5KWIA

M.tb ag85c modified at c209 by adamantyl-ebselen
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
283
structure length
283
Chain Sequence
MFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Diacylglycerol acyltransferase/mycolyltransferase Ag85C
total genus 105
structure length 283
sequence length 283
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kwiA00
1FSSA 4ETWA 1N8SA 1D07A 2QVBA 2CZQA 4OYLA 1CV2A 3AIKA 3FCXA 1R4ZA 2QXUA 1Y7IA 2ZJFA 1R88A 5ALVA 4FFWA 1EDEA 2JGMA 7YASA 1QLWA 3EIOA 1U8EA 2Z8XA 1LPAB 1P0IA 1CUAA 4EY5A 3IUNA 2WU3A 1IVYA 3D4LA 3RLIA 3VDXA 4QLOA 3G9ZA 1SCQA 4BAGA 2XMBA 2QRUA 1ORWA 5C81A 3GA7A 1GKKA 3EQ7A 1ETHA 3JWEA 4L0CA 2HA6A 3E0XA 4G8BA 4X94A 1VXOA 4E11A 1ZOIA 5EHZA 4LYEA 1J07A 2D0DA 3AINA 4DNOA 4J0DA 1UXOA 4BTVA 1I6WA 5AK5A 4HS9A 1ZIYA 3D2BA 1UK6A 1MT3A 4NZZA 1MAHA 1LGYA 5IVDA 4V2IA 4X71A 4H7FA 2YYSA 5CT9A 3KDAA 2XMZA 4G9EA 1XRMA 2HA7A 4EBBA 2PU7A 5FPQA 1DQZA 3HZOA 1EX9A 4CCWA 1HL7A 2J3DA 4J0GA 4Q05A 1L7RA 1ZD5A 3STXA 3WJ2A 4OU5A 4FMPA 1R3DA 3A6ZA 1DTEA 4C87A 2CKMA 4JH0A 4I3FA 4F0JA 3ANSA 4QDUA 5HK8A 5AHXA 1EHYA 1DT3A 5CT5A 1W76A 3BDIA 4N8DA 3G0IA 2WTMA 3ICVA 1QO9A 2EDAA 4LXIA 5K3CA 4UHDA 1DQYA 5ALPA 4H7KA 3PFCA 4OPMA 1P0QA 3VXKA 3W04A 3BWXA 3ZWQA 1X2BA 3WL7A 1XZDA 1LBSA 2BJHA 1T4MA 4HVTA 3S2ZA 2XI4A 2PUHA 5AO9A 1E8DA 2IX9A 2O2IA 5AKGA 4FLFA 5K3BA 4QWMA 3WK5A 5K3AA 2ZJ6A 1Q83A 1QZ3A 4U2EA 3VVLA 1DWQA 3G7NA 4FWBA 4NMWA 4OB6A 3OG9A 1ZI8A 5LKAA 3CCBA 2H1IA 3I6MA 5JAUA 3ILSA 2AXEA 1VA4A 2HU7A 4AX4A 2B9VA 4ZRDA 2EEPA 1W1IA 5JAOA 5DYWA 3WKAA 1E66A 2XQFA 1EK1A 3IIIA 3I6YA 1VKHA 2R8BA 3M3DA 3C5WP 4P9NA 3DDUA 2AJCA 5DTJA 4BZZA 2XUGA 3KXPA 1UKBA 1UKCA 1LPPA 3VJLA 1U4NA 4LHEA 4YK7A 4S0XA 3KD2A 5ALWA 1WB5A 3ESAA 2PU5A 2XQIA 2J4FA 4HXFB 1IMJA 3I2GA 2O2HA 2DHEA 5AP9A 1ZI9A 2QUAA 2B4KA 5ALNA 2J4CA 3P2MA 3Q0TA 2QS9A 1Z68A 2JGIA 5T4HA 2XMDA 2JGEA 5FXMA 1A88A 1GQRA 4C88A 1O6FA 3RKSA 3VJKA 1ZIXA 3AZQA 4M0FA 4H35A 4PF1A 5LZ9A 1BS9A 1VZ3A 4AB1A 5ALHA 4UFPA 5EIAA 3CN9A 3ZV7A 1THGA 2QOEA 2WTNA 3BF7A 2Y2VA 2WIJA 3WI7A 5DJ5A 4QNNA 3I2JA 5KWJA 1DX4A 4L3WA 5F4ZA 1T2NA 1E8NA 3KWFA 2XMSA 4FDMA 2RHWA 4BTLA 4QZVA 5A6VA 3F98A 1BRTA 2DR0A 1CQZA 4NVRA 4W63A 4PSDA 1J2EA 1QGED 2WHPA 3WA6A 5AI5A 2WFLB 5AKLA 2QR5A 3R3ZA 3WK6A 2QXTA 1UZAA 3ZLVA 4PW0A 5FOQA 4J0CA 4JEIA 5EIEA 1CQWA 4W1SA 5HFAA 1WHTA 1R9NA 1CUDA 3D59A 1ZICA 5ALUA 1G5FA 5LZ8A 4ARBA 1MN6A 4BRSA 3UUFA 2PL5A 3NGMA 1QFMA 4BVLA 4K6KA 1ODTC 3L1JA 3LLCA 5AKZA 1ISPA 1BEZA 4DSZA 3PE6A 1XKTA 2PSJA 4U2GA 4EUSA 3FVRA 2GBCA 3T52A 2C7BA 5AKKA 5I8PA 2AJBA 1MX1A 2C5FA 2ZYSA 4IH4A 5ALTA 3IULA 1WOMA 1WB4A 3WMRA 1KU0A 4AMYA 3IBTA 4ZV7A 3NOXA 1ZD2P 5JAPA 4YASA 3WWOA 4QDOA 3FCYA 5DYYA 4UHEA 2XMGA 3HABA 4L72A 4HXGA 2HA5A 5HK9A 3DL7A 3WQHA 4AO7A 5FKJA 2XMRA 4RE5A 3WK4A 4B81A 3VKFA 2PVSA 1QIGA 5AK6A 2ACKA 3WIBA 4C4XA 1IUPA 4LXHA 2BAGA 2QKYA 4JYMA 1XRNA 1H2ZA 3I28A 1AUOA 4IHAA 1EDDA 1AX9A 2OQVA 5E4JA 1K8QA 1DINA 1NU6A 1CIJA 2ZYIA 1KU6A 3HYSA 1XRLA 4DMCA 3G0DA 4H7HA 4ZXFA 4BCBA 5AI4A 2PPLA 5LZ2A 5CURA 3F96A 4WDQA 1GT6A 3G9TA 4QDZA 2ES4A 3V9AA 4Y2UA 3R40A 4GWLA 1NX9A 3QPDA 3A2MA 1QJ4A 4H7DA 4OB8A 2IIVA 4C89A 4BAZA 2WUEA 4BDSA 5AKHA 4JUIA 1ODSA 2JGKA 3H18A 1MAAA 5EFZA 5AK4A 5JATA 5E4TA 3OURA 3EBLA 3H2JA 1Q84A 3HRHA 3N2ZB 3DOIA 2VAVA 3HXKA 4W9RA 4DNQA 1WM1A 4B84A 3QVMA 3D3NA 4X92A 4UPDA 2WG0A 3BIWA 5AM1A 1TIBA 4WY8A 4IO0A 1QE3A 3WKEA 4F60A 3WK9A 4X95A 1CR6A 3QZUA 4GXNA 2XE4A 5ALQA 5CTAA 2XDWA 3KOOA 1F8UA 4HRXA 2XUQA 5ALOA 2FJ0A 4MEBA 4G8DA 2GYUA 1UT6A 1M33A 1UFOA 4AO6A 3HI4A 1MJ5A 3EQ9A 4UBIA 2NW6A 4QDXA 1YAHA 1XLWA 2O7RA 3M83A 4EZIA 3WKBA 4MYDA 4CG1A 2AJDA 5JZBA 2PSDA 4EY4A 1VJ5A 2JEYA 2V96A 1MO2A 3ESBA 2OGTA 5E4YA 5JADA 2V9ZA 4DSAA 4PSCA 3FLAA 4OU4A 4ZREA 4DIUA 1GGVA 3RM3A 1XQYA 1Y37A 3BXPA 1ACLA 2QM0A 5AKJA 3C6YA 4KRXA 5JAHA 2C0QA 1EVEA 4X93A 4RNCA 2BGNA 3WZLA 5AIBA 5EHNA 1YS1X 2OGZA 4G5XA 3F9CA 3B5EA 5DNVA 5ALGA 1CUCA 1GPNA 1JFRA 2W6CX 2XLBA 3IDAA 3O95A 1AGYA 5CW2A 4B7ZA 3GZJA 5SYNA 3FNBA 4GHWA 1BCSA 1X70A 4ITVA 4BC0A 2WUDA 2HA4A 4KAJA 5FV4A 2Z5GA 1XZIA 3WYDA 5HQ3A 2G63A 1XZHA 1CUUA 4DTCA 2WFZA 3H04A 1YA4A 4BP8A 2DQYA 5FPPA 4KEAA 3OPMA 1E8MA 5K3EA 1TAHA 4FLMA 4O08A 3LP5A 3V1LA 3C6XA 3WLAA 1UK7A 4G4IA 5FRDA 1VZ2A 4CG3A 4Y2SA 3OM8A 4KACA 1LLFA 4I4CA 3I1YA 3E4DA 4TGLA 1JT2A 4WFKA 6YASA 2HU8A 4B80A 3PF9A 1YCDA 2QJRA 1ZGCA 1JI3A 1J1IA 3MUOA 4OUKX 1XZAA 2CUTA 5IVHA 5C8VA 4Y9SA 3PI6A 5ESRA 3G8YA 3I2IA 5K3DA 4FBLA 5HCUA 4GW3A 4PNZA 1XZFA 1TCAA 5FUMA 4F5ZA 3I2HA 1F6WA 2OLEA 2FUKA 4UBNA 2JGJA 1LPNA 5JIBA 1XZMA 4WCVA 3DYIA 2GBFA 3M82A 3WL8A 4B9AA 3K6KA 2RI6A 5JALA 2RIPA 2OXEA 3S8YA 4HAIA 4GEGA 1QO7A 5CH5A 4E46A 1BE0A 1UOOA 4UBOA 4U2DA 3I1IA 5ALMA 4Y2PA 4KE8A 3A2LA 2RONA 5CH3A 2OGSA 1CUWA 4Q82A 5AI8A 2HFJA 1MU0A 1LBTA 4MWTA 2HA2A 4FNMA 2BUCA 2DSNA 4ZGBA 5ALIA 2JBWA 2PX6A 4RGYA 3W9BA 4CG2A 4YX9A 4XX1A 1UK8A 5C8XA 2JEZA 1CPYA 1EVQA 2C58A 1QIDA 5DNUA 3QITA 2DQZA 4CFSA 4DM7A 2QUBA 1PV1A 5AKYA 5AM5A 1DWOA 2XMCA 3D2CA 3FYUA 2O7VA 1GPLA 3B3QA 1QONA 4P93A 1WPXA 4Q3OA 4UUQA 4DYHA 4UHFA 2AJLI 4HTAA 2PKYX 1L7AA 3ESCA 3PFBA 1LPSA 2CMFA 4UBJA 1ZJ5A 5AM2A 5T4EA 4A23A 1XKLA 1XQWA 4UHBA 2ZJ7A 1N5MA 4ROTA 4J0JA 2PUJA 4C4YA 3WKCA 4K6GA 4N8EA 3HEAA 1EH5A 1FFDA 1YS2X 2C5GA 1BU8A 2B20A 3ANTA 4CI9A 3FYUB 4DMFA 1XZEA 1P0PA 2ZVDA 1EB8A 2Z3ZA 5ISMA 1Q0ZA 4FBMA 1VXRA 2H9YA 4UHHA 3STUA 2I03A 3H1AA 1XZLA 1DT5A 3BJMA 1G42A 5JD6A 4DNPA 4Q1VA 5AM3A 1PFQA 3FBWA 4UFOA 1DU4A 1EB9A 5JARA 4QDTA 3O9MA 4CIAA 4GI1A 4N8SA 3WL5A 3W05A 4KAFA 1QIFA 3FVTA 2E3JA 3H2GA 1Y7HA 1MNQA 3H19A 3QMMA 1AQLA 3NWOA 2G5PA 5C8ZA 3DCNA 5AM0A 4CCYA 2WUFA 4ARAA 1CUYA 2X8BA 4FNGA 3PF8A 2OCGA 5K5EA 3X3HA 2OQIA 2PSHA 2W22A 5KBYA 2VJDA 2Z8ZA 3R3VA 2PM8A 5ALXA 3A2NA 2FX5A 1GKLA 2HL6A 4Z49A 4FFVA 5DNWA 1J06A 2HA0A 5ALDA 3H1BA 5A7GA 3DKKA 4G9GA 2YASA 5BWBA 3W9UA 1K63A 3BE8A 3GFFA 3QM1A 4ZWNA 5JZSA 2BUBA 2DCMA 3K2IA 1MX9A 4Y2VA 5LKRA 2K2QB 3B12A 2GBIA 3ESDA 3IUJA 4EY7A 4C4ZA 4GBGA 4H18A 4MXDA 5HQ3B 1H23A 4Y7DA 3PDCA 4RE6A 2XUDA 3ZLTA 1Q0RA 4LKOA 2VF2A 3LCRA 2JGLA 1WHSA 3DKRA 1YB7A 5A7FA 1AKNA 1BCRA 1QIIA 2BFNA 5JD5A 2H7XA 4G1FA 4BDTA 5AI6A 1YASA 4U2BA 2VEOA 5JANA 4B0PA 3WK7A 4BCCA 3DL4A 1AURA 2ORYA 4W1QA 1H22A 5H3HA 2DHDA 4FOLA 2RHTA 4BP9A 3RK4A 2VJBA 2G4LA 5AK3A 2HA3A 1N1MA 2DFPA 4BBZA 3WYNA 2ROQA 4MJ3A 4C6HA 1USWA 2R11A 1VA5A 3HLKA 5JZ9A 5ALEA 1VE7A 3BF8A 2QTBA 2GYVA 2XLCA 1GQSA 1O6GA 4KR0A 3F8SA 1QIKA 1G66A 1WPRA 2JF0A 2CJPA 3WZMA 3WWPA 1C7IA 1VE6A 3SX4A 4BYMA 2G5TA 4P92A 4KE7A 4GDMA 3H2IA 1NU8A 4FKBA 3O4GA 3OTQA 1SFRA 2WIDA 3STVA 2OAGA 5AM4A 3D7RA 4QE3A 4X97A 2WQZA 4AZ3A 2WHQA 3V48A 5HFNA 3V1MA 4H7JA 2GYWA 4QWWA 1VOTA 4Y2JA 1DWPA 2IITA 2VQ6A 4CCYB 4B82A 1TK3A 5IKXA 1B6GA 1CRLA 3MVEA 5LP1A 1CUFA 1C7JA 5D3ZA 2VA9A 5HF8A 3PICA 1ZD3A 5LZ5A 2WIFA 3FLBA 1EI9A 3G9XA 2UZ0A 1EINA 1JU3A 4OCZA 5YASA 4INZA 2XUHA 3H2KA 5HF9A 1WCYA 1BEEA 4JNCA 3WWCA 2J3QA 2HM7A 1JKMA 1S8OA 4G4GA 3RARA 4MEAA 1BN6A 1CUVA 3C87A 3DNMA 2WLSA 4EB0A 2JIDA 2GZSA 3N0TA 5KWIA 4H7EA 3AFIA 2CEKA 1HKHA 4LIPD 3CXUA 4KAAA 4U2CA 5AJHA 2OCKA 5AIAA 1W52X 4K6HA 5DWDA 4Y2YA 4HXEB 1U65A 4BE4A 2I3ZA 3DYVA 2WUGA 2HIHA 3H0CA 4Y2TA 1CUBA 3DD5A 3WWEA 5HZGA 3FOBA 2WIKA 3DOHA 1FFAA 5LZ4A 2Y1KA 1FFBA 1U2EA 3M81A 3TEJA 5BV7A 5CXXA 4MQMA 1JJFA 4X3CA 5CBKA 2QZPA 2GZRA 4G4JA 1EXWA 4WDRA 1F0PA 1XROA 2QMQA 3AILA 4DMKA 5EI5A 1TQHA 3AJAA 1H2WA 1E89A 2WKWA 3D0KA 5HF6A 1R1DA 5D3KA 2BUAA 1UKAA 4H77A 3LS2A 4F21A 3ZI7A 1XFDA 1W75A 1R9MA 3GELA 3W2TA 3D5EA 2V98A 2XMQA 3FAKA 2WM2A 2D5LA 4M0EA 3E3AA 2V97A 2C4HA 4TPKA 3DS8A 3R3UA 3I2KA 2VJCA 3F97A 4EY6A 1FFCA 4M0MA 3U0VA 4FLEA 3U1TA 4A5SA 3OC0A 3H2HA 3C70A 1CUEA 2PBLA 5AKEA 1XRPA 1H2YA 1G4HA 3VJMA 3PUHA 4AXBA 1QTRA 3IVMA 4PQEA 3JW8A 4QA9A 5BOVA 4X6YA 3AIMA 4K2AA 1LZLA 2YH2A 1X2EA 2WG1A 5AOAA 4W1PA 2OG1A 3C8DA 1MNAA 3QPAA 5A7HA 3DQZA 3BIXA 3C6ZA 5AOCA 2XT0A 1K6EA 1FFEA 1QIEA 5AICA 1A8UA 2X76A 3C5VA 1B41A 4X6XA 1THTA 3QBJA 5DYTA 4AN1A 4PO3X 2WG2A 3DJYA 1XZCA 4WY5A 4AMZA 2HADA 1JMKC 4BB0A 3QMWA 1OXMA 3KSRA 5FLKA 4MWSA 1LPMA 4N5HX 5FP0A 1JJBA 3TRDA 2Q0XA 1JJIA 1QFSA 1AC5A 3JYHA 1SC9A 2VJAA 1JU4A 4E15A 3SK0A 4H7IA 2AJ8A 2OAEA 3FSGD 3FWHA 4KE9A 5LIPA 1RYYA 5A62A 3R3YA 2WHRA 4TVKA 1DX6A 4I19A 3V1NA 3ZPXA 3GBSA 2WFMA 1E3QA 1HDEA 5DLPA 3QYJA 4J0KA 1F0NA 1W6RA 4BAUA 4J0IA 4BRZA 1ORVA 3G9UA 1YR2A 4ZV9A 1R50A 1UWCA 1A7UA 1CUHA 5LLSA 4ZI5A 2I78A 2ACEA 3Q8WA 1HQDA 2VAXA 3C6BA 2VSQA 4Q3KA 3FYTA 5ALYA 1JMYA 4LYDA 3AIOA 3L1HA 5CRIA 4X7BA 5CH8A 3VVMA 5FDFA 3E1GA 2B61A 4JYPA 5A71A 4J0HA 1QIMA 4Y2QA 5HF5A 5IVIA 1CUJA 4MQLA 2H7CA 1SCIA 4AO8A 4XVCA 1CUXA 1LPBB 5ALZA 3F67A 5JYCA 4XIIA 3HJUA 5E2IA 4CIBA 2XQJA 5ALKA 3O9VA 4B85A 3IUMA 4D9JA 5IVKA 2H7YA 4P08A 4WFJA 3QPCA 5AI9A 1N5RA 3G0CA 1EDBA 2Y6VA 3STWA 4U2FA 1UOPA 1YAJA 1AMNA 5AOBA 4J3JA 2ZSHA 3IUQA 3R41A 1IUNA 2RAUA 4GECA 2HRQA 3R3WA 1CUGA 5EHXA 5ALSA 2C0PA 2EDCA 4BVJA 2DHCA 2PSEA 3V1KA 4Q3LA 2WJ3A 3ICWA 4KRYA 4FHZA 4WJLA 3G02A 5AKIA 4KYVA 3EQ8A 2HDWA 2BKLA 3FYUC 4XJVA 4DLNA 1XQXA 1XQVA 1YSCA 2XUOA 1QOZA 1C4XA 4Y2XA 5C7YA 1ZGBA 4DMHA 1RWQA 4Y2RA 1CLEA 2O2GA 1XRQA 3WA7A 1TCCA 4AN0A 1EK2A 5I9IA 1HPLA 4FTWA 2OPHA 4QEKA 2HFKA 3LIIA 4BZWA 1XZKA 4W1RA 3UMJA 1ZJ4A 2X5XA 5CT6A 1SCKA 5D6OA 3WWDA 2XB6A 1MPXA 2VT6A 1RP1A 1L7QA 1BN7A 1P0MA 2Y2UA 4KJXA 1TKRA 1XLVA 2BCEA 3FSGA 3KWJA 4LXGA 1VLQA 1ZD4A 3R0VA 5EGNA 3AZOA 1IZ8A 2WIGA 1SOMA 4IH9A 2Z3WA 3WJ1A 3CN7A 3G0GA 3I6ZA 3L1IA 3AUKA 2HHAA 3YASA 5CT8A 5I7UA 4Q34A 2RGUA 4EY8A 1EA5A 5D7BA 3W06A 2ZSIA 5AI0A 1CUZA 2GBGA 2ZYHA 4PV7A 3UUEA 4E14A 4DNFA 3MUNA 3STYA 2WJ6A 1OILA 3WK8A 4L9AA 1ACJA 5AH0A 1XRRA 1LNSA 4IQ4A 5BWCA 3H17A 3SWWA 3BL8A 5HKAA 4X91A 2ECFA 4WFIA 5T4BA 3HSSA 4B0OA 4X00A 5AKXA 2I3DA 4UBKA 1CVLA 1FJ2A 3K9BA 4C01A 2VT7A 2BGRA 5T4FA 1HBJA 3O0DA 4EHBA 1XZGA 3DEAA 3C8HA 4QLAA 3TGLA 2XUJA 3VISA 3EF3A 2YXPX 1OCEA 3IB3A 2XUAA 4IH1A 5ALJA 3MGAA 3C45A 5CXUA 3BJRA 4HZGA 5JASA 2CB9A 3TJMA 4XWGA 4NS4A 2CBGA 3I2FA 1IZ7A 2HU5A 4J7AA 1ZI6A 3BDVA 3QH4A 5ALLA 3HC7A 2XUKA 5LZ7A 2Y6UA 3O4JA 1YB6A 3NUZA 2HRRA 2WFLA 2WHPB 2WU4A 3FLEA 2WJ4A 2PSFA 1PJAA 4UBLA 1H2XA 1CEXA 2VATA 2ZYRA 2JGFA 5CT4A 4X6UA 4PSUA 5IH7A 1MTZA 4J03A 2ONCA 4BCDA 4A16A 4AQDA 1UOQA 5KREA 1GXSA 3WL6A 4HRYA 3ZLUA 2XQGA 4YPVA 3GUUA 4H0CA 5J3JA 3HACA 5K3FB 3PUIA 3QMVA 3DLTA 1QTIA 4N5IX 2QT9A 1XLUA 1GZ7A 1LZKA 2QJWA 1E5TA 4X85A 1TRHA 4DGQA 4KE6A 4UFNA 4UBMA 4UHCA 4OSEA 3G0BA 1IUOA 5A2GA 4B83A 1A8SA 3STTA 1QIHA 3C43A 5EIHA 2VTVA 4B9EA 4BATA 2P8SA 3IA2A 4RPCA 1ODCA 4MYSA 5K3FA 2XUIA 4B6GA 4GLBA 1KEZA 3SC2A 1TCBA 4X90A 3GROA 3O4IA 5ALRA 3T4UA 3CCCA 1UK9A 4BE9A 3O4HA 3WIOA 3R3XA 4EA6A 1BROA 5JD4A 1K5PA 3ED1A 4BVKA 1A8QA 1YA8A 1QIJA 1W4LA 3D2AA 4G8CA 2WSLA 1HLGA 2XQKA 3WKDA 4OD0A 1WB6A 4OYYA 4OB7A 5HKBA 2LIPA 3OOSA 2XUPA 1GPKA 1LPOA 3IURA 1CUSA 1CFJA 4K5QA 3LIPA 1K4YA 5EHQA 2OCLA 1AZWA 2XUFA 2FJPA 1MX5A 1XZBA 4BC1A 2WILA 3A70A 1XZJA 5CMLA 5DTIA 3AZPA 5ALFA 4AZ0A 5SYMA 5LYYA 2OCIA 1CUIA
chains in the Genus database with same CATH superfamily
1FSSA 5CDYA 1EJBA 1J1UA 4ETWA 3B20A 1R64A 4B4VA 3IMGA 2CZQA 4ME6A 3IAEA 1CV2A 2JA2A 3AIKA 3DTVD 4O2BB 5D2CA 2FW7A 4F4UA 3R7LA 3KQSA 3X1YA 2QXUA 4Z4QA 1PEKE 2AMVA 2IUYA 2WJPA 2AL7A 2VF5X 4R1SA 4FFWA 4DB4A 2QTFA 2RGXA 3TK1A 4D0SA 1QLJA 2JHFA 2A1UA 5A6SA 1CUAA 3N1UA 4TM7A 3THWB 3C5CA 5JSHA 3HK2A 1XF1A 3A58B 4C3OB 4X84A 3VDXA 3ZQJA 3GEPA 3DTNA 2P9CA 1RC1A 2P1DA 2IEYA 2Q0QA 3ROGA 2GJKA 5T3UA 1U3WA 3LT5A 1VE1A 1IY1A 3BKXA 1YCFA 3ZH2A 4B47A 5I51A 1V71A 3TZEA 1XNJA 1F12A 1I6KA 1JAYA 2ZQYA 3LCCA 4JI6B 4B75A 2GXUA 2EKDA 5JCZA 3P8ZA 3EQ7A 1W5EA 1QDEA 2OBXA 2BMEA 1IN5A 4IMJB 5AR1A 3JWEA 4KZPA 2HA6A 4L0CA 2KBEA 4RVHA 4BQNA 5THQA 2AJTA 5JXGA 2BFDB 2YKGA 1QYRA 5BUQA 1NXTA 3SU8A 3IJEB 4H59A 4BGVA 2D54A 1M0SA 3L7IA 1D7AA 4S05A 1L5WA 2HY7A 1XPRA 2D0PB 2FX3A 4UMDA 2O5EA 2BP7A 1RHMA 3S8EA 1A9ZA 1KIMA 4E5DA 1OHHD 3QV2A 2VYVD 3SHVA 4WBXC 2I8CA 4WUTA 1E5QA 3AINA 4J0DA 1O6BA 3FOFC 1WNFA 4LF9B 4PHGA 1N5IA 1AKYA 1ZIYA 2AI1A 3N2NA 1YJXA 3T7JA 1UK6A 2W2NA 3E27A 4DSTA 2FSUA 5ERXA 4KXMA 3AY7A 1UBTS 4I9NA 4J2HA 4X1KB 3C3BA 1T8TA 3OQPA 3R20A 2EJVA 5IVDA 3MCVA 4E88A 1LCIA 2PGAA 5LD2C 3AR2A 3LK6A 3Q7SA 2QLJA 4UUBA 3NO4A 1BMFD 4WZ6A 4BNDA 4DW8A 4FCTA 1KY5A 2PX5A 2ZITA 3UATA 4OMFG 1QG6A 2G36A 1V7ZA 3ZW7A 4PNEA 5JSQA 4XM0A 4EBBA 5T5QA 2CL6X 5FPQA 5EP2A 1C9JA 2G0AA 4O4HA 4B40A 1JHZA 2XECA 2VSFA 4Q3AA 3KUUA 3AKDA 4CCWA 3QLTA 2J3DA 4K6CA 3LP8A 1QCDA 1HXHA 3IAS1 1U8YA 4IGIA 1TF2A 4V3CA 2WSMA 4W5HA 3P0RA 4X20B 1X7ZB 4BKUA 3L82B 4BO0A 3HBFA 1TC1A 1W0CA 2ATIA 3CVOA 2YIJA 4I81A 4D8UA 1KORA 1MV5A 2Z43A 5F73A 1FFGA 4B33A 3IBFA 5BOSB 3D0QA 2J0UB 2CKMA 2B4RO 4NCKA 4WFQA 2WSSA 1M2VB 1W25A 2HJWA 1N36B 3T94A 3FZGA 3ANSA 1FQOA 4ZVVA 1T1RA 4DPLA 5HX7A 4RK6A 4GYYA 4M21A 3ADDA 4ZZ1A 2P2NA 2GUWA 5IABA 4ND5A 1I7LA 1TMKA 1NBMD 4TWRA 3K7EA 2I71A 4DQUA 2WQ7A 4H4DA 2A1UB 3G0IA 4N8DA 3RHFA 1UPAA 1YZYA 3ICVA 3T1OA 1AVTA 1P4GA 1NI4A 3RU7A 4MVJE 2VSYA 5LMUB 4RTQA 2DG2A 4C4SA 3D6JA 4JOCA 4OPMA 1K6JA 4YA6A 2FQYA 2HJVA 3E7FA 4F8YA 2ZRIA 2BM0A 2CK3A 1PN3A 3LQ2A 2IEBA 1NYRA 3K0CC 3WL7A 1XX6A 4XX0B 4BFXA 4DBLC 1WZNA 5KCZA 1LBSA 1GL9B 3JD1A 1SIWA 4HVTA 3HWWA 1URPA 4HP8A 1Z34A 2FOIA 1VRCA 4MWBA 1Q2UA 5DCWA 5A9TA 1Z7WA 5CAEB 4ECEA 5KJFA 4NCHA 1ZCZA 2B21A 1AKUA 3AR8A 4NWIA 2G83A 5K8TA 2YHAA 4QWMA 4QLBA 1NVVQ 4R1PA 5K3AA 5FBHA 3F9IA 1EFVA 3FNHA 3HB9A 3DTVB 1E3DA 3NGXA 4IIUA 3PHHA 4TT3D 4WN9B 2XYHA 2NV0A 3ZNQA 1PX2A 1DWQA 1P72A 3G7NA 2Z1NA 3TGWA 3KZMA 3VC2A 1W36B 1EBBA 1MW9X 4NMWA 4NU0A 3DE7X 1CETA 4TQUS 4FE3A 2H9AA 2VPIA 1ZI8A 1A77A 1KHTA 1BH2A 2X19A 2K7FA 1GUZA 3PPWA 2OZEA 4JP1A 4L6IA 4Q0MA 4WNCA 3OC6A 3X2FA 3ITKA 2CLFB 4RIIA 2EKPA 1PT5A 3IPLA 2CLSA 5K6AC 3W79A 4D26A 2UVDA 3ONEA 2HU7A 3TEFA 1OBHA 1N2GA 1RWPA 1Q1EA 2PJDA 2B9VA 2WD8A 4HJXA 2W2LA 5CYPA 4IVNA 3DHYA 5LUBA 5JS2A 2DFKB 3DW3X 5L3VA 1ZOLA 2DUUA 8ADHA 5JVDF 3AP1A 5CCDA 1SCJA 3WKAA 1SKBA 4CQMA 1J9ZA 3H9GA 5B7QA 5CNJA 2DJIA 3RC3A 5JV5A 3E6AA 1K06A 3UMMA 4OHXA 1M2FA 2IHNA 3I6YA 3AF0A 1V1MB 4FMDB 3GLRA 1ECJA 1X19A 2GO1A 3F3MA 3NPAA 3MCWA 2GPYA 3O4RA 1EESA 5FPYA 2JEOA 1RJDA 1IWBB 2QI9F 3DDUA 2AJCA 3ZZNA 1USKA 2B30A 2PKCA 5E6SA 5KZMB 2XWJI 5CVVA 1UKCA 1LPPA 2R2GA 4QXQA 1U4NA 3TZLA 1XWIA 1ZA1A 4GMHA 2LW7A 5P8WA 3EVAA 3OTOB 1RIIA 2QDKA 4LE0A 1XN1A 1DBIA 2ZUWA 5J2TF 3MN1A 3KD2A 1S4QA 4HLDA 1U1IA 1TM3E 2P3OA 1XBTA 4D4IA 4PZYA 5BQOA 1X3LA 3IUEA 3NDBB 3VC3A 4YHHB 4AKHA 3PUKA 2B83A 4G01B 3GJ3A 2Q4TA 3RREA 8GPBA 1GLGA 1M10A 1RWBA 2HUPA 1GNQA 1W73A 3CW9A 3KT3A 3DBRA 3H9BA 2P0EA 2R65A 2B34A 2XB8A 4ZOBA 4CM4B 1EX7A 1OBFO 1QQ5A 3TIXB 3L3BA 1JBEA 2O2HA 1HLPA 3FN4A 4MV1A 5FV7A 2XWQA 5FIUA 1JU9A 2IYPA 3GX1A 1OT5A 1Y80A 2J4CA 5JQWA 3GG9A 1K9VF 3ZZTA 1B4DA 1Z68A 1ZGZA 2CBXA 3QXJA 1YGPA 3UH1A 4WOCA 1VKZA 1SXGA 2OL4A 3O75A 1LSUA 5HKKA 3KETA 3HKDB 1I1QB 2VDVE 4UZEA 1O2DA 3T95A 4N41A 1WDLA 1P7PA 1W0JA 3R8FA 4F5YA 4MIYA 5FL7D 4N5MA 1XJCA 2ZU0C 2VJLA 4IJVA 1JSRA 1LFDB 4WCFA 4IZOA 3K4PA 3AF3A 1A88A 1KJNA 5FXMA 3LQRA 4WBNB 2WIBA 3EIHA 4Q4AB 4UMVA 1O6FA 3PQ3A 1NV8A 1L5NA 5BMVA 1HNZB 2Q5OA 2VA8A 3L0BA 4PYOA 4JBGA 3I01A 2WA2A 4YREA 1DUIA 3ANLA 3C3XA 3G7SA 3H7AA 2BFWA 3I0MA 2VTBB 4B3GA 2F59A 2QTMA 4PF1A 1E7RA 3TXXA 2Q50A 3FBGA 4EHLA 1XVIA 2XT9A 4I66A 1OFHA 3B1WA 1VZ3A 5IAGA 3BTUA 5JE8A 4LTNA 1OX5A 4MS1A 4L76A 3QF4A 2AQIA 3LF2A 3OICA 3EAGA 4C1NA 1M1ZA 2ENUA 4BQFA 1QHHB 3BF7A 2QOEA 5ICMA 2CV1A 1EM8B 2PLAA 4J3FA 4NH4A 1GY8A 1CYEA 2ZYUX 3OJOA 5JQGF 4OBBA 1C1XB 5H81A 1CCWA 3UV3A 1AQJA 1AUQA 4OMCA 4LYAA 1DX4A 2O3UA 3A4MA 3PTLA 3ZDQA 4BO9A 1VPLA 4IOLA 1YZKA 4N49A 2P0YA 1E8NA 3SLKA 4JVOA 2D2EA 4ZYWA 3GPDG 1H94A 1BOFA 3EVZA 4G5RA 3RDPA 4MGHA 1G18A 3IQZA 2XMSA 2FFBA 1ESCA 1FDVA 3UMSA 1Z7EA 4DV2B 3FR8A 3MGGA 4F9EA 2I87A 1JBQA 1SELA 1E6UA 4L2IB 3L4KA 4M38A 3RPEA 2RBGA 4FYMA 3SQXA 1BMTA 2RJOA 4Q39A 4CR8A 2YOFA 3DDWA 4Q6WA 4D80A 4OXKA 2QORA 2ZYDA 4PHCA 4QFMA 3RV3A 4FYXA 4TLDA 1CQZA 1U9JA 4NVRA 2P4EA 3ORFA 3OFVA 1Q1ZA 4HD8A 4PLFA 3QFCA 4PSDA 4W63A 4X1OA 1J2EA 1E7QA 2X4LA 3F6YA 5AK0A 2QP3A 5AI5A 3SR3A 5H4GA 3W6UA 1H9AA 2QR5A 1KYXA 3VU3A 5E6RA 1L5FA 2D2IA 3QA3E 4GXTA 4I9HA 3E03A 1Q17A 4DY4A 3PR3A 2ET6A 4EL5A 4ZO9A 2HCTA 4JMPA 1Y8CA 4J0CA 3NTVA 4CKYA 3LUAA 4LNAA 4R9NA 1Z28A 2FSGA 2NUAB 2B8NA 4XKJA 3U4HA 2QV7A 1CQWA 4LBVA 3RIXA 5FR1A 3JQ7A 3B78A 2E6UX 4K9LA 1XNRB 3GFQA 1FRQA 4LJ8A 5IKEA 1FRVA 2AEJA 4IOJA 4MW9A 4YUXA 3R24A 4WV3A 1T4GA 4C6RA 3CR8A 1ZICA 2Q3JA 1UBOS 2CXNA 1G5QA 3RLFA 2HNKA 3GGJA 4LXYA 3WLIA 1SO8A 1CQJA 2AVDA 3UWSA 3ZWCA 1PR0A 1RYZA 1A2QA 4CM6A 3DGFC 3MCTA 1WW2A 3BM5A 5AKZA 5CEEA 2W2KA 3TLGA 3AX6A 4L75A 4F96A 1RJEA 2HC9A 2XTZA 4NZPA 4DSZA 4ZI7B 5BXQC 4CKBA 4Y9UA 5LOVA 2CMHA 1Z2EA 2BGKA 3EXHA 4PZPA 4U2GA 5FWXB 3FVRA 1FYEA 1G19A 1N6OA 2C5BA 4B4DA 2QY6A 1YFKA 1I9GA 1T4CA 2C7BA 2GBCA 1OLSA 1OX4A 2I2CA 2REQB 3EYAA 4L0MA 5DNAA 3ZDZB 3NMUF 2WD7B 1TLTA 2P5SA 3V46A 5KJEA 3ON5A 3VU9A 2FW0A 3CX4A 3I6QA 1GLVA 4B31A 5JS7A 4B3IA 2V6MA 1NIJA 1IQ0A 4UEKA 1GPH1 4G3XA 1H0RA 2H2AA 2K4MA 1QZZA 2I6XA 1WOMA 3AY3A 4GICA 4OGLA 3PC3A 2YJ3A 1N6NA 4PSVA 2NU9B 2B25A 1FUUA 4JDUA 4L4SA 521PA 3QWIA 4A6EA 1I4LD 3FB1A 4EHNA 1EWVA 1HE8B 3AO0B 1SBNE 1TMOA 3I23A 3EMKA 4LX8A 1R0CA 4TL6A 3RSZA 3OQ1A 3OAAA 4XD2A 2JK1A 3C16C 4DQ0A 1ZUWA 1U3FA 4AMYA 3ELDA 3IBTA 5E3JA 4ZV7A 1TD9A 3SJZA 2QLMA 4QFDA 2PUCA 5JAPA 2PRIA 4Q9JA 5TQJA 5JPIA 3LE8A 2GXQA 3DNFA 3H3FA 1OZGA 1JYFA 2WTUA 4AWXA 4ENUA 2FPWA 2A14A 1EWRA 4CKCB 2D1YA 3PIIA 3FCYA 2VBGA 3IHKA 5DYYA 2XMGA 2OA0A 3SXJA 4LRQA 3V7YA 1NLYA 4CKXA 4HXGA 1ZAKA 3P9CA 4AMBA 3GUYA 3AGQA 3U1BA 3LLSA 1TFRA 2R60A 3QXHA 1GG8A 2XMRA 4GKVA 1ZK3A 3HZHA 4IY1A 4B5KA 1PLLA 1LK0A 1ISMA 2JFOA 3CYFA 4D1YA 4F12A 1TW3A 1BAPA 2IXFA 2IX3A 1PZFA 4UDYX 1NVEA 2E4VA 3MFYA 5J4LA 2N46A 5KB3A 5MGNA 3C3DA 1R00A 3AEXA 4MV5A 1XD2A 2N3ZA 4TLEA 4A91A 3WIBA 1A8PA 1RTTA 3C1OA 3T8YA 4C4XA 4YN3A 5IM4F 1ZHOA 2NMVA 2X8LA 1E4EB 3G5UA 2G1KA 1ZNXA 3B38A 3BQMB 3N7UA 3JSXA 4PAQA 3OWHA 1X14A 4E5UA 1AMOA 1ZU4A 3ADPA 2GK6A 1H2ZA 1W4ZA 3GK3A 4OHVA 9GPBA 3TM5A 3CF6R 3KUDA 3KKEA 1QVVA 4URHA 3ZVNA 3HA3A 3PFHA 5FAKA 3ZCPA 5L8VA 4LPSA 1YDFA 2VUIB 1CB7A 1CFZA 3EFOB 4MRAA 1MW8X 3UGQA 2WMYA 5D84A 1CE8B 1Z26A 2X15A 2ZYIA 5CNKA 5K3SA 4HF7A 3U7EB 4BZPA 3DW1X 3LNTA 3CEHA 1I7SB 3THXA 5KMGB 1L2TA 4DMCA 3SAJA 1KC3A 4H7HA 3R44A 1GSOA 5CR9A 3LYHA 2Z4SA 3FBTA 3MYRA 2GCGA 5AI4A 1ZSYA 3GJ8A 5FB3A 3L8ZA 3THYA 4JA0A 1H42A 4DCCA 3NTXA 4UXIA 4C04A 4C22A 4MI3A 1W0KD 3D8NA 5ILGA 4F3NA 1GT6A 3NM4A 5KVVA 1GL7A 1WKBA 4Y2UA 3V9AA 2ATVA 3R40A 4AY3A 2P91A 3WRVA 2ATCA 2KB0A 5CCXA 1GAEO 4DIMA 1U5BB 4Q4HA 1NX9A 2PVCA 3D6UA 4F46A 3ETGA 3JSAA 3QPDA 1IRXA 4NHOA 1T6BY 4E1VA 4G36A 1LQUA 1FDTA 2QAGA 2IPNA 1I3OA 3LRXA 4GL4A 1SB9A 4NEGA 3GVIA 1QJ4A 4P86A 1R8JA 4IDDA 4PS1A 4Y8VA 2DKFA 4OB8A 3LHFA 3QKSA 2O19A 5K01A 4CEIA 1SOVA 4RKEA 1HDZA 2AN9A 1Y98A 1GRQA 2I2XB 3D3WA 1ZW1A 3JZAA 1P1FA 3L7KA 2AI2A 1U5AA 5JD3A 4BAZA 1SURA 3ORQA 4NATA 1DEKA 1Z07A 1B73A 5DU2A 3IEKA 1BHQ1 3AUUA 3RWBA 1IJKA 1ILWA 4XRRA 3ZQUA 3NHRA 1JVBA 2QPOA 3KSUA 3T1VA 4GDFA 3W9YA 1J8YF 2C92A 4B48A 1MFPA 3GUCA 2J1LA 2QTGA 4FHCA 2RK3A 5U4QA 1Z15A 2QVXX 2VP6A 3UT0A 1POWA 1XMPA 4FUQA 1E6CA 3KTAB 1YDMA 4FSHA 4L22A 2P6RA 1EZ4A 3EBLA 5FA5A 4H9GA 4AJ4A 1NPTO 3RC1A 2QUHA 3SE0A 2OC4A 5AVWA 4D97A 1IG3A 1M8FA 3FF4A 3H2JA 3HRHA 4FI3F 5JSUA 2O5CA 1L7MA 3N2ZB 1ZGGA 2OVFA 2B92A 4YJ3A 1B8VA 5E6RB 2PGJA 3LUBA 4UM5A 1GNTA 1D04A 2R79A 3SJ7A 2YWEA 4J1NA 3FNQA 3OF3A 1JHVA 5I9TA 4DDUA 5B64A 3ZWBA 3PA6A 1JQDA 2XNCA 1N1GA 4PSAA 4W7HA 4ZT3A 4UU1A 1KYYA 1N7JA 3MMXA 4ED9A 4ESOA 5IJ0A 5BQ3A 1TZBA 3HB0A 2WG0A 1I5RA 3HFJA 2ZULA 3L7DA 3BFKA 4N7MA 5I45A 3QNUA 4FQ5A 5KYXB 2VJPA 2B98A 3KQLA 1RRGA 3IODA 5IZ4A 4E33A 2Y1XA 2ZI3A 1Q50A 4LYJA 4X95A 3GU3A 1CR6A 3W2FA 1AS3A 2Z2IA 3QZUA 2YYZA 1PEYA 3H5AA 2BGGA 4QQRA 2CEAA 3OIWA 2R1UA 2XE4A 5B1SA 2ZXFA 4JMLA 1WU8A 4OL9A 4B9AA 5IUJC 4JI7B 1C1XA 1AE1A 2I6GA 3COWA 2HV9A 4FJ2A 5ALOA 1C8BA 3OT1A 2XA2A 3LVBA 4G8DA 3HM9A 1XXHB 1V1JA 2WVGA 4EPYA 1QHHA 4G67A 2IEZA 4QX6A 3O73A 2ZJAA 1O8CA 5BMVF 3DHVA 1MJ5A 3QQPA 4EI9A 3EQ9A 3H9JA 4UBIA 3GEHA 2KJQA 1VHDA 4QDXA 4JOSA 5C0OE 1TYDE 2OP1A 2VYVA 1J24A 3PNSA 4O2AA 3U6KA 4KGZA 1BC5A 3HCPA 4JJEA 4NYIQ 4EZIA 2OYCA 5KYKA 3FRHA 5CFNA 2DULA 3CZPA 3CPHA 5JI3E 1Y9EA 4QECA 2XA1A 4K0KB 3QYFA 5BPHA 3VZPA 4HN2A 2VTBA 3SS8A 2Q4EA 4FJ1A 3UT6A 2QT0A 3EZ9A 2LVBA 1R6BX 2FVXA 2W00A 3OFSA 3R3HA 2E4UA 4MR9A 2JBHA 2IYFA 1SMKA 2JHAA 2OGTA 4KDCA 4GSKA 5E4YA 1T2CA 2GEDA 2VXYA 3CRNA 3HR8A 4ZIRB 2YV3A 3INRA 3UOWA 1DKQA 1D4OA 2A5FA 2EFYA 2A78A 3IQDB 1CP3A 4TL7A 3KJNA 4RIEA 4YLEA 5ARCA 1C8KA 1Z2PX 2ZJ2A 3PTZA 1NKVA 2OYSA 3H2BA 2P9EA 3G2LA 4OU4A 2HMTA 3CS3A 3T3EA 1YE5A 3AWDA 4C5AA 2B3TA 1PNRA 4EB3A 4CDMA 5TQ2A 2ZUCA 5CGZA 2H54A 1UJBA 3GJ6A 3GRZA 3VHQA 3O8BA 3SFTA 2FWPA 3RADC 1Y37A 4WJKB 3BXPA 4JKIA 1H2HA 2FGJA 1W5BA 2P9BA 2QM0A 3C6YA 3QY0A 4I4TF 1ZSVA 2C31A 5ESXA 6Q21A 1GEEA 1XCPA 3COSA 3IAAA 3IVCA 3G5AA 4KRXA 5L3QB 2CNBA 3GRKA 3MXTA 3HVIA 3WGGA 4A1OA 5AW1A 4TKZA 3TUJC 1J8VA 1E2FA 2F3SA 5AHRA 3SVZA 5KVCA 1CRQA 3JZIA 5KO2A 1TZCA 3WZLA 2VDRB 2ZEJA 1R4AA 1YS1X 2ZJ5A 3LPDA 3P19A 1NHWA 4FIDA 4ZVTA 5GZ6A 4D8WA 2O8EB 2AE2A 4JT9A 3PUXA 1ODIA 3FY4A 4L5AA 4NQRA 4ER6A 1J9GA 3A1UA 4AG5A 2H4XA 4HQKA 4HAUA 3DB2A 4K26A 2VHTA 4DIDA 3ICOA 3TR5A 2Z30A 4E2YA 1YL5A 2ZSUA 1KC1A 4TYQA 4V38A 2Q1WA 4UOZA 1C3OB 2FGKA 2O0JA 3OZTA 4C3VA 4OBXA 4D0LB 4JP5A 4LKRA 4ZT6A 2H1HA 1VCHA 2WWXA 3HU3A 4ZZIA 1P1KA 4NFLA 2P2YA 1IN7A 1CUCA 4GKBA 2GA9A 1XL0A 1Z6PA 2JHCA 4LISA 1QSGA 3UJBA 4KLRA 1OYVA 3IJRA 2QMEA 4TWJA 3UIEA 1M7BA 1SM4A 1B14A 4HEA1 1K1EA 5F52A 4DCUA 3ZHZA 4CXMA 3ZJ4A 2GKGA 3U9TA 1RXYA 4IGKA 5JHHB 3IDZA 3NYWA 4TXNA 1BGWA 2F90A 1ABEA 4GHWA 1BCSA 2JGDB 3QX8A 2BDUA 1J56A 2V7BA 2ZJZA 3FUVA 5BNZA 2FPIA 2ZJYA 1CQXA 4BC0A 3IUPA 2HW8A 3BGOS 2A33A 4KAJA 2HCRA 2D8AA 4XDYA 3T7AA 1V4BA 1HURA 1T3SA 3PVCA 1RAFA 3KJFA 4IMIB 3WE7A 3AEUB 1AB5A 1CTQA 1K86A 1Q16A 1XZIA 2NNWB 4GLOA 5K0EA 3OCZA 4MP6A 3WYDA 4EW2A 1DELA 5IAEA 4YMTA 5ESDA 2JGAA 2IOYA 2WAMA 1BDHA 3O2SB 1DBRA 1ECBA 2XGJA 4IUCS 1DQRA 5JEEA 1DQNA 3OU6A 4TYWA 3R5JA 4F8EA 2JLVA 1X7WA 2NSLA 2DQYA 2BCGY 3UN1A 1KWGA 3H1TA 3CPEA 2DTDA 1JGTA 3ASZA 2BW0A 1I51A 2FWMX 3BG5A 4RU1A 1ZU5A 3Q6NA 4AAYA 3S68A 4YIHA 3QQ5A 4L1KA 4PC2A 3AKZA 4H17A 5CDTA 2R8RA 2XE8A 4WMLA 3ZQ6A 5EP1A 1X15A 4YMGA 1U0FA 4LJKA 1TFUA 3WOHA 4FHEA 2XYQA 4GGOA 3RC2A 1O6CA 3A0UA 3C6XA 3OU2A 1QH0A 5D85A 3W5SA 5JWHA 3WLAA 4DMLA 1I2BA 2H3EA 3P2YA 1AA6A 2W6IA 4IIDA 1ICEA 4Y2SA 2XWSA 3PC6A 4CZ2A 4IYRA 3U19A 3I1YA 5AW3A 4WLUA 1AS2A 3BMNA 4TS1A 1SCAA 2RKWA 2H1WA 3LJKA 1IN6A 4FMBB 4JCOA 4WFKA 4FWIB 2Y27A 1TO6A 1NGSA 3UFXB 6YASA 5ILOA 3PF9A 4YC7A 2QBYB 3O8NA 4N5DA 4FYKA 3SBEA 1KJ9A 1JI3A 3DDSA 1J1IA 4OQMA 3ZZ0A 3OF2A 5IVHA 2VF4X 5AW2A 4NBKA 2BEVA 1E69A 4LG1A 2VK4A 3ZWAA 1J09A 3I2IA 4LC0A 1OFUA 4RDCA 5CA1B 1YIAA 3DR5A 4XUGB 4I1RA 3EBPA 4GR4A 1M2VA 4QPJC 5LWHA 4HFJA 3GUHA 2E89A 2LD4A 4PNZA 3L05A 2C7OA 3L7CA 3I2YX 5FUMA 1GV1A 1GJRA 2DPHA 3DHWC 3FKQA 1YO6A 4QUBA 2QUZA 2ZUVA 3VAZA 5KYWA 1OH7A 1XTRA 1KOFA 2ZYGA 4AZVA 3GJXC 1X7ZA 4WKNA 2HB6A 1DAHA 1JEAA 1H2RS 1H69A 4KO8A 4RZ3A 4PEVA 3VR1A 5JLAA 3DYIA 2F64A 2YL2A 3HZRA 1VSQA 2GBFA 4YJHA 2HR1A 4CTMA 3WL8A 4AJNA 3K6KA 2RI6A 1NBMA 4FZ5A 2RIPA 1QYDA 4R2HA 3ODGA 4RVGA 2C2HA 1GZ5A 4RF2A 2HT1A 3GQBB 2GI4A 2JATA 3RUFA 3HP7A 4UD2A 2UYCA 1QO7A 2PBFA 3LL7A 5G4LA 1BE0A 1NW4A 4H3HB 2C8VA 4U2DA 2IDJA 4DRXA 4Y2PA 3OF5A 4URVR 5ES4B 5AW9A 4X44A 2XZOA 1Z3IX 4GYKA 3T61A 1MB3A 4R6WA 5C34B 2PWAA 1F51E 4BECA 5CLFA 4V1CB 1CUWA 4GF5A 5K8CA 1ZX1A 1HK7A 4P4TA 1F2UB 4WOPA 5E7MA 5TEWA 3SJBA 1F3LA 4CMIA 3D3JA 4ZQCB 4OUDA 2I55A 3RUPA 3G2OA 3FDZB 3KYDA 1N5DA 3BH6A 3S1LA 3AP3A 2BUCA 2HIGA 2QW0X 2G28A 2M6RA 3NDIA 3QXGA 4HX9A 3WTBA 2OBBA 3MB8A 3KKPA 4ZCMA 2GVDC 4CG2A 3O3MB 1FA9A 3GLUA 2NTYC 4PYMA 1RLUA 1RC0A 3UF0A 5JMPA 1YMQA 1APBA 3AJDA 5SY4A 2C58A 1V37A 2WFAA 1U5CA 1YIDA 1QIDA 5JBNA 4TWAA 4D9CA 1GQ2A 3VH2A 5EJ4A 1GPWB 2DQZA 1LA2A 3DKPA 4TMVA 2W4IA 3HY3A 2LTAA 1XDSA 2CHFA 3ZCUA 1UJ5A 5AKYA 1I0ZA 3E81A 3O4FA 1BFKA 5HE9A 1A5BB 1J4AA 1N2CA 4JFRA 3T7TA 1II8A 4HWKA 3VZBA 1J0CA 3DE0X 3VR3D 4HY3A 4P93A 1WPXA 1W1UA 4AMVA 1OZ0A 1IWOA 1EKXA 2JI7A 4HV4A 3HKBB 5KQRA 1ODKA 4Q3OA 3FETA 3E18A 1JHXA 2CHVA 3KZOA 1SXHA 2B6HA 3CE9A 1U7TA 3LDHA 3MTGA 4NS1A 2P3QA 1YRBA 4Z8YA 1NQ5A 2BFBA 3PVSA 3T4EA 1MHPA 1G38A 3U9SA 3SNKA 4UBJA 4OV6B 1ZJ5A 3CJTA 4Q5IA 4AWBA 4G0OA 3L8CA 4WLOA 4CMAA 1T9AA 1UFKA 3EEFA 4I8DA 2W6OA 2ZRMA 3CG0A 2P2CA 1O9BA 3LC7O 3JY6A 1YOVA 5E1OA 4A23A 1RQNA 1XKLA 2AG0A 3G2JA 1UMCA 4IILA 4L9SA 4N12A 4DQLA 1NRWA 2P9FA 4XFKA 1S3IA 2ZJ7A 3QHQA 4ZTBA 3VPHA 1NR1A 3ABZA 2ICAA 2PBZA 4P3XA 4ZZ2A 1FFXA 3PQDA 4HAWA 4NECA 3R5HA 4ROSA 4KB5A 4E22A 3EVCA 1AU9A 2NO4A 3HEAA 3R5KA 3UJAA 2D8MA 2QYHA 3EIWA 4IDQA 4JT8A 4RIHA 4BQSA 1YS2X 1ZEJA 4EDHA 3CIOA 4EJ0A 4HN4B 2B20A 5IAJA 3VVBA 4DYDA 4BMSA 4YJFA 3FYUB 2ZBRA 3ACCA 2XCIA 4E94A 2NSDA 2NYRA 2XIJA 3QE0A 4TRJA 3K6RA 1N2SA 1U1CA 2XNDD 3HV0A 3K8YA 4FYVA 4ES6A 1QU3A 3ZDAA 2ZVDA 3LKBA 4LRXA 1HLFA 1J0BA 3EQ2A 3OOWA 3QPBA 4DNXA 1FFHA 1DFIA 1RU3A 2BWJA 3KKOA 3MMPA 3QEOA 5HEKA 3PBKA 5C4GB 2H9YA 4P5EA 3HKEA 3SDBA 5CA0B 1XZLA 4ZALA 4ETMA 3ETNA 4U5QA 3BJMA 1VE3A 4IM7A 3GLSA 1C8LA 4O2AF 5CB4B 1PNTA 1RPNA 3II6X 4BJHB 5JD6A 1G6OA 4DNPA 1KYIA 4AJIA 5CD1A 3MD0A 4BVAA 4TMWA 3H97A 3PEUA 5JARA 2NZXA 4QDTA 2AX4A 5HUQA 2PCLA 2QI9C 1Z5ZA 1ZGAA 2XAAA 2JAQA 5HDQA 4DUGA 1XQ1A 4HUTA 2FLKA 3ZY4A 3K2EA 3IYLW 2O8FA 3WL5A 2W58A 3M6XA 3NUQA 1FP1D 3VZSA 4D99A 1NDUA 3N7AA 5A06A 4D9GA 1PR1A 5F5LA 2FPOA 5JMTA 4RPIA 3EPLA 3H2GA 3A1NA 2NTJA 3OE4A 4MARA 3H19A 4FUTA 4U6SA 1BKSB 3GHYA 3ZEIA 1LUAA 5DBOA 4C21A 1AQUA 2G5PA 4JP2A 2J6CA 3IHTA 5A9SA 2ZAIA 2C7PA 1T8RA 2TSYB 3HGMA 5LMNB 2Z2YA 1IB0A 1Y6RA 1A5TA 1SXJA 2IZ0A 5AM0A 4ARAA 1RHRA 3BMOA 4Q00A 4GFDA 3U26A 4FNGA 3NCTA 2G9UA 1FP7A 2JK0A 2WAXA 3GVXA 2BVNA 3NRCA 3UANA 2I6QA 2OQIA 5FBZA 3X3HA 5LBTA 4BO4A 4EA9A 3EZYA 2AR0A 3ILVA 4TTSA 3RG8A 4PR3A 3ZHUA 2R7NA 1D1SA 3KL2A 2PSHA 2R7MA 3ZDXB 5JNTA 2I3BA 3DMGA 1B1AA 1OXTA 4I5FA 3V55A 5AHKA 4B6SA 4CQLB 3UNXA 1TQDA 5A4KA 4ZTZB 4PNPA 4DR2B 4U9IS 4KPUB 4RFVA 5DX0A 3U16A 1A72A 5ALXA 3UPDA 5JH7A 2OXCA 3P9IA 1GKLA 2FX5A 3KYBA 1GGJA 4PC6A 2HYDA 3LC0A 3O7MA 3X1WA 4CMHA 2Z8YM 3ETJA 4PBSA 2WI8A 4IVQA 4B8WA 1RKQA 2MR6A 4KVGA 1IONA 5AVSA 2C8KA 2H31A 1YCHA 4K1LA 5HNKA 1E1DA 4ND1A 2BKVA 3M3HA 4ND4A 2JFBA 2OB2A 3L7BA 1RHUA 5HJ2A 1ZPDA 1MIOA 5DP2A 5DNWA 3RUDA 2IYYA 4BWYA 1LJUA 1J06A 2Q1XA 4NPHA 9ATCA 3DR3A 3NUGA 2A5GA 3QX3A 3BSWA 3CUWA 4P4LA 4QATA 4EUEA 3U7JA 3VPFA 3UWKA 3H1BA 1M76A 1NXXA 4O4IB 1EAYA 3KP1A 3IBSA 4JT2A 4ECAA 1E0AA 3PKZA 1R6DA 2FSFA 1NAIA 3BE8A 4IV5A 2NTNA 2IS4A 3GFFA 1DC5A 1ZK1A 1QKJA 3L7OA 4OFZA 4OKIA 3LUJA 2IDZA 4QOJA 4WZBB 4ZT4A 2P68A 3U4GA 1MX9A 1YULA 1YS4A 2GN1A 4MV8A 1EZZA 4BNMA 3KOMA 1JFSA 2A30A 1K0FA 5DSXA 1F38A 3B12A 2P79A 3QJ5A 3ESDA 3C3JA 2AKYA 3SF8A 2CFOA 1FYWA 4C4ZA 5SICE 4DWVA 5KNCA 3UY4A 4GOLD 3GY0A 1KQFA 3IELA 4UE6A 5JHGB 3MCUA 2CJWB 2KSQA 4M60A 3VO2A 2HHHB 1IMOA 1ZRMA 1GAJA 1G8AA 2NN3C 1EEXB 1D8AA 7REQA 1WS6A 4G07A 4Y7DA 4MV0A 2X58A 3PDCA 1DEOA 4B6RA 1QB7A 4RE6A 3ZWXA 4PS0A 2QTWB 3ZLTA 5I7RA 3RSOA 3PXBA 2VF2A 2OLJA 1WHSA 1ZMOA 3DKRA 2O8CB 1R9GA 3GP3A 4DWJA 4LW8A 4EEKA 5JMWA 5E3IA 5M3BA 4Z53A 4P54A 3UKJA 1QIIA 2F8LA 5CVCA 2IU0A 2Q4BA 3T0IA 4E1BA 2OV1A 4RTJA 2LBPA 1CY1A 3L0SA 3PXEA 3UXHA 1QR6A 2VDWA 3GVCA 3ZC3A 1T8UA 3LX6A 3VOAA 1P8AA 5JANA 2YWRA 3L8EA 1ZXLA 3GXOA 4Q7QA 4KXUA 3OQIB 4EITA 2QX4A 4XB2A 1WXDA 4HZUB 3DL4A 3TD6A 3L4SO 4O59O 3EX7C 4OI0A 4H08A 1R37A 3AF1A 2XKJE 4JI3B 1NBAA 2XE7A 4LDZA 3BFPA 4NBLA 5TGTA 1ZM9A 2AHOA 1K8YB 3SIWA 3KYIB 3LXXA 2NZ2A 1H22A 2J41A 5PGMA 3PQ4A 1YT5A 3LOPA 5I47A 3T3IA 2DHDA 3UUWA 3Q11A 1RLIA 1FNCA 3C3PA 4I9FA 1VG9B 4OL0A 3BWBA 4FOLA 3TX6A 1KJ8A 1VL6A 3X1DA 5LVAA 2D5IA 1E92A 1PWYE 1P91A 3P0FA 4LRWA 3ELYA 2H1SA 2AG1A 2G4LA 5AK3A 2HA3A 5LL6P 1GEGA 2ZAOA 1YB5A 3A05A 3LY7A 4MGKR 3SF8B 3GCWA 2PQ2A 1XMQB 2J87A 1QNLA 4NJOA 2Q5FA 3UKDA 1USWA 2R11A 1VA5A 1FPMA 2PR7A 2QN9A 4FZ3A 5JDIC 5JZ9A 3MT7A 2K5UA 2G72A 2PRYA 3BTVA 1OWNA 3ABQB 2I4OA 1V26A 3CRVA 5AXAA 3TW8A 5F3RA 3AOGA 4RH1A 1VE7A 4LJ9A 5ALEA 2VXBA 3SHFA 5FTWA 3FCEA 2QTBA 2GYVA 4PIVA 4FYPA 2JLWA 1HE3A 2XLCA 1L5ZA 3HVUA 1GQSA 1ISSA 4MGYR 4GUDA 4CLRA 1PJRA 1XTZA 4S1PA 4YR9A 4AS2A 2CT8A 3TI9A 2JCVA 1Z6GA 4TTTS 3NHPA 4Y1EA 2HK6A 3BB3A 1SHJA 2WM3A 3U3ZA 3WISA 1J23A 1LQ2A 3ZIAD 4URZR 4F4FA 2QQFA 4I50F 4Z9XA 4TWIA 5FOWA 4G09A 3SX4A 5EIXA 2ODEA 1CWUA 4P92A 3ICPA 2HJ9A 2EWWA 1KE2A 5FPHA 4PX2A 3ZDDA 3BHJA 4ZYVA 1HOXA 4FKBA 1D0IA 1TF7A 4K6MA 4M86A 3OTQA 1DZIA 4G26A 4XVRA 2B0JA 4P53A 5E9QA 3ZJVA 1SFRA 3O1HB 4Q93A 4CQNA 2WIDA 1AA9A 4BQRA 2WQ6A 3ND7A 3NH9A 3K72B 3O4VA 5HIMA 3TD2A 3VNBA 4YQFA 4L4UA 3VR6A 4JB3A 2XBUA 3JQEA 5BRNA 4CQLA 5EHGA 3CH6A 3EEBA 4J7XA 3NVKI 3M4JA 2R6GA 3Q8LA 1FP6A 1Q20A 4IEFB 4ARSA 5HFNA 2UVPB 1UBRS 3HYNA 2BGWA 5GV7A 1XNQB 4AT1A 4FGJA 2YRFA 3BXFA 3MRSA 4Y2JA 1DWPA 5A0FA 2DFNA 1IHYA 1P7WA 1IHXA 2Y99A 2QQ0A 2VQ6A 3COPA 4B73A 1RM0A 4CCYB 5KDDA 2QE7D 3E5RA 3GDFA 2NX2A 4B82A 4F5DA 1TK3A 2A1TS 2Y0DA 1KI6B 2YYAA 3HZZA 1P1JA 1SCNE 3UWPA 3T54A 3LH5A 3WGNA 3L7NA 4B3CA 1B6TA 3OJEA 3B52X 2BFFB 2Q5JA 2D7DA 5LMZA 5DGCA 1CUFA 1MO3A 2Y77A 4FXPA 3SIRA 2IF0A 1G5IA 3OQ6A 4ALNA 5G1PA 1R4MB 4NV1A 2EZ4A 2WHYA 2QM3A 2EKLA 5EKUA 4A8TA 2Q3LA 3K9GA 5C5EA 1YB2A 5JI2E 1NW3A 2EF0A 4OCZA 1C8VB 3RK1A 2FXVA 2GAFA 3NAMA 3HBMA 4MVJA 2DVMA 4ID3A 2ZM5A 1Z36A 3KWLA 3OZDA 1IIBA 5HF9A 3WIDA 2ODAA 2H0QA 1BEEA 3N6RA 3ZW8A 5IW8A 3NAQA 2VJMB 2J9FA 1CQIB 4BB9A 1HE2A 1S8OA 4WQMA 3VNSA 1X1RA 5MN5A 3GMIA 4TV9F 5BYAA 1MC8A 2AMFA 3K1YA 3K96A 1I6LA 1NZJA 2HLPA 3IP9A 3DO5A 4ZVLA 2XYPA 5I9BA 1BN6A 3HKEB 5CA0A 2VPQA 3FKSA 3NHYA 4UARA 1K4MA 3B7WA 4U63A 3DOCA 3V8NA 4UNSA 3D3KA 3K5IA 1LNZA 2O0HA 3HMKA 5TPWB 4DSUA 2CDBA 1YZQA 4FC6A 3DNMA 4BIMA 1PS0A 2WLSA 2OV8A 3FDXA 1ZONA 3K15A 1FTYA 2JIDA 2GZSA 1JAHA 1Q7CA 3N0TA 1V35A 4WLEA 3BTOA 1VTKA 5HM8A 1Q0PA 3TOVA 3QIVA 3RWMB 2GGSA 5ECYA 1JAXA 5CW1A 2PRJA 3SS7X 3MC1A 3EVNA 3ZI4A 4U2CA 3RTBA 1CW2B 5A5FA 5E1MA 4D3YA 3ABSB 3F4BA 3EYWA 1MC5A 4GX1A 3ZIAA 2VBCA 4WJZA 1ONNA 1W52X 4P6VF 1X7XB 1R16A 3BJIC 3FOZA 1QVZA 3QENA 3SDSA 4KXNA 4L78A 3SHQA 5CNIA 4EUFA 4Q03A 5CEFA 2ZIEA 5F1PA 5JO0A 4R0NA 5HQJA 3IQHX 1Y42X 2FU5C 5AXCA 1MDBA 2JH9A 2WSYB 4MUAA 2ZWIA 1KMHA 2WD9A 1YTLA 2ODBA 1ADCA 2G0NA 2AR9A 1CS4C 2O3SA 1OBVA 2QENA 4Z3OA 2V0GA 1F0KA 2I6SA 5AJTA 1L5RA 4N48A 2C78A 3H0CA 2F1JA 2PY6A 4BIIA 3M3PA 1OXBB 2PH3A 4MV6A 2HK9A 3WWEA 4TSFD 3GGDA 3NETA 3P2EA 4G2NA 3E2MA 1FFAA 3FCAA 5GADl 3P45A 3P52A 1HNWB 1J90A 1FSZA 1UC9A 1TE2A 2V8OA 1U2EA 2HLNA 3M81A 4OQYA 4TN1A 4ZCSA 3H5LA 5CXXA 2WYIA 1IQRA 3OOHA 1GU0A 3RS3A 4X3CA 3U40A 2QZPA 3PFWO 2RDMA 4JR2A 4YALA 3S44A 5BN3A 4JYZA 3ZWDA 1GTZA 1F0PA 2ODWA 4EFNA 2W90A 1WWKA 1WZUA 1YHNA 3VI4B 3AW9A 4QASA 3KELA 3LD9A 3IEVA 3TQRA 3LZCA 3TOCA 2QMQA 1LEHA 1ZIDA 2A9FA 3AILA 5F12A 3N8KA 3TFWA 3GLHB 5KWEA 5EUBA 2ZUTA 3AJAA 5H9WA 1LB1B 4NENA 3RW9A 1MHTA 2PR2A 1NXWA 3EN0A 2PKQP 3E9NA 2V54A 1R1DA 4ZQIA 5HF6A 4A15A 3MJRA 1LSOA 5H8WA 4JP8A 1FDSA 1KYTA 1UKAA 3QWFA 5J9FA 1F7VA 4EKNB 1UC5B 2I80A 2RK6A 3P9PA 4PLYA 1QAOA 5TVKA 3B6JA 2KI5A 3BRSA 3FHCB 4IDPA 4OAPA 5EMNA 3LS2A 3F90A 4F21A 5L4LA 1XDWA 4LVOA 4PZAA 1AIPA 1N7HA 2VAPA 4G5YA 1H4SA 3MUFA 1NLFA 2QN6A 1VP9A 4KKXB 1R9MA 3D8TA 1SWVA 4MDHA 4QTTB 3T7EA 4DA8A 5K03A 2WYWA 1O6ZA 1SOAA 2ZM6B 1JX6A 3FJOA 2WJZB 4DRXB 1YQWA 4P5PA 2XMQA 2CNDA 1S3SA 5TGDA 2CHUA 1YDHA 3FAKA 5A02A 2P6NA 1RT9A 3UJ3X 3W1WA 3KQPA 1QE0A 3Q3HA 4R2MA 4RVSA 1JAZA 2DC1A 4J9UE 2IHZA 3AR4A 2IUSA 3E53A 2LKDA 1KP9A 2W6ZA 5DHTA 3V00A 3K53A 3UENA 2VJCA 1XSEA 2SHKA 3F97A 4KBYA 2QV0A 3KSMA 3EASA 1TM1E 4KOEC 1E1NA 1RMTA 2BMVA 3TGPA 5DM2A 3T1TA 4B43A 3QU4A 2R1TA 2GJ8A 2GAJA 1FNBA 3EIQA 2OFXA 2NAPA 1ISGA 3OZXA 1T5IA 1U3GA 3SZUA 3TZHA 4XYGA 1B7GO 2TRSB 4MW7A 1CUEA 3ZV4A 3SSOA 3TVDA 1W36D 5D5PA 2HN9A 5AVRA 1HEIA 2F3RA 4AXBA 1RYMA 1IATA 1QTRA 5TMPA 5C1OA 3AR5A 2VPZA 2WSSD 1TT5B 3DE2X 2PX8A 4D8TA 2IYTA 1JWLA 3K70B 4AFNA 1US8B 4YUZA 4ARZB 4DUYB 2V7UA 4XFJA 4I1PA 5T6BA 4I55B 4N9QA 3W3ZB 1IE3A 5A3VA 2BCJQ 4Z1OA 1QRDA 3NANA 1PTKA 1GLNA 3Q5DA 1W4RA 1EXDA 2ZRGA 2X0RA 1XEWX 2OG1A 3K1TA 2HQBA 3ILXA 4MS3B 5TS2A 1GG9A 2I22A 4EELA 5HIJA 2OHIA 1MNAA 3C8DA 4CU5A 2FNAA 4G1EB 3OFND 3UMBA 4CWAA 2R4TA 5B4UA 1K7FB 4EKDA 3R76A 4PG6A 1NFRA 1ZWKA 1T24A 4FPXA 4QHSA 4GX5A 4IKOA 1K6EA 4MH0R 4MNTA 5B2FA 5KOHA 3OJXA 1HE4A 2EV9A 1A8UA 4KQ1A 4R3UC 1Z0AA 2IYEA 1UIRA 4WW0A 5SZJA 3MWKA 3SYTA 2CCGA 1B41A 3W6PA 4CTOA 3DLAA 1KVRA 1O94A 1VE9A 5DW3A 3HL0A 5G53C 4RPLA 5DYTA 3CG4A 4PO3X 3BMCA 3VR2A 3O1IC 2BI8A 3RKRA 4BLPA 2WG2A 1ZVJA 4XSGA 2FHSA 4JQYA 4QRIA 3ZX4A 3NYRA 2HADA 3IGFA 1UP6A 5BWMA 4F91B 3RNOA 1QP4A 1UMDA 1CX9B 4X7PA 1YQDA 3GH1A 1G2OA 4BEBA 5C1IA 1Q5PA 4DXDA 1DDGA 1P6UA 2EJWA 1R0LA 3LA6A 4ZYXA 4HDKA 2M1XA 1Z8NA 3F8TA 1WUYA 4MAFA 3FPLA 3B60A 3R4VA 4V0QA 2PMEA 5A9RA 1ZR2A 1TK2A 1RVDA 1E1CA 4LOJA 3JQAD 4LPKA 3FPGA 1QYIA 1FNSA 1GG5A 1TB4A 2QTAA 4HLUC 1OLXA 4IOKA 3WLRA 4HNRA 5ELXA 3L0OA 1N2EA 3ASUA 1L9KA 1DAMA 1JJIA 2ZLBA 3RVBA 1QFSA 2UVQA 2VRCD 2ZTLA 1SC9A 1VLLA 2FWJA 1GYRA 4N76A 2O3RA 3SK0A 1U81A 1KYWA 4H7IA 4H1HA 4QYWA 3RAFC 1U6JA 1A7JA 2AJ8A 2NYUA 3C2QA 3HEMA 5AW7A 4IIGA 5LIPA 1OVMA 1DKUA 1TZKA 1U7WA 5A62A 4M87A 2D2FA 1OZHA 1VG1A 5CIWA 1ZJWA 1HGXA 3CX8A 2WWGA 2VQ3A 3V1NA 3ZPXA 4CW7A 2XJ9A 5HYVA 3RT9A 1H9BA 3RHZA 1Q21A 3RS0A 4BLQA 5I7HA 2Q7DA 1E18A 2VQFB 2W71A 1H9CA 4R0VA 2AOUA 1YE3A 5F9HA 3HYTA 2ZJOA 4M9ZA 3HO8A 2DZDA 1G41A 1JB1A 1F0NA 4J0KA 3ASVA 4DUGD 3WICA 2G04A 2YR0A 4RFSA 4X5OA 1KA9H 3ZR4B 2DBQA 1SQ6A 3FPHA 4ZK6A 5C32A 3JTMA 3DONA 1Y1PA 3G9UA 4MKFA 4LFAB 1OFVA 5FUWA 4PZ9A 3U7QA 3WLKX 2GFIA 2NXCA 3F4LA 3QK7A 4TV9B 1QMPA 5K2MA 2O54A 2IRWA 2HBYA 4C6SA 2I4MA 1CF4A 4REOA 1S9DA 3FZEA 4ZJPA 1GV0A 3IUYA 3PUZA 4G1BA 4RBNA 4YV1A 3DWGA 3BE4A 3SIPA 4QU5A 4XVQA 4ZCRA 1X0XA 3CT6A 3A6PC 1WCV1 4PG4A 4MV7A 4LZWA 5IN5A 3GEBA 3OBIA 1MDFA 4JS0A 1PQPA 1GQOA 2C2ZA 2LP4Y 3GJZA 3ZVLA 4A8PA 3AIOA 5FBRB 4ZCTA 3WLNA 3VU0A 2OXFA 1PW5A 2FRDC 3U3XA 2IW3A 3Q8MA 1YS7A 2JCGA 4FE7A 5FLYA 1YL6A 3KBOA 3HKCB 5CH8A 3KKQA 3GFRA 2BELA 4Q9KA 2WWRA 1G0OA 3VVMA 4WIAA 5TR9A 3SVTA 4HDCA 2ZT5A 2AFIB 2H1RA 4MR9B 1MZPA 4HQ0A 3TXAA 3P71T 1PHPA 2EKZA 2LUOA 3IT0A 2FR8C 4V1CA 2Y76A 1J0XO 3GT0A 1VGQA 2BHSA 2I3AA 4Y2QA 5HF5A 4JLBA 3N74A 1FU8A 2V5VA 5H70A 4NH0A 5FNVB 3RJ9A 3TRHA 4REQB 4O4HF 2IV7A 5KEIA 1Q95A 3WLQA 4AO8A 1ZK2A 2XHEA 1C3EA 4KSYA 4ZHSA 3G9QA 3R7BA 5AJYA 1K8XB 1LPBB 3F67A 4CLOA 1V5FA 2GWRA 5JYCA 3N0WA 4FXOA 2VBFA 3HJUA 1QR2A 1EVZA 3LX4A 4HEQA 2Q3FA 4K9KA 2R7LA 4OQNA 5E2IA 4JKOA 2GZ3A 2DR3A 4FFMA 2E49A 3IUMA 4TYPA 1B0PA 4MK4A 2Q7XA 2F43B 2FKNA 3OSUA 4D9JA 1U2TA 4FFSA 1P7ZA 2XAUA 4U0KA 4OQPA 2Z09A 1VB3A 4BO8A 3RB8A 2WF8A 3FCOA 3MOSA 1D0VA 1YZGA 1IM2A 3TN7A 2WWFA 4XTCS 4C0AC 1JVNA 5JRZA 2ATXA 1KJWA 2C5AA 2PL9A 3AF2A 1H2EA 1UPBA 3G1UA 1EP1B 5KYXA 1RSZA 3STWA 1J8QA 1KO7A 1Z4PX 2JAXA 5TMBA 4CIXA 2PGIA 1N92A 5AOBA 5C7LO 1E9CA 1MV8A 2ZSHA 4G0MA 2IXEA 3L7JA 3T34A 4A4DA 4CTKA 1DAIA 2ONKA 1GNVA 3W5AA 1FPQA 5TQVA 4C2UA 3LKDA 1IUNA 1SKQA 4ENRA 2RAUA 1R8QA 1GGMA 1Y3FE 3U3OA 1NY5A 4YWHA 1M1NA 2HRQA 2I34A 3T5BA 5IASA 1W19A 1Y1SA 4W6QA 5I9MA 1WF6A 3SYNA 1M83A 1ARZA 4DJEC 4QG3A 3U7GA 4MMZB 3FNFA 1WABA 2FN8A 4OTZA 4E2ZA 2VUHB 3HWSA 3UA3A 4GPD1 4K28A 4L7QA 2DHCA 2EATA 4GVXA 4NYIR 4UUNA 4P7GA 4YDHB 2QLTA 1IEWA 3KLOA 3CFYA 5A9SB 1WL8A 5DPMA 4ZAFA 4WJLA 2EL7A 3G02A 5AUNB 2Y1WA 4FK8A 1EU1A 4O8ZA 5AKIA 2HDWA 3PFKA 5JC8A 1N9GA 4O8CA 3VNQA 5B55A 3RGGA 1TYEB 1FL9A 2XUOA 1C4XA 5C7YA 3GGSA 4FZVA 4TQGA 3L46A 4CIYA 3IQEA 1ZGBA 3OU7A 4D9MA 3MB5A 3CNHA 4G4SO 1JG6A 1KEPA 1CLEA 1ZM2A 3DZFA 1I6MA 3LGXA 3MSXA 3PFFA 2MJLA 7ABPA 2JFXA 5J4VA 3WA7A 2IH4A 3KVRA 5F3WB 3GXBA 2QX6A 5BR7A 5K20A 4F4HA 2Q1SA 4RLFA 1HETA 2P3LA 2BE7A 1P2DA 3SDZA 1HYEA 4ZFNA 3AEKB 5EUMA 4LOHA 3WTCA 4BZWA 3IJPA 2Q7OE 1XJ0A 2WU0A 1NTOA 1S2GA 5GIOE 4RPKA 1PF7E 4R7ZA 2QMOA 2RB5A 3L6CA 4W1RA 4XM2A 3W8RA 1NBWB 1TTHA 3A31A 5LCXA 2X5XA 3GAMA 1MRSA 3THYB 3IPXA 3BXHA 5DFAA 4MQBA 1W8DA 4UVHA 4UPVA 4DOMA 2CB0A 4TKVA 3BK2A 5EJAA 4HGNA 1SR8A 4BRWA 1AV7A 5ANRB 1PIWA 2XB6A 4RGBA 4BQQA 1VC2A 2BTOA 3OCUA 5KMGA 1E3WB 1XEFA 1W85B 2VT6A 4QAQA 5EIOA 4BNTA 4CU2A 4DLRA 4DB2A 1PD1A 1BN7A 2VT3A 2J45A 4GIBA 2DX7A 1D2RA 1JG3A 2Y2UA 3AM4A 3L0PA 2UKDA 3UT5A 2CV2A 1TKRA 1T8WA 1XLVA 3FSGA 3REQA 4JHLA 3W0LB 1N2IA 3GEIA 3DOFA 1IHPA 3MLBA 4LXGA 4RJIA 2IHYA 4NNOA 1PGPA 2GESA 5KSWB 1Y7LA 3KU4A 4Z1MD 2PJZA 3F2IA 1YMUA 4KPGA 1QH1B 2VYCA 3R8CA 2NAFA 4Q1EA 4CN9A 3AZOA 1IZ8A 1PW7A 5FI5A 5AUPB 2C3PA 3WP0A 1JDVA 3JU3A 3NYIA 5KX5F 1DDIA 3UH0A 5C53B 2IP1A 4QUDA 3A6EA 2QXYA 2PANA 4K9PA 4YEDA 3BMQA 3VUFA 4E4RA 2VRNA 2FPRA 1MJNA 3CN7A 2P7HA 4F6RB 1T5OA 4BWFB 2ZYTX 3RTGA 4BLTA 1KGDA 3L1IA 2EL9A 3AUKA 4EABA 1Y8RA 2OBFA 5CG2A 1T3TA 3JQBA 5CT8A 5C1DA 4OQFA 1IN4A 4Q34A 3MLEA 5CLLA 1P80A 5BWLA 2RGUA 2BMDA 2W11A 3G5TA 3LX8A 2WY2D 1Q22A 1XZ8A 2QRZA 1RXSA 4BLSA 4CL3A 1TF5A 3WNVA 1HUQA 3RS2A 3K71B 4LFBB 4HQLA 3OA0A 4YBRA 5IJAA 2X4IA 3Q15C 4V0MA 3RRMA 1TXGA 4I4NA 2ZR8A 1X8XA 1JQJC 5KYVA 2WVAA 1RM5A 2D59A 3EEYA 5DGXA 3W1EA 3TFOA 1OI2A 1JFVA 2CJYA 2MDTA 5JJLA 3DEZA 4NYMQ 4IBOA 4OHBA 1KY2A 2F6RA 2G09A 4KIWA 4B46A 3UFBA 4I6JA 4BNIA 4M9RA 4UU0A 5DBFA 5EE1A 4FNAA 1W29A 3HU2A 2AV6A 1V39A 1OILA 3ZE6A 1D4ZA 4QUKA 4RVDA 4L9AA 3SQLA 2DPLA 4XGKA 2GCPA 1HDGO 5AH0A 3UAZA 1RQRA 1LNSA 2OGUA 4W5WA 3TR0A 4ETIA 3P2KA 5LP6B 1VYTA 2P1RA 2RARA 5DB4A 1BRMA 2RIRA 3RRXA 1CNMA 2JIMA 1A71A 4NONA 2GH1A 1T2EA 4X91A 2C5SA 2PN1A 1BWQA 1V95A 1FLNA 3GEEA 3O9ZA 2NU9A 4FI3C 1DDOA 1UAGA 2E4AA 2IKQA 3OT4A 3HSSA 2RI0A 3O74A 1V96A 4NDNE 4DV7B 1QO0D 2ZIGA 3WO1A 1JPNA 1KIAA 3NWPA 1VPWA 5CJPA 3ORHA 5BUCA 1I33A 1J2YA 1GTMA 2HHJA 2VT7A 3N2YA 3P9RA 4KXXA 5K05A 5EWMB 1WV1A 1CJMA 3ZKAA 1WBDA 1OX4B 1P44A 2OGWA 5T4FA 5KVAA 1E1QA 3IR7A 4RULA 3DE3X 4UAJA 3JWPA 1Z5PA 5AVTA 3PX7A 4GRDA 4V2UA 3RIEA 1ZQ1A 2P0AA 1DJMA 3U48A 2E6KA 1U1FA 3IA7A 1JEDA 1V16B 4C0HA 4YT4A 3WMGA 5BNWA 4E5NA 1ZWLA 3VISA 2XSZA 4ZKDA 1SXJC 2MYPA 3E3LA 3MPUA 4KTVE 4WXRA 5DNCA 1OCEA 1QVAA 1VRVA 1CY0A 1H8HA 2XUAA 2ZPUA 1XLTC 3IB3A 2OTCA 2FMIA 5HPYB 2G6TA 2YUIA 4MJ7A 4KIFA 5LYJF 5C5IA 1ICIA 1KKLA 1Q3HA 1WUJS 4HZGA 4Y6RA 2ZJ3A 5JASA 1QAQA 1U0TA 5J5AA 4UHJA 4FCVA 4JQOA 2J5BA 2OORC 1DKNA 2VSOA 1WMAA 1Y1KE 4NS4A 5HS6A 3TJMA 4QGSA 2CBGA 2HLHA 5G02A 1Q44A 1XD9A 1RI4A 1R74A 4X1YB 4J7AA 1RKUA 3DV2A 4EMBA 1P9WA 5H16A 4OOEA 4QUAA 2FF7A 5LZ7A 3G8DA 3R7NA 5CHEA 4GRIA 3NEPX 1YFLA 4ZI3A 2Y6UA 2CLKB 3O4JA 1UC4B 1VE5A 1YB6A 1JQ3A 3NUZA 2Q3HA 1OQAA 1K98A 1KZ6A 5IDYA 2YW2A 3TRIA 3N2IA 4OHMA 3O8DA 1KERA 4GVLA 3HU5A 4RCZA 4LA4A 4WESB 5DTRA 1WXXA 2GNPA 5BW8A 2HWUA 4QGGA 3W4KA 1CEXA 1BXRA 3P9ZA 1QC5A 4CFZA 2VHCA 4JCCA 3UOGA 4S3MA 4AS1A 4F85A 2R6AA 3BH7A 2JGFA 4M2LA 3GRPA 2LE0A 4KKVA 1VFPA 1FS6A 1FDOA 4DE5A 2DWQA 1AHNA 1HI9A 3M1YA 1CIVA 1RHKA 2ONCA 3KAJA 1GQYA 2X9LA 1KWKA 3PYMA 1XMIA 2JA1A 1TZMA 2DT5A 5EINA 1NI3A 2VLBA 5GJBA 3A6HA 5F98A 1N57A 3PDJA 4IS2A 1ISJA 4A16A 3OHSX 1PDVA 5G3ZA 3F47A 2YHIA 3M1AA 3OMWA 1EM8A 2W37A 4TRRA 2NV6A 2CGEA 1DG9A 5B3LA 1NKSA 4KITB 2DY0A 1SVWA 2QRVA 2GBLC 5EVCA 3I01M 2WIAA 3QF4B 5L7TA 1D6MA 3NKVA 3ZLUA 1YS9A 5HXAA 1ADYA 1E6EA 2HMUA 5E7IA 1JI0A 3GLTA 3U3JA 4ETNA 2VS1A 1W9HA 3HACA 3VR0A 1RABA 1XAGA 4FMDF 3WLMA 2H9IA 3PHGA 2NU6A 4ZVMA 4OKNA 2YN0A 2OB1A 3D7LA 2JJMA 2ZU6A 1QTIA 3AHJA 1W581 4N5IX 3REOA 1OXVA 3QYAA 3LPMA 4MHSA 4ZO8A 3CWCA 4O4IF 4H60A 4BNVA 4LGCA 4Z4CA 4BMDA 1NW6A 1TI7A 1FX0B 4O4IA 3LG2A 4Q9HA 3BK7A 1GU7A 1QM5A 3SR4A 2CL7X 4DGQA 2WTAA 4WKPA 3BD6A 4QAJA 2JBAA 3TRFA 5CDUA 3AYZB 3TSWA 1QCYA 4UBMA 4CM3A 5DNDA 4PTYA 1E7MA 4QPNA 4B83A 1REQB 2IUFA 3KSZO 1NL3A 4M1MA 2I91A 3TKAA 4MZDA 2NZVG 2FEWB 1QIHA 4EJMA 3UKOA 3R9XA 1Z25A 1GTL1 3K20A 3FNIA 3DDHA 4PG7A 3MJHA 4Q15A 5EIHA 2HF7A 1HA3A 3N39C 4KPUA 5J1SB 1FSPA 1BKYA 4DLYA 1OH8A 3X2EA 1T2AA 2MSNA 3IA2A 4B6JA 3TD9A 3DBRB 2M98A 7AT1A 3INYA 3G8CA 4PXSA 3NTRA 3H8VA 3CNNA 1J2JA 3CPJB 2QW1A 4MYSA 2IOQA 3A6JA 2D62A 1IAQA 3A3KA 4RELA 3PE3A 4B6GA 5JS8A 3UMYA 4L5YA 1SCDA 3ZVRA 1JF8A 4Q47A 2JNWA 3M34A 4Y6QA 3WGIA 1TCBA 1N25A 4F04A 1N0IA 3H3XA 3V7NA 2PUFA 4YRRA 4EQZA 3JRNA 3WYEA 2VWHA 3KZCA 1Y3DE 2RFLA 5JFGA 4GLFA 4YQYA 5D3QA 4R05A 3H75A 4OSOA 3ZXYA 2BMAA 3D1LA 4D81A 3PD0A 3T4UA 2F8TA 1HT1E 3FF1A 1K3UB 2EFEB 1PWEA 2Z1MA 3ELWA 3PGKA 5D8DA 2ZCJA 3WIOA 4LHWA 3VDMA 3RNLA 3K30A 3PGLA 3R3XA 1ZMBA 3LQKA 1SK9A 3K3PA 3KJEA 4LVUA 1T10A 2WKPA 3WRXA 2N42A 1A2BA 5I4IA 2IP2A 1Z2AA 3IQFA 3EHEA 3KT6A 4BVKA 1LLQA 1YA8A 2TMKA 3O1JC 5JD4A 2GXAA 1QIJA 1QC5B 1Y48E 2E85A 2PIAA 1GRVA 2WSLA 3N6VA 2ESRA 3UGTA 1WULS 1QK5A 2G8LA 4HAVA 3ZTYA 4RMIA 2XKAA 2QD5A 3AQ4A 3UHAA 3UXEA 2HDHA 3IV9A 3A2KA 3U7HB 3A25A 3SJAA 4M8IA 2CFCA 2R8XA 3PQ7A 1UKZA 5CB4F 5KNCH 3K1ZA 1KR2A 5EXE