5KWYC

Structure of human npc1 middle lumenal domain bound to npc2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
b'EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Niemann-Pick C1 protein
molecule tags Transport protein
source organism Homo sapiens
publication title Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
pubmed doi rcsb
total genus 29
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kwyC00
1NEPA 3MU3A 2E59A 2E56A 1WRFA 4G8AC 3M7OA 3WEBA 5KWYC 3VQ1C 5IJBC 2F08A 1A9VA 2Z65C 3WEAA 3FXIC 3MTXA 5IJCC 2Z64C 2HKAA 3T6QC 1XWVA 3RG1C 1AHKA 3B2DC 5IJDC 3ULAB 1KTJA 3VQ2C 1AHMA
chains in the Genus database with same CATH superfamily
3LY6A 2AF2A 3GMNB 4BDVB 3IMTA 3O6ML 2EO7A 2OMZA 4WU7A 4UM9A 4PQXA 3DECA 3RDTB 4FLRA 4OZ4A 3D7PA 5JIQA 5DC0A 3WDJA 1LO0H 1B2WH 2R8SL 1T89C 5E2WH 1NANI 4FFZA 2HRLA 2RFXB 5CZRA 1VZHA 3DV6B 1NMBH 4M8QA 4ZRGA 3MJ8A 5C1MB 3TA3C 1BPVA 2VL5A 4OIIL 3X12A 1Y1DA 5DJ0A 4XGZB 5HXMA 2HXAA 3N1MC 1PZ5A 2Y7LA 4I88A 2DQCH 3ARZA 1AD9A 2M8XA 4ELDA 3HS0C 4PJCF 1T6VN 2WCGA 3RGHA 3ARSA 1IBHA 2P7TB 2MPAH 1C9SA 4IRZH 3F83A 3BC9A 3V6OE 2EUXA 4YBQD 1U8KB 2A38A 4G1MB 3FCGA 2IIJA 3OKNA 5F1NA 1T5XB 5FUZL 3ZE2B 1E5UI 1I3GL 3AQDA 4D9LL 5KG9B 1JSYA 1NM4A 1ZSDA 2HJKA 4YBQC 4P4KC 2X3BA 1GC1L 3C2SA 1PQZA 1MFAL 4JZJC 1RMFH 3O11B 1IFRA 2YPVA 1DEEA 3D69B 1PVHA 3OKOB 4LNVA 1UM4L 3KE0A 3WFCH 5EWIL 3NIGB 2CD0A 1WFNA 3UGXA 1NFDB 3FOLA 4PRHA 5A7BA 3SPGA 1KBWA 2IH3A 4K7FB 4LCUB 3WS6A 2EXSA 1BDYA 1AZNA 2RD0A 4P46C 3JWDC 3RTQA 5FO9B 3U7AA 4AGNA 5F7AA 5I1DB 4Z0BH 2LU4A 1FYTE 1VCBC 3CSTA 3QEQB 1P5UC 4UDUB 4Y5YA 3OKNB 1IC0A 2NY1C 1U8CA 4FQ2L 4N8CL 3GKWH 1J87A 4MDJA 2KH2B 2GJ6E 1AHMA 1E40A 4ANWA 5B1KA 5INDB 4X6DE 3WCYA 3WTWA 1C08A 5CN3A 1M7UA 3AY4C 2DQIL 4RGOL 2D4DA 5I18H 1KYOJ 2VIRB 3PWPD 3HE6D 1FH5H 3VH8G 1XSIA 3VI3B 5EU6B 3GSUB 1CFVL 3GGWB 4NKQB 3G08B 2CHZA 3LS5L 4WO4B 3HHSB 2O6EA 3CSYB 4KUCF 1EVUA 3BSZH 1PTZA 3EADA 4NDMA 1AS7A 3CN0A 5F7NC 3ZK0A 2J56A 2Y1VA 3CDGA 3G6JB 4BH8A 3U4EA 5IB5A 3RL1B 1IEBB 1XF2B 2E27L 2E7CA 3FAWA 3L3OB 3FO9A 3MRLB 4YXKH 2QSCH 2N7BA 3DX7B 1MLCA 4HKBA 3FQWA 4X6FA 5B3NA 3EDJA 5BOJA 3LJ3A 2OMBA 3SEPA 4EUPB 5MEQA 3PAUA 4DQOH 1S8DA 3FK3A 4ZFZA 4Z7OF 4WWID 2O72A 1OT1A 3D85A 4K3EH 2HPOA 5HDQH 1KPRB 1ICTA 4MJID 3KWUA 2IALA 3H0TB 3O0LA 2X09A 4U1IA 2GK2A 4JHUA 2FX7H 3U36A 5FECA 2UYLA 5SV3A 2N1KA 4XPAH 4Y5VB 3TBYB 1S7TB 1BG1A 1OL0A 1ZPLA 2F8VA 4BCZA 4ELMF 1SOQA 2QGEA 5MENB 2CRIA 2ZYHA 1MDTA 3APNA 4IBLT 4PJEE 2CJSA 4JQXA 2B59B 5FHAL 1WE5A 1THAA 3MLSL 3DX7A 4HKBB 4OW6A 4CNIA 1EAQA 1IRAY 5ICZB 1LWJA 5K9QG 3GLAA 4UUJA 1A6TB 3WKML 3QUMH 1IEAA 4QRRA 4BFEA 4U7MA 1XF3A 4P5MA 2X6BA 3FB5A 5KBMA 2DH3A 2BFVH 2OZNA 3CBJB 3FN0H 3GS0A 5EU6A 1ETZA 1XBDA 2H47C 4L1HA 4YHIB 3ULAB 2C9AA 2ESVE 2XA3A 2WB1A 1L6PA 1ZY9A 4MJ4A 3V7AE 4Z7VB 3KYKL 2R1XA 4HIEA 3UGEA 1TO4A 4C56A 4M5SA 4CMHB 2HJFB 5EC1B 2WBJA 3ALXA 1J1OH 4WI0B 4BSVA 2R2HB 5T33L 2DM2A 3RURA 3U4BL 4N0CD 1E6JH 3ILPB 2VDRB 2F53D 4FN0A 4OFVA 3IS1X 4GKZB 4IKJA 5MP6H 3ARTA 3BUBA 3BVNA 4JFOA 1SY6A 3ZKXB 4FXKB 2BCMA 4JLRB 3QDJB 2OR9L 3AAZA 3WMPA 3RTQB 4N8VB 4WUKL 2BWDA 2WIIA 1YEGH 2PTTB 3CVCA 3GSQB 2CIKA 1WFTA 3NH7H 4FG6C 3AT0A 4YSRA 5D72L 2XWCA 3HLAB 2J6EL 1CYWA 3W9EA 1S3KL 3BVTA 3LIZA 4OT1H 1LDPH 1WBYA 4U2YA 3SBRA 5F89B 3WNNA 1NOAA 2WWOA 4G8GE 4DK5A 3VI4F 2H45A 3GIVA 3LZQA 4AG4H 1MFCH 4MCYA 4RAVA 2XXMB 4PJXA 2YOAA 1GHFH 1FVCB 3MC0A 4JANA 2X2UA 4DEUA 4DQOL 3L3HA 4J6IA 1DQDH 3DSFL 5IJDC 1KCLA 1R19A 4OM1H 4BFJA 1A4KB 3BWZA 4JO1L 2BNRB 3MV7B 4HH8A 5ENWA 3E8UL 4KKBC 3NCBB 2RR3A 1VPOH 2BY0A 4HF5H 4RFNB 4XHQA 4JHVA 2XNAA 3DUSB 3HHRB 5TGBA 4KO5A 4Y1AA 2F7QA 2EUZA 4XCNB 1FUNA 3WUWG 1UKTA 4N2CA 5I15L 4XMVA 4K23H 1HYSC 3DTXA 5BJTB 5EZLA 2VCOA 1S7RB 3HUJF 5EA0H 3UDWC 2VDOB 3KVQA 3U9UB 3NJFA 3KPOB 1FVCA 3MUY1 4OQTH 1BFSA 3CFBB 1ZIAA 3SD5A 4L37B 3B9DA 1D5BA 1TZAA 5C08D 3QULA 1AMXA 1T0OA 4ALAH 4JJ5A 4A7TA 3O4OB 4E2OA 4KQ0A 3QCTH 4FYTA 4YQXH 1QRND 1TENA 2HT4C 2F54D 2Y7OA 1SF5A 4OKVB 5IROD 4CADB 1FO0L 2DYPB 4N90D 2Y23A 1T0NA 4QWWD 1OVZA 3OHMB 2KYIA 3BVWA 5B39G 1IM3D 1GAFL 4KK8C 1NKOA 8FABA 2XQYA 5K9KA 1X5KA 1LE9B 1J86A 1EV2E 1LWHA 4P9HH 2XG4B 2W91A 5E1IA 4XVJH 4DW2L 2IANA 5A6IA 3UG3A 2ICWB 1OARH 3UJJL 2TRHA 5DVLA 4ZXBD 3UTZB 4AIZB 3C5ZB 5HHXL 2DAVA 2X1OA 4DHLA 4J3OG 4UV4L 2ENSA 2N3JA 5DUPH 4OFDA 4OD2A 4HLZH 2OPCA 3A0OA 4A7SA 5IWLA 2F7PA 2NX5A 1NMAL 1TZGL 5IKCB 4WVRA 3BVNB 4JFOB 2ESVD 4MAYA 4Y2DB 2D9QB 1EBAA 3BFQG 5E1AB 4F24A 3QWNA 5BVJA 1OSEA 4C56E 4GLRI 5LWYH 1R5IA 4HFWA 2DTSA 2Y1YA 4RIRA 1GSMA 1JF1A 1RJLB 4NP4L 4HKJB 2EUVA 3C08L 5IBUG 5JUEL 3BZDA 4JMNA 2F5BL 2DQGH 3O3DA 5T1MA 2D8KA 5TF1L 4OM1L 5I76B 3QDME 1G94A 5J6GA 1EHLH 5E8OA 2FIRT 3DURB 4G8AC 3SGKC 3MUHL 5JMRA 4OZGE 2CJTA 4YFDB 1ZHNA 2VLMD 4FNPA 3SPCA 3QUXC 1XGQA 3K0YA 4KI5E 4A39A 4LVHC 4KU1A 1IKFL 2NQ3A 1QFWI 5JMOC 4X6EB 2B1OA 2IAAC 4OGXL 4OCMC 2VGLM 2F5BH 3SYPA 1JL8A 1U91A 3SGEI 3TBTA 1XIWB 4AGQA 3OKEA 4Z95L 1GYWA 3B2DC 4HZLB 1X5IA 3UEQA 1UM5H 5JXAH 4Y4FC 3KGRA 1I1FA 1H9DA 3FCSB 1FFNB 5TK4A 3MV9B 1HSAB 3OWRA 4K5NA 4WTXA 5I71C 1SFDA 2CPUA 2A6JB 2JH2A 3VGGA 1B3IA 4EO5A 5KWYC 2GBVA 2PP7A 3PIQB 4MHHG 5CS7A 4LCWE 3QO0B 4HUKB 5DFVC 5C0AD 2BS9A 3R8BB 3VFWB 4XMTA 3CNKA 5DHXB 4APQD 2CJUL 1QAWA 4JFWA 4RGNE 3D2UB 3ZW3A 2X7LA 5BCAA 5I8CB 5EIQA 3DJZA 1NBVL 1QFWH 1GGIL 3CFBA 1CL7I 3H85A 4K5LA 3AQXA 4LSQH 4O02L 3LIUA 3G08A 2VLJA 5DZJA 3DTXB 3NTCH 5T1KD 4RX4D 3ARDD 4HKJA 4UV7L 2R0LH 2XACC 1DJYA 1BHGA 3JSSA 4GIOA 4GKSA 5JPNC 5C0BE 5DC2A 3WIHA 4F57H 3LKRB 3UEZA 2X6MA 4P59L 3O8XB 4JO2L 4UTCA 1Y1UA 4I3SL 3H55A 4GRLD 3PUUA 1EX0A 2FUQA 1LO5B 1RHFA 2UUDH 3H7BB 4OQTL 4FMFA 5I0ZA 1MW1A 4A63A 4GUCA 4NO3B 4DFHA 4AQZA 4OD2B 1P5UA 5FFGA 3IGAB 3W0WD 2FB4H 4C4KO 5BV7H 1LNUA 1SY6L 5BRZD 2ICWA 1S7TA 2ARJQ 4UQDA 3QJSB 1DUZA 4JDVB 2CM5A 2VMCA 1R9FA 3CFKB 1SOKA 4L4VE 3U4KA 4WTQA 5CN2A 1I7TB 1N7MH 3D34A 2F61A 3EJPA 3HI1A 2CLZA 1U3ZA 4XVJL 4TOYH 2EAEA 4LCCB 1UZ8B 3D52A 1FE8L 4ZSOA 1XL6A 5JHLL 2K45A 2GTWA 2WM0A 5DHYB 4OFPA 1NCCL 1U92B 3VH8A 4ZW3A 2VAAA 1KENL 2WBKA 2WJ7A 4FLHA 5I6NA 4L37A 1GKOA 3L5WB 1DLHA 2Z4TA 2J6WA 5CCKL 2NT1A 4ZS7H 1KBKA 2DBLL 4W93A 1GTFA 4MJ6A 3Q8AA 1MAJA 1M05B 1Z9SB 5EC1A 3B56A 4XTRD 5CGMA 1NIAA 4TNGA 3ULUL 4FQXC 1ZS8B 3ZQWA 2BSTA 1L9SA 1JBJA 1UXMA 2ZUVA 4B0MM 4H2CA 1YYML 3KDPB 3NJKA 1W8NA 1TEFA 3WDHA 1X44A 2C9XA 1FGNL 3ECQA 4YDLC 1P53A 1VLXA 2VR7A 3FQUA 1VKXA 3KG5A 1ZVSB 3QZWA 4HSCX 3KPLB 5HDBB 1L0QA 4E41A 5CR8A 5EF2A 4ZUVA 4NQXB 4NWUH 1F3DH 2I7SA 4CA4A 1B3JA 1B0WA 1DLHB 1JVLA 3LB6D 1WEJL 3K6FA 4QRUA 4YSPA 2VSMB 2R56H 3CMOL 1CU4H 1OOAA 2EINB 4KNUA 5I30L 2DB8A 3FW6A 4EVNA 4Y4HB 2FBJL 4GMSL 1I8LC 3WFDH 4B9ZA 4A2HA 5CMAB 4XOCA 2V2WA 1GHFL 3T0EA 3CSFA 4BUQA 3WN5B 2N01B 3PWPE 3GSVA 5C0AE 3GRGA 3FQXB 2FQGA 2APBA 1BZ7B 4LLMA 5E1GA 1QSEA 5MHSD 1XTLA 4DN3L 4XNQB 3WLWC 3H3BC 3SPVB 3V0WH 5CJ5A 4D0BB 3HE6B 1HEZB 4H13C 1FORH 4KJYB 1DTUA 2QTVA 43C9A 2AQRA 2EEFA 2YAQA 5C2BL 3ZGIA 3B2UC 5IQ9A 5CJBA 4J3OC 2Q76B 2YN5A 1ZVHA 4KZDH 1XSOA 4NGHL 1XR8A 4J3UA 1RZQA 5F0PB 3IMSA 4PI2A 4TN9A 3ZZ1A 2G3XA 4B5EA 2Z4QB 3CSPA 4I0PA 4Z7UB 1IC1A 5T33H 2J8UE 3HMXA 4OBSA 2CA4A 1DVYA 4LGSB 1KB3A 5HP5A 4O58L 4IJ3C 5DSCA 4NQDE 4R4FL 3R4DA 4F5CE 4XHJC 2P5PA 1IQDB 3VFMB 2PPDA 4LDEB 1IGFH 1KIUA 2C9SA 2J8HA 4C56D 4F7PA 1CZ8H 3Q2NA 3ZIMA 3AXIA 3RWCB 2BCKA 4OR1A 4BK5C 2R9HD 1OAYL 4ODHL 1TFHA 3QHFH 2JKWA 1T7WA 3QZOA 2P28B 1LE5B 2FVNA 4PRAA 5E5MA 4Z76B 4R96B 1D5IH 4UBDC 4LVNB 3B3IB 3D9AH 3DXAD 4G7RB 4IRJC 4YE4L 3QFDB 3IPFA 1BM3H 4FYQA 1UOLA 2CUIA 3LKPB 1ZGLB 2BP0A 5KBKA 3WFEL 3AW5A 1S6NA 3BLBA 5CBAA 2HTKC 3MODH 3P11H 2PYEB 2A1WL 3CHQA 5B7EA 3QQ4A 1ZLWH 4U1KA 3EJZD 1KZYA 1K8DA 4WV1A 3RPBA 3ZDYE 2XZZA 4OJDH 1PNDA 3EJZC 4GRWH 1OE1A 1XXDC 2OXGA 4TNVK 2YGPA 1HFUA 5JOFB 2P5WA 5HDBF 1M71B 4AZ8B 5ICYB 1EK3A 4QXVA 4UAHA 1N4XH 2DWXA 1KIPA 4JQVC 5J6GB 5K9JL 1UC6A 1A7RH 5HGBB 1LJMA 1YNTF 2R4RL 1PJ9A 5DQJA 4QHMB 3GZKA 4Q7DA 2W0LA 5IB2A 2Y6TE 4TM9A 3IGLA 4Y7MA 4BHUI 3QDHA 2VKXA 1ASQA 3TT3L 3KLSA 3MACL 5LXGH 4MZIA 4F9PA 5B8CC 2UXFA 3TASA 3SGJC 4LB8A 2AJSH 3ABGA 1M4KA 3ECVA 4DPRA 2LU3A 1GCYA 3IDXH 3DO3A 2Q6WA 2Q7YA 3K80A 1CD0A 2WNGA 4O2EB 3KEDA 4H5SA 5CNHA 1E4HA 4P2YA 4PLNC 2XY1A 3FUHA 2G2RA 2E9BA 2J73A 2A9AA 3PV7A 3VRIB 2VWEE 4APXB 2Z6FA 4RGNC 3OHXB 1LP9E 5HVGB 5KS9A 4P5TA 5IJCC 3VE0A 1J8HB 1LO2L 2A2QT 4KDTC 4G59C 4HUVA 3VXMA 4OZGF 2YAHA 4LCUA 3RY5A 2X6VA 1MJ8L 4YE4H 2IANE 5JIHA 3OJDB 4HCIA 3B9VA 4F9LC 1QW9A 5DD0L 2F5AH 1OGAD 5KVGE 1AHWB 3DYOA 5C0EB 4XPBL 2X38A 1IC7H 2HCZX 2VXUL 3HZYB 1AQDA 5E08L 3VQMA 3F5WB 4H1LA 5JQ6L 4PRIA 1SJVA 3Q6FB 4DZBA 5BRQA 1NZRA 1BAFH 2YLHA 1EVTC 3IFLH 1Z5LB 5IB3B 4HWBA 1A4JA 2LOEA 3Q43A 2JB5L 2F18A 4KNTA 5AZEH 1LEGB 3U46B 4B5ZA 4AG4L 5M95B 4XB3A 1KN2L 3GRWA 4X8JB 1VAHA 1JWUB 1HCVA 3FT2B 3OB0K 4FI6A 3FL7A 2WTRB 2XX0A 2BRRH 5E0FA 4CMHC 2DJ4A 4X7SL 1W72H 3L8QA 1CB4A 2KQNA 3LEYL 2EZ0C 5J12C 1A4CA 5E9DA 4MSWA 2ZP9A 4QXUL 1CD9B 2VDOH 5K59E 2DBJA 4DQAA 5DZAA 1JK8B 2DL9A 4LCWA 4LF3A 2OKMA 4UOZA 4PH8A 4NUGL 2X4RA 4TUOB 3JVGA 3N43F 3LAFA 2ZAHA 1MZZA 4L4VB 2ADGB 4DVBA 1OAYH 3WSQH 2VLKD 5CGBA 4BELD 3SKUD 4WV1B 4RMRA 5AVTB 2NZIA 3EIFA 1M57B 2JQMA 3NP3A 5LGYA 4NSKB 3RL2A 3MFFB 4Y1TA 5J89A 5LBVA 3BZFB 4UNVA 3GUTB 4N0CC 4Y2OB 3IU4H 4LQFL 5HDOA 3ESOA 3MCLL 3M17A 3MRJA 3VXSD 4CGUB 3S37X 4ZUTA 2P44B 3LKOB 4YGVB 1FSKC 5GZNA 3EG9B 2Z7ZA 2C3GA 2DKMA 2H6OA 3UTQB 4YSEA 1ZLSL 5IHZB 5IIEB 2X4RB 2A4CA 1L5GA 4JCWA 4NGHH 5DJ2B 1E43A 4ZQKA 4HJGA 4O5LH 4CN1A 1YPZE 2J1YA 4AEFA 1XCXA 1BF2A 4L4TA 2N56A 2AI0H 5DC4B 4Q9CA 4HDIB 4OVVA 4MQ7B 4X6BA 3K1DA 4X4ME 3ATAA 3APDA 3P0YH 1CJYA 1LHZA 1BLNB 3ESVF 3QJRB 2W88A 4A38A 2BOCB 1F1AA 3DVNB 4MYWB 2GK0A 4YIQB 4DUWA 1M7DB 3FAXA 5TDPB 3TYFB 1NGWA 3MACH 4QY8B 1XF3B 3CLEL 2LTQB 4JRXD 4P5MB 1AE6H 5HYJE 4FQHB 2WK2A 5FYKE 1U8HA 3I6GA 3B7SA 1IFHL 3DX8A 4YC2C 4HPOL 3ZQ9A 3CXDL 3NSCA 5IESL 3JZYA 4HJUA 3WFDL 2BO0A 1PZDA 4M7LL 4LCVA 2CKBH 3EDEA 1R46A 2BNQB 3PGDB 5TE6H 4NUJB 4Y4KA 2NRDA 4NOBA 3SY0B 3FUEA 3Q1SL 4MBRA 4N6RA 4TVPD 3SGDI 1AQDB 4LPWA 4NFCA 5KYNA 3HI5H 4Y5VC 2IWGA 5TFSL 4PGCA 1GZQA 1NGPH 4E41D 5SX5K 1N6VA 3MODL 3UZVB 1NCJA 3UCRA 4PJCA 2VMEA 1OAKL 4OZGB 3O41A 4ABUA 2D4FA 4BSJA 4AOFA 4ANVA 3VFNA 1RZIA 2W80C 2EVIA 1REIA 2Z7UA 2NQCA 1HOEA 5E6IB 3K0WA 1PEWA 1JWUA 1F3JA 2O5ZH 4HS6A 3C09B 4G8GA 1ZD6A 3NJNA 4JFVA 4OLUH 1RK7A 2Z9TA 3OV6A 3QORD 4CSTA 1IAIM 1MI5D 4M43H 4ZOBA 1G9MH 4F7KA 2G4EA 2I5YH 1NFAA 4Q2ZA 4EUPH 4FQXA 2WVTA 2Y5EA 2WXNA 4HQQH 3WYRA 4KMQA 3ZKSD 3GBMH 5IFHL 1MEXH 2BW4A 4G80B 4LKXA 1MFDL 3W11C 1IIIA 3UO8B 2EDBA 4HXAH 1YY9C 3HEIB 1EZVY 3ZYOA 4OCXL 3IDGA 2MKLC 3KLAA 4F2FA 2ICWI 1AGEA 4LPTA 4N86A 1HEJC 2JIXB 3BH8A 2C1PA 4GXUM 5LO7A 2A83A 2B8OT 4U49A 3FH5A 2JE8A 2OFQA 3QXAB 3UBXA 3UTSA 4PY8J 3CZUB 4YWGL 3QEQA 1A0QH 4JPWL 3QDGB 1U8MA 2DH2A 1E4KA 3WO3B 6PCYA 3RVXD 5I1LA 2R59A 3C6SA 5JXEA 2UXTA 3L2NA 1D7FA 1I8LA 1ONQA 5E9AA 1QVOA 4NO2A 2CE6A 2O61A 1F2XK 4LLWA 3H6AA 3MUZ1 1WHPA 2CPCA 5AOMA 1MG3C 3GDBA 2CALA 1CE1H 1K4CB 1HH9B 2WY3B 3MJWA 4N3UA 3CVHA 4N8PA 4TQEL 1HHGA 2I27N 3LSOA 5B4MC 3TWCH 3LHAA 2YPVL 4PD4J 4NNPL 2ARJA 2FJSA 4KNSA 5B1JA 2ZP8A 4Z7WF 4ZW5A 3DTUB 3MPCA 1MW2A 1LVEA 2MQCA 4P2AA 4YOKA 3RIAF 5HHQA 1WEJH 2NSQA 4J23A 5HHPA 1RI8A 1T20A 5E2WL 5IW1B 32C2B 3SGJA 4NP4H 3NDYE 5KUKA 4Z3GA 3QNXA 1CBVH 4JGUA 4UMGA 1RURL 2BY3A 3IVKA 4JM4H 1MUJA 4RMSA 3TIDB 35C8L 4GLRH 1A6TA 1A6VL 1YN6B 3VFTA 5K1VA 1RUMH 1FF5A 3PV6B 3ZYJA 2WANA 2AJVL 2B5IB 4Y19E 2A9DA 1AD0B 1H8LA 4QYOB 1OGPA 3T77A 2W5PA 3LPWA 3O4OC 3BQUD 1NAMB 3UIZA 2E46A 4TNVF 4E9QA 5IHWA 4OCWH 1KCVL 1KOAA 4KWUA 5FLUA 2VDPB 1OGAE 2O30A 3MLRL 2D3LA 3FFDA 4Q8BA 2D03H 4ORGB 2IPKA 4U6HB 2P4AB 3MRCB 4WW2A 3TF4A 5J11B 3ULUE 3GC3A 1L7TL 1FL6A 3Q0HA 4GXUN 3MRGB 3CG8A 4HUXA 1G6RB 3V6ZA 1DDHA 1EIBA 2RMNA 5KZCD 1G9MC 3OAWA 4KHTL 4F7MB 1IKOP 1BVNT 5D4QA 4PJGB 1AKJD 2ZYRA 4UAOB 5JUEH 2FCBA 4GKOA 4QJ4B 2OR7A 3VGBA 1BPLB 1DBAL 2EIJB 1PKQE 3KYMB 2IOMA 3RX8A 2Q3XA 3BIBX 1AANA 5I1JL 2ERJB 3DYMA 1T04B 4Y16A 2WKGA 5JXED 3AU0A 5LG1A 3UPRA 5JLZB 2JJWA 3SGKA 1VFAA 2NW2B 4J4PA 2VXSL 3UBXB 4R9HA 3UTSB 3R7QA 4NFBA 3NPSC 4X6CF 5FYJE 3VX0A 5AB2A 4G11A 3GT6A 1RK1B 1IQWL 2UY7A 3W39A 4TULH 5HYSB 5F7WC 4W9CC 3VFPB 3CZSA 4ONHB 4U4BA 3STZB 2NLJA 3TYGL 1TVDA 3TH2T 3EYSL 3LZOA 5EFIB 2HG0A 1ED3A 1JZHA 1LP9B 5DLMH 1HH9A 2CO7B 4WEBH 5SX4I 5KS9E 3EOTL 5FKPA 5FYLD 2CDEB 1OWWA 2VWEC 2CAKA 4M6NL 4RDBA 3L3JB 5IB4A 4XVTH 3BN3B 5D6CB 1GA2A 3TA3A 4NM8L 4TKWA 4Y4HC 4GRMB 5AW1B 5DO2D 3BYTA 5GRUL 5LB1A 2QLVB 5E8PA 1W8EA 3WN5C 1C5CL 1HCFX 3LV3B 1YEGL 4P05A 4AMKH 1A8ZA 1RUAL 1A6VH 4LCCA 2EADA 2YZ8A 1KYAA 2O5YL 4L9DA 3T65B 1JV5B 4YUEL 4M7JL 4OZFH 2ZT9C 3NSJA 1V55B 1XVSA 4FEMA 4JB9H 1BJ1H 1S9VA 5LHDA 1BMWA 4I85A 2PTTA 3MRDB 3U30B 3FZUD 2H4EA 5DJAB 5FHBH 1BIHA 4UZGA 2GUOB 1X5AA 2FWSA 3D8MA 5F1NB 1AXSB 1XGUB 2GIMA 3VI3E 5GSVA 3TFBA 3MJGX 1KPVA 3KCPB 2Q9OA 4R84A 1WIPA 3KPOA 3NA4A 2NZ1A 4JEGB 1NIFA 2AV7A 1RZ8B 1NTDA 1KTLA 3RFZA 1N12A 5CKGA 3EYVB 5J56B 3CHSA 3SPHA 1UH3A 4OCRH 2DMCA 1JHLL 1D3CA 3A4FA 3LD8B 3KPQA 2H6PB 2IH1A 2KKQA 3N50A 1JPFB 3MN8A 3MJ7B 1EEUA 2ZKHL 3F8UB 1EJ6A 1OM9A 2VN6A 2HRPH 5ENWB 4M8UA 3UZEA 4BH7B 4BM7A 1BZQK 4JFDB 6TAAA 2FQEA 2Q86B 2YD3A 2V2TA 4JQIL 2W81C 5DS8B 5HHMD 2W59A 1N0XH 4ZJ9A 5HVFB 5L2JA 1X7QB 1RU9H 3UTZA 4LVNC 1ZK5A 5MENA 2ZUSA 2P8PA 4WHYG 3OAYH 3ULVH 2CR0A 4KITB 3BUDA 3L5XL 1J05A 4S10A 5JYLA 1PY4A 3GBML 1BZEA 1KEGH 3AMKA 3OJMB 4K5MA 3REWA 3OF6D 5HHOE 3AREB 3QVAA 2XWTA 4X0KA 4PJHB 2ATKB 1I7UB 1P7QA 2FD6L 3K74B 1T1YB 3EJYD 3HJEA 3T2NH 1R6VA 3MREB 4CC4C 1NAML 3GEWB 3VACA 4OM0H 2GAZA 5LKNA 2FR4A 4KNQA 1CGYA 3WEAA 5EOCJ 3KVDD 4KH2A 4ANKA 5DJZB 3QI9C 2YAPA 1V05A 1WUZA 3HS0A 3L7EB 4W9JC 2PKDA 2V4LA 3WY4A 5DD3H 1FZOB 4JZNB 4LCWD 2A5UA 3IS0X 1H3XA 4ZMOA 5ID0B 4HZAA 3RFZC 4Q9RH 4XPHL 1J18A 1MHPL 2QMKA 3N85H 4NQCE 4YHML 2B2XH 1JPGA 1T1YA 4HSQA 4WTWA 3X11B 3QEUA 2XIBA 2HRPL 1ESOA 2G5BB 3ELQA 2J3SA 4HG4K 1EZVX 1T04A 2R51A 2CXKA 3G6JF 5HHVL 1NAKL 2AABL 2R29A 2Y4SA 5D5MF 4Z0BL 3QWQB 3F58H 3LMJL 1P0SE 4JKWA 1JHLH 4LPUA 1GGBH 3VFGL 4FQQA 5F1OB 2ZJSH 4PJAF 1E5ZA 2PCPB 2DD8L 3KZ8A 1JV2A 4Y2NA 3KL0A 4Z7WA 4PRPA 2YPLA 3VXME 3D0LB 1TTGA 1BF5A 3VFRA 1QKZH 3UMNA 4GT0A 4D0DA 1S9YB 1NQBA 1ZLUK 5L4MA 3TO4D 3DX9A 2FE0A 4DZ8B 5GS0L 1DUZB 4JDVA 2JKIS 4OLWH 5TJWK 4NZRH 3L17A 5D7LA 3DO4A 2J2ZA 1A5FL 2B4CH 2CO7A 2WHVA 4HUWB 3Q9QA 5HYQA 1GZPA 4L18A 5CIPA 4R4ND 4GKZA 4U3CA 4AM0B 2BZ7A 5IJKA 2BNUB 5J7CC 1MFEH 2PWHA 3SDDD 4YSOA 1S7RA 2WLHA 2YK1L 3I6KA 5C7ZA 1C5CH 5DHEA 1U6AL 1XCQB 1WLHA 3ISWA 3U1SH 4NQVA 4PRNA 5CEZL 3VQ1C 1CLZL 4G8GD 5D2NE 4G7VH 5BZDB 1FYTB 1IBDA 2KI6A 4KGLA 2ZXCA 1JZIA 5F7FA 1X9LA 2OTUB 3HAEG 2YQGA 1ASOA 3JT2A 4IU3A 3K2KA 1ZS8A 1AVAA 5EU7C 3VB8A 2BIHA 2WUBH 3TNMB 3L5JA 1GZPB 3SOBH 3MI6A 5HI3D 1WJ3A 1R33A 1OSZA 3MREA 2KLSA 4BZ1H 1NEUA 2HWZH 4LL9A 5B1JC 5DEGA 4M6MH 1EFXA 1NLDL 4N1HB 4DPCX 1U92A 3MLSH 3QUMA 3ZRSA 5FUZH 2VR9A 1OLZA 1IAIH 1ZTXH 2ZPKL 4OV5B 1UOKA 2FO4B 5D2NC 3MNDA 4F3FB 3KYNB 5DO8A 2F74A 5F8RC 1MHEA 4R97B 1FL3A 1SEQH 3SGEH 1MI5B 2X70B 3P54A 1YEKL 4YHNA 1XH3A 1TVHB 4GG6E 4J3OH 1HT6A 4K3EL 4TQ8A 5HDQL 1NGQH 2PR4H 1EXGA 1JGUH 5GS0C 5A6MA 4X8XA 2W65A 1WZLA 3EGDA 3SHSA 1AI1H 2PO6D 4ZXBB 5KVMC 3VSTA 2PNDA 2R0ZH 1ZT1B 2WXPA 1LD9A 4PG2C 2E7DA 3D5OF 1N2RB 1PD0A 1LXMA 5CLYA 4B0MB 1V3KA 1HILB 3C9NB 1BM7A 2H9GA 4K9JA 5E99L 3WFHB 4XNDA 5D1ZC 4Y16D 1A6ZA 4UNIA 2WYIA 5E4EC 4J3TA 1P1ZB 1UXSA 2Z4QA 4I0PB 2QPUA 4L8DB 3AU1A 1A1OA 4Y16C 2FJHB 4PJEA 2J12B 1P84J 3QZWG 1SJEB 2OJ1A 1OPGH 1FI8C 2JJTC 3QUXD 5A2AA 3QRFM 4FFYH 4YK4C 1P69B 1VHPA 1CTMA 4L3FA 1S9KC 5B39A 2PTVA 4QRRD 4N90E 1TJMA 2ODIA 1TQTA 2ZWNA 3BXNA 4PRAB 1A2YB 4PCKA 1X5XA 3FDWA 4AW7A 1L9NA 4QYAA 3P02A 5BMFH 4AEIL 3QIWC 3GIZL 3PHAA 1NOFA 4HBCH 1GRWA 1UCTA 4N20A 4N2LA 5ALCL 1T3FA 5KYUA 4H0LC 4JE0A 1AG0A 3DI3B 1WGVA 1L0PA 5AKSA 1XGQB 1MPAH 2IGLA 3D0VB 1JYNA 1U8JB 4M62L 5TH2B 4JJOA 2G9KA 3ARXA 3FT3A 4GP4B 5DJCB 1YEDB 4N2NA 2AJUH 3EBGA 4PRPE 5E8EA 1JHKH 2LT9A 2BIMA 1Y07A 5JW4N 3O4LA 3MOAH 4H20L 3PCYA 1MAML 4WGKA 1B4RA 4LP5A 3RKDC 4TLKA 3MHZA 3LN5A 4PS7A 3P11L 3VFUA 5J12B 4X6BB 3EUUA 3H9HB 2XWZA 1INEL 2FH8A 2NXYD 4IRSC 1CL7H 2I07B 3G9AB 4JDTH 5D7SL 3S34L 4Y2DA 5A3IC 1W0WB 5GGUB 2DMBA 1AQKL 5F7KC 5AD0B 4G6JH 3S96A 2WN3A 2E9JA 2IAMC 3NZHL 4OD1L 3EXLA 3NJHA 5FV2A 2SEBA 1T4KA 5FO9A 3AGWA 2R29L 1ACYH 3PXHA 2ODHA 2OL3H 4N22A 3WELA 3ZR5A 2E9GA 4EN3A 2DQJL 3E9UA 4JPKL 4XNXL 3WTXA 3SO3B 3FTGA 4LASH 3VXPB 2NR6D 2DF3A 3JWOC 3ZKNC 1N0LB 3QDMB 5DZPA 1DEEB 3O6MH 3UTSD 2XWRA 3SDAC 1Z0NA 3O6FA 3GXPA 3B7TA 3OLDA 1Y6NR 1QR4A 4C58B 1MZYA 3PWVB 3FF8A 1CLYH 5MHSE 2PW2B 1P7HL 1ZV2A 5EBGA 4F5CA 1INQA 4KKPA 4NUMA 4XC3H 4WUUB 2Q3AA 5KSAB 1LO5A 4YHLH 5EH1A 5EZOL 4F37K 1X4YA 2XWBB 3I02B 2P42B 4PP2A 4TUUA 5JA9A 1FH2A 4FFVC 3OTTA 1JDCA 1YC8A 2FATL 4XXDB 4YE0A 3KD4A 3QORA 1FNLA 2X5PA 4OIFA 3IE4A 2RACA 4HCGA 4ONHA 3QK0A 5T3XD 5T3ZE 4CJ1A 2NLJB 2COQA 1NDMA 2HN7B 3MZGB 5GJTL 3QYNA 3QYCA 3CPUA 3QA3A 4C55A 4OLYL 3PJSA 4OLZL 1H0DA 2ZSVB 1OP5K 2ROXA 3MRNA 2PR9A 3FU6A 4HUMB 5DJDA 4A2EA 5K59F 4HFUH 1SN2A 3L3KB 3H9ZA 1CLVA 4HU2A 1SQMA 1L0XA 2GTWB 1QATA 2P1YA 5DZNA 3F65A 3ULSA 3BUYA 2OI9B 4HIJA 3V2AR 4KZCA 4PJ8C 1OPOA 2XXGA 2X87A 4Z8FL 4OLYH 3ZE0B 2E6PA 1KGUA 4CU6A 2YPLD 3F85A 3GK8H 4OCNC 3UTTB 1OSYA 5AQ0A 2EDEA 3DX9B 4DZ8A 1YEWA 3BQUA 4CBZA 3LNDA 5IVXE 4HGMA 1F56A 1F6AA 1OIOA 2IGFH 4XN2A 5DEZA 1CTOA 3HRZA 4OFQA 4APQA 2PETA 2R2CA 1FGVH 1Q1JH 2ALAA 2FSEA 3ZDXB 1ZANL 1R3KB 3VWKC 4K7PH 2J4WH 2R1WB 2H3XC 2QPEB 1EHKB 1DLFH 5EU6D 2BXZA 2IFGA 2V7HB 4KOCA 4FJ6A 5IJVA 5GGTA 5EPMB 4GSQA 4PJEB 1OM3L 5D1QB 4HIEB 4P2QD 2EIEA 2F68X 2XZQL 2VR5A 1JVKA 3DPBB 3N42B 1HXMA 4XX5A 1HSBA 1YJDC 1WYJA 2IF7A 4U05A 2NY1D 1AXIB 4C4UA 1IGTA 3V8CA 2ZYIA 3MLZH 3C8KA 3EO9H 4NO0B 1FDLL 1FHGA 2FEEI 2XPGA 5GHWH 4BQ6A 3IVKB 2BFGA 4L29B 5HHMB 2P5WD 4P9ML 1P7QD 1MFUA 1BD2B 1I1AC 2GJ6D 2VLKE 2WOBA 3B1UA 4TOYL 4TTDC 3MA9H 3FHQA 2F8IA 4K71C 4A7UA 1XEUA 2L3BA 3UAJC 2VDPH 4JL2A 3ZL4L 1TPXC 1CG9B 2MH4A 3QG6B 2XG5A 4Z7QB 2BLFA 4POYA 4XZUA 3MDJA 3P3YA 2FEDD 4KV5F 5EB9A 1INEH 3ZOAA 5KVEH 2M26A 4KJYA 1HEHC 2AANA 4UT6A 2AKRA 1ZWIA 5I0WA 1AAJA 5AW6B 1UD2A 4I87A 4KBPA 4ATTA 3WENA 1PG7X 4HJJH 4CC1A 4ZW6A 2WTOA 4GSXA 4F7TA 5I1EH 3WEXA 1XGPA 3CH8A 1FL5B 1RVFH 5DJYB 1CBJA 5I1IL 1E7UA 1UTDA 4GUPB 5D2LF 3TURA 2QVKA 1E8WA 3QDGA 4NEHB 2FJGB 1QLFA 2HTKD 3CLFH 1MHCA 2AK4E 2NNAB 2WUBL 3QFJE 4F2MB 4LPXA 3Q8EA 2UZPA 3EDFA 4YHOH 2VZOA 1H9VA 3FU9A 4UILL 1I8AA 5J6SA 2GEQA 3ZN6A 3ZMEA 3CIAA 4NKOB 4QAWA 4G8EA 3RKDD 4FTDA 3D4YA 1TTBA 4NN6B 2BSDA 5B3SB 5D1ZA 4JFYB 2CUMA 3RP1A 1IUZA 1BQHG 1CL7L 3CHOA 2ZOKA 2NZ9C 2YD2A 4Q2ZB 1MFEL 2GI0A 4YHZH 1EGJA 1O6SB 3NIGE 1A4JB 4XP5L 1C08B 4W6WB 3BAXA 5HYSA 4AGOA 4NQEA 1HWWA 3OAZH 3DHJA 4NQDD 2EQDA 1HS6A 5F3HB 1TTFA 1F8TH 2G2NA 2IANB 2CR6A 5A2LH 2XWBA 3I02A 4PP2B 3KPRD 4ZAKD 5LAXA 1AGCB 3CXHK 1J5IA 5C71A 3O41B 5E6ZA 2ZKMX 2IXQA 5IBTL 3E6FA 1E4JA 3L3GB 3QS3A 4MYPA 2WVUA 3W11D 5K9JH 1EZSA 1K5NB 1AHKA 1OF2A 2FQFA 3S97C 3JV6B 2XQYK 1RJYA 5BMFL 2X6AA 4OJYA 2WLMA 1KT2B 2YC1B 1JYVA 4CKQA 4XBGA 2XTSA 3FO2A 5KVGL 3VWJB 3QEHB 3ZTNL 2NTFA 3FBKA 1WFOA 5CN1A 5ABAA 1Z32X 4ORGA 4TSAL 5E5MB 2F7IA 4AKPA 4MJ5A 4Y4KB 2GJZB 4QXWA 5FKPB 1I1YB 5JHDB 1NBYA 3EYQD 5CGYD 1UOVA 3QJHB 3QGVA 5B7FA 3D0AA 4XHJD 1OP5H 4LCIH 4NP9A 4PRDB 3IJHA 1HWHB 1FVEB 1I7ZB 1NMAH 1TZGH 1ZT4B 3CXHJ 4GW4A 2ZXBA 5D4HA 1PD6A 1YQVH 3ROLA 4N2BA 4FABH 5H94A 5CEXA 1QR1B 1IAIL 5I74C 4IRSA 2HMID 1M3IA 4S0SD 1W0WA 5GGUA 3QH3A 4K2UH 4QD2E 3Q5OA 3OM3B 2FWUA 5JHLA 5BPPA 3UPRB 3TV8A 1O9WA 3OAUL 3BVXA 1CF8H 2XTJD 3M86A 1VFAB 4LEOB 3QRLA 3ZDYB 3SCMA 3E9TA 5CHNB 2FECI 3ALPA 2OMVB 3T0XA 4NXKA 4CW1A 4AH2B 1G7HB 3ARYA 4XO9A 3UROR 1G7LA 4GJTB 3TO4A 4QTIH 3C5JB 4JFDE 2B9BA 4DPAX 2X4OB 5C09E 1EAPB 1FLRL 2AV1A 5LGKA 4ERSL 3MJ9H 3B2PA 4GT7A 1IZKA 3UO1H 3HE7C 3PHQA 5EEYA 3O6FC 4IRJA 2DLTA 4JDEA 1N19A 1F58H 3LSOB 3S48A 5J4MA 3UPCA 3GBEA 2XWDA 3CFDA 4JPIA 3LVTA 2DWYA 3N44F 1A21A 2ZOUA 1X5GA 3E6HB 3JQOB 1AO7E 4NRZA 5CD5D 3ZT5A 3ZJAA 4YHPA 2QPSA 3QQ3B 5AZ2H 1A5FH 3D39D 4AMXA 2EYSB 3JV5A 1D6EA 5LBSA 4D8PA 5GS0H 2WCSA 2V2TB 5D7LE 4NERA 3K5SA 3BP5B 5DS8A 1JK8A 3TIDA 3U4AA 4AVHA 1P2CB 1ZLEA 1D7BA 4NENA 4I2XE 5D2LB 2YJLA 3HCVA 1A7PL 1KYDA 3WUWB 5JIDA 2IAMA 1I1AD 3QFGA 3KJ6H 2D0HA 2OMUA 4OAWA 2HAZA 4IK7A 5E51A 5J13C 5T3ZL 4DKAA 3CDGB 1EJOH 3PYCA 4BH8B 4XPTL 3VXRD 1DFBL 1EFQA 1HHJA 1XZ0B 3QXDB 3SQBA 5CJ8A 3TGXA 1QEWA 4Z6AT 5DJZA 2KUTA 4M29A 3HG1B 1V3MA 1AQMA 5IT2L 5CEZH 5GRVK 1HDMA 4IKLA 2AV7B 1G9NL 1K72A 5F72S 1DJHA 3KXFA 3SIKA 4AEHH 4IU2B 3U1SL 2WJ5A 1XH2A 3QIWD 1WBZA 2WGXA 5IIEA 5IHZA 3THMH 5FOJA 3NIFB 1P4BL 3VU2A 1NC2B 4JPVH 5INDA 3FO2B 4YEFA 3NIFE 3G6JE 5ESQA 1DQLL 3D2UD 1YY8B 3V10A 3ZMRA 5CZXC 3VXSE 1OCWH 2YGVA 4MA7H 1RZJC 3LPPA 2HX8A 1M6UA 3NK3A 1T5WB 2J20A 4GSDH 4NN7C 5D2NB 3FH7A 2Y6SD 3RJQB 2OQJB 5KJ4A 4NZUL 1BOGA 5F70A 4R97C 5LDUA 3ARQA 5FYLE 3BYYA 4GRWF 2Y2WA 3O6FD 3P9LB 3DJSA 4P2RD 2KC0A 4MRCA 4BRVA 3QCUL 1OAQH 4NLHA 2VXQL 3VSUA 3VTAA 5TE7H 3SDDA 5C97A 5JW4M 1LWRA 1E65A 1ED3B 1LP9A 5HHVH 2Q6WB 1SBSH 4DEWA 5AAWA 4Q9QH 3MBXH 4ZFOA 1HQ4B 2B2XL 2ICWJ 3GSRA 3IKKA 2FWOB 4IMLB 4F80A 1GZHA 2WXQA 3RZCC 3B83A 4HAGA 2XNAB 3O2VH 4QHNB 1KTRL 2MWCA 4GXVH 4XPAL 4LBEA 1UEYA 3BPOB 1BXAA 3RX9A 2PPFA 4EIZC 5I9QB 2VLME 4HG4J 3NBNA 2H3KA 3DYPA 4ZUUB 3SQOL 4UBDD 3MX0A 3FUIA 4FNSA 2Z1KA 5DFWH 4D8PB 3ML8A 2CHDA 5E6IA 2XN2A 5DJYA 2XRAL 2NTSP 1RPQA 3K72A 4OCRL 5IJKC 5JQIB 3W5MA 3JWNC 1IGCH 1BVKA 1HNGA 4I18B 1QFUL 4UM8B 3FCSA 5I66A 2FJGA 3BPLB 3L4TA 3CC5A 5ADOL 3ECWA 4ZAKA 5CR1A 1GIGL 1SXZA 2BWQA 5DRNA 2J57A 3GYRA 2X4TA 5EOTA 1YYLL 2WZPA 1F2QA 3FUJA 1GGIH 1T0MA 2A9NL 2BNQA 3LPGA 4KQ3H 4DSYA 2G5UA 3OXSB 4HX1B 1QLEB 4PJFB 4OF7A 3VI4A 2NY6C 3TA3B 4LAJH 4XBEH 5JR1H 1HN1A 3SY0A 4I0CC 4M5TA 3WIIL 3B8SA 2JK5A 4H1LG 4A2FA 3N55A 5I18L 1YQVL 1BBJA 1MFBL 3ARBA 1XXFC 2H1LM 4QNPF 3RNKB 4M1GL 1NIBA 4M1CC 4E41E 1M56B 4OZIA 3DBXB 4GINA 1QEWB 4N9GB 4MS6A 1OT2A 4NKIH 4KFMA 5C0IB 3UAEA 3R1GH 4JFDA 3U82B 1DQJB 3IM1A 1H3VA 4IIZA 1CE6A 1HILA 3U48A 1UVQA 3O3AA 5J0BA 4AL8C 2EDYA 3CE1A 4MVBD 2VRKA 4Y4HD 4YX2L 4HJ0D 1Q8MA 3O3BA 4CILA 5L2KB 4PYHA 3RAJL 2G60H 1IBZA 1LGVA 4L3CB 5GJSL 2A6KB 1OAXL 4JFPA 3W38A 3H9SA 4KX9A 5HJDA 3BIAX 2AVFA 3WJLC 5HVHB 2D7TH 2VISB 4ZMPA 1L9PA 2VW6A 5AYUL 2ADFL 2OYPA 3Q06A 1HINH 2GSMB 5AEAA 5CF3A 2K3TA 1FIGL 1Q38A 1TJGL 4JY6A 1YEJH 4RBPH 4MJIA 3RZCD 3QEHA 4MS8C 3IETB 4UYQA 4UOQA 2AEQH 2GT9B 3BQUB 1SEBB 2XU9A 5F0LB 4HZLA 2BW5A 2UX7A 5D7EA 5IOPB 5EOTB 2AK4B 3HG4A 3AC0A 3QFJB 1F45A 4ODWB 4XP5H 1E4XL 2BSBA 2NY1B 1MF2H 1H15B 1B0GA 4GQRA 4RMUA 3WTVA 3TOPA 3GZOA 4RQQA 4QRFA 3IFNL 4X5QA 2Q20A 4HALA 1DBAH 1CO1A 5A2FA 3RB5A 4E9SA 1SJHA 4R0LA 5SWSB 1Q94B 4E5XA 4ERSH 3CX5J 1H3PL 2HT3D 2BVYA 4PREA 3S3DB 3TN0D 3IJ7A 4DKEL 1AFVL 3TPUB 4B9JA 3LPOA 3OC5A 4L0PB 4RFNC 5FGSA 1S9XA 4H0IA 4DOHE 5FC9A 1UEMA 3GWJA 3QE5A 4RMWA 4X7FC 4ZMLA 2JF1A 3T3MB 1FYTA 3EYSH 3NEXA 4PGDB 1KB5B 4L2YA 3KAAA 3R19A 1VZGA 5DMYA 4MNQA 1ZHLA 4QR7A 2R2EA 2BWIA 3UFIA 1D2OA 3ISYA 3QRGH 1ND0B 3CK0H 5AVZB 1KTLB 3WY2A 5BZXA 4KK9C 2J4WL 3QI9A 3F05A 2B59A 3T6VA 3MGAA 3KDMA 1TQVA 2DS4A 3GJFK 1MWAH 4CSPA 5I15H 3BPCB 3CFCL 1MJJA 4HHAB 4KKZA 3SPVA 4PLOB 4JAMB 5DR5L 3VFNB 4M03A 4HC1L 1YMMA 5DK3A 3LZFL 1YYCA 5KTEL 2Y25A 3QEQD 1BQSA 1G6VK 2AK4A 1QG3A 3QFJA 4BFNA 1MCOL 1AGFB 2F19H 4K8RC 4L8SB 1DO5A 3PWLA 5TE6L 1F13A 1JGVH 3N44B 4PW3A 3PAZA 3BIKA 1XB6A 1DQDL 4WK0B 4KRLB 3CZFA 3C5ZC 3I74A 4LGRB 3WJJA 5FFLA 3TFKD 5EO0B 5LLIC 2D3VA 2P45B 4PJEF 2EECA 3CBKB 4HPHA 4OB5H 2DIBA 3ILPA 1TEYA 1W16A 1OGAA 3I2CH 5EBLB 3HPJA 1FZKA 2JV6A 3V4VL 3EFFB 1M53A 5D1QC 4Y2DC 2KLTA 3I6LE 4KKLC 5GRJH 1KCVH 3D3VE 4N0YH 4NUQA 3TONA 2JTDA 3ZE0E 5GS2H 3BD5A 5E6YA 1KJ2B 3FQNB 5EOQL 4DO6A 4Y7OC 1HOCA 3O8XA 3IXAB 3C60A 3KL3A 2EDNA 1BZDA 1DL7H 5IREA 1MFVA 3FQRB 4P5SA 4AXWA 5D9SB 3M88A 5D96C 1VEMA 1A1MA 3MLYH 2XFXA 1P6AB 3D39A 1IZJA 4RRPA 1U8JA 2C4FU 1UT2A 2YPKB 4HZ1A 4N26A 2HVJB 2XN9D 2IH9A 4PJDE 4PS8A 5LUMA 3CIQA 3GBNL 3CVHL 1CFSA 4FXKC 2BOLA 4GAJH 1K3IA 4ZMTA 1OGAB 4UTBL 3ARBB 1F4XL 3VWJD 3CHPA 1XGRA 3HNSL 1A9BA 5IFHH 4WENB 2ZX7A 3W0WA 4HQQL 5D2NA 1J8KA 1MY5A 1TMCB 2GQHA 3E3QC 1OP4A 4JKPL 4PHZA 2XWTB 1XH0A 4X0KB 4HVBA 3TP4A 3QFDA 2AFNA 3LXUX 1OCRB 4MHHI 1IAOA 3QISA 4TTDD 2YAEA 3DX1A 1FHNA 2C3VB 4XPFH 1A9EB 4Y19A 5FYJU 5A2JH 1GYCA 3GSVB 3T0EE 1LE5A 1DQMH 2VO8A 4ODUB 3KYOA 5ANMB 1E2VA 2SEBB 5MI0C 1FCGA 4L48A 3HZKB 5ID1B 2WPGA 1C12A 4QHLA 1UACL 5FR3A 1CD1A 3TTYA 3FFCA 1SN5A 2UXVA 4F1ZA 4GQZA 4JPWH 2ZZUT 3ZZSA 4EI6B 4F8TA 3H2WA 3QBTB 4R2GC 5EF3A 4G1EB 4CMMA 1TCRA 4LLDA 3CFEB 2HYMA 1S5HB 1ZHLB 3HI5L 1SFHA 4HCFA 4LBEB 1FJ1A 5F71A 4RMVA 3UGUA 1W6WA 4BZ2H 2XPGB 4MKMA 4ZNEE 1A3RL 5F6IC 3V5DB 4E9VA 1NGYA 2D2OA 1JF1B 2DLFH 4WFED 5GGSA 4C4BA 4LEOA 2VLKB 4AZUA 1JPST 5AW8B 5IHLB 1IGTB 3APFA 3JV4B 1MPAL 2I5YL 3C60C 4YDNA 3QDJD 3E8VA 2QQQA 4O51A 4PN6A 1JYXA 3S35X 4OY9A 2PP9A 4IOFC 3VWKA 3C60D 3RVUC 4YXHL 1YMME 1L3NA 5IMKA 4KI5C 4PP1D 4P2OD 1FCCA 2WP3O 5CIPH 4MD0B 3CHXA 3IXTB 4MNHB 3ZRCC 4LLUB 1JGDB 1OM3H 5EEUA 4HIIA 1MN4A 1ZHKA 3NJMA 4TVPL 4ZYKA 2PABA 2K4AA 3K71B 1T0MB 1JHTB 1JOIA 5DMIL 3CVDA 1E8YA 2NXYC 3NCEB 4TUKL 1OY3B 3BDBA 3GSOA 2OMWB 1CDHA 4LEXH 4YN3A 1TT6A 4FYSA 4ODUA 4JGNA 4AQOA 1N64H 1BGXL 1N8OE 1BFTA 1JPTL 1O7VA 1ODAA 3ARFC 1NGPL 4I48B 4U6YB 5D7KD 3RTQD 3RY6A 5JXEC 3AADB 3VWJC 3MKKA 4MASA 5TFSH 2D9CA 2XKSA 4PGEB 5I6LA 3QSKB 5H35B 3V0VA 4EXPX 3KW8A 4Y5XA 4UTAL 5L7XH 4H0HB 4MAZA 5D4JA 4ZUVB 5IB5B 5CCGE 3IDXL 4ZO7A 5CWSB 4BD4A 5EZJA 5CD5C 3OSVA 3A67L 5FOBA 1DJWA 4HA1A 2BP8B 2DYSB 5DLLA 5I6MA 3HG1D 5ETUB 2WWNA 5KYWB 3A6BH 2BSSB 5KSUB 5FO8A 3LZLA 1HX0A 2Z8SA 5AOIA 2FL5A 2ZIDA 3TF7C 3GIZH 4PJGF 5F7HA 3U0PB 3L1OH 2DM7A 1A7QL 1ID5I 2XDHA 3ECBB 5KSVB 3U83A 4OZHB 1DQKA 3NRQA 1FFTB 3MTRA 1E2WA 1S7QA 2G3ZA 4AQ1A 2BPBA 5ITFB 3T2OA 2JB6A 2HVKA 2ITDA 2Y6SC 4HSAC 2IDFA 1NCIA 2H3NB 2XXFA 4YBHA 3ZE1F 3ZE1E 3VG0L 4P3CH 3PL6D 4AV5A 2VDKB 2XA8L 4FZ8L 5HGAB 2CLVA 2V5MA 1QPXA 1OK8A 4P46A 3REVB 4N0RA 5SV4A 1KTDB 3N43B 2I60H 4F3FA 2H26A 4NKOA 1O75A 4JO8A 4ECNA 5E2TH 3R7RA 1SUJA 3BAEL 3NJIA 1ZTXL 3MUUA 4YMPA 5IGXL 1TTRA 3D25B 5C0CE 3FUNA 2BIQA 2VN7A 5E6ID 1RZPA 3C5ZD 3VYPA 4IMKC 4WFFE 1WAAA 1D9KC 4FFWD 3A4AA 1D5IL 2UV3A 3X1FA 5DFTA 3QIBC 2X2YA 4Y2OA 1G9EA 2AKRB 1NMBL 4PGZA 5C09D 4G42A 2VE6B 5EORH 2C3HA 4NNYA 4Z7OB 3FONB 1BFVH 4S1SH 2E7LC 4Z7WB 3G6AA 2DQJH 3QNYA 1T2JA 5AW2B 5BZWA 3SYAA 1AI1L 1D5MB 2H8PA 2LFGA 2A99A 2EE3A 2B4CC 4PWFA 1BIIA 4S0HA 4FQ1H 4TVSa 4W4OA 4MA3A 1YDPA 4AENA 1X5MA 1BLNA 5DD1H 2DQTH 2IAMD 5J13B 5T5FH 2ED8A 2JIXD 3R4RA 3VWKD 1V3JA 2FNBA 1DVFA 5D70H 1D7DA 2E3VA 2IOIA 3GS4A 3K46A 1UT9A 2UWEE 4U0QB 3ZZLA 3BT0A 1CF1A 4AT6B 1P6FA 5DJCA 1I85C 4M61A 2ZF8A 4GQ9L 4RCAA 3W9DA 2NY3C 4H20H 2NXZC 2IDQA 5BVPH 5JZ7D 3K6OA 1XR9B 3P77A 1ROCA 4W9GC 3HZVA 2VDRH 2ILLA 2YXWA 3KM1A 4N87A 2X05A 5DO2C 4UZUA 4UTBA 1U3NA 1A7QH 5B3JF 3Q8CA 2EC8A 1QX1A 4XOEA 1KUMA 3MNMA 3OD3A 1AQ8A 4I0PD 1AG6A 4OTXL 4IOIA 2BOBB 5IJVB 1RIHL 3GINA 1I9RL 1KMGA 4MGXA 4MMXC 5T1DL 1I9JL 4PM1A 2DQHH 4NSKA 3RL2B 5DHDA 3LQAL 2KS0A 4JDEB 1U3HA 1NFDA 3FOLB 3DVGB 4CBPA 4JKNA 4Y19D 4ONOA 3L13A 1D5BB 3RNQB 1P1ZA 1UXSB 3ARDB 4Z7WE 4UWQB 1QNZL 3TEXA 1TO5A 4YR6A 4Q52A 2NNFA 1GPOH 1T5KA 4D9RD 2WWMD 4WWKD 4PJXE 4KJWD 2WO4A 1I1AA 4JE4B 4J8RA 2O93L 2TRYA 4A2DA 3LRGA 1PDKB 4U1LA 5E9DB 4G6AC 3D30A 5D7HA 1CXFA 3HUJA 3FT2A 2GBAA 4R7LA 3QUGA 3KMDA 1TU2A 4GXFA 2ENPA 5D5ME 3X1EA 4ZXBA 4GG8B 3IMRA 3FPXA 1L0YA 1OAZL 1DVFC 1XQ4A 3H3KA 4ZPTA 4XVOA 3HR5B 5I9QC 3FYIB 3ET9F 4I77H 5KUMA 3Q6GL 1DVFD 1IC5H 2WINB 1T4WA 1A8JH 1RIUH 1JV5A 3ZRFC 5CJXA 2EXTA 2H2SC 3CZKA 4L8CA 5DU7A 5H37G 3O3UN 4N1EA 3PQYB 2RIKA 3A21A 3LEVL 2PW2A 4IBSA 5DVMA 1U8IB 3BPLC 4Q9RL 3OMZA 1RJYB 1JUFA 3TN0B 1QWHA 4X4ZA 1E90A 5BRZB 1S7SB 1J88A 1U8PB 3UP1A 5CBAB 4ZFZB 2GBTA 2K9UA 4PGJA 3BRGC 4PVMA 3BZ4B 1Z5YD 2WC7A 3BESR 1FORL 2QSQA 3O2DL 5CEYB 4MLIA 2GIYA 3GSWA 1QHOA 4PRPD 1RUQH 1AH1A 3ETTA 1H6EA 1U58B 2NY4B 1ZSDB 1KTDA 4HKXA 4LHUG 4JLRA 2TSAA 5JW3L 1M9WA 4ODHH 1CLOL 3MNWA 1T4KB 1JIBA 2E8ZA 3VUAA 2VXQA 5EC2B 5ISZA 3ULVE 3SOBL 1K9TA 2P52A 4PV8A 1ORSB 3OQ3B 3TJPA 3LH9A 4IJ3B 3QH3B 4YPGB 2E9IA 1UWXK 3HMXL 2FBJH 4GMSH 4U1MA 4FADA 2HH0L 3G5ZB 4LIQE 3X14A 4KGJA 1TU2B 2J8UA 2Y7NA 2AJZA 2F1AA 3G5VA 4J7RA 3ROLB 5CINH 2QDVA 4JRXA 5DJ0B 4ELKB 4E0RB 2ZCKH 4KK8D 1WA1X 4G8EB 4PW9A 1INDL 1ETZB 3AG3B 5KW9L 5F1SA 2OMUB 1UCBH 1JWMA 1KCSL 4KK6D 1JCVA 4ZQKB 1MNNA 4OGAC 5DZLA 3RNQA 1BQUA 3V8OA 4GO6B 5LN8A 3BZEB 5BZZA 9CGTA 4ANUA 4IHBA 3UZVA 4L8BA 1U3HB 1DP0A 4DN4H 1S7XB 1YYMH 3LS4L 4RX4A 3MRGA 2QJDA 5EOQH 3U36B 3ESUF 4M3HA 3OXRA 3GMPA 4M48L 4ZMWA 3TV3H 4IBVA 5ADPH 2EE0A 2F58H 2VERA 1DCLA 1X5JA 3JTTA 1BBDH 4H8WL 1FSKB 1PNCA 1PG7H 4NBXB 4WEBL 3RUGF 5F9OL 5C3LD 3UBXG 1FL6B 2YD7A 4U6VL 5HYIA 4HBQA 2FZ3B 3MRFA 4LKCB 2BMKA 1IEBA 3ABZA 3EGSA 1NINA 2G4GA 1YPZF 5DJ6A 5HGGS 3FFDB 3IDJA 3HUJB 4X8CA 1FN4B 1PAZA 3OVUB 2HX7A 4XVUD 4PJ8A 2K3HA 4ZTOL 1ADQH 1PZBA 3FCTA 4BFOA 2Z0BA 1TQSA 2BHZA 3C2AL 3AXLA 1A1OB 5I8OH 4FTVB 4IDJH 4Q14A 1CE6B 1WG3A 4RGMC 1GR7A 5K93A 3TEUA 4PJIB 4C56B 1SRDA 3T4YA 2JKXA 5B22A 5GZND 3U9PH 1QSED 1ETJA 1G7QA 2ZF9A 4WUUE 4UV4H 4MFHA 4PLKD 5GRUH 3CK0L 1QR1A 1OB0A 2PW1B 4KXZI 3IT8D 5ACZB 1KFAL 3ULUH 5HDLA 4I3SH 1BD2D 5KOMC 4Z1PA 2CGRL 5ECGA 4DW2H 2UYLB 4MJ6B 5SWQB 5ERWA 5AVUB 4GUPA 3FULA 2EYSA 2OMZB 5KJRL 1EHNA 3F62A 5CGYC 5E4IA 3KR3L 3PDOB 3U6RA 4LU5H 4A6YA 5CEYA 1RZGA 5E94B 4Y9CA 4ZZFA 2F2HA 4UCFA 1SDDA 2XWEA 1JI1A 4YL9A 5EEWA 4XCEA 1CVSC 5H37A 2E8YA 3U0TA 4TVUA 5MEQB 3IMBA 3L5XH 4NJ9H 3JTBA 2XV3A 2Q87A 3PWNA 4BYHA 4UB0L 4OV6F 2D31B 4LHQB 4U0RC 2DLEA 3DV4A 2BP5M 3G5XB 3IB4A 2AJVH 4ZTPL 1XCTB 5EA0L 4LCWB 4LF3B 5IV2B 2A6DA 2ZX6A 7TAAA 2Q0ZX 1AR2A 2YLKA 5B1CA 1UM6H 2AAVA 3QXAA 3G5ZA 4DTGL 4HWBL 5I23A 1JPFA 3SYQA 4NHCH 1AQHA 1NA8A 1I4FB 3MJ7A 3SPIA 4E0RA 5FKAB 2QSTA 4BSWB 1FG9C 32C2A 1ZA3A 5JXAL 4G1MA 3ULUF 4QIRA 4TXVB 1QI5A 2FWOA 3B5HA 1FIGH 1TJGH 3FU3A 4JRYB 1JDAA 4QRTA 5J5EA 3MNVA 3ZHDA 2OAAA 5CSZB 1IKFH 2NZ9D 5BV7C 4KUCD 5CEXB 3JV0A 2YMOA 3P73B 1QRKA 1XCTA 3C5SB 3EBIA 3IFPA 4YDJB 1ET5A 3FUDA 1T6BX 3MA7A 3QXUA 5AL8A 4HKXB 5IVOA 1TSRA 2DYRB 4WIQA 3WY1A 3BQUC 2ED6A 4FG2A 4R4BB 1MI5A 4G6KL 4MJ5B 4KX7A 3R0MA 1ZEAH 4LDCA 4LSUH 4KZEL 3EJUA 3VXUB 4QXTB 5HSFA 3CVBA 4HCRH 2I9TB 4DN4L 1PF3A 4HEMA 4XPGH 5E8PB 4NZFA 4AQEB 3ZL2A 2H1XA 5T5FA 1DBJH 2GJJA 1A65A 2EJ1A 3IDMB 4ZMXA 1U93A 4RNRB 2E4TA 2G0KA 3J07A 2HP4A 1AKJA 3MXWL 4LVOC 4Q4EA 4XWOC 4IBZA 4Z7UF 1R5VA 4NPKA 5J6HA 4F58H 1DN0B 2I9LB 4QEGA 4JG5A 1K5WA 3GSQA 3K81A 5I24A 4XP1H 4KZEH 5B21A 2ITCB 1U8HB 3IFPB 1EUUA 1GOGA 1F1DA 1H5BB 2BHYA 3BPCA 1JI2A 3SKMA 3AG2B 2WXFA 2HH0H 4R2GB 3WFBL 1GZHC 5ID0A 4K7PY 4JY4A 1MH5A 2OMVA 1G9ML 1NBCA 2SODB 2YAOA 3K2UH 5IY5B 5JHDD 1LQBC 5B38G 3PJNA 3FOMA 5I1HL 1NCNA 3QEUB 4JFXA 4K8RH 3T0WA 4HMCA 4CDHA 2LTQC 2QQKH 3WLBB 3CZNA 3P0VH 3VFPA 2O4EA 5F6IB 4URKA 5E2UH 1FAIL 1UA6L 2JCCE 3NACH 4JZNA 1YMHA 5TGBB 1YNLH 3H6JA 4N5ED 4R0LB 5SWSA 5AB0A 3BH9A 5LCVL 3QPXH 4F8OA 1JGIA 3DVFA 3ERXA 5DWUL 2EYRA 2K7QA 3CGTA 3RIKA 2XTJC 5AW5B 3II3A 3ETBF 1WITA 4YWGH 3BP6A 4DP5X 2GAZB 4UQBA 3F7VB 3DNKA 1YEIL 1CFNA 4HWBH 3QJHA 2NYYC 4XAWH 5C0DB 4DKTA 1CICA 4KROB 3C5XA 1FBIL 1R34A 1TJIL 2NR6C 4H40A 1S7SA 4DP2X 5FAAA 3ZKMC 4BBWA 3NIDE 4QXGH 3S8GB 3MBXL 1EAJA 1QWUA 1WK0A 2E86A 2W60A 3ISRA 2QHLA 1VFOA 5DS1A 3P30H 4P2OA 3G5YB 3HZKA 5ID1A 2DLHA 3NUKA 3ZXAC 1N18A 2C7FA 1JV2B 4I9WE 1TJHL 1GAFH 1S8DB 5E6IC 4MXVF 3NCJH 3QUKA 2QGBA 2ERJC 4NX0A 3VXSA 2R0WL 3C09C 3MV9E 5DURB 2X4NB 2WBJD 1I8UA 4M02A 1WWCA 3C5JA 4QRUB 2R15A 3DK0A 3OKDB 3RUGB 3GRBA 4XC1L 4EQ2A 4AQ8A 5JNYB 2EKJA 1LDPL 5D1XB 3P40A 2I07A 3BDYL 3DK2A 3KPQB 4LK4A 4OCWL 3HZMB 4HS3A 2AJZB 4ILDA 1Q0EA 1AGDB 2A6KA 2GFBA 4WI0A 3BUIA 2W9DH 4P9HC 3DUUA 4JHZA 2X6CA 4IS6A 5D96B 3A6CL 3UAJD 4BH7A 5BZDA 3I9AA 3CN4A 4M5YH 1J48A 5IQMA 3DBSA 3EGXA 2FT6A 4K23L 4AT6A 3CFEA 3K8MA 1AZRA 3L7EA 3SE4A 4ZG1A 2NX5B 4ZQTA 1URLA 4G3YL 2YHGA 3LRMA 3IGKA 1BLIA 1GGCL 4YGAB 2BNQD 2M2DA 1ZT4A 4Q97A 4QRRB 5C9JB 3QQ9C 5FYKH 1ZLSH 4U3HA 3QG7L 4Y1AD 5EZIH 4ZFFB 4PCTA 5GGVL 1IE5A 1HHGB 3WXWH 3ALWA 2O5XH 2Y06L 3JYBA 1H5BA 1IC4H 4LARH 3AQYA 4HMEA 2ZOLB 1T1XB 4LO9A 1UXWB 1QLFB 1AO7D 1NFIB 1Q72L 4S1QL 1HI6B 1PZ2A 4F33A 4PYGA 1HU8A 1JF5A 5DYOA 5E7BA 3KLHC 1G1OA 4KTEH 4JW3A 3TCXA 3TBBA 3HI1B 5E4OA 1QI4A 2ROYA 3BAYA 3UTPD 2JCCA 4M4RB 4BXSV 4BQ9A 4XCFL 1A9BB 4P5KA 3BIKB 4J12A 2AHIA 1RSYA 5MEPB 2ADYA 1Z1WA 1DUYB 5E9DD 2HFFB 3OKOA 4UT6H 2OMWA 1B9ZA 3WJLA 3M8OL 3IDNB 5DVNA 1WAPA 5CZVH 4HLZG 4PJ9C 5F96L 4PY7B 1IM3B 1X4ZA 4K94H 5LGJB 2VITB 4MNHA 4XCFH 1G0YR 2FDBP 1ND0A 3WFHA 1Z9MA 2ICEB 2VZ3A 3S88L 1ZPUA 4MDIA 4KTEL 2QR0B 5EUOB 3U4BH 3QIBD 1S9WA 1QMUA 1Z9OA 5AZEL 4JUTA 4B50A 1J1OL 2YD8A 4DP4X 2JB5H 5KYWA 4GEIA 4OCLC 3D4ZA 4OZHA 3LX9A 3MOBL 1PKOA 2MCMA 1P9MA 4DGYL 2MHAA 4LSVH 3QORB 1ZAGA 2NY3B 1LO0L 1KN4H 4H88H 1EMTL 4OAWB 1JRHL 2P5EE 1L5GB 1TZHA 3KGTA 2PCXA 1SYSA 5JW3H 5ETUA 4HD9A 5DD6B 1CXLA 1UFGA 5IF0B 5SWZD 3LCYA 43CAB 1RUQL 1IJ9A 4BFKA 2X0VA 4IIQA 3A47A 3ZQXA 5KYYA 1BREA 4IW4C 4JO3H 1KJ2H 3BAEH 5ICUA 4FABL 1PYWB 3CFKA 1MDAA 3MRQA 4X7SH 4D0DB 3UZQB 3FB8B 4JFFA 4JRLA 5TTRA 3WHE0 1F86A 4X5XA 3BKCL 3NABH 3DKHA 3BKMH 3UTTA 5JHMA 4N2FA 5F93C 1MAMH 3CDFA 4DGWC 4PWEA 1E6OH 4LESA 5H8DA 1YY8A 1JHTA 4UZSA 2YGQA 1SHWA 2A74C 3D85B 4ZFFA 1I8IA 3FB7A 5GZOD 4NI3A 3KLHD 3ARDC 1R3HB 1E30A 5KVGH 3X13B 2COVD 4Z7UE 3IFLL 3DX0A 3MROA 1HXYA 3O9WA 2A7BA 4LIQL 4UQCA 1FV1A 4KKAD 3HI6H 2OTUA 4HGWB 3N1FC 1V7NH 2KLRA 2DI7A 5FYLH 4BJLA 1IBBA 5I73C 4HXBH 3EFOB 3RGVD 4ISVA 1RZJH 5C0RL 2PWDA 5D7JA 3DROB 3PREA 2Y7MA 1TTCA 1UXLA 1NGYB 3UDWA 3PHOA 1EUTA 4HUUA 1D6VL 1RUPH 3HC4L 5DJ8B 1VACB 2X4PB 1KBBA 5EDSA 1OP3K 2JXMB 1KBPA 3RG1C 2NNXA 2FHCA 3NFSH 1DQTA 3M07A 4KI5F 2C3WA 3OX8A 4XH2B 4DK3A 2KMWA 2XN0A 1LO2H 2CIIA 4TL5A 3RKPA 1BGXH 2H0JA 3RVTD 3RI5K 1AKJB 1ET8A 1HH6B 3FFCB 1DJXA 4HK0A 1NH6A 4C59B 4WHTB 2X70A 4G2AA 2NUPB 3MMEB 3POHA 4JPSA 5I1HH 5IVXA 1U36A 4CVZA 3OJDA 3UOAB 1JGEB 4RZCA 2XC8A 4NWTH 1CVRA 2DQHL 3CAFA 3QR1A 2C5DC 4HUVB 2PWEA 1BOYA 5IVNA 1KGCD 5HDBE 3V4UL 3QQDB 2N1TE 1EMTH 1P7KA 3HZVB 2RTTA 2YIHA 3IDGB 1ROWA 2VYRE 3NOIA 4WFGE 2EO9A 2CU9A 5CJXC 5CGTA 3CV5A 3GJFA 4TVPE 4W81A 2C4FT 2CIIB 2Y3AA 3QW9A 2RCSH 3P4OA 3N1PC 4FNQA 5DQ9B 4BFIB 1LK3H 4Z3TA 2QELA 1A7OL 3IF1A 2CZNA 4MAYD 4HCRL 3S88H 5E2TL 5T8IA 5FUCC 2K7PA 4X80L 5AG8A 4I1NB 1MCWM 4IRZL 4AY0A 2A1WH 2FO1A 5KSBA 3BKYL 2DQUH 4GYBA 1XGTA 1QOKA 2I60L 1BIIB 2BSSA 4WRLA 4X4KA 5KSUA 4J2QA 1ZS2A 2DQFA 4E9YA 4EIBA 5KVEL 1SXAA 1CGWA 4AKQA 1U8CB 3N0AA 4P4KB 5F7DA 3WNJA 4D3CH 2VDPL 1WVZA 1A7OH 3PFUA 1OQXA 4X9IA 4R8WH 1GS7A 3RGVC 4PJ5D 4X4XA 3HUJE 1IM3A 4DVRH 4OZFA 5LGJA 2HWZL 4Z3FA 3M45A 4PJDA 2E9WA 4JFSA 4UYPA 5HHNA 4U1KB 2QLYA 2R7EB 2GJZA 1C16B 1BFVL 1IGFL 4IGBC 5TDOB 3SYCA 2PUQT 4FP8L 1HHKB 1FNHA 4ZDHB 4DGYH 3FTGB 3FSOA 5AW9B 2YGOA 4NHUA 1JFQL 2PYFB 5C0GA 4AV4A 2VLRE 1S9YA 5E4AA 3M1BB 4LRIC 3QUHA 1NJ9B 5JW4R 4HS8H 2EEDA 3HG3A 3F01A 5EZIL 3CDYA 2AEPL 3JVFC 3I50H 1JF6A 1QLEH 4XMPH 5AL0A 3ZO0A 1SEBA 3V4VB 1FVDB 4KO6A 2IO5A 3OSKA 1QACA 4OF0A 3QI9B 3WIAA 1MCRA 4ZXBC 1KC5L 4XNZB 3ZZQA 3EO1B 5C2BH 1PLBA 1UB5A 3K8LA 4QKTA 2J1KA 1OOWA 3SSGA 4XNMA 1RLBA 4ELMB 4XI5D 4XB8A 4IEFA 4QOKD 4FMVA 1C5BH 3O6LL 4PJBF 5L88H 1SXSA 2MKWA 4GMTL 1Z9PA 1G6RH 2FX9L 2BP8A 2GHZA 4LPVA 2O5NA 4GW5A 3VXUD 4C57C 4JHAL 2QHRH 5E4EB 3MBEB 3FQTA 5C0RH 3OB0H 2KPWA 3X3GH 4XXCC 1CD8A 4L0YA 3MR9B 5C86A 5IHBA 5FUOL 5D6DC 4HKZA 1NGXA 1FE8H 3V0IA 3VFGH 1AO7A 3AT9A 1EJFA 3CMOH 3GIVB 3MROB 3O9WB 3WJMA 2V5SA 1F4WL 2R2BA 4ODBD 3GNML 2XWJA 1OKEA 4L4TD 2EXWD 1C5DB 1E6OL 2FATH 3T1WA 1A6UH 4MWFA 4R90H 2OMXB 5IQ7H 4ZO8A 1L9OA 1OANA 4QRQA 3MGOB 1N64L 4MD0A 4L8BB 4E42B 4X6EA 5I75B 4IRJB 4EVNB 3QR0A 1MJJB 4HHAA 4K4KA 1CT8B 2AC0A 1SBBA 5FUOH 1XSKA 3EF4A 3CFDB 1MQKL 1S7VA 4MJIE 4U6VH 2MNJB 2BVQB 4ONGH 3M7OA 4O02A 2OM5A 2EDWA 4V2CB 4TUOA 4WSJA 1N10A 4KK9D 1MVUB 3LZPA 4RH4A 5JA8B 1R3IL 5KYXB 3KPPA 4O2FB 1ES0A 5INCB 5BQ7B 1UH2A 1MIMH 2VDLH 3KPTA 4NDMB 4H88L 2XBDA 1RAMA 4PLJD 2PWFA 1OCOB 4CVXA 1M7DA 5BS0A 4Z7NB 4W9HC 1X5HA 4R4FH 4GUQA 1UZ6E 1J8SA 3B5TA 3T8XB 4L1LA 1F3DJ 3BCFA 3HNSH 2Y07H 1IFGA 2WTRA 1U0QA 3DMMD 1P7BA 4G7QB 8PAZA 3MNWB 4RVBA 3F7YA 1LEGA 1P1VA 2CLRA 2FZ3A 3MRFB 1NWPA 5CLZA 3ZKXC 1N6QH 4XMLL 3RILA 4F8QA 1ML0A 1DVQA 3ZHFA 4S0TD 4AYBA 2ARJB 4NPJA 4GS7C 5ITBH 1ADQA 4CDGC 5F96H 2H2PD 3C6LC 4X5XB 4ZD3H 4PP1C 3MRJB 1KPUA 1XH1A 1LK2A 3LQZA 1K5NA 1OF2B 2BIPA 4P2RA 2P24A 4JZOA 4P2OB 4ATWA 1IL1B 3FQYA 5E95B 5D1XD 3KW7A 3P4MB 1CLOH 1BQKA 3ZKMD 1WFMA 5E2UL 2OYKA 3BZEA 3FU0A 5EEVA 2IXQB 4NNXB 4G70B 4QRPE 3MAWA 3U7WH 5F7LB 5FS5A 5ALCH 4XODA 5AALA 4Z5RB 5GPRA 4MZ2A 4R7NB 1EWHA 5FM5O 3ZE0F 2Z3FA 4AGMA 2G0LA 4M9OA 1F00I 4IKKA 5CJOL 1BXUA 1KXVC 2YXFA 4JCMA 3JT0A 1K3ZA 4CADA 2DQUL 2Y06H 1VA9A 3LQMA 2HVKB 2WLIA 3FQTB 4JFHE 3R1GL 5L8LB 4LEEA 4B9CA 1XMWA 4QHKI 1MVYA 1YUKB 3FSVA 3ZMNA 2Q7YB 5D1ZB 2BP3A 4D9RE 1R5WA 4WI5A 1TQBB 3DDGA 4CJ0A 3SDDB 4OIBA 2XTJE 4YVNA 1RERA 5ICYA 4EXKA 1PU0A 4G7YH 1HJBC 4H8QA 3CVIH 5BO1H 3VSVA 4AEEA 3A6CH 3SDCA 3LDBB 1N59A 1NBZA 2X0WA 3C8DA 3VD7A 1K4DB 3VFVB 2GKIA 5HGBA 3MLVL 1HQRA 4UQ9A 2A74A 3SDXF 3V4VA 2LW3A 3H9YA 3NYKA 2CKBB 4NJ9L 4WI4A 2FYVA 1RIVL 5JTWA 4XBMA 1MCKA 1XD0A 3MUGB 4K3GA 2DBLH 3OWEA 4KJQD 1WP6A 4P9HL 4X5WA 4OZGA 3S5LA 5C0EA 1NC4D 4P2RB 1IGCL 1IAKB 4OI8A 3SGDH 5F7UA 1ZGLP 1MCPL 5D93C 2CBOA 2DTMH 1BA9A 5HYSG 3GI9H 3TYGH 5DUMH 3OPZL 2J25A 3P30L 4M1DL 2Y36H 3QPQD 4U0RB 4L4VD 2AXJA 3FRPB 1UGKA 2JQZA 2NQDA 5C0JB 4HIIB 1IQWH 4MD5A 2FYYB 4LPYA 3IFOA 5LWYL 3N40P 1S5IH 4JN2A 3MA7B 2V0AA 3NFSL 2XY2A 1TFPA 1R3LA 1IBGL 2G5RA 2P80A 2YJQA 4K3HA 2VN4A 3WUZA 5BV7L 1FWXA 2QFPA 3IAPA 1X7TA 5GS0D 3T3PF 3U2SB 5IVXF 1CDIA 4EDXA 4XP6H 4WY7H 3KS0J 5I5JA 2WWKT 1LM8V 4WGWB 3LOWA 4PJ9D 1NCUA 3JWOH 3IGFA 5I1AA 3L5IA 1G0XA 4DERA 3CQQA 3KHQA 1XF5B 5EBWB 1D5ZA 1CC3A 3NFPA 4UQAA 1S7WB 2FAUA 4GMTH 4N9GA 5ACMA 4TSCL 4NZ8A 1T89A 3FCTB 2IAMB 1MCPH 3AXLB 3B37A 5CUSL 1UATA 2V6HA 4UV7H 4F2MA 1XR8B 5GJSH 1XIWD 1S7VB 4BQ8A 5KJ7E 5ECJE 3DOSA 2G60L 2JJVA 3S3JA 3FFCE 3KJ4C 4P3DA 1NKGA 5JYMA 1XBRA 5HHOA 2IG2L 1SDYA 1YEHH 1XB3A 1SYVA 5CAYB 4HEME 1CLZH 3K4ZA 1U95B 4M6OL 4S1RH 1BJ1J 2VDKH 3WMQA 1KBGL 1KPRA 1W72B 3CFUA 3VXQB 4AYGA 5DJXA 2QMJA 3SDYL 4LVOB 4JM0A 1ADWA 2B15A 1J9TA 2WKOF 1QFPA 1T7YA 1ZVNA 1E4XH 4A7GF 5HI4C 2O61B 1CGSH 1PX3A 3BGFB 3VWJA 1NLBL 2FGZA 2ADIA 3P3RA 1U91B 5I6KA 4R4BA 4UU9B 2XSKA 1H5BC 2FEEL 4OF5A 2OTWB 3ULSB 1DANT 4QLRA 1AYRA 4TQHA 1GCFA 3X3FH 1AGCA 3W0WE 2WAQA 3CQFA 4J6RH 3FO1B 1QKZL 1T83A 4NN6C 3RQ3A 3WIFA 4FLSA 3PV6A 4GAYB 2YBRB 3WNLA 2AITA 2Y0SA 3U4EB 1G7HA 3G04A 3HPLB 4LLVA 4KJWC 4I4WA 4PTUA 5HPOA 2AAAA 3GZPA 4EKXA 1WBXB 3O8XC 2BVEA 3F58L 3LMJH 4G6FB 2P3YA 4LP4A 4X9GA 3LVEA 4PJBA 4WEMB 4G9DB 4XT1C 2X2JA 4PJ8B 4I1RA 4MCMA 5FO7B 3P9WB 2K78A 1KDJA 2X4QA 3RY4A 3QO1A 3B7YA 5KBPA 5FEBA 3HN8A 5IG7B 3IJHB 3QJFB 1WFIA 5H35A 1KCSH 3HE6A 5F9WC 5F88B 5HJGA 1E6JL 4PJ5A 4UM8A 5I66B 1BXVA 3A4DA 3LEVH 4UDUA 4Y5YB 4JPIB 1FZJB 1KB5L 3KYNA 2IEPA 1E5CA 3RVTC 2XPZA 1RQ5A 2N59A 3IJEB 2VXQH 3PQYD 2QSCL 4ODVL 1J8HA 3RI5F 2IPTL 4ZUUA 5JIMA 4NT6A 2A74B 1R3IH 1Z2KA 4NRYB 1J0JA 1GGCH 4EI0A 3EYFA 1ZJAA 1S7QB 4YQXL 3FKUS 1FFQA 2GPZA 4GRWB 4X6CA 3VU1A 3SE9L 2CK2A 4P4KD 5HI4D 3K6SB 4M5YL 1FH5L 3S3BB 2HT2D 1KCUL 1U8QA 4YSAA 2FX8H 1BFOA 4NKDB 4NQSA 5ESAA 3HG0A 1BX2A 1M9SA 5CP7B 3BAWA 4IKNA 5HGHB 4LVHB 1D6VH 5KSBF 1KJ2A 2W0PA 2G75B 5IK3B 2QR0A 3NJVA 1ZDSA 4MMYA 1KBVA 1PFCA 4J8RB 5T3ZD 5T3XE 5L0QB 5FKAA 1U30A 2AXFB 2DPKA 3HMWH 5D7JD 3NIFF 4KUZL 1TJHH 4M5ZH 5T1KA 4OJCA 5LJYH 3K5RA 4WW2F 1F18A 1SMOA 5CU5A 2OQJA 1PSKH 4YXKL 2C34A 1YQ2A 3K8KA 3TBYA 1I75A 4XN9A 1H3TA 3DWTA 3V5HB 4J1UB 1KWKA 3QZBA 3P3TA 2WOYA 3SBWA 1CI3M 4GRLC 4X6DA 2XI9A 4U1IB 1AE6L 2X88A 4ODWA 1L9RA 1V54B 1G6RL 4X6DF 3VXNB 2PXYB 1KIQB 3BKCH 3V6FB 4ZUSA 1LO4H 3AM8C 5IMLB 3UTTD 1YEIH 5JW5A 5GSRA 3P2TA 3IETA 1I3GH 4D9LH 3FRUB 5BVPL 4QRPD 2BCKB 1CFBA 3P0YL 1QTSA 2VISA 4M7JH 1F42A 1TZIA 4KO7A 5ICXB 3JV4A 1YHPA 1GYAA 5HHOB 5T1MB 5I76A 3WTSA 1YN6A 3PS6A 2Y9RT 3MLWL 3RDTD 4EZKA 1CGTA 1QLEL 2YRPA 5KW9H 4RIRB 2EE6A 4X5LA 5ESAB 2GTZB 4LP8A 3K2UL 4PJ7B 1J7VR 4PVNA 4LSVL 1F97A 5DJ8A 3VAEA 3KYKH 1E27B 1LDSA 3HZMA 4HS3B 5T1DH 2VQUA 2Z91A 1X7SA 2YQBA 3LKSB 2MTPA 3C6EA 3TPUA 3TZVD 2LE9A 3V6OC 5T3ZH 4AV0A 1J8HE 2WLNA 3S5ZA 2BH0A 2P5WB 1DVTA 2VDMB 2APFA 3DXAB 3L9EA 3PFQA 1SJHB 4MXWH 5LBSL 5I1IH 1CFQB 3VMPA 3S35H 4IRJD 2P8LA 3NCWA 4DVRL 1IBYA 2P5EA 2XIIA 4OI9A 1VSCA 2DIEA 3U2IA 3V6BR 2XBZA 3CSBA 1PCSA 2ATKA 4PY8I 5GRYA 4I3GA 3UABA 4Z7VE 2OSYA 3VD5A 3QWRD 3U0WL 3VFSA 4JRXE 4XMXA 5ISZE 2DQDH 1AGBB 2F74B 1EO5A 4HWEH 3RPIA 2A9ML 3BD3A 4BE5A 2KDYA 4P2QE 4WHCA 2XA8H 12E8L 2L0DA 1II4E 4JFFE 3OZ9H 1VGEL 4PWHA 3SDCC 3VXUA 4QF1A 3RWEB 4TQPA 4UQ2B 4X9BA 3GJEA 4HWZA 1XF4B 5ILTH 4P5TB 4IRSD