5KWYC

Structure of human npc1 middle lumenal domain bound to npc2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Niemann-Pick C1 protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kwyC00
2E56A 1AHKA 3M7OA 2Z65C 3MU3A 3WEBA 3WEAA 3ULAB 3MTXA 3RG1C 1KTJA 5KWYC 2E59A 1XWVA 5IJCC 4G8AC 3VQ1C 5IJDC 2Z64C 3B2DC 1AHMA 3VQ2C 3T6QC 2F08A 1A9VA 3FXIC 2HKAA 1WRFA 1NEPA 5IJBC
chains in the Genus database with same CATH superfamily
1SBSL 3LPOA 4UIKH 5INCB 4KO6A 4JFOB 3T77A 4HU8A 3LQAL 3O9WD 1UCBL 3O6FD 4Y2DD 1HYRC 5B1JC 5TDOA 3UZVB 3N42F 4V1DE 2H32B 4P57B 3UDWA 3BVUA 3BPLB 1U3HD 1BVNT 5D7KD 3LEVH 2FHCA 1QLFB 3WN6A 1L5GB 1A7NL 3V9CA 4L29B 3IFOB 5DD3L 5EBWB 1X5JA 3GSNL 4Z7OF 3K6DA 3WEXA 1I1CA 2BNRD 2ZXEB 4X0NA 2X5PA 3WAJA 2V4LA 3C8KB 3L4TA 4RX4A 4IHOA 1KY7A 2X4OB 1TSHA 3WNLA 2OMTB 2YWZA 3RWGA 3RZCB 2VN4A 4JBSA 4YSPA 1JFQH 1G1YA 3U2SB 3L3OC 1FFOA 4J3OC 1E40A 5HI5C 2XG4A 3MUY1 1SYSB 4ISVA 4KKZA 5CP3H 2GC7C 5I8KH 3U9PH 3WNOA 3UTTB 4UQ2A 3EBIA 4G6JL 4X4XB 4H8VA 1X5IA 4IMLB 1VLXA 3MRPB 3N40F 4L3CB 1KCVH 4XOAA 1VEMA 1RZ7L 2M8XA 3QNYA 4EDWH 2V2XA 3T3MB 4F8LA 3PAZA 2KZBA 1HNGA 2BVYA 2P80D 4Z1PA 4L2LA 3RFZC 5CJXC 4Z78B 1M9WA 3ZK0A 4O51B 2NUTB 1G7JB 3D2UA 4LLYA 5F7YC 1D3CA 5DJ0A 5IBLD 2ALWA 2X2JA 2NXYD 2QQNH 5B1KA 1IJ9A 4Z7AA 3FRPA 3C5ZC 4X50A 4MA3A 1A7PH 2PP8A 5FW7A 3AG3B 3PHOA 4JG0H 3VXRB 3BIKA 3BZEA 2OP4H 2XXFA 3VFTB 1UM4H 3NSDA 3LKPA 4OT1L 4Z3EA 4JDEB 4U3HA 5E0FA 5K9QI 3SQOH 1H3WM 1IC5L 2FJGB 3OPUA 4G8FB 3T2NH 2HH0H 1NIDA 5GRYA 2OI9B 4YFEA 3GSVB 3OR6B 1S7SB 1UA7A 3KPRD 5ERWA 5DJ8A 4P5MA 1PVHA 5ACZB 5J11B 2UWEE 3OAZH 1CGSL 2VQ1B 3L08A 2ORBL 4J28A 3GRBA 3FQXB 3KMDA 2X0WA 3BP6A 4PBVC 4F8NA 2ZX5A 3O2VL 2AEQL 2D0FA 4MMYB 3GJFB 1EEYB 3PABA 4UZUA 1OIOA 4IJ3B 2WXOA 3US0A 3IMWA 3TJEH 4KNQA 4MAYB 2IPUK 2AJSL 4J8QA 1R5IA 5HJGA 4BXSV 3QRGH 3EHBC 1THCA 4MQXC 4RGOL 5HHQA 2O5YL 3TZVD 4UINL 2DN7A 2F53E 1YECL 2ENPA 3HHMA 3LS4L 3BEVB 1TCRA 5I1GL 1A7QH 3C5ZD 3ZY7A 5JHLA 4OZFH 4G9FE 3SKMA 2JSFA 3VVVA 3Q2LA 4GYBA 2GCYB 4GBXA 3EO9H 5ESAB 4DKTA 2YPVH 2ZUSA 4M6OL 4YWGL 3I6LE 4CUCA 4Q6IC 1WFJA 4JHUA 5BUPA 4P5TC 1CXEA 2IMMA 2YGOA 2NQDA 4X8JA 2VQ1A 1JVLA 3SKMB 4X6EB 3MLZL 5DMIL 5EORH 5CMAB 4UDTA 3GHPA 3BEWA 3SIKA 1T7XA 4LSVL 3V6OA 1KTLA 2OMZA 5A2JH 4FEIA 4PJXA 2OSWA 3H2WA 2DKMA 3VCLA 2XBDA 1NCWL 3L9EA 1PEZA 5ANHA 4K7PY 4PJDA 1OOAA 3EOBB 3QPXL 1ZGLM 1HZHL 5L8LB 2WIMA 3VXUA 4BV1A 1HDMA 2QZ5A 5I1EL 3KPMA 4H20H 1BF8A 4APXA 3FTSA 3LH2H 3LZQA 4OCRL 1U95A 4EN3B 4G6MH 3OMNB 5FYJD 1Q72H 4N2KA 7FABH 3LNIA 3UDWC 4XX1E 2QLVB 3GIVB 2FGZA 4ETQB 1QYGL 3LEVL 1FIEA 3LVEA 5DO2C 2CH8A 3LNFA 2H0JA 4EI6B 5FYLL 1AD9B 1A0QL 1JDAA 2MHAA 2B1HL 1DSWA 2FLRT 2APFA 3O8XC 25C8H 1KYAA 1JFQL 3OKOB 3TO4C 4ZRGA 4M6AA 5AUMB 3HI6H 3SPCA 4GG8A 1WBZB 1KYDA 3ARRA 4M62L 1H5BA 4N9GB 4OCMC 3WY3A 4NSKA 3FN9A 3UAAA 3FH5A 4WHDA 1J1PL 3F04A 5HD8D 1IGTB 2F1AA 3KR3H 4JO3H 3KPRB 3BAEH 5IROC 3WNNA 2SEBA 3VI4A 4CGTA 2KQMA 3U7AA 2HJKA 4IOIB 2UZPA 1JHTA 3G5YA 2P5EE 2G5BB 4L37B 4MQXD 4D94A 4PVBA 1LVEA 2X28A 5F7WC 3TEXA 3ZO9A 3T4AA 5D7LB 2DQJL 3EDJA 1HILA 1F41A 5IBUB 2E86A 2FSEB 1U91B 2FX9L 3I6SA 3NCYS 4A2HA 4U3XA 5CP7B 4G1EA 1X9QA 5T1DH 3S5LA 3L3HA 3O8XA 2Q3XA 4E42A 5GS0L 3DBXB 4EI5C 1OB1B 3DLQR 1AH1A 1T0OA 3QG7L 5B1JA 4M9OA 4Y16C 2OMXA 1T66D 4GSXA 1OAZL 2VB5A 1A21A 2DICA 4KGJA 1R46A 3HHSB 1AO7A 3FOMA 2EDOA 2QHRL 5DHVH 1C5CL 3TH2T 2CJSA 2CBQA 1BQSA 3FO1B 2FLMA 1R9FA 3RBGA 1RPQA 4M9PA 3K4AA 3OC5A 3EJQA 2VMFA 3U36A 2X4UB 2YUWA 3P9MA 5HYJE 3WHXA 1XF1A 1VEOA 4NRZA 1PLBA 3ZKXB 1HU8A 4UQIM 4LPXA 1C1EL 1FZJB 1EXGA 4M3HA 5DXWA 1ZLUH 4APQA 4AM0Q 3N44F 1F6AA 3JWOL 3U7WL 3EYOB 4R83A 1E5AA 4XGZA 1Z5HA 4XRCA 3X1EA 4JANB 5LQBH 3QGVA 4XBMA 4KUZL 3CQPA 1ORSA 4K3DL 4IBYA 3NK3A 1NMBL 1KDJA 4PGBB 5H94B 2AZAA 4P2RD 4DP8X 1RY7B 3QH3B 3GDCA 3NG5A 4QWWD 4O02H 2V2TB 3T5WA 4IRZH 4ZXBB 1IC4H 4U7KA 2NW2A 3D05A 1ZHBB 4UM8B 1ZKAA 1R5VA 4TUJB 5I76A 2DLFL 1IIIA 2OCJA 1FCGA 5I1LA 4AVHA 3PPSA 4U1NA 5D1XA 3PP3K 4QRRE 3CSTA 3V4VA 4L9DA 2WKLA 3EH1A 3UZEA 4EZJA 1RSFA 4GBXC 4WQOA 1DUYA 3QCTL 4HS3A 4KXBA 4PMFA 2EH7L 2Z35A 3ARQA 5FS5A 4X6DA 4NIYE 5C0CE 4YSUA 3VI4F 5JHDB 1V3JA 2KC0A 4MCZB 5DI8B 3HS0C 5E9NA 1PS3A 1VIWA 5C0BD 3W9EB 3IDIB 3S0PA 5I16A 4KHXH 4RMSA 3DV4B 2F53D 4CADB 4MMZC 1IC5H 1RZGB 2J2ZA 4LHUD 5T1MA 5KYXB 1KJMA 3KLHC 2ZX6A 4GKNB 4GW1B 4PP1C 4N2DA 3T8XA 4Y5YA 2AP2A 3OR7B 4PG9A 3VD2A 1IL1A 1W15A 5INCA 3C5XA 1K6QH 5E6YA 1R3LB 3QEQE 4XZUB 4ZFFB 5KSVA 3ULVF 4NO5B 1P4LA 1TNNA 4Q97A 2ICEB 5IGXH 3C2AH 4NJAH 2EP6A 3SQBB 2F18A 4QTIL 3N1PC 1MCDA 4XP9L 4YDLC 1EXUA 3QORA 4FNLL 1P5VA 4PJBE 1TMQA 4BHUA 2VH5L 1AGCA 3M45A 4YDIH 4U2ZA 1ND0A 5AL0A 2J55A 4Y2LA 1U8MB 5C0JA 4BFFA 2WUCH 3EYQD 1A6ZB 1F42A 2Z4TA 4LQFL 4BQ8A 4M1GL 2IWEA 1DQLL 5HVWA 3LN4A 1NGXB 2W0LA 4P2OC 1BD2A 2WB1A 3CTTA 3TXAA 2YD3A 1BLNA 2FHFA 5IREA 1CL7I 4NUGH 3CVHL 4WUUB 1XEDA 4MJIB 1OCWL 2F19L 4U3CA 4LOEA 5IFAH 2WKOA 1QLEL 3UEQA 4NOFA 4JUSA 2ZUXA 3DJ9A 3BOVA 2PLTA 4HIIB 1WDAA 3HI6L 4LEBA 3FCSA 1T21A 5BQ7A 3JT2A 1SJVA 4M93B 2JB6B 2WWKO 4LKXB 2AEOA 1DVFB 3GI9H 4IJ3C 1MCOH 3E6HB 5DDHB 4ECNA 5EB9A 5J5EA 1R5IB 1U9KA 2PXYA 2CK2A 5BRZA 1HOEA 2B9AA 2PYED 3FSVA 1D5ZA 1WTLA 2W38A 4XCFL 4XPTH 3TP4A 1UJ3B 1MCWM 2OR9H 3QS3A 2VDNL 4M4RA 3VXMD 5L0QB 4ZMLA 1B0WA 1CFNB 2Y1YA 1IAIL 2J88L 4NZRL 1XBDA 2BSSB 2YKLH 4QKXB 5D1QB 4KTDH 4FA8A 1J8HE 4YE0A 2J6EL 4PVLA 3V0IA 5JPMA 1CO1A 1BF2A 1E2WA 1HHGB 3T6ZA 1SDYA 3JWNE 1QFWH 1AG6A 1JP5A 2WXGA 3UZVA 1S4IA 3HC4L 5KSAB 4L37A 3S35L 3DMMB 4GIPD 4MNQE 3SD2A 3FJTA 2VDOB 3B9KC 2ZAHA 1V7ML 3VXRA 2BSSA 4WO0A 3CIQA 1UD4A 3FH8A 3D69B 4P4KB 3VXTB 3L54A 1DL7L 2MCAA 3V0FA 4PMEA 2AXGA 4G72B 4L3FA 2C1PB 5HGDB 3QNZB 3K71B 2IV8A 4WU5B 1BBDL 1U30A 3EOBA 4G9FB 5SX4H 2DBLH 3ISWA 4MNGA 2OMTA 1T7ZA 4U7SA 5J12C 5E2VH 4DP9X 2F53B 2J44A 1DSFH 2G60H 1EEYA 1T2JA 3IGAA 1XH3A 3PGDA 4R97C 4NQXA 3VAEA 4RMVA 3EJYD 2W59A 1AIZA 1WCQA 3BLPX 4GQRA 4L4TD 1MJ7L 3NACH 4MXVE 1HWGB 1LEKB 1MY7A 2DWTA 5ICXA 5FECB 3JVFC 4K0OA 2K0RA 4XH2A 1GY2A 4H4NA 4GKLA 2ED9A 2XCMC 3FQ2A 3L3DA 2EDHA 4NDMA 2CQVA 1DL7H 4IBZA 3DYOA 3JV6A 1SEBA 5M95B 4PJEE 1Y18A 4NEHB 3QDAA 2BRQA 2P5EA 4Y9EA 3RHWK 4YSOA 3WE6B 2UWEB 1BQKA 5I6PA 4QRUB 1JYVA 3R1GL 1HH6A 5ICYA 1CE6A 4AYMC 5CD5C 2IBZX 3PAYA 3ML8A 2V7HA 4TNGA 2WTRA 4UU9B 4TULH 1V3LA 1KBKA 4OJDH 4FTVA 3K80A 3LZPA 2XWTB 2ICES 3HPJB 3VJ6A 4PJHA 1G9EA 1U8JA 2YKLL 1AG0A 1IX2A 4LLDB 4NLHA 3OAUH 1PY0A 4OT1H 1HAWA 1C1EH 1HAUA 1GIGL 5I82A 4UU9A 4IRZA 4W6YB 1RUPL 1W9XA 4Z7IA 1UUSA 3E8UL 3PP4L 3F7VA 3QXDB 3LPGA 3DWTA 2H3KA 2CCWA 3KLQA 4MFHA 1R3IL 5DJ8B 5EU3A 1V27A 2IANA 4O2CB 4JLRB 4Z7WA 3W0WB 1SYSA 2IDCA 5DT1H 4LFHD 5H8DA 4ZG1A 2XBZA 4YNYB 5JDJA 4BZ1H 4OLXL 4MA7L 4MAYA 4PY8I 2V9TA 2G3MA 1I8KB 3QBTB 3L9BA 4RIRB 2W0PA 5EOQH 4ZFZA 1TVHB 5SWSA 4ANUA 3H9SD 5L2KD 4R2GB 3FC8A 4AMWA 1UZ6E 4PBDA 3V4UH 1BAWA 4MRCA 4KNUA 3UGEA 3UJIL 5JW4N 1MAJA 3V6OE 2LT9A 4Z7NF 2OR8A 3MRBB 3RDJA 4QAWA 4B41A 4F7EB 2PW2A 4NM8H 3KJ4B 3G3LA 3HJEA 2FCBA 3G9AB 4M43L 3WKNA 1D5XB 3CN0A 4W6XB 3FU5A 4JPIB 4Y4HD 3FDWA 1CVRA 3RWDA 5D4IA 4W93A 1HIML 1WT5A 5JIHA 2GJ6E 3QW9A 2GSIB 4YMPA 3FQYA 3I9IA 2EXWC 2HVJB 4IOIA 3TJHC 1UB5B 2DQCL 5FGRA 5ICUA 3QRLA 4DGVH 4GG6E 1E5YA 4G80A 3FSAA 1FGVL 1UD5A 1JMZA 1F3JB 1CGTA 1NBCA 4NGHH 4CC1A 4YHYC 4V1DB 1JGDA 2CHWA 3LTVA 3V5DA 2YMTA 3QHZL 2E27L 1PG7X 4L4TB 4MQ7B 3WO4B 2DJUA 2BMKB 4G8EB 3GSUA 4KRMB 1E4HA 4AENB 5KBMA 4YDIL 3BGMA 2Y2TA 1ODAA 2C9PA 3UAJD 5IB1A 3O0RL 5CWSA 4FF9A 3IAPA 1VA9A 1E42A 4OKDA 3VH8G 5C09A 1HHKA 1TVHA 3DPBA 4NJAL 3RL2A 1WLHA 4XP4L 3IGUA 1D5ZB 1EX0A 4N28A 3P3TA 3HBQA 4OCRH 3VXQB 4BUGA 2X0VA 5KYNA 4W9FC 2JI1A 3DHUA 4I2XB 4WTXA 4X7SH 4KQ4H 4YZWA 4EI5D 1A1MB 4M5YH 1EBAA 2CUIA 1T7WA 1IEAA 2JJTC 3RGVB 2J21A 4JFXB 1ICTA 3KL3A 1FYTD 3CVIL 5A1AA 5DR5L 1Q4NX 2CKBA 1WJ3A 5IFJA 1GGBL 5KEZA 2FECL 4U1MB 5D7HA 3KGUA 1WK0A 4LNRA 1OAJA 1WC7A 2WSKA 4N6RB 2QKIB 3IDJB 3PWJA 5K9KB 4BA8A 2AERT 2FJFA 4RSVA 1NSNH 1ETA1 4LLQB 4PWJA 2NY1C 3APNA 1NIFA 5IVXA 1F6LL 2Z0UA 5CUSL 4HCFA 2KDGA 1ZHLA 4PLJC 2AW2A 1JNHA 4HS6B 3VFNA 5KN5B 2AQ2A 3B2DC 1P9MA 4ERSH 1FAIH 5C0BA 2BSRA 5FOBB 4BFRA 5I66B 4JDVA 1M1SA 1ZHNB 4Z77B 2K9UA 3TPKA 1TJHH 4OGYL 2OZ4L 4FP8H 4F9LA 3QWRD 4HGKC 1K9TA 4G71B 3EW3B 4NQCB 1A3LH 3QFDA 1CFTA 4B9PA 3VXOB 1WIPA 1GS8A 2ZSVA 5EIVA 2K3TA 2K45A 2FQFA 4PB0H 4Z95H 3U2IA 1ZPUA 2HX8A 5DQDL 1M7DB 5IIEB 6PAZA 2E6QA 3BIBX 2W88A 3P4NB 3I74A 3DTXA 2X4TA 3APFA 4QYOA 4XXDB 1T4WA 1MFMA 4EKXA 1FL6A 3I75A 5L88H 3CV5A 1RUKH 4HXBL 4PN6A 4XWOD 4FFVD 4YHPA 1UKQA 4F7PB 4YH6A 2WJ7A 3J2PA 3ARDB 3BUTA 4S11A 1SXAA 3PQYD 4WV1B 4R84A 3NUKA 3TV8A 4JY5L 4EUPG 2NY1B 4K94H 8PAZA 3QDJB 4C4UA 1IFHH 4RMQA 5ICZB 3KPQA 5AFAA 2PO6D 3HE7A 4E5XA 5DVLA 2HFFA 2IADA 4C58B 2DD8L 4PFEA 4AQEA 3HAEA 3JV4A 2AJXH 3NGBB 2NY3B 3OC8A 4WNSA 3H2QA 3PHAA 5BS0D 3CZLA 1VACB 1NCNA 4Z7NB 4LLUA 4ZMQA 4NZDA 2WIIB 2GAZB 4MASA 5MP6H 1FFRA 3RIAF 2B9BA 3IF1B 1TJMA 2B16A 2E0PA 4UTBH 3NZHH 4HJEA 2VQTA 5TFSL 3Q1EA 4QHPA 1NC4A 5LN8A 5EUKA 2B1HH 4QIRA 5T3ZE 3P0YL 3S5YA 4NT6B 5LHDA 2CPUA 1YEJH 3IDMA 2ZOTA 3PV6A 2G9KA 4W6WB 5EOTB 5EOCL 4HLEA 1E4XL 3CQQA 4WCYL 2Q1EA 5HHMD 2DEXX 3IFLH 5DJAB 4CC0A 1GKEA 2K7QA 5F6HI 2WUBH 5DJXA 1WWWX 4NZRH 2NSQA 2Z8WC 2V0AA 3F7QA 5AZUA 2R4RH 1MG3C 3GMQA 3MACL 3V0WL 1QI3A 1IGML 2O5ZL 3NK4A 4ZZFA 1UC6A 4YVNA 2MNWA 2UY7A 2FH8A 2Y7NA 5ALBH 3MJ8A 4PWHA 5E6ID 2VAJA 3HN8A 1DLHA 4K2UL 4NPKA 4NENB 3D5OF 4YHOH 3RTQB 1NMCB 1JL8A 2QR0B 2UZXB 1I9RH 1I3VA 4XOBA 3L17A 2WYTA 2OYKA 3C87A 2WP3T 3FQTB 1DVZA 1E4WL 3HG1D 5F9AC 1GGIH 1MXGA 2VXSH 4LE8A 3BUBA 5EN2A 4RGNE 1O5PA 2VUOA 5GRZA 1ZVSB 3RKPA 1TVBA 4YDNA 2DQTH 1SDAB 2YN3A 5AVTB 1RIUL 4GKZA 1C12A 4AIOA 1YMMA 2I07B 1KEML 4NS0A 3CXFA 1CBVL 4IBLT 4YFLI 1UXWA 2GJ6A 1CDGA 2ITDB 4RMTA 4Y0GA 4BRJA 4UT9H 1A1NA 2ICWB 2CHZA 1R3JA 1OEZW 1IBFA 1RK1B 4AOFA 1NKRA 1UD6A 2R51A 4I1NB 3ULUH 1KY6A 4XP4H 1YEKL 1AO7E 5T1JA 3BKCL 4U6VH 3IBEA 1S7RB 5GSRA 2DF3A 2W9EL 1TCMA 3GSUB 4JFUA 3FU7B 4YHZL 1NL0L 5IFHL 1OPGH 3DARA 3UYPB 3HE6C 1S9YA 4A37A 1GL4B 4KNTA 2PPFA 3H9SA 1RVFH 5F44A 3QVAA 3SDAA 5I0ZA 3TYGH 4GLRH 4KJYB 7PCYA 1AQMA 5MP6L 3O3AB 1KMGA 5HHOB 2WBJB 4RFEA 4DO4A 4Y9FA 3ZPDA 3OR7A 4CILA 5LCVH 3DSFL 4X9FA 1Q0YH 4UDUB 5TDNA 3V6FB 4WEUD 1WFOA 1ZHKB 1RK7A 4JO3L 3S48A 1IGJA 4TL5A 1YO4A 3FTGA 3UTPD 4WJKB 1L0YA 4KHTH 3UYPA 2GSGA 3I2CH 3IU4L 3PGFL 1U8HA 1CUOA 3S96A 1QEXA 3WE1A 1ZLEA 1K4CA 3FB6A 4B9GA 4JZJA 2IFGA 1TQSA 4OLEA 4PRAB 4IBQA 1LEKA 4LU5L 4K8RD 4AQEB 2NY3D 5C6WH 5TD4A 4GW4B 5GSVB 2IDUA 5I73B 2P8PB 1F8TH 4MDJB 1MHCA 2WO2B 5KVEL 1GCFA 1HL4A 3Q6FB 4RDBA 5KSBF 1UG9A 1EVUA 2E9WA 1QNIA 3RWFA 5B3JE 4I5BA 4KKRA 3BZDA 4WFED 1ZTXH 1L0XA 2ENJA 2I7SA 3NJFA 4H13C 2H3NB 4H26B 5L88L 3CFEA 3CN4A 2DPKA 4H1LH 1S6NA 5FK9A 4KITB 1XDTT 1ZIAA 2HLFD 3BGAA 2GJZB 3IXTB 2FJGA 2W9LA 4G8FA 1AGFB 1I7UA 2D03H 3AACA 4NRYA 4U1JA 4W9KC 4Q9QH 3RWIB 1LQSR 4GXVH 4QXGL 2G0KA 3IMUA 3JWOC 4RVBA 5T1KA 2XQYK 2J1ZA 4L8DA 5DD1H 1B4JH 3BD5A 2E7CA 4PJEA 4IBTA 1CTMA 4YC2C 1T7YA 3CBJB 4B9KC 4MJ6B 4TRPH 4OCYL 4AVIA 4UMGA 5LNEA 4X6CF 2PCPA 2OXGA 1GGYA 2R23A 4L3ED 3KPTA 2HRHA 5I15H 4XAKD 3K71A 1SY6A 4MMXC 3CZGA 1H3UA 2JIXB 4J3UA 5DUJA 4GMTH 5A2KH 5MEND 3HG1B 5IWLC 3QXWA 5GS1B 1IC1A 3BFWA 5JDSA 4X9BA 4J3XA 4HSQA 1FORL 3ZDXB 2GT9B 3O4LD 2CGZA 35C8L 2ZP0T 1SBBA 3HRZC 5D1XD 1KIQA 5B1BB 4I4WA 1KBVA 9PCYA 1NCAH 2O30A 3AVEA 3QAZC 1V3MA 3QSKB 5AVSB 3UZQA 1MIMH 1KCSH 4NN6C 4PS4L 5JHMA 2YBRB 1F1GA 2XTJD 5CN3A 3QDME 5TQ0H 5MERA 1MVFA 2YSSA 3L7EA 3N85H 5A2LH 4PY7B 4AYDC 1I7TA 4EDXA 3IAGC 4HDIB 1FL5B 3TF4A 5D1ZB 4YBHA 5BZDB 4IKKA 1KTRL 5A7BA 4RMRA 5DRNB 2VUYA 1HCYA 1MFBH 4YSDA 1BCIA 3EUDA 4HK0A 3LRSB 3QYCA 3C5ZA 3TA3A 3R06A 1ED3B 2B5IB 4PJ8B 4UOJA 2Y36H 4ZUVB 1YYCA 5TDOB 1KXTA 4YXHH 1HX0A 1R5WA 2OP4L 2VN7A 3DTXB 1DP0A 3MX0A 4TLTA 4YOKA 2DEWX 25C8L 3WNJA 3FRPG 2XLLA 4PJEF 2JCWA 4UOW1 4ELKA 3MV7E 3A4AA 3MRQA 7TAAA 4EBQL 2ZX8A 4XNZC 3B9DA 2FT6A 2EEFA 5C09B 3O0LA 4ZODA 4Z23A 4ZMNA 4MAYD 1MRFL 4ADGA 2X3BA 2X42A 3RLSA 3RVUC 4S2SA 3T6XA 3CN3A 4YHNA 1RZKH 1RUQL 3HG2A 3JQOB 1LP9B 3TZVB 1MJUL 1PAZA 2A9NH 2LU5A 3RX9A 1ASOA 5HHPA 2XWZA 4DP2X 1JF1A 1BOGB 2L8AA 5ICZA 5CBEA 5FDWA 1TDQA 1CC3A 2C4FT 1RMFL 3OHXA 4JJ5B 4JHWL 2J1KA 5TH2B 4U05A 5E5LA 2ITCB 1H0DA 3BVXA 4OI9A 3QDGB 3RWHA 2COVD 4HIPA 5I18H 1N64H 2NYKA 3N43F 4HHAA 2NXZB 1D6VH 2PTTA 3BN9D 1KTLB 2EDXA 2FJUB 2AQ1A 2OMZB 3FOLB 2Q8AL 3OLGA 1O6SA 3QCVH 3H2PA 4L3EB 3OL2A 1QG3A 3FHQA 2YOAA 3MOQA 5IW1A 2YD8A 3S3BB 2GBUA 2OR7A 4KY1L 1E27A 1FGVH 4PR5B 5B3NA 3ULUD 1XAUA 1IGMH 4QOKB 2R0LL 4FQ2H 3IT8D 4QI3A 1KV7A 3HG1A 4NP9A 5IJKA 3RVUD 1DEEA 3MN8A 2BSDA 2PN5A 2XWXA 3D39B 2C7FA 2Q8BH 2KZWA 5DJXB 1N10A 2WXJA 3OHXC 4AENA 1IFRA 2FHBA 5C2UB 1SZNA 4HWBL 4IIQC 1NCUA 3LKQB 3O0RH 1DQQA 5TF1L 3FB7B 4TS6A 1E5BA 4NOBA 2V7HB 2ED6A 3ARXA 3HNVL 1ZVHA 4JREC 3V4PL 2XOTA 4XZUA 4UF7C 3OV6A 1JIBA 4U0RC 1CD1A 2YPLA 4HK3J 1XGPA 3G7TA 4WENB 1GZPB 2HUHA 4PJ5B 5F7EL 1F90L 1I4FA 2GTWB 7PAZA 5T1LA 1JPSH 3BSHA 3QDMB 2EILB 4BZ2H 4LRIA 3B1UA 2R1WA 3EYVB 4DO5A 4JCMA 4WK2B 4FGMA 3W2DH 1YN7B 1AD0A 3KPOA 3D3VE 3GIZL 4EF3A 5HYIA 3HZMA 3NPSB 4OIIL 4OSUL 5LJYH 1FFNA 3TO4A 4FABH 1VESA 2FEDD 5ISZE 3HZYA 2J8UB 3VWKC 4OQTL 1ZDSA 1A6AB 1RERA 1L4IA 2F61A 1N8ZB 2GBTA 2P28B 5TK2A 3OAUL 5C0RH 2XQBL 3FUKA 4ODSL 1XB8A 1NQBA 2Y24A 5D7LD 2BM3A 3QZBA 3RNQB 4CMMA 2WLYA 1HHIB 4HH8A 2QQNL 3U0TB 4B9FA 4E42B 2KQNA 2X41A 1ZTXE 2XVBA 4A63A 3HC4H 4XHQA 2QBWA 3B56A 2N4IA 3NIFF 5EU5B 3QQ3B 3WIAA 3FCTB 5BJTB 2OJ1A 2Y4SA 3P11H 3CAFA 1ACCA 4BFJA 5E1AB 2AITA 1UQSA 4PJ7B 3EYQC 4OZIB 1DJIA 1EJFA 3N0PB 3IDIA 2ERJB 3B9KD 4XVOA 5LG1A 5DS1A 3MRFB 4P2RA 4CKVX 2MNJB 3QDGD 4OKVA 5A2BA 4P2YA 2WYHA 3EOYG 1ZHNA 2AI0H 3KWXA 5EU4B 2ODHA 5KJRH 3WHXB 3GMNB 3ZIYA 4ALAC 2DIJA 2HA1A 3Q2NA 4AEIL 5GGUB 2EDKA 3ZHLA 4R97B 3VXUB 4GG8B 2OULB 1UXLA 3KLKA 4UAHA 5GGSB 1FVDA 4QRAA 1A6AA 1BYPA 2P8LB 4GRWB 2Z91B 2G3NA 3ESNA 2W65B 2YXMA 4YAQB 2GJZA 4KRPD 2BIMA 2DS4A 3D08A 5A40E 2BP3A 3O3DB 1AS6A 2BSTA 2CD0A 3JV5A 1UT9A 2XYBA 4JG9A 3NYKA 1YJDC 4ZOEA 1DQIA 3O6ML 1OO2A 4MXWH 2CKNA 4JY6B 1XH3B 2IDTA 2ICWI 3HRZA 3E38A 3LD8C 4K8RC 4YAQA 2C9AA 4H0IA 5HD8C 2NQCA 2VZSA 5B38G 4M7LL 5HHNA 1F2XK 5F70A 2G3XA 2VQ4A 4QRQA 3SGJA 1E28B 4HBCL 4OTXH 1ZS8A 4DP7X 5HP5A 4LF3A 2IWKA 3BI9X 1N67A 4NGHL 2XRAH 4UOW0 4DTGH 3OKMB 2XTJE 2J88H 3DC0A 2IWFA 4UDTB 1CE6B 5L0QC 1WGOA 4L3AA 3II2A 1GHFL 3KPPA 2R2CA 4L5FH 3UAJA 3QNXB 3QULA 1NGPL 3ZOAA 3DI3B 4I3GA 5E8NB 4LHUB 4MB4A 4LEXH 4QMEA 1EFXA 4KROC 3UROR 3HI1B 1HHGA 3KHQA 3IETA 4NUJB 1KTBA 5FDYA 2FK9A 4NHUB 5F0MB 4AEEA 2ZIDA 3GDBA 1FDLL 1J11A 2MQGA 3F7LA 1G6RL 1LXMA 3MJGX 5HPMB 1P5VB 2HTLC 3M8OH 3OLIA 5ABDE 2FNWA 5K1VA 2C3XA 1GZQB 1OCOB 3DIVA 4XXWC 5EOQL 2VW4A 2QFRA 3LOWA 4I0CC 2NYYC 3CFBB 4PGEB 5DRZB 5EZIH 4G6ML 3NCJL 3SE8L 3CVHH 4A1RA 1RJZB 3BRGC 2CR6A 4I87A 2NTFA 5E94A 4UBDC 3ZTEA 1PNDA 1NJ9B 2A6KA 2W9DL 4YE4H 5EU6B 1CN4A 4XNQB 3HLKA 3BKML 3IXAA 1NMBH 4JRFA 4E9VA 3T6WA 1CFVL 1ACZA 1XCQB 2XN2A 3WHE1 3CZFB 2NOYA 1EA9C 4RDQF 1LD9A 4MJID 1CDIA 2VH5H 1HCZA 5TE6H 3NIGF 1MCOL 2X3AA 3O41B 3FN3A 4XN9A 3NCXA 5D93B 2I32A 5F89A 4GUOA 4DVRH 4XNUL 2B4CC 5KVFL 1OF2B 4HLJA 3L3KA 5FM4A 3QZWB 4PJIB 5IGXL 1F02I 1TITA 3QPQD 4LPCA 1P7KA 3VG0H 2QTEA 1M2VB 2GPZA 1U8LA 5TDNB 3SKNA 1VEPA 3LXUX 5C7XH 3G5YB 1UJ3C 2C9QA 3UCQA 2HPOA 1NFDF 4M1GH 2NW2B 3TBYA 3MODH 1GC1C 3JVGA 4KRPB 1YEJL 1N3NB 4DPCX 4QUOA 4FG2A 2WTRB 1CFQB 3M1BA 1QLRB 4XE0A 1N5YL 1HVXA 4NO5A 2OMYB 3TCTA 4PWGA 3MBWA 1U8QA 1PYWB 5JLZB 2HLAB 4AUJA 4AG4H 2O5YH 5JHAA 4XCYB 3QDJE 4DKEH 4U6YB 3EYOA 5DO2D 3GBLA 4A55A 3PABB 2D7QA 2GI0A 1NTDA 2DI7A 1T66C 2EVHA 2EVFA 2VM3A 3BWAA 1IJNA 1ORSB 5DZOA 5ECGA 2XV3A 2R2BA 3CSYB 1XSJA 2KLTA 4N2CA 4XBGB 3IJYB 5GS2H 2ENYA 4X5XB 2FX8L 3DETC 3BZFA 1H8SA 1MHHB 2XV0A 5C0GB 5E6IC 1JZIA 1A9BB 3BAEL 1QRNE 4J3VA 5E7FA 4KKBC 1UB6A 4DK5A 4WJG3 3CXHJ 4RESB 4M62H 1TU2B 3AY4A 2YS4A 4KY1H 1JAEA 3K2KA 1SN0A 4ZT1A 4PB9H 3QRFM 1FFQA 2IEPA 3MUHL 1Z6JT 3PUUA 5IBUG 2ZCLL 2QMJA 3OMAB 3NJLA 5SWZD 2AXHA 2R1XB 1T1XA 3CFJB 1HZKA 4S1SL 2W81C 4YHNB 4Z3HA 5FUOL 2QQLH 1NUNB 3RHWF 2Y7QA 4B97A 1NZRA 4WUUA 3U7YH 5E1GA 4OFKA 1CXLA 1JI2A 2I7OA 2XWJA 3T4AB 1ZIBA 5KUKA 12E8L 1BG1A 3QJTB 4LXFA 3VDAA 3RVXD 4TPRH 4PV8A 2R2BB 1K4DA 2OV0A 1YN6A 5GS0H 4XC3L 1KEMH 3AAZA 2OJZL 2ZX9A 3GQFA 4J3OD 4MKMA 1XMEB 1QSVA 3MLWL 2QVFB 4HHAB 2R2EA 2FR4B 5D2NC 1KIPB 1FG2A 3EF7A 1EVTC 4EJ1C 3QZLA 4K23H 4XCEB 4Z7VE 3FOMB 4LU5H 4TTDD 5G55A 4GT0A 5F71A 5B3SB 2EIJB 4OM0L 4FXGB 1I9RL 3DETD 5C0FB 2R29H 5L4FA 4X4MA 3ZTJG 4X80H 3BWUC 1P84J 3LKOA 2MOQA 4HCGA 4WHTA 1TTBA 2AKRA 1F58H 2WP3O 4NNXB 2CLRB 4O2EA 5KS9E 4KFMA 1H5BC 2Z6FA 1BGXH 2YAFA 5I5IA 4G8GB 4JO2L 1FC1A 2FT8A 2FBJH 2YQ2A 1ES0A 4PV9A 3PJSA 1X5HA 4H2AA 5AKSA 1OW0C 4NNXA 3KPNB 3CFCL 3CPUA 5A3ID 4O4YH 1KLGB 4JFOA 3KWUA 2AK4D 2ZF9A 3E1ZA 4I0PA 3EH3B 4OZHF 4BFOA 4GRLD 1Y1DA 5JXAL 3UTSE 4RBPK 1NH6A 4RGOH 4QHLB 5CGYC 3FRPB 1JNNL 2XT1B 4F37K 1OM9A 2FQDA 2WXFA 3ESPA 4GAGL 4XE5B 3PIQB 3ZDYB 1Q72L 3CZSA 3D3VA 2XZCL 3VXSA 2BOCA 3VD7A 1S7QA 1OSEA 3UC0L 5FOJA 5AW2B 4WDIA 3TWCL 2BVOB 3TESA 3UTSD 1I8MB 1EGJA 1HXYA 3UGUA 4Y4HB 4OLZH 1BEYL 4H88H 4IHOB 5E7BA 5FYJU 4Z5RB 4BCYA 4KHXL 4WKZA 2IDFA 2NY5H 1I8AA 1I7TB 2ZP8A 1QASA 4EDXB 4NKMA 4JVUA 5F2FA 4PG2C 4UQBA 2RR3A 5DSCA 1I1RA 3VRLE 4MD0A 1E9OB 2VXUH 2XPGA 4M8UA 1UM4L 4U1KB 5HVGB 5DUMH 4CMMB 4Z5RA 5JOFB 4RAVA 2N1KA 3MGOA 4OCYH 2NUPB 2VC2B 3F65A 1XR9B 4MNGB 4HLZG 1NDMA 3P73B 2AJUL 5AVYB 3O6LL 5JO5B 2XX0A 3IVKB 3A3YB 3SY0B 3IDYB 3O9WC 4Y9GA 2WKGA 3WSQL 4N86A 2YJQA 3ARYA 3MV9E 4LARH 4R4BB 3FPXA 2DQHH 4IGBC 5DQDH 1X5GA 4A6YL 2BIOA 4HS8H 4EI5B 4F7MB 4R26L 5CF3A 4LCYA 3UJTH 4GXUM 3RGVD 4HEPG 1RU9H 3RURA 1VFAA 2JCCB 2W60B 3DROA 4HJGA 3U1QA 1QR1A 5EUOA 3GSXA 1EFXB 4WIQA 3STBA 2BW5A 3ZKMC 1QATA 3WLWD 4E9QA 4IBSA 1FAIL 4Q6YA 4AQZA 2CDEB 2YD4A 5DD5L 1XGRA 2JE8A 1BVLB 1X9UA 2L4OA 3MRPA 4L9LA 4X8GA 2DQFB 4HOZA 3M17A 4MX7B 3GIZH 3T6VA 3VB8A 5DWUL 3KE0A 2A73B 4M29A 1NWPA 1FHGA 5J6SA 5A2CA 3RUGE 5I0DA 3HC3H 2A7BA 4X6BA 1RUAL 3ECBB 5F9JA 1FZOA 4MMZA 1FHNA 4RA3A 3SPVA 3RZCA 2KERA 3JWNG 3CFNA 2EO1A 3J07A 4ZSOB 1TTFA 3CLEL 4XP6L 3NN8A 3KH3A 1FNGB 1EJOL 1ZJBA 3HRZB 1OPOA 1KGCE 4N85A 3FH7A 3QZPA 3TBSA 4JFHD 1U8PB 1KOAA 3EOAB 3K91A 3LMJH 3MV7A 2HJLA 4FZ8L 4LPUA 5HHVH 4EVNB 4GRWH 4M7LH 4N4YB 3SYAA 2AV1A 4EI0A 3EYVA 3WKML 3HR5B 3L3JB 3ARFA 4N2IA 4KJWC 5TF1H 1U8KB 4PB0L 3R7QA 5L2KA 3FTXA 5DUBB 4MJHA 2V2XB 7CGTA 5LGHH 1JRHI 4PJ7A 3F85A 3NBNA 4RAUB 1O5DT 3FBQA 4MNQB 1NC4D 2WOBA 2VW6A 1BFTA 3GNMH 1TJHL 4OGYH 4HFWA 1ND0B 1K8DA 3QDJD 1T0NB 2EEDA 4NN5B 3FL7A 3KPRA 1DVUA 3GBDA 5D5MF 5IQNA 1ADQH 4LHJB 3F2LA 3RNQA 3W11D 1KEGL 2KMWA 5IHUL 4DGIL 1INDH 3MNMA 4X7EC 1YY9C 3LB6D 5EA0L 4A6YA 2P45B 4DW2H 3TT3H 2WMPB 2CM5A 1MW1A 3ASNB 1MCCA 1D7CA 2HTKD 2NLJA 3ULSB 1MREL 4JO1L 3GSWA 2DYSB 3CFKB 2EDMA 3ULVL 4U1SB 3L13A 4MJ6A 4WTQA 4TTGA 1GGBH 3RWDB 3U0WH 1DJGA 5C09E 3TWYA 2CIKB 2OI9C 3PY9A 3BH8A 1LP9F 3L81A 2PWDA 2ZKHH 2ZPKL 5IVOA 4KQ4L 1KDIA 3I84A 1ZXQA 5DRXA 4E5XG 4W70A 4AMXA 1YG9A 3JV6B 2VLKE 3MZTA 4MB1A 3HAEG 4APXB 3B2VL 3GXUB 5HHMB 4ETYA 4IBUA 3MRNB 1URZA 4G6JH 4Q9CA 3MLXL 2KLRA 4NUQA 5IHWA 3T4YA 5DMKB 4BSWA 2FWUA 1QSEB 3U4BH 4NZUH 1MNNA 5DYOB 5C0EA 3EDDA 5FO7A 1OXYA 3N1FC 3EF4A 3ZUCA 3WU1A 1UZ8A 3FB8A 3C8KA 3MV9D 4JHBA 5B4MD 2M26A 1RUPH 2CDGA 3PAVA 3L7EB 5T5NG 3L5JA 4UYQA 2M1KA 1NEZB 2MH4A 3EO1A 1XL6A 5E24E 4JM2B 4P2OD 4L8CB 4RSYA 1SDDA 3MACH 1M71B 3FO0L 1WZ1H 4QCIA 5KSUB 5L9DH 1GGTA 1PKQA 3O6KH 4PJHF 4WEBH 3UG3A 3H9HB 1EBPA 4GSDL 5DURD 1THAA 2VZ3A 3VXTA 4WCYH 3MV01 4UZSA 1G6VK 1E2ZA 4QHMB 4CMHB 1NWOA 1M3IA 3BQUA 3EO9L 4NHCL 3EDEA 5E5MB 1KNOB 4Z3GA 2P8MB 3MV8B 2WIIA 2BCMA 1BP3B 1UCBH 5IK3B 4LSRL 2J57A 2Y07L 4PGCA 4KK5D 5KBLA 5AUMA 1PBYA 4Q14A 1TR7A 2XG5A 5DZVA 1AGBB 3SGDI 4Y5YC 2DIEA 1QWUA 4NZJA 4Y4FD 5KYWA 5JNYA 3BPOC 2E9IA 1PZ5B 1KJVB 5DGQA 5L8KB 1DE4A 4OD3H 5F0JB 1SQ2N 3UO1H 2BVTA 5HHOD 2V5RA 4QRPE 3HUJF 2C9RA 4JGNA 4B7IA 3RE0A 3GHEL 4O58H 4KTGA 1UUNA 1SLXA 3S4SB 4ETQA 3US1A 3INOA 4YO0B 1VZIA 5JIQA 1DQKA 3E1F1 4B5ZA 5D7LA 3RJQB 4PU2A 1S9XB 1F90H 3FNKA 2E9GA 3DV6A 3C75A 4OGXL 3LN5B 2W65A 4TQIA 2F74A 3PHQB 2Y7MA 5DJZA 2XA3A 2C26A 3VGBA 5AW7B 4QXUL 2MTPA 2NNCA 3HZYB 4UQDA 3NEEA 2QKSA 3O2DL 4KOBA 3RZCC 4BKSC 1D6VL 5I1JH 2DTSA 4PLNC 3O3EB 2ZAGA 1UWFA 2BNUA 1MFEL 5AAWA 4BSVA 1BQRA 1JV2B 4KVCH 5ES4B 4K5MA 3HA0A 4PV8B 3EYSL 5L6YH 3T0EB 4AQ8C 4MZIA 4XOCA 1FV1A 1TFHA 4JG1H 1IAOA 3ARDC 1NBVL 1URLA 4WSKA 3QNYB 4K3JL 3BPLC 2R27A 5BXFB 4F57L 1QHQA 4F15B 1QSED 1A6TA 4XVJL 1R5WB 2WANA 1KCRL 5JZ7D 5C9JA 3BKJH 4XVUC 4KJYA 2I9TB 2A6IB 3IE4A 4GP5B 1SN2A 1I8IB 2Q86A 5IFJB 5I8KL 1YJDL 1G9HA 4ORZC 1P1VA 2X70B 4ONFL 5I9QB 3DVGA 3VMPA 4G6KH 1XWVA 4P2OB 4PTTB 4MD5A 3CSBA 2DWEB 4MCZA 1JGUL 3MRBA 3P2TA 4KPHL 5EIIG 3UADA 4OI7A 4KROB 5MENB 5JDSB 3N1MC 3KNBA 4RQQB 5SV4A 5I75B 5KYUB 1XF4A 3PWPD 4ENED 1U8CA 2G2RA 2Z9TA 3LZFH 2HT3C 3RB7A 3VX1A 2VLMD 1MKFA 1UD3A 2R1YA 5D1XB 4H0HB 1X4XA 3UH8A 4LLMA 3NAAL 2A74A 1NL0H 1XCTA 1PX8A 2WK2A 5ADOL 2VN6A 1IBGH 1QSFD 2Z7YA 4AI7A 1JGDB 2NY4D 1ADQA 4W9HC 5B38B 1Q9KB 5CCKL 1SXSA 4AUYA 2AXWA 4WHYH 4BWUA 2CLZA 4UOQA 4MVBD 4ABUA 1S5IL 4OAWB 2WLNA 4YEFA 2W0FA 2IDQA 1RK0B 1AS8A 1DUZA 4GAJL 3S3SA 1ETB1 5DCCA 3BUDA 4G7QB 1K3ZA 1GTFA 1ONQA 3IMVA 4DKAA 2PW1B 1S9WA 3O8XD 5T33L 2ATKB 5CGMA 2VXSL 1R3LA 4ZFFA 5KSVB 3I6GB 3AWFA 4NKQB 4NUMA 4XWGL 3W38A 1I8LC 1MFBL 3EJZC 3O4LA 1H3GA 2DMHA 4P3WA 5D9SB 4OZFB 3WY4A 1BXVA 2VDQH 1QEWA 3REWA 2AJVH 4AL8C 2A74C 2VLKD 1U92A 1LHZA 1OAUH 5F1SA 1M42A 1EEUA 1OCZB 5C0AD 5JXED 3VU1A 3TEWA 1BFVH 1R75A 1XZ0B 3WJLC 5IFAL 5HI3D 1OGTA 4Y8DC 4U6TA 1CXKA 1OSPL 3GPEA 4FXLA 4PGZA 4GP8B 4Z7NE 1JWMB 3LEXB 2W94A 1GZPA 1IE4A 2UY6A 3F7YA 2LV4A 3GJFH 4XVSH 1IQDB 1MJ8H 3QJQB 2Z91A 4J3OF 5JUEH 1REIA 5I1LB 3LN9A 5DC2A 1FORH 4FQ1H 5BMFH 3FTVA 5DVMA 3U7YL 2VLLB 4WJ5B 3LHPL 2J8OA 4DP1X 1AQHA 2UZYB 2DM4A 3HRPA 5FKAB 1PQZA 3O4OB 1CXHA 2ZXQA 3SJVD 4LLDA 1MCPH 2H5UA 3UXFA 3CDGB 1AGCB 3IJEB 2OL3B 4BEIA 4ZPVA 3HPLB 2FVNA 1KC5L 2OMWB 4QRSB 1LMIA 1T1YB 3B1TA 4O9HH 2ZOUA 2PCXA 3BC9A 1ORQA 4HJJH 1ZVNA 4WI3A 2ENSA 5DUPL 5LAXA 4BINA 5CIPA 1H8LA 1OQXA 1UOVA 2IFFL 4PR5A 4ZFOA 5ID1B 4B3EA 2PYEA 1NA8A 2ILLA 3V0AC 1LNUB 3IKKA 3SKOB 1WFUA 1D9KC 1QZ1A 3D4YA 4JFEB 4KZDH 2AQTA 4GUPA 3QEUB 4WHYG 3NPSC 3GS0A 3OKMA 4NNPH 3E6FA 3EHBD 3IKCB 3QCTH 3OVUB 2CK0H 2E7MA 3D39D 4NQUA 4YO0A 1G9ML 3G6DH 5GGRB 1NMAH 5KVMC 5F9DC 3TEUA 4A2MA 1ET5A 1BAFH 3GXIA 3MTXA 1XTLA 2GFBB 2R69H 5J6HB 2C7UB 2Y5TB 3FB8B 3QEGL 5FKAA 1YUHA 1ZV5A 2EYTA 4U0RB 1F97A 1KTKE 4BFBD 2BS9A 4LLQA 3V9FA 2VDMB 1J1XH 4IIQA 3WXVL 5MEPA 3QRBA 4U6VL 3FTUA 4CL7A 2BC4B 4FNQA 3QDMA 4KKQA 4LCUA 2A83A 4B9ZA 1RZJH 1CURA 2ISDA 4JZJC 3L45A 3MJ6A 1JGLH 1Y7VA 5CZKA 5FYJE 5I1IH 2X1WL 4QTFA 4AV5A 2NXZC 5LB1A 1LNUA 3SKOA 3H3PL 3VTMA 3T3PB 5BXFA 4A04A 4Y2OB 2JK5A 3D8MA 5F7LB 4CSZA 4F27A 2H32H 4HOWA 4EIUA 4NQQA 3QR1A 3OD3A 3D12B 3FONB 2E7LC 5AZEL 2X7LB 1YNLH 4Q2ZA 1WE5A 4HK0B 4JRYE 5BMFL 3AG2B 4LVNB 4NQEE 5D6CA 3VE0A 4M7JL 3LRGA 1ZLVH 4XAKE 3DGDA 3ETBJ 2A9AA 4LMQI 5FA4B 3B7YA 2QT6A 3SDDC 1OAQL 1ROWA 1YEGH 2WTOA 4HV8B 4GAJH 3ZZQA 3KNBB 1JPEA 3IPFA 3ZN6A 2GY7B 3EDKA 3G5ZA 4ZQTA 3P1VA 2AJYL 4JCLA 2OKMA 2JMRA 4JAMB 3MGOB 3WIHA 1L6PA 2WUCL 3B9KB 3IXTA 2YSTA 3DV6B 1E0OB 4B95C 1YNLL 3ZE0B 1XR8A 3TS8A 2E27H 4JKWA 3BMVA 4KMTH 2X2YA 4ZMPA 1AIFA 4R6UA 5E9DB 5I74B 3G5VB 1XBRA 3WMPA 4A2DA 1PFOA 1IGIH 2GTZB 3KGSA 3FYEB 1JV5A 3LRHA 4QY8B 4G7VH 4LL1A 3SBPA 4DF9A 2FECI 1IAII 3DJZA 1T1ZB 2B08A 4M02A 1FNGA 4B0MB 1A6UL 1FNEB 2ZONA 3DX8A 3U4AA 5HHXL 3KPOB 4CMHC 2Y6SD 5D8JL 2WZ6A 4MCMA 2MTAA 2QL1A 3BDBA 4JRYB 43C9A 4DPAX 1M6OA 2Z93B 4EEEA 2FO8A 3LNEA 1WG3A 4U1IB 3O6FC 4IYKA 4KH2A 5AYTA 3OAWA 1HNYA 5C1MB 2OW6A 3V5DB 3S8WA 1PZCA 1IGJB 1MRCH 4B0MM 4R0LC 1XD1A 3WXVH 1FIGL 3OSKA 1XGPB 1AI1L 3MFGB 1HEZB 2EDWA 1N6VA 2AK1L 4J6IA 4QRUA 4CSPA 1SOQA 1KTJA 2CJ3A 4S1QH 1JPTH 4PY8J 3R19A 1AQKH 2F5BH 3RL1B 4GIAA 4MXWL 3SODB 1JN6B 1NCTA 1TJIL 3HZKA 3L3IB 4QLRA 1AD9A 4WY7L 2E46A 4FLSA 3BP5B 1U93A 1KLUB 4KJQD 5K59E 3GK8L 4ZTOH 3S36L 1R0AL 2JJVA 4KK9C 4JPWH 3UABA 2BNQD 3QPQC 5JA8B 3EOAA 1GYVA 4OM1H 1GA2A 3HE7B 3X3GL 2HFGL 3P40A 1P7QB 1T1ZA 3NA9L 4YHML 3G5WA 3HNSH 2VLLA 4WJ5A 2PYFB 5CSZA 1DFXA 2EH7H 4YSTA 5ESQA 3BGMB 2V6HA 3D9AH 5B1CA 3VSQA 2GBAA 3VFWA 3R18A 2QDVA 2IGTA 2OTUA 3F64A 4RZKA 2UUDK 5KVDE 4ZX5A 4MNQA 5FLUA 1ZEAH 1TVDA 3D50A 2V2TA 1MFUA 1PZAA 1USQA 2ZXAA 5B38A 5H35A 4X6CB 5EF1A 2Z34A 4XNBA 3K2IA 4MLSA 1JTTA 5T5FL 2NYYD 2H2PC 1Z1WA 1KLFA 1NC2A 2ID5A 5F3FA 4M93C 1U2CA 3F6IA 1QD0A 2B77A 4TSCL 3TF7C 3DX9A 4Y2DB 4CJ0A 2ICEC 5ABZA 5CP3A 4TF4A 1NOLA 4IRJC 1JGEB 2OXHA 3ZTNH 3VD9A 3GSNB 1KTDB 1LTXA 4RRPG 5AVXB 1H3XA 1U3HB 5FYLE 3SE8H 1EV2E 1TZHA 2Y5QA 4JM4H 5D9SA 2ZXGA 2AQ3A 3KJ6H 3JWDC 1HJBC 2IAMD 4PJCF 2AABL 1KCLA 3BX7C 1U8HB 3STLA 3VFNB 1I7RA 4G6AC 4M61B 2UXFA 3NPZB 4B27A 4ZPTA 1BBJB 1UFGA 2DQJH 5T8IA 3DVNA 3EFDH 1T89C 2HVJA 3FCBA 3RZCD 4ENZA 3MDJA 1E3ZA 2EXTA 1WWCA 3SDXB 1EJ8A 2CRYA 4NLAA 5IB5B 3O3BB 1G0XA 5IJCC 5DZAA 3LKRB 1NINA 1OE3A 1TPXB 2Z31A 3OKYA 5PCYA 1MELA 3KG5A 1P69B 2JKXA 4JFHE 1UZGA 4ZUTB 3GIVA 3SN6N 1J8HB 4NM4L 1ZS2A 5AOIA 1RZ8B 2BRRL 2YAHA 3C2SA 3GBMH 4XPBH 4WKZB 4ZUUA 3ZE0F 1L9PA 1SLUA 4HPYL 2Z3FA 3RIAK 5F72S 3ZVVA 5ANME 5MEQB 3E9UA 4KOCA 2ZUQB 3T3MF 2ED8A 3T0AA 4WVRA 3QEQA 1ETZB 3GGWB 3QXVA 4ZUTA 3DIFA 4W9ZA 1E67A 1P4IL 5E6RB 2JB6A 1YNKH 4LKXA 4NT6A 5F9OH 5KYYA 4UT9L 1S9XA 3O6KL 3V52H 4KK5C 5I8EB 4X8CA 2WM0A 2CM6A 5E2TL 2NX5A 3QJRB 2R83A 3DX0A 3CMOL 2PO6A 3HE7D 3GXDA 4PJGF 2R4SH 1QMUA 3DGGA 4X6DE 4LLUB 5C6TH 2BXZA 2IAND 4PYHA 1IILE 5KSUA 2YUZA 3H4HA 4EI6A 4QF1A 3L9RA 1WEJH 4F58H 4DCQB 3VQ1C 3VGDA 3LIZA 3VW3H 5D1XE 3DX7B 4MHHG 2VN3A 3O11A 5I1KH 4TUOB 3BXNA 1MFDH 3L4WA 4YDVB 3PV6B 4XNXH 3F6LA 1XF4B 4N5EC 3IXAB 3O6FA 2AFNA 1FFOB 1URIA 2ZP9A 5IEKB 1Q94B 4P9HC 4FQJL 4LRNH 4R0LA 1QLEB 3QEQB 3RI5F 4AW4A 5K9JH 3CU7A 4CRPA 4JO5A 4KXCA 4LKCA 3GYRA 1J05B 3L1OL 5AW5B 5A2FA 2OYPA 4P5RA 2YPVL 1JS4A 3UERA 4EUPB 1AGDA 4MNHA 3N5AA 5K93A 1I8IA 3KEDA 2Q86B 1IEHA 3AAZB 3ES6A 3SDDA 1F0LA 1MFEH 2C3GA 4QXTB 2QQLL 2IAMB 2ZSWA 3EH4B 4GRMB 3D48R 3S97C 1Q94A 4HU2A 3F7RA 1I1AD 4NI3A 1WFNA 4BKLA 3D34A 1Y6MR 2XZQH 4CC4A 5IB4B 4AE1A 3MRIB 1T2XA 2ZUUA 1OTTD 1QFUL 3QNXA 3QULB 4HUNB 2CO7B 4HWNA 4AEHH 5JYMA 3ARSA 3TVMD 5GGVH 1OWRM 5DJAA 2KH2B 3COOA 4MGXA 1KLUA 5JW4Q 5D2NA 5DK3A 2NR6A 3KLLA 3P69A 2OMVA 4NQDB 1MFCL 3P3SA 4WWOA 3S2AA 2EICA 4CDHA 1IBHA 1T04A 1YY9D 2CALA 2XETA 3I50H 3LB6C 4L48A 4HUVB 3DGCR 3UTSA 1SLWA 2CJUL 2DV6A 1J8HD 4HPOH 1PIFA 1KENH 3VWJC 4E36A 3M88A 4FULA 1BBDH 3VWKA 1SEQL 2GSIA 4JN1L 3ZE2B 4FKKA 1G7PA 1ZT1A 4WI6A 4HUCA 2XZQL 3AGWA 4YL4A 3OQRA 1D5BB 1TJIH 3HBGA 1VGEL 1MWOA 1OT4A 4X5LA 3VXOA 3KXFA 3ZDXF 1FV1B 1D2PA 1W0WB 3QUKA 5FAAA 2D8KA 1CYXA 4GRLB 3QISA 1MVYA 2EDJA 3ZTNL 5I0VA 1CDJA 1D5MA 3LZRA 2FQEA 3LIZL 3DUSA 3B2MA 5AWNL 2UVFA 3MROB 4EN3A 4ZX3A 5IHZB 2V9UA 4F5CE 1G5AA 3VI3A 3B83A 1KELH 4U3SB 5D71H 1LO2H 3FO1A 3HW7A 4HG4K 4OLVH 2C9UA 2CWRA 4QNPE 2K6YA 3MJ9H 3SEPA 3HLAB 2H1LM 2XPZA 3IRCA 3LHAA 5AL8A 4UM8A 4HMEA 3KH4A 4FG0A 3UYRH 1FG2B 5B8CA 1KT2A 2NZ9C 4XNXL 1UA3A 3W5MA 4NPJA 2OQJB 3SQBA 2ZE0A 1CCZA 1EJ6A 1T21B 1CICC 3RGVA 3GS4A 1CYWA 5GS0C 5C92A 1LK3L 1ZA3B 5EBLA 3OQ3B 5ICXB 5FECA 5L2JB 3A24A 5DHVA 3IEAA 5I18L 2Z4QA 1BBJA 4RFOH 4XPGH 1SHWA 2MSPA 4Z3IA 5D7LE 2J4WH 4QRTA 2VERN 3DRTB 4XNYH 3ARVA 1SDDB 3O2WH 1GGCL 4OF5A 1JD9A 5E2TH 5E1QA 3P9WB 1XF2B 2FYYB 3SGEH 1YNTB 3NQIA 3FU8A 4HW6A 3QHFL 4FTVE 4G9DA 3T65A 3VD5A 3VFVB 2YD2A 5E5UB 1FVCA 5B8CC 1QRND 2ICEA 1CDYA 3ARBD 5J11C 3BHBB 2NSXA 1UB5A 4LPVA 1AQ8A 3QXAB 1W80A 3VA2C 5I6KA 3CWGA 1M05B 3L2LA 3BYYA 1K8IB 5F88A 2CDEA 4OFYA 3M1OA 3H3KA 1BZ8A 1RJYA 4NZFA 4M1CD 3D52A 5FK9B 5GGVY 2ZJSH 1IKFL 2A6JB 2RFXA 5CEYA 1ES0B 5AYQA 1QA9A 3TN0A 3QQ9D 4PRIB 1K6QL 4LSUL 4L5FL 1MPAH 4GQZA 1QLEH 3QXDA 5GRUH 4A66A 1XGUB 2EIDA 4LL4A 3V4VH 5CJXA 1QQDA 2D7OA 3S37X 3H9ZA 3DPBB 3WY1A 2XQYA 4M6NL 2HKFH 5J9PA 3D4GA 5EO0A 4N25A 5BS0E 2F53A 4F8PA 5KVGH 1OAKL 4HEPA 3QDJA 4I8DA 5ANMB 2TRYA 5IROD 1OF0A 2CGRL 2JF1A 1ZCRA 4YPGA 4FQQA 2AJZA 2DQEH 2GK2A 4ONHB 5C3TA 3ZW3A 5IR1B 3LXBA 1IBGL 4HYTB 4DETA 4JPKH 3RIKA 2EE6A 1NOFA 4P07A 2X0UA 4N2MA 4FCAA 2Y25A 3QEUA 5J13B 2AMUA 2DQMA 1VGKB 5LBVA 1CDHA 2DKUA 4LCVA 4FMFA 3HE6D 3WE6A 4XC1H 5AW3B 1E4XI 4M8QB 1JNLL 3ATAA 4NBXB 3AUWB 3KPNA 4NIKB 5FYKH 4O02L 3TH3T 5ADPH 4NKIH 1ASPA 4BK5A 4NNPL 3PXJA 4QRSA 2Y2YA 4Z76B 4ONFH 3NCMA 1DFBH 5K69A 3FFDB 4M6ML 2J3SA 3LAFA 5DHDA 3VJ6B 5ERWB 5ACZA 2XTLA 2D7TH 1L9QA 3BZ5A 3C6LC 3QQDB 4FFZA 5FM8A 5I15L 3MV11 4BCZA 3AG4B 5INDA 5L8JB 4AEIH 1D9KB 4AX3A 5JPNC 2OX5A 3FAXA 2QQQA 4LCUB 2NR6C 2XG4B 1XH2A 2WV3A 1S7UA 1LDSA 1MHEB 3II1A 5JMRA 5KJRL 2YPKB 1ZA6B 2AJZB 4R4FH 1OP9A 3GSOB 2PYEE 2WWMD 1CS6A 1UD8A 4PWKA 4TYUA 3AG1B 2V3FA 1SGKA 2BPBA 2E4FA 5IT2H 5D1QC 3TYFB 1PJ9A 1QBLH 2RD0A 3ME0A 3SGDH 3T0VA 3K2MC 8FABA 1OGTB 3ATEA 3D0LB 2LTQB 2W5PA 4MD0B 5AW8B 2WVSA 2X6CA 4HKJA 3RBSA 3Q48A 4WI9A 4UV7L 3RDTC 5C07A 3HUJE 4OZ4B 1SJHA 1Z0MA 2D3VA 2NY5C 3ABGA 4K7PH 5DK0B 4DAGH 1ZY9A 3STZA 4J12A 3CMGA 1I7ZA 3K6SA 4N8PA 3IE9A 2YC1B 4YXKH 3WL9A 5JW5A 3THMH 5JPNA 4DWHA 3U6RB 1UWXH 4WU5A 5GHWL 3C6EA 3O2VH 3P0GB 4X4XA 2QPFA 2Y7OA 2Y23A 1WBYA 1QZNA 3MV9B 2R2EB 4HIQA 5INDB 3V0HA 3T1WA 1Z5LA 2YR3A 4AH2B 4DGYL 1V8HA 4N8CL 2LHAA 4OY9A 3SDCD 3L1FA 4UB0H 5E6IA 1V5JA 2G2PA 2WVTA 3SO5A 4QHMA 3OXRB 3OKEB 3SZKC 4RAVB 4JR9L 1YEDA 2UX6A 3RDTA 5FB8A 4Y5XB 5KBKA 2EEAA 4L1LA 3WFBL 3T3ME 4YDLB 1JV5B 3ARFB 4KX9A 4QY8A 4WW2A 5E9AA 5FHBH 1NDGA 5LBSL 4N0CD 5TE4L 3O4LE 3GI8L 1WO2A 3OGCA 5D1QD 3UC2A 2Z65C 1QTYT 3DOSB 4JN2B 1KLFB 2BXYA 3FAWA 1PPIA 1RIVH 2HFEA 5IB2A 3UTTA 1O7VA 4G5ZH 2BSBA 2G30A 1NM9A 4HUWA 2HJFA 4KWUA 5KSAD 1UH4A 1TKWA 1S2EA 4LSSL 1I1FA 1JF5A 1NIEA 4XO4A 3D25B 3HE6B 1NCDH 1H0DB 1S3KL 1WICA 2ERJC 5HYSB 5H37H 5LGKA 5TGBB 4P2OA 4PTTA 5E4EB 4AMKH 3IM1A 1FSKB 1WSST 3V4VL 1CB4A 1BQUA 1J1PH 1YEGL 4NP4L 1UATA 4PREB 3H9YA 1WBXB 5FM5M 5IVNA 1IKFH 1T0PB 1TEGA 3MXVH 1LO5A 4O51A 3TPUA 3DTUB 3PLYA 4L0ZA 3VW3L 5KWYC 4GXFA 4OF3A 3EKCA 4P2RE 3TN0C 3ESUF 4D0CB 2QVTA 3LQZB 3PAUA 3AT9A 1YJDH 1D9KD 3IETB 5ACMA 1F11B 1X5XA 4Y5XA 1NPNA 4PJ5A 5DC4B 5LXGL 2FL5B 4Z7UA 4ZXBC 5FW8A 1BIHA 3ABZA 4BFEA 3HPLA 1A9EB 4G8GE 3A4EA 5DHXB 1TZAA 2F7QA 3TPUB 1QA9B 3WHE0 4NQEB 1I9EA 1XFPA 1YUKB 5GIRB 2XRAL 4DTGL 2ESVA 4MKTA 2CR0A 4ZAKD 5EFIA 4K4KA 3CC5A 4Y1AE 3G6JE 1B6DA 4AYSA 5C0EB 4FQXA 2EDEA 3J8F7 3K72A 1EWHA 3CZKA 3FK3A 4DVBB 4FNSA 1OB0A 3SE4C 1WC7B 4N6RA 3WG7B 3VD1A 5CKGA 1JZ5A 4LOUC 3AROA 5ITFB 1WT5C 3D3VD 3LQAH 3OSVA 4JGMA 1YEHH 3QUYD 4ADJA 5GIRA 2JKLA 2X05A 2Z8SA 2VABA 2OS7A 5IHUH 3L5WA 2J1XA 2V8LA 2WNGA 3IFOA 3ATDA 1ACYH 5LLIC 5EBGA 2O6EA 2ZOLB 3ARDA 4BZ1A 1FO0A 3MHZA 4C56B 4H0GA 1WGVA 5EBMA 4X5WB 1SYVB 4QRTB 4DN3H 2DQDL 1P0SE 2BHYA 4OZIA 5ACLA 3QO0B 3DGGB 3BWUF 3SDCB 5HSFA 4M8QA 1G84A 3DHJA 4H40A 1LO2L 4KROD 1UVQB 4Z6AT 1N70A 1BF5A 5E51A 4ABVA 4LLWA 3U1SL 3PWPB 5IQ9B 3NGBC 5E95B 4PGCB 5KS9A 5CILH 3WGUB 3EJZD 3U2JA 1E3XA 2BJML 2FX7H 4NC0B 5EU7E 1EHLL 1PF3A 4LGSB 2EXWD 4V2CB 3NFPA 2XVGA 4YDVA 3QQDA 1KB9J 2HT2C 2PXYC 3F8UB 4PJ7F 2PWFA 4RLDA 1P7BA 3W0WD 5I9QC 2ZKXA 1X5AA 4F8OA 5F9WC 2ZG2A 1U8IA 1QSFB 4A7TA 1OLZA 1S7XB 3EGXA 5C0AA 5JXEA 4HC1A 1YPZB 3GXFA 1E6JL 2VDRB 3MREA 4JFTA 4A2FA 5EIIA 2DQGL 2ZICA 4ZYKA 2ZTBA 3OB0K 4GPVA 4ZUUB 4PJGE 2AEPL 1CGXA 4GNKB 3DJSA 35C8H 3WTTA 2B0SH 4U6XB 3MOAL 3QORD 1A5FH 4HJ0D 2CG9X 5EWIL 2AAAA 3GINA 1N5AA 2E74C 4FL4C 1BYNA 4P57A 4JFYA 4IU3B 3S8FB 3ZKND 1OP4A 4YBQD 5DD5H 1CTOA 2G5BA 3SO3C 3MRHB 4WTWA 4RZCA 2HKHH 3MBEA 2YARA 3BE1L 4LP8A 1L9NA 4OUOA 4DK6A 2CO7A 5TH2A 4OB5L 1QACA 1GCYA 4I7ZC 3FU3A 5I1AA 1P1ZA 3AXLB 4MDJA 4ODUA 1PKQE 3VXME 5J06A 3CK0L 3DI2B 5D2LF 5CR1A 3D33A 2X4PA 3HUJA 2VXTH 4IW4C 3R0NA 2EIKB 2IAMA 2RTTA 4G82A 4R7NA 1MOEA 2BMKA 3MV7D 3NP4A 4G8EA 3CMOH 2HTLD 4WK0B 4HMCA 5F7EH 4JE0A 2YGNA 4TSAL 3AQZA 3RVWD 1AXTL 1OF2A 4U1HA 2OL3H 1I31A 4HA1A 4WEEA 4DSYA 3B9AA 1W72B 1KCBA 5E4OA 4ZNEE 3O3EA 2B4CH 2ESVD 3C60B 1MRCL 2BJMH 2EXYD 3CGTA 3SJVB 1WEJL 3LNHA 4QRPD 1TUPA 1WBZA 3WIHL 5C2BH 1Z2KA 5EU6E 4ZS6D 2VIRA 4JY4B 1NJ9A 2A6KB 3IDXH 5EU6A 2MOVA 1X5FA 5DLLA 3GBNL 3WTWA 2EVJA 2H2SC 4KI1A 3DXAB 3SBRA 4NC2B 2BS71 5EF2A 1PGRB 5K1JA 1HEHC 4FQ2L 5DUBA 5J9PB 4X5WA 4C4BA 1GH7A 3WO4C 5AOJA 1YEEH 2P3YA 4X6EA 2DAVA 4PBXA 4JVPA 4XN8A 3X13A 5EEWA 4E0RB 4DNLA 1K4CB 3FB6B 4HIEA 4KMTL 4KQ0A 5GGRA 3HB3D 2QPDB 4GO8A 3F58H 3QUXB 1DEDA 2WLLA 2F7OA 5J3HD 1FVEB 3U46A 4K23L 4FQLH 3RFZB 3MLPA 3VGAB 4N5ED 2B1AH 3ETSA 5EO9A 1MJJB 2ZOOA 3QIUD 4KRPC 4UIKL 2LAAA 4XNQA 5ETUA 2GEEA 1H15B 2P48B 5MENE 3B6SA 2FBJL 2AABH 3DYPA 1RUML 3D1MC 4OZHA 3H53A 4P2QA 1OARL 2BCKB 3RQ3A 2CNYA 1N3NA 2FYVA 2VLJB 3IS0X 3GJEA 4H5SB 3B4NA 1A9VA 2BSEA 1DLFH 1RJCA 2IGLA 3OKNA 4ODTH 3VRIB 3ZYZA 1RIUH 1FP5A 5D7IA 2DMKA 2VNCA 4TSCH 4NXKA 3L3GB 4PP2A 2R15A 4LCCC 3EYUL 4K3EL 3GEFA 5GGTH 4P2QB 3Q1SL 5DLML 3SGKC 2ZOKB 4I0KA 2H6PA 4ZMTA 5DMIH 5EORL 2R0WH 2GCYA 5C97A 4CSSA 1XIWD 4XMWA 3T0EE 4NO2A 1WCBA 2GK0A 5FIEA 2VDKB 1NUGA 5D7EA 2ZNWA 3MA9L 1H3TA 3LZNA 3GMPA 5C08E 4WFHD 3L3DB 1OSZA 2G9HA 2WLKA 1B90A 12E8H 5JO5A 4J8RA 2O61A 3IFLL 2WQSA 4KTEH 3AS3A 1DQLH 4MA3B 3O6FB 1DYZA 1E6OL 1MCIA 4R3SA 5DS2A 2E7BA 2FR4A 1PY9A 4PLKD 2NNFA 5F7DB 3FUIA 2D2CC 3ARWA 4G3YL 2GFBA 5D6DC 3CHQA 1NBYA 4H8QA 4XB3A 2YGQA 5MERB 1J86A 5TE4H 4F37F 3V8OA 1A6PA 3CLEH 2BRRH 3GSVA 3OR6A 4QXTA 1ZGLP 3FN0H 3QIBB 5LAPA 4OZIE 4M5TA 3GO1L 1NAMB 1XXDC 5I74C 1BZ7A 4LOFA 3EDFA 3MJ7B 1YPZA 3LQAC 4F24A 2I25N 2WGXA 4AM0A 4XXDA 4AZUA 4U6HA 4BFNA 2DMCA 4LOVA 5E6IB 1B0RB 3U82B 4TLUA 5E4IA 3DXAD 1L6XA 3HE7C 3NIGE 2HTKC 3BDYL 4WWKA 3H9SE 2RGSA 4PRPE 4XX5A 3VI3E 2R9HD 1LO3H 3NJGA 2YA1A 4PSPA 4UT7L 4Z7VF 4AZ8A 1I3RB 3U1PA 4RETB 4PJAE 3OPZL 5GRVK 5F21B 2ZWLT 4HKBB 1C08A 1JVOA 3H54A 3MFFA 3BRFA 4UNTA 3RAJL 5FCSH 2BVEA 2VWEC 1GPOL 2TSBA 3QUXD 4G7YH 4L05A 4OGQC 4XP1H 4POYA 3QI9C 1RD6A 3GKZA 5FFGA 1DJXA 2FQGA 1A6WH 2VDPH 3WDHA 1JNNH 3HZ3A 4Q58C 4W9LC 3KYNA 1JZJA 2BX5A 3B2UC 3NABH 3RZWA 2MKWA 5DYOA 2YA0A 4HETA 4KK8C 4V33A 2PXYB 1P2CA 3HR5A 5JA9A 1JGVH 4ZX6A 5E4AA 4G8GA 1IT9L 5EO9B 2WB7A 5AAWC 2DQUH 2QVIA 3RY4A 5BVJB 4RMWA 1QBLL 4F7KA 1N8OE 2EJ1A 4PJ5E 2JLPA 4NBYB 1ED3A 4PRNA 2Z1PA 4FLOA 5DQ9A 4XBPA 5I30H 3BT2L 3K1KC 2ATPB 3BCFA 4H8WC 5DZNA 3WN5A 4D9QD 3VFTA 1R47A 5D72H 5EDSA 2BNQB 4Y5VA 3VXRD 4OJCA 3TURA 5IWLA 3ASWA 3HN5A 3VG0L 1B4RA 2PYFA 5CSZB 1HJCA 4KVPA 3H7BB 2EYTB 4P2QD 2XNAB 1DQML 4GIOA 2LLGA 3T0BA 3K7UA 1F8TL 1CFTB 1PFCA 2HRLA 5KJ7E 2BVQA 4MCYB 2FIRT 5AZEH 5HHME 1PD1A 1XIWB 1MZYA 3MOAH 4J1UB 3RY5A 4M6MH 2BOCB 1O7DE 1HZLA 2IAAC 5FYJL 1F1AA 4Z76A 4HAGA 4QOKE 3Q5TA 2LGNA 3MLUH 3ZHDA 2EECA 5ADPL 5A6IA 2JJTA 1G5GA 3SBWA 4CNIA 3IN0A 5J56B 5HGHA 3HOGA 5FO9B 2AV7A 3EJSA 4L3EE 3FCTA 1VGKA 1SY6H 5E2UL 4HEMA 3HG5A 5AQ0A 1T04B 1JWMA 3LEXA 3QR2A 4GRWF 1YY8A 2IAMC 4OLYH 4G5ZL 2C9XA 5JYLA 1CG9B 1BV8A 1BXXA 1FDLH 1OSYA 3STLB 1CK0L 4UT6L 4NZTL 3HNTH 4P06A 2OCCB 5FWRA 4UYPA 4DW2L 4IRJA 4KXZH 1I1FB 4PJ9A 1FUNA 1M6UA 3CFTA 4NKDA 4FA6A 2PCYA 3VDCA 1PQZB 2L04A 4PSRA 3W56A 2CO6B 2FSDA 3MNVA 4YXHL 5HHPB 2DWYA 2H2PD 2MEJB 5DSCB 4XVTH 3C9NB 2GUOA 5JW3L 2XUWA 1EANA 3QJZA 4RRPA 1ODUA 2WNXA 3VWJB 3BQVA 1TQWA 1L6ZA 5AVUB 4G80B 3UBGA 2LW3A 4FTDA 4MB5A 2IO5A 1RURH 2EYRB 2AV7B 4HKZB 1IQWL 3SE9H 2CJTA 4YXKL 2H6PB 4KVNH 4ZSOE 4XC3H 2Z31C 4WU7A 1FO0L 4TSBH 1U8OA 2O5ZH 1FZKB 5GGTA 3QHFH 5DGRA 1OGPA 5TQ0L 1JF1B 5JIMA 2PXYD 1G9MH 3G6DL 4TVPL 1YYLL 5IB1B 3KWWA 4N1HB 3U9UA 1IC7H 5DEFA 1KLGA 5LGJB 3AFLA 3FFOA 3DRTA 5CFAA 2B1OA 4CDGC 1QNZL 5D1ZD 1RULH 5T3ZH 2R59A 4WUKH 1JGIA 4N2OA 1DBAH 1NCWH 4FA7B 5JORB 2VL4A 4NWTL 1ZEAL 4Q6IB 1SPDA 3GF8A 1I7UB 2QPUA 4U1JB 3L4YA 4FN0A 1EAQA 4L2YA 5GZOA 2CMRL 4FG6C 5HY9B 1E5UI 4JRXD 4J7RA 3G08B 5CEZH 1W72L 2Z93A 3AREB 4OV6F 3ZDXE 3PWLA 2CIIA 2J5LC 1QBML 1LWJA 3FSWA 4LLVA 1NDGB 2VDQL 3GUTB 3RI5K 2HWZH 4X0KB 4PVMA 1Q90A 1CFSB 1IM3A 2DQUL 3G6JF 4L8SA 4YXLL 1C5DB 2DQHL 5IEHB 4GG6F 2CDFA 3VCLB 1W0VA 3MRRB 1F00I 3FQUB 2UWEF 3CIAA 3VI3B 5DVOA 2EUZA 3X12B 3QI9A 1JPSL 4OCLC 3NABL 4NJ9H 4HUXB 1SXBA 4UTBL 4M4PA 2MQ0A 1P4BH 1FPTL 5D7JD 2PW1A 3ILPA 1EXHA 1QWNA 1UYWL 1YHPA 3QZMA 4GAGH 1WWBX 2IF7A 1YEFH 1UXSB 4JZOA 4MYPA 3RWEA 4AGPA 4AIEA 4KJQC 3HKFA 1TQCB 5EHFA 5HYQA 2GJ6D 4I4WB 4YSRA 1HH6B 1PZSA 4ZMAT 4FAAB 2DQEL 4HFWB 3QUGA 1E6OH 4GKNA 3K6SB 3C6LB 3X17A 3MBED 1D7FA 2NXZD 1BEYH 4H88L 5T3ZD 3MRDB 4LF3B 1KFGA 5CJQH 3D2UD 4NQCA 2TAAA 4L8SC 5C7XL 4UOZA 4ICWA 2OZ4H 1DBJH 2X2IA 3ATBA 4JO2H 5HXMA 1CQYA 3UL4A 4I5BB 3VFOA 2VC2H 3IRPX 4G7VL 4E5XB 1KBGH 5A6MA 2ZD0A 4RBPH 3MRLB 4OZGF 4QOKD 3UBXI 1YPZF 2ZG3A 4WUKL 4MMXA 2FJFB 4BGDA 1LJMA 4OM0H 2YO3A 4JO8A 1WVZA 4NZTH 4N8VB 4GQ9H 2E7LA 2XFGB 4YHZH 4NPYA 2OX5B 2KT6A 3S7GA 2H3XC 4ZS7L 2ZT9C 2BOBB 2JKSA 3FRUB 2IQ9H 1SVCP 4XVSL 1LEIA 2P1YA 2PPAA 1IKNA 4FQJH 4F2EA 2HFFB 5ID1A 4JJHA 5IVZB 4DFHA 3H42L 1EO8H 2ZUQC 2VLJE 1TQUA 1PCSA 4HAFA 3V4PA 5IY5B 5AW4B 3BXNB 2Q8AH 4F7EA 1QPPA 5AKRA 5IMKB 1CD9B 4H8WH 3BPOB 2N59A 4F7PA 1Z5YD 3OB0H 2YZ8A 3GXNA 4OFVA 3U79A 1BZOA 3FU9A 4X9GA 5FYKL 1GGUA 3ARED 3VQ2C 2WQ8A 4K3JH 4OFYD 5DJ2A 1HOCA 4RGMC 1B3IA 2DQCH 4Z8FH 4IDJL 1AY1L 1LO4L 1MW0A 1NGWB 3UCRA 2R69A 3MRHA 4M6OH 4N20A 2ZQKA 4JFDA 4YWGH 2UY6B 4MA8H 4PRNB 5G4OA 2WSDA 4JY6A 3QUXA 4NX0A 2QSCL 4BGLA 4Y2NA 2IDSA 3DIFB 3IFPA 4LGPB 3CE1A 5DD0L 1D6EB 2RAMA 5I2IB 2H26B 2IOMA 4HUXA 4ZOCA 1XGZA 3B3IA 1FBIH 2YD9A 4HCRH 3RL2B 1WAAE 1T89A 2FBOJ 2JWYA 3MROA 4R90H 5TQ2L 1H6FA 4U1NB 3G04B 3ARGB 3KBHE 2IALB 3H4FA 4YC2B 3C6LD 3NZ8B 1BQLH 2BZ7A 1GS6X 2KHAA 1JF6A 3MBEB 1A2YB 5FUZH 5IUSA 5EOTA 2JJWA 1MFCH 1AHWC 4NWUL 3NFSH 4NHCH 4FI7A 4PRID 5E8NA 2EIBA 1G7PB 4N2GA 3RX5A 3VXUD 4GEJA 5EMYA 1WHPA 1CT8A 4EKJA 2NT0A 3T6QC 5EULV 5IB3A 1Y18B 2ZXCA 1KC5H 2GAZA 4GFTB 5EC1A 3TJHD 4XODA 2AZUA 2H47C 3TO2A 3VXMB 1PKQB 5DK0A 4D9RE 3GZQA 3BAJA 4FJYA 3IJHA 5B7FA 3D30A 3MGTA 1KGXA 2P7TA 2Y1ZA 4K07A 3OKNB 5DJCB 5E8PA 1S78C 1NCAL 1Q9OA 2H6UA 2WXPA 4OW6A 2WBJC 5AOLA 1AC6A 4HQQL 5GGSY 4CVZB 1IM3B 1JUFB 1N8ZA 4JREB 5EC2B 4FQIH 2XQYG 4OBRA 4Y5VB 1PJWA 1ID5I 2EEBA 4GMTL 3LS5L 3VXNB 2XQBH 4X7TB 2GYSA 3IN2A 4OB5H 4GI8A 5EFIB 3LCYA 4OUUB 5HBBA 4WF7A 4D2NA 3FUJA 1SM3L 1BZEA 5EEVA 3QIBA 3RP1A 3P2BA 3RTQA 4DZ8A 3DUSB 2GBVA 3MJ9A 4XP5L 1KXQE 4G9FD 4MXVF 5E03A 1WITA 5I1DA 1MY5A 3PGDB 3B34A 2KI6A 1QNZH 1UEYA 3F00A 1DUYB 4K3EH 2K8QA 5GGTL 3E80A 2ZNXA 4RA0C 4Y8AA 2AQPA 1A6VH 3VWKB 2JLLA 3X1BA 5C6PB 2R9HC 1GHFH 4ZFGH 3MGTB 5F1KC 1JPGA 4FJ6A 5CZXC 2CDGB 4XO3A 3FTWA 1PL3A 3ZT5A 3ZGHA 4ABQA 3A6CL 1F4YL 3IDYC 5D7JC 5EZIL 4DKEL 3Q2VA 1FRGH 5IMLA 15C8L 1YY8B 4XN1A 3REVA 1CLYH 1PDKB 5EPMA 4Z7OE 2WOYA 5ISZD 2JI3A 1RZJC 2CUAA 3G9VA 2OZ4A 5EU6D 2FX9H 5TTRA 5IFHH 2EDRA 4OCSH 1DVFA 3MXWH 4I77L 3F7KA 4MTMA 3WD5L 1DSFL 2APXA 3QT2A 2F5AH 1CGUA 5E8DL 1GC1L 3QHZH 4GS7B 5DWPA 1OL0A 1TENA 5DYFA 1ETZA 4Z8FL 1EAPA 2NQ3A 3POHA 4QT5B 4TVUA 2UYLB 1CFNA 5GRXG 2VXQH 1UGNA 3U0PB 2QQKL 1U92B 4HIXH 1NGXA 4Y4HA 2DLTA 5JNYB 4K5OA 3C08H 2X12A 1R3KA 3M6DA 1AP2A 3CFIC 4MS8D 4HWZA 4MMZB 4MD5B 2B5IC 1FI8C 4OCSL 1LILA 3ROOA 3VMNA 1A4KA 1W6WA 1I3GH 1G94A 1RP9A 5JQ6L 4DP5X 4GKSB 1TYEB 5HHVL 3TBYB 1IEAB 3CZUB 4Y88A 1XF2A 3F84A 3V4UL 5AAPA 4XH2B 4ZTPL 2OL3L 1Q0XH 1T3FB 4OKVB 3QI9D 3KYAA 1QO3A 1VAHA 4K7FA 4NUJA 4HZLB 1CFMA 1BD2B 1DO5A 4HSCX 5L2KB 3DUUB 3A22A 1CLOH 3QZOA 2PPCA 4P46D 4P2AA 4GSRA 2PW2B 1MCBA 2FEEI 4WWNA 1GRWA 2VGLM 4GG6A 4TMPA 1JZ2A 3OF6D 4EI5A 3X3FL 3TBCA 4F7MA 1JV2A 2YPVA 4GLRI 1S7WA 4Z18A 1R3IH 3GMRA 2EDBA 1IKNC 4YX2H 4QTIH 2WLZA 4FXGC 2AJ3A 4YIQA 4F8QA 4XXCC 3SGJC 2JTDA 4F1ZA 4GI6A 1KNOA 4L5FE 4CC4C 5ALCL 2IH1B 1XCWA 2CIIB 3RWGB 4M48H 1BVLA 4L9LB 1A9BA 5MEQA 4J3OG 3FOLA 3P0VL 4FFYL 4P3DA 3UTZA 3SYOA 1X6LA 3F3HA 3FRUA 2CA3A 4V1DD 3UTOA 3X3GH 1PKOA 2DD8H 2A6IA 3VWKD 5E00B 1DO6A 1IT9H 1J0IA 1JPST 4APQC 3UAEA 3GK8H 3CFQA 1TZ8A 1TYJA 3P54A 32C2B 4N0FA 1DVTA 1CQKA 1BZ9B 2G0LA 2RQ8A 3N1QC 2P5ED 3BAYA 1YECH 3ZTCC 1YUHB 2L7UA 3GSXB 4JFFE 2X1XR 3MA7A 3NN8B 5ISZB 4AQOA 3VG9B 1P4BL 2Z0BA 4R8WL 1UOKA 3BWSA 3QA3A 5DMKA 3T4YB 1PSKH 4F33B 3D3VB 3KWWB 4JR9H 4R7LA 3QQNA 4N2AA 1GMIA 1BIIA 3HHRB 5EZJA 3KL5A 4OCXH 3VFVA 4ATTA 1FYTB 3OMIB 3CD4A 3NJKA 4GEIA 4N8CH 2CE6A 1BG9A 1UWGL 2WQWA 4L4JA 4NI6A 4ODHH 3D6GA 4GSUA 5EO1A 1HINL 2WW8A 5HJ3B 3AWEA 4PJHE 3BSGA 3KBPA 1WZ1L 4JY5H 3W39A 5I6OA 2IQAA 4FP8L 1BYOA 1FJ1A 1IGFH 2APTA 4KUCD 3JWOH 3SDAB 3H9HA 4WK4B 2HX9A 3TIEB 3U7WH 5AENA 4CBZA 1BGXL 4U1KA 1J5DA 2B14A 3AU1B 2LVCA 1C7SA 2VE6B 4MDIA 4D0CA 1I9IH 4G1EB 5I28A 1NCGA 3MVSA 4YHKH 1DN0B 1FH5H 1H3PL 2ADGB 3VTAA 2Q2LA 4LPYA 2X6AA 4OJEH 4YJZL 4H8WL 1UD2A 3GUFA 3L7FA 2OQJA 1XCQA 3L95B 3ISYA 3W82A 1C5DA 4HS8L 1L9SA