5KWYC

Structure of human npc1 middle lumenal domain bound to npc2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Niemann-Pick C1 protein
publication title Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kwyC00
3M7OA 1AHMA 1KTJA 1WRFA 5IJCC 2Z64C 3T6QC 5IJBC 3MU3A 3FXIC 3ULAB 3MTXA 3B2DC 1AHKA 2HKAA 3WEBA 1XWVA 1NEPA 3RG1C 2Z65C 3VQ2C 2E59A 2F08A 5KWYC 5IJDC 3WEAA 1A9VA 3VQ1C 4G8AC 2E56A
chains in the Genus database with same CATH superfamily
4MXVF 4AE1A 2X87A 3UACA 4K71C 3EJTA 1QA9A 4N0UA 4I3RL 3APNA 5DZVA 3SHSA 1A9EA 4JPWL 2Y3AA 2OMWA 5FS5A 4PH8A 4Q9RL 2OLDA 1NWPA 3WTYA 3QORA 5I6PA 4MJ5A 2VSCA 1PAZA 4OLUH 5CCKL 1INDH 3IVKB 4I0CC 1KCSH 1ZRUA 1VHPA 3AT8A 3C6SA 3ES6B 2B2XL 2NDGA 2WO4A 5H37G 3ARXA 4G3YL 3AVEA 1U4EA 3DVFA 5I6OA 5EHFA 1IBDA 2JKSA 3BZDA 4HBCH 3CDFA 1NZRA 2V2TA 4BFGA 4DTGL 1A4KA 3NZ8A 1FIGH 3UERA 3FQTB 2MRYA 1ACYL 2WM0A 2DMGA 3UO8B 2JKIS 5I8OH 2VNCA 5C0RH 1HE7A 1ZWIB 3BZ4B 3U46B 4OGXL 3FFCB 4TTGA 4HUKB 4L37A 4QXTA 1PY0A 4FG6C 5AD0B 5DMIH 3V6ZB 3E0GA 3E6FB 4OCLC 4L4TA 1NMBH 4N1HB 1HXKA 4PJXA 5GSVA 3RVVD 1L6XA 1TQSA 3JUZA 2YZ1A 5A2IH 5I1DA 2HMIC 4K3JL 2BINA 5AAMA 3FTWA 1S78D 2NXYC 2V17H 5DLML 5KSUA 1PLBA 5GS0L 2XYCA 4NDMB 4YHZL 1R5WB 1J0JA 2EO9A 4NPYA 1MH5A 4XCNA 3V95A 4JDEB 5JR1L 1OB1A 1THAA 2WUBL 5G2NA 4EQ3A 1EEZB 4ACPA 5DRWB 2EYRA 2P5WA 2BNUA 2R29A 1HT6A 1ET8A 2VMJA 2AJSH 3RZCC 4A1RA 3RFZB 2WKGA 3LDBC 7CGTA 4GLRI 1MVUB 1NKOA 1EGJA 4B9JA 5EUKB 2A9AA 4Y7OC 5LAXA 4ELME 4OZGE 2G30A 3W0WA 3QUYD 3JBG7 5MP6H 3ZBMA 1PZBA 4MJ6B 4HFUL 3B9KC 3VXOB 1LEKB 2HVKA 2PWHA 2QKIA 5KSAC 2NUTA 1KJ2H 4QO1B 2ZWYA 4GFTB 5KYWB 1RUPL 4TQ8A 1GW0A 3PJSB 1UM6L 2CUIA 3QJQB 4P04A 4YX2H 4KTGA 5I5IA 1J10A 2EIBA 3KBPA 4GJTB 4GW5A 2WMPB 4KJQC 1C16B 2JQZA 15C8H 3I9PA 3TIDA 1KB5A 4OGYL 3RWJB 4ZNEA 1N4XH 4K2UH 2OXGB 2O5ZH 3LEYL 4Z0BL 5CCJA 1HHJB 4H26A 1FDLH 2XACC 1MY7A 4GEIA 1JZ5A 2YK1L 2X0VA 3K6IA 5MHSD 4K5MA 1BG9A 5D4HA 2BVPB 2XG4B 4ODXA 4YFDB 4WENB 3PFQA 3R7QA 2KYIA 4QOKE 4I2XE 2X4SA 2I9TA 3UYOD 3KPNB 4DO6A 1O7SA 4J3VA 3S4SB 4PJCA 1H5BC 2JQAA 3LEVL 4OIBA 3ZDYF 5F88A 2A6DB 2C8NA 3BXNA 1UFGA 2CA3A 4JFZL 4JY6A 2COVD 2DL9A 5IBTL 5AKTA 4LQFL 2XV2A 3VACA 3BGFB 3SBPA 3O6ML 4LVHB 3VD7A 4FG6D 4WNJA 2IAMA 5SV4A 5I1GL 2A77H 2G0KA 3TO2A 2E7BA 5AENA 2HMID 3QIBA 2VLJA 4I9WE 1KYUA 2V5RA 3L4ZA 4N68A 3UZQB 1Z1WA 1JBJA 2NXYD 1QNIA 2EABA 3TEZA 4K4KA 1XZ0B 1N12A 2F7IA 1CGXA 1IVLA 3FUIA 3NCJL 2OW7A 4DGVH 2M1KA 2H6UA 3O2DA 2FK9A 4JANB 3WE1A 5ICZA 3F04A 3MCLL 2GSIA 2VR9A 4AKOA 4ZO6A 3RZCD 5DT1H 4E41A 4LRIC 3QDAA 2ZCKH 5E03A 3M88A 4HJJL 1LEGA 2ED9A 4F7MA 5IB4A 2FX7H 1BVLA 4W9ZA 1J7VR 1BGXL 3OPUA 4H5SA 2ATKA 5DQDL 4IK7A 5DJYB 4XMLH 1QSZA 3VXMD 3B9KD 1NGPH 2ZXBA 1YQVL 1NDTA 5KSAD 1YEGL 3QO0B 5IW1B 1SN5A 4D7PA 2RIKA 2I85A 3HNSH 4LLUA 3OWRA 4UM9D 3O8XC 1TTFA 1CE1L 3PIQA 3WEAA 2GK0B 3JYCA 1MCDA 4XRCB 2A83A 4NQEB 4PRHD 4NWTL 4YQXH 1E2WA 4KJQD 5ILTL 1E9PB 3SJVA 4HUVB 4ZPVA 5C6TL 5DMJB 4WWKA 3M1BA 1DVFB 2C1OB 5I76A 1OE1A 1U8OB 2ZOOA 4OH2A 3U9WA 4AK1A 4GKSB 4RDBA 1ZK9A 4NQDE 4ZQTA 5I16A 4C56A 2O61A 1EANA 3GZOA 4CVXA 1BIHA 3QNFA 1ZPUA 2DLGA 3DJTA 3H4FA 4O02A 1SBSH 4QRUB 1GHFL 4YGVA 2JXMB 4M5ZL 3Q8FA 3X12A 3JTSB 1PG7W 5EU6D 4F9PC 1WG3A 4EN3C 5DO2C 4Y5XC 2YRLA 1GSKA 5CJXC 4AV4A 3HMXH 3IF1A 5DI8A 2NSMA 3H3BC 3O11A 5F1IA 5JIDA 3CSBA 4GRWB 2EDDA 4DN3L 4L3AA 3C2AL 4OI8A 4TNFA 3KPPB 3SY0A 4R5VA 1N8OE 4GRWH 2AJ3A 3QUYA 1MF2H 4BHUI 3C5SA 2X9YA 5A7EA 2APTA 4GMSL 4AUYA 3ULUE 4ZRGA 1KGJA 2VABB 4U1MB 3MNVA 5DS8B 4BA8A 3WTWA 5D5ME 4HIIA 4OZIF 3WL9A 3VRJA 2ZOWA 5A16A 3SPHA 1DYZA 3ZE1E 5BUGA 2FWOB 1B0RB 1XEDA 3EDJA 4BGLA 5CGYC 5I1EH 2EXSA 3EYFA 4GP4B 4P9HH 5AW6B 3BRFA 4G7RB 3IXAA 4HALA 2UYLB 1BDYA 1R3KB 3H4HA 1RZQA 4IOFC 4F7PB 2B4CH 4HGWA 1EBPA 3VDBA 3IU4L 2XZCH 5I15L 4P5SA 4O5LL 5I0DA 3DHJA 4X6CA 3NGBC 3NIFB 4KPHH 5K69A 1HJCA 1A0QH 4HF5H 1ZS8B 2CU9A 3IPFA 3O8XD 4QHPA 5F21B 1HYSC 5HHXH 1EHXA 2GUYA 3B7SA 3LD8B 4WUKL 3CN3A 1T5WB 2FX9L 3FCUB 4Y2DA 1D5XB 2V2WA 4WFED 5EBGA 3HPJB 5BO0D 1LJMA 4FMKA 3PWPB 5CN1A 1E8XA 5F8RC 1QLEL 1TITA 3B3IA 4OFKA 4WFFD 4BA0A 2YLKA 1P1ZB 3D08A 4P57A 5BPPA 4UDTB 5CUSL 1YNTA 5DJXB 5IFHH 1F4XL 2XQYG 4AC4A 1E50A 1L0YA 3C9NB 3LQAH 2DTSA 1MUJA 1BZ8A 4IDLA 4AEEA 1ZA6B 4XPTL 4PJ5B 3N1FC 3QJXA 5BOZG 2FQEA 4Y4HC 1WAAE 4YMPA 1X5IA 3M45A 4XCCH 4PCTA 3VH8B 4EN3D 4QGYA 1FHGA 1P4BL 5E9DD 5DO2D 1HDMB 4HG4J 3Q43A 2V4LA 2G5BB 1UEMA 3RZCA 4XC1H 1BJ1H 2XWTA 1ETZA 1ETB1 5TTRA 1A8ZA 1SOQA 2VUOA 1F3DJ 1PEWA 2A0LC 1IBHA 2AGJH 1VACB 3DX0A 4BRJA 2O30A 4RZCB 1AY1L 1CDBA 1DSWA 9PCYA 4HZ1A 1HESA 3VXMA 3FFCE 4QOKD 3MOAL 3BKJL 4JVUA 3EHBB 5KSAA 4WHDA 4YSUA 2NW3B 4Y1AE 4QEGA 3BUPA 4JM2F 1KWGA 1OZTG 3IMVA 1NFDB 4KDTC 4C58B 3EG9B 4MQ7B 4QMEA 2YKKA 2UZXA 4AVJA 2FUTA 1SYVB 3DVNA 1ND0A 4XWGL 2EUVA 4O58H 4HXBH 2Q0ZX 4PWEA 3VO0A 5KVGH 2R0ZL 5CGYD 1MLCB 3ATEA 1C12B 1VGKB 3P0GB 4PLJC 1UJ3C 3MV8A 3MX0A 4L8CB 4XCYB 3AQYA 3BVUA 4IOFD 1BYOA 4PGDB 4P2AA 2H47C 1YEFL 4PJ7F 4GG6E 3BAXA 2SEBB 3O4OB 1K8IA 3EJYC 4JQIL 3RNKA 1YN6A 3MJ9L 4J1UB 1H5BA 4FYTA 1HYSD 2CPUA 2ZWZA 4U4IA 1QFHA 1F18A 1EDHA 1PZSA 5LLIC 5EU6A 4BFEA 3QGVA 4WY7H 5LBGA 3MA7A 1O6SB 4E9QA 4HOZA 1E4WH 4OLWH 1T03L 3MOBH 2E75C 5L2JA 3QXAA 1AFVL 2UXFA 4PGBA 3P2DA 2DKMA 4KOCA 4WEMB 3UPRB 5E9NA 4YFEA 4BQ6A 1IFHH 1F4WL 3QPKA 4JN1L 1T04B 1IGFH 5J6HB 3BWSA 2YMOA 2HWZH 4X50A 5E8EB 2ZG2A 3I02B 1A1NA 3UH8A 5LWYH 1E5BA 1W15A 4Y4HD 1KTLA 1WFJA 1JYNA 2BWDA 3V0GA 4PD4K 1U3HC 3ZL4H 2R1WA 3AMKA 2PP7A 4PRAB 2GITB 3GZKA 3RAJL 1KG0A 3NCMA 4S0TD 5BRZB 4LRIA 1CLZH 1YYLL 4ZMZA 5SV3A 3QP3A 4L8BB 4KKAC 5I0WA 1G9MC 5CLWA 3LZLA 1CLOL 5TE4H 5JXEC 2A0LD 2IDTA 5DVOA 1A6TA 1IGML 2NCEA 4JKMA 4W6YB 1ECYA 2DQIH 5IROA 3PDDA 4Q74A 5IM7A 1AHKA 1ZT4B 3OXRA 1JNNL 5J13B 5EF0A 1WQVT 1N7MH 3U7WH 2YMXH 4X7DC 5CWSB 1DJGA 4L0PB 1I7TB 2VXSH 3LRMA 2AJUH 1AC0A 1WWAX 4D9RE 3AXIA 2G4GA 1HWWA 1MPAL 3BKCH 4MAUL 2Y7OA 5MERB 1CBJA 1J48A 1FFOB 1CVSC 3GSNH 3RWDA 1XT5A 2N0KA 4OJCA 5GPRA 1TT6A 3AG2B 4MS6A 3KL3A 2KI6A 3R0MA 1AS6A 4OZFG 1ZKAA 4GAAA 3PWLB 2EIMB 4CBPA 4PLJD 5CJOH 5I6MA 5EBMA 2QSQA 1A25A 3WE6B 4AJWA 4PVLA 2FO8A 1M3JA 3QIWB 1IGIL 1TPXB 3T4YA 1E5CA 5ITFA 1YO4A 5ETUB 1HSBA 5HJDA 4NWUH 1FLTX 3C5XA 4UQ2B 2P42B 3RTQA 2F15A 3CX5K 3EZJB 1WGVA 3EJYD 4KI1A 3B9VA 2WSDA 4RVBA 2L3BA 1CDYA 2WTRA 4BHUA 1E8YA 1MJ8L 2BIQA 1PZ5A 2JI1A 4PRDB 2BSSA 1QFUH 5HYJD 3P3SA 4Y5XA 4ZYKB 3T0DA 4QHMA 4FNLL 4L29B 4B9GA 3P77B 1J0KA 4N28A 5C07B 2R2EB 4OCWH 5EO1A 2BPBA 2VLRD 4K23H 4AMKL 2MPAL 3RNQA 5B3NA 1KPVA 1L5GA 1JZ8A 1KPRB 3QHFL 2F1EA 1GGUA 1B4JH 2J57A 2X5PA 4I3SL 4QTFA 1JWUA 2WLIB 4MZ3A 4YLQT 4YGAB 5IZ7A 3GXUB 1B4RA 1JCKA 1AOHA 35C8H 3QULB 4NQEE 4PJIB 3RL1B 5I1JH 2X1PA 1HJBC 4KRNA 4WSKA 3DUSB 4XNDA 1U3HD 3RFZC 2JB5L 2ZXWB 3L5XL 3R8QA 5TDPB 3GWJA 4YK4B 1D2PA 3CZJA 4L3CA 3G9AB 1QTYT 3QQ4A 3SE4C 4G5ZL 2ZOUA 1X5XA 4D7BA 2W65A 1AQ8A 1NLDH 4KKAD 2XKUA 2Y2WA 3JV0A 5JXED 4EJ1C 3TNMA 4AY0A 3C60B 4KOBA 4FZEH 2ZF9A 5HYEA 1Q9LB 3OKYA 4Z7NF 2Z35B 3HZKA 3L3OB 3NZHH 3H9HA 3IU3B 4XN7A 1TVHA 1AIFA 1F4YL 3R1GL 4NQSB 3W3BA 5LBSH 1N8ZA 2VO5A 3I85A 2WCGA 2OMXA 1R3JB 4RMBA 4NO5B 3D0LB 5C0IB 3OMZA 3BHBA 1MFBL 3VVVA 5HSFA 4G8FB 3VAEA 4ZW8A 3B2MA 2DQHH 1KGXA 1TNMA 1CZ8L 1H3PL 4DFHA 4XBPB 2DWEB 3HNTL 3NBNA 4IDJH 2AFNA 1ZA3A 3RPIA 4MZ2A 3WNNA 3WKNA 2GJ6B 5EZJB 2BSRB 1KB3A 1F97A 3T3PE 2YSTA 3QEQB 5HDRA 2LAAA 3W9EA 1ZE3H 5F7KC 5C3IA 2WZ5A 5EIVA 2IQAB 1DE4B 3VFGL 1DO5A 3FFCD 1XD0A 4YHPA 3Q5TA 2BP3A 1NIBA 3EFDL 1D7FA 3G04A 3BGFC 5D6CB 3LB6C 4XI5C 5EZIL 3UGXA 1LDPL 1V54B 4LVHC 4RISL 4P23B 5DMGC 5KN5B 2H6PA 4XN8A 3VX1A 2F1AA 4DZBB 3VM7A 1UATA 5EWIL 1EDQA 3MRKA 1U91B 4JFFB 3WNKA 4ATTA 2AF2A 2VC2H 3U79A 2V7HA 3WFZA 1CK0L 1MN4A 2GC4C 3BDBA 4KRLB 2AEIT 1S3KH 1MFEH 3NIFE 2HJKA 5CIPB 1IT9H 2WBJB 4LIQE 4NFBA 3BWZA 2X44D 3D06A 3QIUB 4HD9A 3R06A 3D25A 5G4MA 4OJFL 2Y6TE 3PNWB 4IBLT 2H9GA 5AZEH 5HHOA 5I1IH 5EOCL 4MXWL 4X5RA 2BW5A 4P05A 4G80B 3PJNA 2VR8A 1CFBA 3V0FA 5JHDB 1QBMH 1VCAA 3GMLB 4KHTH 4BCZA 2PP8A 2OMZB 1U8IA 4H8VA 5EU4A 2XV0A 2CQVA 4FNTA 3LH8A 4HIEA 3TESA 4RDQG 3ZGHA 5ALCL 1F8TL 3T08A 3RWFB 4LL9A 4DZ8B 4TNGA 3PGFH 2N59A 1U9KA 2YAFA 3MTXA 4WZ9A 4OLEA 4OQTH 2WY3B 5I18H 1JZDC 3PHAA 4Z3FA 1BFVL 2IEPA 2HFFB 3G6JF 3OKMB 4QRSA 3ZDXE 4R7NB 5HJGA 1U8KA 4MHHG 1HZHH 1F6FB 4AH2A 4PG2C 4GBXB 3PWVA 4LLQB 2R69L 1DVFC 1Q9WB 3OAZK 1A6PA 1A6VL 1WD8A 1KSRA 1DN0A 1RH8A 2OPCA 4WW1A 5E5MB 1ZT1B 3GJEA 4M43H 4F8TA 1BV8A 1SZNA 5JW3H 1EZLA 4F2MB 1MNNA 5IFJA 3LZPA 2JF1A 1LD9A 1AGBA 5I17B 3ORJA 3EDEA 5KBDA 3CVBA 4WJ5A 5EC1B 1DBJH 3S34H 3P2TA 3LB6D 3MJ8B 3PUUA 4XI5D 1WC7B 3UZVA 1Z32X 1MCPL 1YMMB 2RHEA 5DMGD 1TJIL 1U3HA 3NA9L 1JMZA 3LNDA 1U8MA 3EFOB 1A5FH 2J88H 3L6FB 3ZUNC 2FUQA 5F8QC 2WYTA 4PJGF 1VZGA 3F58L 1E5ZA 1OM3H 1CD9B 1NBVL 3A4AA 3FN0L 3IDMA 4X4XA 2HT3C 1OF2B 2H1PH 4K8RL 5E8DH 3DECA 1BXAA 3TYFB 3HHSB 3INUH 3MLRL 1HE8A 3KPOA 5ADPL 5JHAA 3V4UH 3IVKA 3CWGA 1OVZA 1H8OA 1P4UA 1S5IH 4WUUB 4B9IA 3KWUA 3L5WB 4JPIB 3UP6A 4H20H 3PDGA 2JKNA 1IKOP 3BIKA 3OG4B 2XI9A 5DYOB 3WV0A 2GJRA 2XDHA 1L7TH 4I3GA 2TRHA 1B90A 1OGSA 3LPWA 1XL6A 2VDOB 3P0VH 4DVRL 1JD7A 3WOVA 3AS0A 3Q1SH 1ZTXE 4E5XB 2BOCA 2XZAH 2ZE0A 2VDOH 2YIHA 3LD8C 1ZWIA 1RLBA 4FI7A 3TJHC 2VDNL 3U46A 4NQED 1V3LA 3DI2B 43CAB 3J2PA 1S7TB 1X5LA 1DVFD 1CC3A 1RZIA 4NRYB 5ES4B 4QTIL 3JTTA 2DQDH 3LQAC 4JG1H 2F54A 5EF3A 2FTAA 1BZDA 3WS6A 3FT3B 1FH5H 3PPEA 1TDQA 3GMOB 2P8MB 4O00A 4UQ3A 1CPUA 4X42A 1R5WA 1HAUA 2VN7A 4MNQE 2HX9A 4NYLA 1DJWA 2V3FA 1WH0A 2VM3A 1RP8A 3BE1L 2R0LH 2F53B 3MJ7A 1MJ7L 2XV6B 2BCKA 4JRYA 3VFMB 5INDA 4CL7A 4UOW0 1QI4A 3RFZA 2WYIA 1KXVA 1CYWA 4RH4A 4DH2A 3VXSA 5EUKA 3WIIL 4OZIA 2B08A 3HKZA 3MCYA 1HL9A 4WVRA 1KJ2A 3QZMA 1BLNA 2RCSH 4NP9A 2KERA 3VSVA 5EBLB 3N44F 2HT3D 3EHBC 3DX4A 1BEYH 2H1LM 4QXGH 3TEYA 3V7AE 4FNSA 4L5FE 4PFEA 4MRCA 2Z7WA 3HC0B 5ISZB 2GJZA 3LMJH 1JUFB 3OF6D 4Z5RA 4U6XB 3VRIB 3BDYH 2WMPA 2HXAA 1OCOB 3QHTC 1PU0A 2EO7A 3FU6A 2GSGA 3CSYA 1AQHA 2QQNL 1RZJL 2NQDA 2PO6B 1HHJA 1RULH 4XB8A 1FJ1A 4PLOB 5K9JL 1BMGA 1E90A 1NAML 2EDTA 2BVPA 1SY6H 2NY1B 5DMKB 2C34A 1G7MA 2Q3ZA 3O4OC 1BAFH 3VXUA 1F0LA 3FN3A 1MDTA 5FYJH 4UM8B 3TJHD 3QZNA 2CDEA 2WXKA 3AS2A 3GLDA 3W37A 3PWPD 4G8EB 3RRQA 3GMMB 1HXMA 3EOAA 2XWJA 3L16A 1XGYH 1XWVA 2X4UB 3RIAK 2CIIB 4FF9A 2BHFA 1N64L 3CFKB 3BW9B 5GRUL 1XZ0A 1JNLL 5ERWB 4HEMA 3HLAA 3EO9L 4PJ5D 2DICA 3V4VH 3VI3E 4Q4IA 4J4PC 2FJGB 3OZ9H 1KN4H 4FTDA 4UTBH 5EO0A 3P3RA 5AVZB 4GSDL 2DEXX 4K3EL 4XP6L 4YHNA 4FQ2H 5DD3H 1KEGH 2E7MA 2CGRL 1BD2B 4DPCX 4N22A 4ZW6A 1TFPA 1I9IH 3FTGA 3GXTA 4A7VA 2VIRB 2GJ6E 3S5LA 3LRGA 3WHXA 3HG3A 3QJFB 3EUUA 2B16A 1XSJA 3DYOA 1MSPA 2CJTA 1ITCA 1ROCA 2BSTB 3ZL1A 3EHBD 2LW3A 1T5XA 2Y5TB 1FORH 3POCA 5TPWH 5M94B 2OA9A 4PREB 4LU5H 5DR5L 3CBJB 3AQDA 3NSJA 3FH7A 4H44C 1QEXA 2G60H 3WD5L 2GK0A 3MXVL 3KPTA 2OMNA 2ZOLB 4X6DB 3NJKA 3U6XS 4BZYA 5HP5A 3RBGA 3UTTA 1HQ4B 1LK3H 5TF0A 4PG2A 2PPCA 4G59C 1L7IL 5CBEA 2ADGB 2F1BA 2OR9L 3FTVA 5DHYB 2ZX9A 1U8OA 3TEUA 3B9DA 3QIWC 1TPXC 4GKSA 5EEVA 2X3AA 4CC1A 3FO0L 1ZLDA 3S0PA 3K2UL 1T89C 1N67A 3Q2NA 3VGBA 1AZBA 3G6AB 4PJXE 4QRUA 3HHRB 1MIMH 2JXMA 4L1TA 2XXCB 3D48R 4OF6A 5IF0B 3DX7B 1UQSB 2GAZB 3DBXB 3HMXA 3ISRA 1Z7JA 4UILL 4PJAB 4WU7B 1LO0H 1JCVA 2JELH 1MCFA 3B8YA 2C3VA 4D9LL 3T0BA 1HHKB 1HNFA 4HIHB 4FFYL 4XMKL 2IDUA 3Q05A 1LLAA 2I7SA 4U2YA 1KFGA 3UBXG 1TTGA 5AW4B 4DCQB 2R2HB 5GGSB 4LBEA 5F7DA 4MVBC 2VJ8A 3L9BA 4MJIB 2MCMA 2P5WE 3N1PC 3FUFA 3T6WA 4LAQH 3H3PH 3VFWA 4KH9A 3MLYH 4KRPB 4J4PD 5JIIA 2YPVL 1UA6L 4LP5A 3RU8H 1JV5B 1QFWM 2HX7A 3CV5A 5DS8A 1ZIBA 3Q9QA 1YEJH 4BH8B 4F5CA 3WY4A 4DWHA 1A1MB 5EG6C 2VDPB 3L5IA 4YK4C 4HS8H 4AM0A 3VD9A 4OBSA 2ZXCA 5BRZD 3CVIH 1BJ1J 4X80H 4NNPH 5ANMB 2FWOA 1B0RA 2G3ZA 1RUQH 3VWKB 3C60C 1A4JA 4W4NA 1BXUA 1MREL 3IDUA 3A23A 2PR4L 3J8F7 3L3OC 4F7PA 5E6SB 4E42A 2Z31B 3QWNA 1FO0H 2RMNA 1YEKH 1X9LA 2JH2A 3QNZA 2P48B 1YMME 4PJFB 3GI8L 4PJDB 3QR0A 4EOWH 3H0TA 4CJ1A 1KELH 5C0FB 2A74A 3HPJA 2OW6A 2MHAB 3ZIYA 3HZ3A 5CD3B 2Z6FA 5T1MB 2YPLB 3HNVL 4ZS6C 3PWPA 4NKDA 3GO1H 4PJCE 3OHMB 2YRBA 4YZFE 3GTVA 3WHE1 4MMXA 4NPKA 2A6IA 2QTEA 1ZE3C 2HFGH 4NPJA 3QIWD 4KJYB 4M00A 4UDTA 1GR7A 5DZOA 1PQZA 1DBMH 4GRLB 1JHTA 1YSOA 4RAUB 4PJ5A 2H1XA 4JJ5A 1A9BA 3BYYA 4G1EB 2DF3A 1CYXA 4P23C 2Z9TA 3LNIA 1CU4H 5DF0A 4KXDA 1HDMA 1S9VA 4IJ3B 4LGSB 3ESNA 1XGQB 3D4GA 3VMNA 1PDKB 5C07D 5B39A 5LQBH 5C0AB 1NCJA 1F1GA 2CCVA 5DA4A 4HGMA 4O9HL 5DS2A 2OSLB 1MLBA 3V6BR 2VN6A 2WBJC 1TZIB 3M8OL 1CL7I 1RJYB 4MVBD 4N2GA 2O6CA 3QIUC 4E41E 3SGJA 4ZUVB 2XLLA 3HG5A 4HETA 3UP1A 3E6HB 3WU1A 3HR5B 3HZMA 1ZS2A 1RY7B 1QFWL 1NFDA 4CKVX 2GEQA 1EHAA 3EG9A 4MQ7A 1CGWA 2QPUA 2OSWA 1SJHB 2IF7A 2QR0B 4R7VA 4DP4X 1R75A 4NHCH 2BSBA 1SYVA 5D4JA 2NR6C 3GBEA 2LVCA 1UKTA 4QT5B 5GHWH 4JHVA 3CGTA 5T3XH 3BWAB 3C60D 1MLCA 2MSPA 1C12A 1VGKA 4FEMA 4H8PA 4NKMA 1I9EA 3QEHA 4J12A 5HGBA 1DBBL 2ATPB 2AXWA 3MCKA 3FFDA 5GISH 3SKOB 3OMIB 3KLDA 4F24A 5IHHA 2ZOKB 3I6SA 4PTUB 4XP9H 2R0KL 3NK3A 2F53E 4FQLH 4YZWA 5HHQA 2NY5H 5IMMA 3GXPA 3UZEC 3NCFB 3T8MA 2BP8B 3IKCA 4YSPA 4DP5X 3FB8B 1KGYE 1UOWA 4GBXC 3ZT6A 3O6KL 2OMBA 4JHUA 3TIEB 4MXQC 4Q97A 3CDZA 1O6SA 1J5OH 4NEHB 4TUUA 4ZS6D 5IJDC 2EDKA 4ONOA 4B9ZA 4IRZL 1GC1H 2HJLA 4DK6A 1I8MA 2AQTA 4ALAC 2GJ6D 2YD1A 3Q8EA 1UM4H 1NDMB 2IGLA 3RA7L 3QEQD 2WQUA 2P45B 3NMEA 3QQDA 2GPZA 3QUKA 2AEPH 1CD8A 3AMLA 4Z3JA 1P9MA 3EGSB 2X6MA 3OKNB 4OZFH 3V5DA 5JW5B 1CJYA 4I18B 1NCHA 4P23D 2JJSA 2W38A 1FVEB 4NN7B 4A2EA 4HZLB 1JGUL 4WNSA 3HI1B 3JWNG 3T5WA 1D6EA 4JFFD 5FYLD 1N19A 1PL3A 2JMRA 3WFBL 1GGBH 1NJ9B 2IG2H 3CC5A 3HI6L 4QPEA 5BZDA 5E2WH 1B0GB 1A3LL 4KJPC 4JQVC 1E42A 2KMWA 4OJYA 2WBJD 5GSRA 5DGQA 1JWSB 5JYLA 3P40A 2AJXL 1DUZB 3QIUD 5IW3A 3U2IA 3JQOB 2PTTB 2ROXA 1DFBL 1JF1B 2E6JA 2HKAA 5GGQH 3RVTC 1UACL 3GSNA 1ACXA 2O5YL 3CZSA 1QR1A 4JRXA 3EH5B 3QNXA 3NEEA 2FATL 4A2FA 5JHDD 5IGXL 5DRZB 4F7EB 3B2VL 4G6JL 4ZMAT 2VGLM 4ESKA 1T7YA 4EXKA 3GIZH 2NR6D 1HEJC 1QW9A 1MWAB 4UANA 3QEUA 3HG1D 1RU9L 4X6CE 5L4FA 3TBWB 2VMFA 1IARB 4B7LA 1SMOA 1RV6X 4PJEF 3X11B 4G7VH 3TS8A 4B60A 4TL4A 3BSZA 3FT2B 2CNYA 4UNTA 1A66A 3NJHA 2QLYA 3PHOB 5LDSA 4XNUH 3DRQB 1TJHH 1FQ9C 1NCBH 2OZ4L 3WBDA 3DVGB 4RGMB 4O2FB 4XP1L 4PWHA 4FABL 4GBXD 2AJYL 3LN4B 5JMOC 1YG9A 5C0CB 2WUCL 3UTSA 3KPRD 2PCFA 4MXQD 1G7LA 1G0XA 2F5AL 3N1MC 1U2CA 4DP8X 3WLWC 2FR4B 4L29A 1MCCA 5LJYH 3P77A 2FCBA 3QC5X 1DQDH 1AMXA 3IB4A 5C07A 1RK7A 3US0A 3LPGA 4AI7A 1LEIB 3ECVA 4ANXA 4NJ9L 1RK0B 1TTCA 1UM5H 3L13A 1I9JL 3B2DC 2JJWA 5CZVL 1U2HA 2ZSVA 4OTXL 3K1KC 4Z7UB 3BRDA 3QSKB 1U8QB 1QACA 2WZAA 2Y36H 1WA1X 4NENA 2WLIA 1UD8A 3H6JA 4PJGA 2WINB 1OE3A 2YPKB 2IPTH 4FNRA 3W5NA 4XVTH 3RL1A 1YMMD 4TSBH 4TUKL 3DUSA 4LLAA 5DEGA 1NLBH 2XICA 1IC4H 3S8FB 3FW6A 1NIEA 2G75B 3UAJC 2LQRA 3IJ9A 3FK3A 5IESH 3K2MC 2V9UA 5JZ7C 1OAZH 4XHQA 4FG0A 5KSBF 5GGVL 5E2VH 3CFMA 4PW4A 1KT2A 4KJPD 1J9TA 4AVIA 2FNWA 4ZBJA 4M93B 4PVMA 2AABL 4WJG3 4KO9A 3RWEA 1Q9LA 4P99A 2Z35A 3AABA 5LBSA 1IE5A 1EEYA 4R84A 3RVTD 1TXKA 3TO4B 3PQYB 4MQXC 5ABAA 4NQSA 2A9ML 3RL2A 3M6DA 2G9HA 4YUEH 3TBCA 1IC5H 1P6WA 1WWBX 3VGEA 2X7LA 4HKXB 4WUUD 3SO5A 3VYOA 5C0IA 4TLKA 1JXDA 4ZFOA 3OJMB 3F64A 3ZXAC 3RY5A 2MOQA 4GINA 2PO6C 3FHQA 4XBGB 5SWSA 1LMIA 3SDDB 3TEXA 4NQTA 2D8KA 2GABA 2DWEA 1QFOA 3MLTB 2NY1C 3F7KA 4OKVB 1JL8A 2Y22A 5IB2A 2FQGA 2BSRA 2KDGA 5GRVK 4MSWB 3CX2A 3QEQA 2V8MA 5FCSH 1JVOA 4AYDC 2E46A 1IAIH 3TWYA 3S36H 2X6AA 5C2UB 5IBLC 1K6QL 2VE6A 1TLKA 5IHZA 5GGUA 3LAFA 2VLLA 5KN5A 4X4ME 5KANI 1VFBA 2W92A 3QB7C 4DZBA 1CDUA 3WLWD 5GZNC 4H25B 1I7ZB 4ZZFA 3FMGL 4XOBA 4HUWB 4ODUB 2PETA 4J3OC 5K9QI 1NPJA 4NIKB 1D5BB 1DVXA 2Y06H 3GK8L 5HDQL 1SJMA 3PDOB 1DL7H 1QI5A 4UIMA 3QIUA 2QHLA 3QXWA 2Q7NA 2F53D 3G08B 4D0DB 1E3XA 3W38A 3DK0A 2OTWA 3AY2A 1TLMA 3RTLA 3Q0HA 3UAJD 2MNJB 5GGTH 4HJSA 4XVJH 2OMZA 2C3GA 1AQKL 2X6CA 4G43B 1KYFA 3N3EA 3W9DA 5JZ7D 5DUJA 5LGYA 2A6KB 2NR6A 5GZOC 3NSCA 2RJMA 4X9HA 3HG1A 4NNYB 4OQTA 1WFNA 2Q5BA 3CVHL 4ZTPL 4GQQA 1U6AH 4EPSA 5K9OA 3UX9B 5BNXD 5IB3A 5FOBB 3UGEA 4J3TA 4UT9H 4WI8A 1IEBB 3CXHJ 1R0AL 2DV6A 4Y9FA 3X14B 1BQHB 3BP7B 5E5LA 3PXLA 4MQXD 5ISZD 4B9CA 3D85A 3UZEA 2IFGA 1ZGLM 3KGRA 3WIHL 3K91A 5C0AE 4XPHL 3HR6A 4AX3A 4HDIB 3VD2A 3HKFA 4LLQA 1SLVA 2OV0A 4I5BA 5HGAB 1Q9WA 2ZUWA 3KPRA 5IQ7H 2PO6D 2QTVA 5EDXA 4GKLA 3P4NB 5MEPB 1RK1B 5EU7C 3GSXB 4J5VA 2ITEA 2WBWB 1K8DB 2F7OA 3EYSL 1A3ZA 2A73B 4MLSA 2NY1D 1WHOA 2I60L 1AOZA 4F2MA 1PLGH 2VRQA 3O0RH 5H37A 3NFPB 1T4KB 1WF5A 1D7CA 1FFNB 4YHMH 1UURA 4JPVL 5HI5C 4KZEL 4FFTA 5G4OA 4LSPL 1UGKA 3VSTA 4AG4L 4MA7L 3OAUH 3EJRA 3QWQB 2ICEB 2WNKA 5IBLD 2DD8H 3RDTB 2JIXB 3PP3H 2WXMA 1ZDQA 3E8UL 3SQOH 1ZD6A 5CINH 2HZHA 5DQ9A 1UC6A 4BQ9A 4TF4A 3GTTA 1C5BL 1Q94A 3U36B 3WDJA 3EFOA 5GZND 3NJGA 1EO5A 4JE4B 4WGKA 3VVWA 5HDBF 1Q1PA 4J3OD 1YRKA 3DJZA 2VXUL 2YUWA 4Y2LA 5ID1B 4JQVA 5L88L 4AW7A 3QH3B 4RRPM 2X09A 4N1CA 1NUNB 2E47A 5HHPB 3TV3L 3SE9H 4R26L 4OD3H 3MREA 5E99L 5CLYA 5L7XH 4Z7VF 4R7XA 4ELKB 1FFTB 3FSAA 4PG9A 5FCUH 4DP2X 1EAOA 1BD2D 3SZ6A 3MLZH 4HWEL 4NZUL 2H32H 1DDTA 2ZUSA 3GSQB 4JMNA 3VWKC 1FZMB 1CGUA 1PNDA 1CTNA 5GZOD 4QR7A 3F7LA 3CXDH 2Y2TA 1A6WH 2Z31C 1XEUA 3FPYA 2J2ZA 1FC1A 4ZT1A 5KOMC 2V8LA 3T1WA 3CBRA 2VDKB 4OJDH 4Y9BA 4OCYL 4PV1C 3EAKA 1QSEE 1RJLB 3I84A 1O9ZA 4FOMA 4I48A 1XX9C 2VDKH 3I6LE 2YR3A 3P3YA 4JM2B 3MXWL 3NJIA 3ROOB 3EO1A 2VISB 5LXVA 1Z9MA 3DBSA 3KH3A 1USZA 1AYRA 25C8H 3MRQB 3TA3B 2F8OA 3BAEH 2G2PA 1WK0A 4QY8B 5DD6B 3GI9L 4X5PA 4Q2ZA 2XTJE 3FT3A 4LEEA 3T9WA 4GRLC 5I66B 4GUCA 4OV6F 1AGEB 3Q6FA 3ETSA 3GHPA 5HI5D 4PJ7B 1F13A 2ZP8A 3CSFA 5CEXA 1WFIA 3BSHA 5I8CB 4ZTEA 4IJ3C 5KTEL 5EU3A 1J5DA 3VFMA 1P2CA 3NEXA 1KJMA 4R2GB 4KC3B 4GRMB 2BVQB 4JMXA 4EIGB 5SX4H 1XGPA 4HJEA 1LQSR 2XUWA 1WAPA 4NRXA 3SPVA 5AEAA 4GQPH 1P69B 4MJID 2F19L 2QLVB 3HN5A 3B56A 4R97B 4UQIM 2ADJA 3SDXB 3C08L 4F57L 2CR6A 3HBZA 4P46B 5EBLA 5KYXB 1ADQH 3HC3H 1CLYH 2OMTA 4ZZKA 4JS7A 1RSYA 5JLZB 5GS1B 5IJKA 2AK4A 5FXCH 3ARGA 1JUFA 4XNZB 1OV8A 1A64A 3IE4A 3N1QC 4PS4H 4TUJA 5ACZB 3UL4A 3BH9A 3CUPB 2Q3AA 5AAPA 4PYHA 1E4KC 1JPGB 2HUHA 4M6AA 4LOUC 4HPOH 3BMVA 3VWKD 1DEEB 3OG6B 1GJIA 2YA1A 3MRCB 1Z66A 1SY6A 2NY5C 5AWNL 1NPUA 3M86A 5AAWC 1FNLA 2CJUH 4N20A 2Z31D 1T7XA 3VU2A 2JCCB 4JHWL 3ZDYE 5B7MA 5DMKA 5E1QA 1CBVH 3BAYA 3GNMH 5F3BB 3VD3A 2X1OA 4HWUA 5BJTA 5B7FA 3LH2H 1V3KA 2WP3O 4FZ8L 2EDFA 4IW4C 1CIUA 3KPMA 4OZHA 4MZRA 1FG9C 4LZKA 5EZOH 1GC1C 2SODB 2QSCL 4C4BA 2H5UA 4DOHE 5JIQA 2YPLD 2VDLB 3QUGA 4UAOB 3GMMA 4F33B 1F4AA 3DX9B 1JPFA 1E6OL 4FXKB 5CFHA 1I85A 2VDLH 2ZUUA 1CGTA 2X4UA 3JWDH 4WU5A 5GZNA 3V4VA 1SEBB 4U1LA 5EZLB 4XX5A 1Y7VA 4X7EC 4EI5B 4GRLD 3FUJA 1HHGA 4UTBA 2P5PA 1F4HA 4XXDA 4ADIA 1QI3A 3RJQB 4I18C 4BH7A 4JGNA 2BVYA 1ITBB 1AGCB 4NN7C 4XO9A 2A6JA 1OGAB 1WZKA 4YDMA 1F2QA 2R0WL 1G9ML 2IFFH 4OM0L 4ZUSA 5C0AD 1M6OB 4F3FB 1CDGA 1BD2A 2RFXA 3QS3A 5JPMB 2EDHA 3OKEA 2JJUA 3QZOA 4Y89A 3ZDZF 5FO7B 2VIRA 5IMKA 5E1GA 2ZUQB 1YVLA 1UYWL 3BCDA 1HH9A 1QABA 3TWCL 5GZOA 3ABMB 2YEQA 3QJFA 4LT7A 1CE6B 4UF7C 1F3RB 2GI7A 3MRNA 1SJEB 1INQB 2F0CA 2BSTA 5FUZL 2ZKHL 4F8LA 4X9GA 1NCAH 5ESAB 4AYID 2F74B 2Z4QB 4PREA 4PWIA 1YPZB 3WHE0 3ZYZA 4XP5L 2ZX6A 4X6DA 5FO2A 3DX8B 5ELIA 2X53A 5TQ0L 4L1SA 5HGHA 4ZW7A 4LOUD 1RI8A 1FG2B 2XJKA 4G8GA 3MLUL 4WEBH 2DBLH 4K3GA 2NLJA 3BH8A 2Y7QB 2CHZA 1ASQA 3R8BB 4IMKC 4Z7NB 3UJJH 1OT4A 2CJ3A 3EYUH 4B95C 1PCSA 4E36A 2XZQL 3EUDA 1YECH 3G6AA 4HJ0C 4UZSA 1FPTL 5C0EA 2F54E 1W91A 1JHKH 1UQSA 1A7RL 4AQ8C 4U1IB 5FHAH 2YAOA 1O75A 1E28B 2EDWA 5LG1A 1NOAA 4LSDA 3SGDH 5B22A 4FHJA 1CT8A 3QNYB 3QQNA 1UFUA 4I3RH 4YPGB 3IJSB 3N2JA 3MUZ1 4JPWH 4C57C 2PF6A 3DO7B 2PWDA 3TV8A 4Q9RH 4H4NA 5GGSA 2NY7L 2PCPB 1ZAGA 1GAFL 4KZ0A 1V27A 1NFIB 2VL4A 4K7FA 4PGCB 5CCKH 1BQUA 3TN0C 3DYPA 3OL2A 2B2XH 4HH9B 4U1SB 3VFPB 3VXSE 4AENA 5DLLA 4BH8A 4G3YH 4OZIE 1S9XA 2XQYA 4EKXA 3L48A 5AW0B 2EUWA 3IJYB 4U0QB 3SYOA 4DTGH 2DWXA 5BQDA 4GW4A 4D3CL 1ACYH 2J21A 3WIFB 4M93C 2D3NA 3BSGA 4FJZA 4WLCA 1O7DC 5GS3A 1FO0A 4TULL 5DJZB 3T0AA 4OGXH 2F7QA 3D6GA 2CO7A 1YN7A 5D7IA 4KKPA 4PJEA 4Q0XL 3TO4C 1NEPA 2HG0A 2UWEF 4X5XB 3GSVB 3DGDA 3LS5L 2WCSA 4OSUL 4PJFA 4K7PY 1EAPB 2FL5B 4K3JH 3D07A 1J9QA 4OIFA 1FRGL 5DLMH 5HTSA 5GS0H 5E4AA 5C0FA 1T2XA 1XQ4A 3EOBA 4YHZH 3VXUE 1MXDA 3SDDC 1S7VA 4LF3B 4LEOB 5JR1H 3HC4L 1FGVL 1YNKL 2DWTA 2WUBH 1ODUA 4PM1A 5KYNA 3BT0A 5EIIB 4PRPB 1CXLA 4O2CB 4N90D 3QDJD 5EPMA 1ED3B 3OLGA 2WXOA 4XNQA 2GC7C 4GRLA 4ELDA 3MNMA 2ICWB 4O4YL 1W8OA 2XKNB 1YNLL 2YJQA 4F9LC 1MFDL 4HJ0D 4NXKA 3G6JB 5E9AA 4CW1A 1E4JA 2FJFB 1ZOXA 4FP8L 4P5RA 4QAMB 2IH1A 3VXRB 5C0CD 2VTFA 1BFOB 3PWNA 3NQKA 2NZ9C 4HEME 2Z34A 1L9PA 1OANA 2I26N 2R27A 2Y0SA 2Z8VC 3GBDA 3F7YA 4HFUH 5IY5B 1IAII 5ICYB 1U42A 4ZUTA 1QSVA 5FKPA 2IOIA 1RUPH 1P0SE 3ULVF 3FONA 5ENWA 1UM6H 1DANU 1M53A 1RJYA 4LARL 1B6UA 2G3NA 4WO0A 1IJNA 3TN0D 3V8OA 4RGNC 3ARWA 4HKJB 4KXAA 4IBZA 3E6HA 2NZ1A 3HR5A 3VFVA 1MOEA 1KFAL 1NCOA 1E6JL 3B8SA 3FQ4A 4OGYH 3UABA 3BQUB 1PX3A 3QCUL 1BVNT 2VLKB 3LEYH 4NGHL 4Z0BH 5D1XA 1SJHA 1VA9A 1IM3B 4MHHI 2ZCLL 2YK1H 5DK0A 3WKQA 1M71B 2NYYC 4XVUC 2RAMA 4HS6B 2P52A 4LCVA 4G5AA 3LEVH 4PJBB 3WUZA 4WWOA 2HN7B 4WFGD 4JFZH 2RQEA 5AAWA 3SKOA 1YEHL 5IBTH 2VDRL 4IHOA 4NRZA 3TO4D 3GHBL 3JWNH 4LQFH 4PTUA 3PQYD 1TZHB 3O6MH 3UTTE 5D7LB 1AZUA 3FDWA 3EJZC 5I1GH 5GJTL 3N41F 4YWGL 1W72B 1HXYB 1KCRL 2E59A 3ESPA 3NJXA 4UNIA 3GHEL 4QLRA 3P11L 4NLAA 1PIFA 3KDMA 4O2EB 5CCHE 1A9VA 4GMTL 1I8AA 3FB7B 1BFTA 1EMTL 3C2SA 3O81A 1MHCB 3SDDD 2X1WL 3NCJH 1KMGA 5AB1A 3VXPB 4HBQA 1PTZA 5HPMB 5KSVB 4X9BA 4QHNB 1OTSC 4ETYA 1FAIL 3WUWG 3MCLH 4HK0B 1EFXB 5C92A 4OZFA 1CGYA 2BZ7A 3K81A 4L3EB 3R18A 3RWGB 3ZKXB 4NAQA 2ICEC 4HJJH 5BOPA 1K2DB 1MRDL 3RDTC 5JW5A 2CLRB 4I18A 2VRKA 1Z9SB 3U30C 3OX8B 3ARDB 3TBYA 3CVDA 1BGXH 2J43A 3HI1A 4W70A 2NZ9D 2X10A 2YQGA 5DQDH 2AVFA 5FUCC 3ESVF 1YQVH 1SYSB 5F70A 3MRJB 1E9OB 1IC7L 2X4OB 1YEGH 3ARBA 1SQ2N 3MCG1 3BFWA 3GM0A 5LGKA 3WENA 2VZOA 5BVPL 1U33A 1CE1H 4FYRA 3STZA 1GKOA 4K07A 5ILTH 2PTTA 4NWTH 4RGND 3SQRA 1WISA 4NHUB 1HNYA 2P24B 4UOQA 5C6TH 1RHHA 2LGNA 1NKRA 1UADC 2P44B 2FAUA 2ENJA 3F6JA 3LZOA 2FVNA 4NQXB 1U0QA 3LKNA 4APXB 2FSDA 5L4MA 4U6YB 3ELQA 2NYYD 4XVUD 1Q72L 5DDHB 3TBWA 3VU1A 1AH1A 2JLLA 3H2QA 3OTTA 3X11A 4LIQL 4S11A 1GHFH 1JGEA 4M5ZH 5CP3H 3E8VA 4X6FA 3DTXA 3N44B 1MFNA 4A7UA 3QDJA 3PAYA 3PHOA 3WKML 4IMKA 3EJZD 3K2KA 4JM2C 1UD5A 4Q52A 1JF5A 3G5WA 4NT6B 5K39B 5E5RB 5DUML 4UT6L 4DN3H 1TQWA 1ZHKA 3DVGA 1YY8A 3L7EB 3SBWC 2WIMA 4BV1A 4OFPA 1P5UB 3C2AH 5JPNA 5KJ7E 3LN4A 4XPBL 2QGBA 1G0YR 5C0CA 4A63A 2ZUTA 3TA3C 1RZ8A 3D3VA 3OJVC 1SVZA 2Z92A 4GMSH 1FCCA 3QDGB 4LB8A 1LEIA 1OTSD 3TBTA 2W59A 3I6KA 2BIOA 2DYPB 1MCHA 2BERA 4OM1L 1VFAB 4UV7L 3HMWL 4Z7UA 1QVOA 2HKHL 1A1OA 1J0IA 1U8QA 2ESVB 3UDWC 3TN0A 3RDTD 2JIXD 1UWGL 4NKIL 4LMQI 3ILDA 5IREA 1JZIA 3G9VA 4R2GC 3NDYE 1OGTB 4MWFB 5TE7L 4J3XA 5C2BL 4FAAB 2G75A 1M7UA 4KFZC 3V5KB 1ETA1 3L4UA 4APQB 3IU4H 3U0TB 3E1ZA 5I15H 3DSNB 1INEL 4O5LH 4M62L 5B1CA 4JO2L 4R97C 1DUYB 3VQMA 1K5NB 4ES8A 4Z7NE 3CHRA 5H94B 4P46C 4WUKH 4FQQB 3BUYB 2FX9H 3N91A 3SGEI 1CD1B 4L4VB 1BF8A 3NK4A 4R4BA 5DEJA 5E6RB 5FGRA 5SX4I 3K1DA 5GS1C 5C0BB 3PQYA 2UVEA 3QJUB 3SQBB 4XNZC 1V3MA 5BV7B 3THML 1QLEH 4AGPA 2I32A 5CILL 4GPVA 2DLTA 2ZJSL 4HCGA 2B59B 3K8KA 3LXUX 3QDMB 5CUSH 1F4XH 4Z76B 3DUUB 1K72A 2P5ED 5F2FA 1UT9A 4FFZL 4XPTH 3SDDA 2V37A 3F12A 1L9SA 3GKZA 2WSPA 3ATFA 3CLWA 4ONHB 4R5XA 2Y23A 4JNXA 4YC2B 2W0FB 5F9OL 1P4BH 1FHNA 4BSVA 1UXSA 5K9KB 5KAQG 3DYMA 5IQNA 4F8OA 4WI2A 3D7PA 1RUML 1S9WA 5BS0B 4JM2D 3F62A 4NO3A 4NQCD 1DTUA 3ZKNC 1P7KA 3JWDC 4UAOC 2KZBA 2R51A 5IIEB 4UNVA 4Z3EA 3APDA 4FXKC 1AY1H 1ERNA 3TA3D 4JZOA 2WB7A 2VAAA 2R56L 2V3DA 3MNZB 3PWUB 2EECA 5TK2A 3AITA 3UXFA 1ICTA 4ODUA 4EI5C 3MOAH 3BKJH 1JGDB 3D69B 3IGFA 4H2AA 4P5KB 4EKJA 4RFNB 3FS9A 4YS4A 4PBWD 3O3EB 3A4FA 5D1QB 4EVNA 1ZTXL 3QRFM 1KOAA 1CICB 1P1VA 5D55A 3EFFA 1Q0XL 1IKFL 2XG5B 3NZUA 5IVOA 1CFNB 4LLMB 4D0DA 2ARJB 4XWGH 3IBEA 4JFPA 3VMPA 5GGTA 3I6GB 1PMYA 2XWCA 4N8VA 2R0ZH 5FO9A 5C6WH 2VZVA 4R2GD 3W39B 3APCA 3K6SA 2WLYA 5JPMC 4P5MB 1ZVNA 3KYOB 1U8NA 2E3VA 3GMPA 3M17A 1DZBA 1JSYA 2ZUQC 3C5ZB 3TM6A 5DJ6B 3L5HA 1F6AB 1YEFH 4OLVL 1LK2A 3QG6B 1B88A 4CU6A 4UT9A 3MLWL 4JQIH 3MJ9H 3GBNL 1BVZA 4P46D 2CO3A 2X1QA 2ZUXA 4KKNA 2K7QA 3ARYA 3S3CB 3IGKA 1WTGT 3X14A 2W60B 3GBML 4P49A 5H35B 4RA0C 2IWKA 4NOBA 5CD5C 1TOXA 4Y9CA 5D71L 1T03H 3AREB 5F7NC 1AFVH 1JZ3A 4ZS7L 5E6IB 4N2HA 3VD5A 3LS4H 4LPVA 2X2YA 4HUMB 1F4WH 3ZLQC 3DV6A 4JN1H 3CPLA 3BSZL 4UIKL 3CDYA 2C1PB 2ZYHA 1B0WA 1MCIA 1MFCL 1BZOA 2XRAL 5I6LA 1RK1A 3GSXA 2BDNL 4X5QA 1BX2B 2A73A 3QWOB 4W9JC 3UBXI 3VMOA 5F6IB 3T2QA 4E9XA 1EUUA 3IDYB 2KBGA 5FW7A 3L2NA 1SHSA 4OZ4B 1CUOA 1FFPB 5TF1L 3KPQB 5HHMB 4AUUA 3RAJH 5I1CL 5ABDE 2VQ1B 1YYLH 1F11A 4GO8A 1SXAA 2IQ9L 4PCKA 5DRXB 3ZKND 2FIRT 2X4PB 3RGHA 1CLOH 2X2JA 3KLLA 1WFMA 1IGMH 4LQ1A 1ZCRA 1XF5B 4EBQL 3GGWA 5I1LB 3MRIB 3W81A 1RIHL 1JNNH 3TONA 3WS3B 4PJGE 2VUKA 4EI5D 2YSSB 5JO5B 2CIKB 4NAJA 3VGAB 1AQDB 1HQRB 3HI5L 3S8WA 5ID1A 5ID0B 4N25A 3GLEA 5AOIA 1A3QA 4Z7QB 3OHXB 1MPAH 4MAUH 3QH3A 4MD0B 3NH7L 3SGDI 3SKJL 4WF7A 1JMXA 5D4IA 2K70A 2A4EA 1N3NB 3HS9A 4U1JA 1OGAD 2CZNA 1T1XB 4R0LB 1SQMA 5BZWA 4CKQA 1U93B 2H32A 3OKLB 3D39B 5D2NB 1VERA 3MRFA 5D72L 3KLQA 1UA7A 4M7LL 2G2RB 4G9DA 1XF3B 2FE0A 4HIQA 5J6GB 1IGIH 3GTNA 4MASA 3AU1B 1AP2A 2OSXA 1JZ6A 1A7NL 2EEBA 3OM3B 1HSAA 1P84K 4LOFA 2P5EA 3GBLA 3TASA 4HXAL 3FOLB 4TMPA 1TETL 3HFML 3T1FB 1BVKA 1FV1B 5F1KC 1W8NA 1MJ8H 2BNQB 4FTVB 1Q9OA 4N2MA 4WGVB 4WWPA 2WLHA 1BSIA 1RJLA 5GS0C 5CD5D 5K59F 3F84A 4FNLH 5CMAA 1GA2A 5E8NB 5SWSE 4E9YA 2MQGA 1J5IA 4PY7A 4D9QD 1RZFL 1TU2A 2YD9A 1AZZC 4DPBX 4TVPE 3ROOA 4AMKH 3QARA 1E8WA 2C7UA 2MPAH 4NQCA 4OY9A 2H2PC 1BIIA 3AXLB 3EBHA 3QJZA 4FADA 1XAUA 1T7WA 1VGEL 3QHFH 1S7XB 5BQ7B 2EE0A 5DZPA 4YR6A 1E27A 4HU8A 3TA3A 1V7ML 4I3SH 2VN5A 1LGVA 4HCRL 3D0AA 3DOHA 4QY8A 3T3MB 3QQ3A 3WY2A 1QRNB 3JZ7A 4DK3A 2VW4A 5I66A 4RQQB 2JB5H 3AUVA 3L5XH 1M7DB 1ESOA 1JTOA 3NFNB 1IRAY 2EDJA 4G5ZH 1GZHC 1J8SA 5FYLL 1U3NA 4URKA 4BK4A 3L3GB 3LSOB 1HZLA 5G55A 3VB9A 4ZX3A 5EOTA 2XKSA 4JFUA 2BVQA 4X6BA 2DJMA 3ZK0A 3Q01A 3UEQA 5DSCB 1K5WA 2WWOA 1BBJA 2GIYA 4JJOA 4XOEA 2XN9B 2ZX8A 3ARTA 1F4YH 4M7LT 3R1GH 2G9KA 4JFEA 1FSKB 1WZLA 1ADQA 4Z7OF 4N6RA 5MEQB 4TQIA 4P46A 4TNVK 4MD5B 3PWJA 1MFBH 1ZXQA 2YQBA 5IB5B 5JOPE 3BQUC 4WW2F 3EO0B 1ZSDB 4LLDA 1BXVA 4GG6F 1CZ8H 1H3PH 1RUAL 4PBDA 1MCOL 2UWEA 3HNTH 3A6OA 3AJ7A 3ZTJG 1NEZG 5ACZA 5IMOB 5L8LB 4X8JB 2X3CA 1DEEA 2CBQA 2EH7L 3MRPB 1MNUL 4OVVA 1W8EA 3VFGH 2GY7B 1IQDA 2LV4A 1NGQL 5AOKA 2EE3A 5JQIB 3EFDH 2WLLA 2ESVE 2JCCA 5EZIH 3ZE0E 1LDPH 4RISH 1HCZA 2E9GA 3ZO9A 1TIUA 4DO4A 1CF8L 5GS0D 2Z91A 2DH3A 4YOKA 5E4OA 1I8UA 5EWIH 2Q6WB 1KNOB 4ZUUA 3QAQA 2XNAB 4YNYA 3LHPL 4MX7B 3JSSA 1CK0H 1CFSB 4GUOA 2H2PD 2EC8A 4LSRL 4ALAL 2X70A 4XGZA 3NJJA 2QKSA 3IMBA 1G9HA 4YFLI 2W88A 2J73A 3V52L 2I9LA 3Q8CA 4PRPD 2OI9B 5CSZB 5PAZA 3WLBB 4LCWB 4KI5F 4OJFH 4ORZC 5EOCH 4MXWH 1G7IB 4PGJA 2MCG1 5A6LA 5C0BE 3FUKA 4WJKB 3ATAA 2IPKB 3VFSB 3ZKXC 4ZPTB 2C4FU 4OB5L 3VXRD 4U3XA 4HKBB 5AVTB 2NXZB 5DC0A 3S36X 3ARDC 3IJHB 3FOMA 2XIBA 3ZZLA 2IWFA 5ALCH 1F8TH 5BO1L 5JORB 3NPSB 2Q76A 4Z23A 1M6OA 4F3FA 4TNWF 3ENEA 1WBYB 1M2VB 1TSHA 5FO7A 1QUNB 1ZLWH 2V33A 1PD1A 3KM1A 1BFVH 5DHVB 1CE6A 2QHRL 1XF4B 1INQA 2B1AL 3LRLA 1I1AB 5DHVH 1BHGA 1XGRB 3LEXA 5I1AA 2HLEB 2R69H 3UBXA 1PYWB 1AKJB 3BQUD 1GGIL 2VLKD 4LK4A 1L9OA 4BFBD 5C3LD 1A6VH 1IM3D 1TZGL 1YPZA 2GI0A 2JJVA 1X5FA 2DDQL 4YSSA 3QUZA 3SKMA 4YSTA 8FABA 1SDAB 3DX8A 2VWEC 2DMKA 4L4JA 3O9WB 5ALBL 4KQ4L 1CFQB 2IPUK 4WK2B 4FNQA 5IFAL 5KSBB 1LE9B 1D5RA 1R5VA 2PW2B 3O45B 4I1NB 2OTUA 4OD2B 5K93A 5TFSL 4RIRB 1RHFA 2WNGA 2R2BA 3CD4A 3BN3B 3KLSA 4F93B 3NCWA 4GB9A 3FCGA 4A37A 1KBWA 4MYPA 5D7LD 1MCPH 1V5JA 4KWUA 5DGRA 1TJIH 4HEPG 3VSUA 3MV11 3NA9H 1GGCL 4LASL 3HBGA 1ET7A 1P5UC 2ZD0A 3NRPA 4ZI8A 4NC2B 3GIVB 4AIOA 2M26A 1NMAL 1FYTB 3F58H 4Z7WF 1NBVH 3FN0H 3ZE0F 4Y1TA 4LPYA 4K8RH 4PV8B 3Q2VA 3U83A 4QHKJ 3S35X 1EFXD 3FRPG 3PU7A 4LP8A 4L3ED 3MLRH 5ADPH 4XNMB 3JV6A 2O6PA 5EFIB 1F3JB 3U1SL 5EU5A 4ZFZB 3UG5A 2ICWJ 1K3ZA 3ARDD 4P2OB 4RCAA 4KTEL 3U6RB 1MCBA 4N26A 3ZN6A 3FHEA 4W81A 3PLYA 4APQC 5SWZE 3AM8A 2GIMA 2IANB 3OKDB 4MNHA 3V9CA 2BHYA 4DVRH 4HIJA 1ONQB 3FJTA 2N1TE 2VH5L 2AK4E 2XIDA 3MRHB 4CBZA 4EI0A 2VDNH 4U6HA 5HHME 3RY6C 3HVNA 1F00I 3BVVA 2GEEA 1MHHA 1H3WM 1QHOA 1EAQA 3VQ2C 5BV7C 1YMHA 4FS0A 2MNWA 3GSVA 5AYTA 2YGQA 3UGUA 4QTIH 4AVKA 5IK3B 1EAPA 1TNNA 3RBSA 3FU7A 1I3GL 1I8KB 4HX1B 2XU9A 1KUMA 2ZWKA 3DPBB 5FYJE 3WXVL 3UBHA 1WCBB 4N4YB 2OMVA 3QFJB 3TPUA 1YHPA 3L95A 4YC2C 3ZYIA 3BE1H 4GAYB 4UBDC 5D2LA 4O2CA 1MJ7H 1V3JA 4XCEB 4RAVB 4CNIB 5F7YC 4QJ3B 1CVRA 3FQXB 3OGCB 3D39E 5D2NE 1XXDC 1KV7A 2XKNA 4H0HB 2DKUA 1GSMA 3ARRA 1RLWA 3U7YL 2FJFA 5CBAA 2DY2A 3OMNB 3WIIH 4EI6B 1KIPA 1NINA 2V5TA 3VXNA 1SUJA 2F8XC 2FRGP 2K3HA 3UAFA 5C8JA 1MCRA 2NQCA 2PABA 3LVTA 4PJHA 3QDGD 3NIGF 5AW2B 1J5HA 1KC5L 4RFNC 2V2XA 2DYPD 1OK8A 5D1QC 4G1MB 3JYBA 5C0JA 2J55A 1CICC 4JDZA 4WO4B 4Z3TA 5IQLA 1ES0B 3ASOB 1F86A 2ESVD 3AY4A 1AGFB 4GKNB 4AYBA 5CP7A 3N50A 4HT1L 3BLBA 3PNRB 2IBGA 3JWOC 2QQNH 3QJTB 1RZJH 2GT9A 1FL3A 3BQUA 1NAMB 4AZ8B 2YQ2A 3P2BA 4CN4A 4HQQL 2G3MA 2YD8A 2BVUA 3UYRL 1H9DA 2I5YL 3MU3A 4APQD 5K9JH 5KVFL 1AO7B 3C5ZC 1NAMH 3VGGA 1WIUA 5ABZA 4GO9A 2O6EA 4HS6A 5HDBB 2ORBL 4LAJH 2X2HA 3CLEL 4PJBA 5IOKA 4MQTB 5D1ZB 1YEEL 3ZT7A 4L4VD 4R4NC 3L9RB 2XFXA 5C0GA 1E7UA 2EYTB 4JN2B 5C0BD 1AD9A 4MCZA 2JE8A 4RRPG 3AREC 1RZ7L 5D7LA 3M07A 5LNEA 4CUCA 2EEFA 2OL3L 4P2QE 4X0KB 1HEZA 4Z7VB 5E6IC 4YAQA 1HXYA 4G8GE 4XMUA 3HE7B 4W9LC 5DFTA 3QDMD 4GAFB 5DTFB 1RP9A 1N64H 4E9LA 1N2RB 3FB7A 4N1EA 5GRUH 3CH8A 5E8OA 1JNLH 2XN9E 32C2A 5CHNB 3OMAB 3EO9H 5JNYB 1N5YL 1KCVL 1QPKA 3SDAB 1BOGB 4K9EL 4PUBL 1JXGA 2XBDA 1AD0B 5F6IC 3L3KB 5KSVA 2J1YA 1NCNA 3IDYC 1XH1A 2VM4A 3MLSL 1XR8A 4QHNA 5C08A 4UBDD 5K1VA 5SX5H 5CNHA 1EFXA 1HK6A 4FDWA 4GSDH 4K3EH 4XP6H 5BS0D 5JW4N 1AZNA 2DQCL 1OB0A 3RPKA 5ESQA 2ZUVA 2CGRH 2PW1B 3ECBA 1KZQA 1EO8L 5FUOL 3BO8B 1Z9SA 3ARDA 3H54A 3P54A 3REVB 1QBAA 3L3IB 4FQHA 3WFCL 3QRGL 2IGFL 3P4MA 4FCHA 3RY4A 2FHCA 4Y19D 1E9OA 2EIEA 2GW5A 2W91A 3EYQC 3U82B 3VGAC 4KNUA 5IOPB 3IJ8A 4QI3A 3V4PL 4LCCB 3OHXC 1BFSA 5D1QD 4XNAA 5DR5H 1CICD 3WD5H 2VDPL 3MXVH 4ZX4A 2ZF8A 4H2CA 1U8HB 3H7BA 4R0LC 2CRZA 3R0NA 4RBPH 4NHUA 1EXGA 1A7QL 2CH8A 4UINL 4A55A 5DC2A 1WRFA 5D2NC 2R8SL 3CDCA 1L7IH 2OR9H 5DC4B 5DRNB 5J56B 1U8LB 4IRJA 2IH9A 5A2AA 5CU5A 1UWYA 3VQLA 4X4YB 4L18A 4APXA 3HS8A 4BDVB 3C5ZD 3I74A 2ADFL 4G7QB 5DUBA 4DSYA 5D7IE 5C71A 3FO0H 4PPTA 4PJEE 3CBKB 3ZO0A 3HUJB 3K2UH 3S7GA 5CP3A 3UC2A 4PJ9B 5D70L 1NBYA 2QT6A 1ZLVH 3CN4A 3QUML 4HIXL 4JFTA 3VXQA 3MROB 4R4ND 2VZUA 2JV6A 5L4IA 4UILH 1T21A 3C6LB 3HBQA 1B9ZA 3OLIA 5LN8A 3IJ7A 5CS7A 4QRAA 3J27A 1A7OL 3ARED 3NQIA 4S1RL 3FRUB 3KYNB 3MBXL 1FNHA 5E6ID 4D9LH 4X6EB 2QV4A 3G5VA 4FFYH 4XMKH 2PN5A 3L7EA 3SE8L 3KWWB 5H2BB 1QG3A 1XGZA 1UD2A 2R29H 3HPLA 3DOSB 3GS0A 1Z0MA 3A3YB 3L7FB 3FUHA 1QWNA 1T22B 2B8OT 2YPVH 1G1YA 1UA6H 1VZHA 2D31B 2ZG3A 3MHZA 3DXAA 4JO3L 4ZFGL 4ATWA 1R5IA 3IDJB 2DYPA 4MKMA 1VFAA 5HHMD 3QA3A 2IOOA 3IDNB 2BVOB 4BBWA 5D93B 2FD6L 1J12A 2W07A 2C4FT 1HCVA 5FGBC 3WFHB 3IAPA 5AG8A 1M3IA 5IKCA 2ZX7A 1OGTA 1MREH 2EXYC 3B6SB 3WJLC 3QHZL 5T1KA 4AW4A 1ILSA 3MYJA 2PR4H 3V5KA 1ADWA 4AL8C 3DA0A 1EXUB 1OF0A 3EYQD 1M7IA 5I26A 1FSKC 5KG9A 4PI2A 1B4TA 4BK5A 1DUYA 1H0DB 1NGWA 4XXCA 4PRBB 2O72A 2VR4A 3GI8H 5FR3A 3LRHA 3DGGB 4FQQA 3MLVL 4UAHA 5C09B 3F6IA 4MDIA 5T3XE 3RY6A 2MQ0A 3V0VB 4I1PA 3CHOA 3DDFA 4HZAA 3D39D 4P59L 3HNVH 4WTWA 2WYHA 4J23A 3UTZB 1OP5K 4FD0A 3RJOA 3US1A 1DQQA 3DNKA 1ZLSL 2FECL 1G7JB 3QDMA 1IL1A 4MCYB 5EDSA 4Q6IA 3SYPA 1I8IA 4Z76A 5MENA 3ZDZB 5L8JB 2R1XB 2W0LA 3U9UB 2QQQA 1UWEL 1VFMA 2BNQD 4FTVD 3PL6B 2W0FA 2VR6A 1S7SA 3KEHA 4R3SB 2ITCB 2WZ6A 2WW8A 1KPUB 2GFBA 1LDSA 1JOIA 5BS0A 2CDGA 5IMLB 4B96A 3CSPA 5KYUB 3OAYH 3PV6B 4X99B 2RH0A 4S10A 2J8UB 4Y5YA 4PRIB 4O9HH 1RMFL 1D5ZB 2NNAB 3BP5B 1AMYA 3M8OH 3BZEB 2DTML 3MZGB 5D6DA 2OI9C 4M9PA 4V2BA 3V7MA 1JGIA 2NUPB 3AS1A 1HILB 1QRND 4HJGB 3KVQA 1JGDA 4Y19A 3LXAA 1R6VA 1K9TA 3FCSA 4MNGB 4GW1A 1CLVA 1QFWH 4P5KA 3QI9B 4LNRB 4WHTA 3O3EA 4XN1A 5IHLB 1S7WA 2P43B 4XAKE 1CICA 2NXZC 2WWMC 1KLFA 2K6ZA 2DQFA 2NT1A 4R96B 4CMMB 2FB4L 3I6GA 4PIBA 3NPSC 4KH2A 5E56A 5IR1A 2EVHA 2EXYD 1DBBH 1JI2A 4U7KA 2IWGA 2FIKA 4JQIA 3OC8A 2XN9D 3C5ZA 3MJ9A 4I88A 2R0KH 1F6AA 3WJJC 2IH3B 3PYCA 3QG6A 4YXLL 4FKHA 3VCLA 4Z7AA 2ADIA 2H0PA 1FNSL 2FWUA 2HG5A 2E9BA 4N2OA 5FW8A 4OAWB 2VOTA 3MV7B 1M1XB 3CHSA 4FQ1L 3CMGA 5GQBA 1WWWX 4XNYL 1ET5A 3O6KH 2UY7B 4FFVC 3K6FA 1KLGA 1ZV9A 4M7JL 1MWAL 3AREA 3DMMA 4GEJA 4IRZH 1VENA 1UZGA 1T1ZA 4N87A 3GM8A 3JV5A 3O9WC 3QZWB 3RA7H 1KIRA 5LDUA 4G70B 7PCYA 3QCVL 4XBEL 2AEWA 4X9FA 3BUTA 3FUNA 1SGKA 1KENL 1PG7X 1OP3H 5C3TA 3WAKA 3UPAA 5LUMA 4U3SB 1BX2A 3QWOA 4IKNA 3VW3L 2GSMB 1NGZB 2XPZA 4HVBA 3N43B 1JGUH 4PYGA 2H8PA 4BZ1L 4KTYA 3S2CA 4J28A 3DHUA 3KPQA 4KXZI 3D3VE 2ZWNA 3NIDB 3WFBH 1AHWB 4B97A 2BC4B 3HI6H 1DO6A 1MCSA 2QQLL 3WNPA 1QMUA 5DRXA 1A3LH 5DVPA 5TDOB 5E4EB 3G5YB 4DO5A 1T1WA 5F7AA 1T6WA 3CLFL 4GQ9L 1N0LA 4K8RC 4KY1L 1CGSL 4PY8I 4B9FA 4JPQA 4PW9A 3FSVA 5F96L 5HDBE 2AJXH 4EDXA 4D94A 1TZAA 3MRIA 4LCWD 1DFBH 3WS3A 3NP4A 4B50A 2AERT 2E7HA 4MMYB 1UACH 5JO5A 1LP9B 2YXVA 1AQDA 1FYHB 2K78A 4P4KA 2EDRA 2O5YH 5B1KA 5AYQA 4E0RB 3KLAA 4M8QA 2FATH 4JLRB 5IGXH 3EJQA 1MG2C 1QQDB 4Z7VE 4FFWC 4G6JH 4YHIA 1BLIA 3H7LA 2NXZD 4DETA 2WWMD 1S9KC 4P2OC 2EDNA 4LLWA 4R0LA 3QPXL 1RU9H 1UCTA 1GYVA 1EV2E 2YQ3A 5G5DB 4F7TB 1LYQA 1XF3A 2JVUA 4I85A 1QLRA 3Q2CA 1IGYB 3V6OC 1G9NC 1PZ2A 3VI4A 1PPIA 4M5YL 3SE3A 2ENSA 3MGOB 4YSDA 3O3BB 1R33A 1M1SA 2Z64C 3SB3A 3L3JA 3TJEL 5T5NF 2FZ3A 5IBUB 2VITA 1OAQL 3FOLA 2OZ4H 4GKOA 4PJCF 2ZPKL 5L2KA 2DS4A 2J1KA 4XP1H 4FABH 3SKNA 2AJYH 1M57B 3OLDA 4FTVA 4HP5A 4XXWC 2XVBA 1AKJD 1D3CA 1Q1JL 2WUCH 4TQPA 1W0WB 1G7PB 1U4FA 4FFVD 4AQEA 2F5AH 5FDWA 2J5LB 4K7PX 1UT1A 1F90L 1XR9B 1URZA 4RMQA 4LCIL 2EIZA 3OPZL 4FI8A 3P69A 5HY9A 1MW1A 3O9WD 4NJ9H 4XO8A 5J6SA 5HPOA 1KJVA 3AXLA 3KNBA 3Q06A 3CMOL 5CZVH 4OD1L 3FT4A 2EIJB 4OTXH 1NUFA 4GSUA 3ZSTA 2HJFB 3CNKA 4JB9L 2R83A 3CHXA 1HVXA 3O3AA 4N3UA 1Y18A 4IU3B 4RWHA 4LEBA 3BP6B 4TUKH 1B3JA 1Y0LB 4OF8A 4RQQA 4AQ1A 4C55A 2B7DT 2XC8A 4P2RB 4CSPA 2VDQB 3ZTJH 3DHMA 2C3HA 4LPXA 4HLEA 2YA2A 3NCXA 4P06A 5J5EA 2BNRB 2BY2A 3VFNA 3N41B 3PHQB 4XPAL 4V33A 4Y4FA 5GGVH 5IQ9A 3T8XA 1MCEA 4L8SA 3IDIB 1DQJB 1FYTD 2BSEA 3DSFL 4K8RD 4IGBA 3LSOA 1TEGA 4LKXA 5FGBA 1AE6L 2DM3A 3WNMA 4GI6A 4U1NA 2AABH 1DQLL 3EJCA 3QRLA 2D9CA 1HI6A 3MUJA 3KPLB 3OZLA 2UUDK 5EUOB 4L3FA 3RIKA 5EOCJ 1XGTA 1BQRA 2Y1AA 2AXFB 2ICCA 1E5UI 2A9MH 4MBOA 4WO4C 3WI9A 5LKNA 3MV9A 3VH8G 5MEQA 3PUCA 3MFFA 3NTCL 4FFWD 5GJSL 5HHNB 4G42B 4LHUG 1HEHC 5FC9A 3RWIA 1R24B 1U3YA 4OFYD 4P2OD 3NUKA 3S3BB 5IB5A 3O4LA 4WDIA 1ZLUH 1BJ8A 5CEYA 1XFPA 1YQ2A 2JB6B 1CTMA 4DN4L 4JFYB 2IAND 4XP4L 4TYUA 1OAJA 4M61B 4U4BA 2EYSB 3LRSB 4E9VA 3B5TA 4MJ4A 4IKLA 2ICES 5DA0B 4KO5A 4UQDA 3INOA 5D1ZC 3H2WA 2CXGA 3GINA 7FABL 4ZAKA 5H8DA 2CK2A 2XA3A 1DSYA 5AZUA 2WANA 1K6QH 4ANUA 5DFAA 1SHXA 5E6ZA 1F41A 3GRGA 2BH0A 4R4FL 1VADA 2VUYA 3HE7C 4GT0A 1U8CA 3FMGH 2ATAA 2ZWSA 5D9SB 3ROLB 4KAQL 4MX7A 3M46A 2KQMA 1UOVA 1ORQA 3SDAC 1I53A 2N01B 3QFJD 3GK8H 5HDQH 3SGKC 3LQZA 3RGVB 3QJVB 3QJHB 5JHMA 1YJDC 5CSZA 3WLBA 5ACLA 1MCWW 4JFQA 4LCWA 5C09E 3X1EA 1UTDA 1HCFX 3WNOA 1H19A 4Z78A 4ZMTA 1ODAA 3BVNA 1PY9A 2EDLA 2K7PA 2PWFA 3VFSA 5EMYA 4OLXL 1NM9A 2E8YA 5A6MA 4NBYB 4TLTA 5I74B 4WRLA 1AQKH 3CVHB 2BLFA 2JTYA 3GSOB 3IJHA 5CLZA 3P9MB 3QJRB 3TZVB 3PGDA 2R1YB 5DS1A 4NUJB 1Y1DA 3CVHH 4ZTPH 3ZDZE 2I07B 4BZ2L 4AQAA 3RJDA 3EYVB 3Q6GL 1LE5B 1JG9A 2Y69B 2YGVA 4LCYA 4QRFA 1R0AH 1M2VA 2W0KA 2XIIA 3GSRB 4LCCC 4LGRB 3LPFA 3S37L 4LESA 2EVJA 1UJTA 3GXFA 1QHQA 3KJ6L 4WO4D 5DHVA 1TCRB 4X6CF 1VF5C 1RIVL 1G4MA 2Q1EA 1KGCE 1XF4A 2R69A 4OZGB 3WIHH 5IW6A 3SPGA 2EO1A 4HFWA 4XPHH 1SXZA 2FJHB 3CZUB 3C87A 1JPEA 1LQBC 3FRPB 3QO1A 1PYWA 2WCPA 2EVGA 1W6WA 5CZXC 4HD5A 4RNRA 4WI0B 4P5TB 5GIRA 3KXFB 4AQZA 3B9EA 1AO7D 1X7QB 5C9JB 3EYSH 4OQ1A 2I60H 4XNBA 2ZKXA 4JFSA 4PJ9C 2ARWA 1QOKA 1NM4A 3FYIB 1R46A 4UI2A 4DPRA 2FH8A 4MNGE 3U0WL 1CFQA 1YNTF 3GS7A 4D8OA 2FQFA 4JPVH 3L4XA 2PW2A 5D1ZD 3BIBX 3S3PA 4ZSOA 3D51A 4KZEH 2A4ZA 4IBYA 4MQSB 4LSPH 4AG4H 4G6AC 2JKWA 3C6LC 3QR2A 4MA7H 4DUXA 4LOVA 4NM8L 4U1HB 3E8UH 4NI6A 4M6OL 1IBBA 2AXHA 5DHDA 3I75A 2HVBA 1C5BH 1IBFA 4LMQE 3MJ6A 3HE7D 3ZKQD 5KEZA 3GEFA 4I2XB 4XZUB 4I89A 2Z8WC 3GIVA 5DURB 5FECB 2VXUH 1YEDB 1HL5A 1YDPB 1RVFL 5FFLA 2Q86B 3SDAD 4U6TA 3MAWA 5L88H 1NGXA 3CDGB 3LKSB 4EE2A 4JW3A 2X0UA 3TV3H 1OOAA 4R26H 1NCCL 3NABL 5E99H 3SCMA 1MI5A 1WS7A 1GJUA 3UO1L 1OOWA 1S5HA 5E6YA 1OKEA 2EAEA 5D93C 1FBIL 3V7AG 2EINB 1F3JA 3IXTA 4NZUH 4HWEH 1NIFA 4YDJA 3QBTB 2J56A 3QCTL 3KCPB 1FVCB 4P2OA 2ZSWA 3U4AA 3TPKA 3DPDA 4PWJA 4ZMLA 4JFEE 2H45A 1SRDA 1JNHB 1JHLL 1LO2L 3F3HA 2YC1B 5T3ZD 2K6WA 4ZTOL 1FN4B 1E30A 2IANA 1DP0A 3OKDA 4C4KO 4OCYH 1WGOA 4N6QA 3V6OA 1ONQA 1ASPA 1G7QB 3ZYOA 1ZGLB 5KVMC 3MRHA 3TNNB 5T1LA 1GRWA 3D2UA 4ICXA 5E8PB 2VO8A 2ZCHL 3MXWH 2UWEE 1ZXKA 1KJ3L 3KPSA 4X4ZA 1JK9B 1G7HA 3ML9A 5AW8B 4CDHA 3QT2A 1I1YA 5B1JC 3DTDA 4V1DA 1QW8A 4XXWA 5B3JE 3V9FA 4S0HA 5CZXD 4MB1A 3FSWA 3FQWB 4ZJ9A 1LXMA 4DP0X 4DW2L 4A7GA 1UZ8A 3GI9H 1I8KA 1TSRA 4YDKL 4AGOA 4PJ9D 1SF5A 6PAZA 3E38A 3QFDB 1WCBA 2EACA 4U3CA 5FK9B 4NOFA 3IETA 3QFJA 4GO6B 4AEHL 3FCBA 4UQEA 5CF3A 5PCYA 3PL6C 1A02N 4G6AD 3C6LD 3HW7A 3DURB 3KJ4B 4XN5A 3NFSL 4G9FE 4GQRA 5KTEH 2VJ0A 3MGTA 3VGDA 1LMKA 1GYWA 4NQDB 4YDIL 3RFRA 1UD6A 4M9OA 1V10A 1TZOA 1OAUL 5EN2A 2DLIA 2AS5M 4JZJB 3F8UB 1CXFA 2F19H 5F97E 3C08H 4F1SA 1GMIA 4ODWB 4F57H 2Z65C 2LU5A 1EJ8A 1K4CB 3ULVE 1TR7A 4LO9A 3QI9C 1O0VA 3ARFB 4HH8A 1WBZA 1XVSA 5BVJB 1A6UL 1R3IL 4WO4A 2RGSA 4WFHD 1GGTA 4UYQA 4JCLA 3HIZA 2RD0A 1HCYA 1MHEB 4KVNL 2NX5A 3WUWA 1U58B 3CFCL 1I1FB 1XCTB 4JG0L 2VQUA 4FL4C 3TBVB 1YC7A 2JJTC 2UY6B 3P02A 1NAMA 1NDGB 3VTTA 4AIEA 2ODIA 5AWNH 1A6AA 1J8HB 2A5UA 1DJZA 3ML8A 1DJSA 5D5MB 1AO7A 4Q9CA 5J12B 4JHWH 4S1QL 4S0SD 1CGVA 2YLHA 2R4SL 1KTDB 1I3RB 2GBAA 3ZE1B 4DGYL 4FZ8H 3W5MA 3NESA 2BW4A 5HYIA 2OJEB 5C09D 3MRBB 4X8CA 1D5MA 2QSCH 3MZTA 4NQUA 4OFDA 1U2YA 1JRHL 2AGJL 4JN2A 3VM5A 1E6OH 4X0KA 4I9XA 1TTAA 4OF5A 5J1AB 1UOKA 4Z0XB 4F20A 3NSYA 5AVSB 3L9YA 3S6CA 2ISDA 3FQRA 1BOGA 1CYGA 2YD5A 4LLVA 3AADB 1AD0A 3L2MA 3PL6D 3WG7B 1QTSA 4NP4L 5HYSG 3HAEB 5FFGA 1IAOB 1Q90A 4V11A 2MOGA 3BZFA 3RILA 3LKOA 4XH2B 5FGCE 1KGCD 1E65A 2R0WH 4BUHA 1G9MH 4L9LB 2BXZA 4OM0H 1AHWC 2P8LB 4K94L 4OCXL 3K71B 3MACL 1IAKB 3IEAA 4PRID 5E4EC 1TZ8A 4RSYA 3GEWB 1UYWH 2P4AB 3TWCH 3L3IA 2R23B 2VW6A 3L1GA 3VDCA 4FGMA 5FUZH 2ZKHH 4JFDE 1OHQA 1QEWA 3QI9D 4FQJL 3IFLL 4KRMB 4CADB 3EGXA 3ELAT 3ARSA 1NUDA 1X7TA 2XWBA 4LCCA 4YXHL 5D7JB 3D87B 1ETJA 4CVZA 1U8HA 1AYOA 2QPEB 4Q6KA 1VJSA 1HWHB 2V5YA 3BEVA 4LXFA 5TQ0H 3U4KA 4F7CB 3G7TA 1OTTC 1ZHLB 1ML0A 4GXFA 4YHYB 2FYYB 3MLUH 5BMFL 1E4XI 1TMQA 2DQ6A 4YDZA 4X4YA 4Y1AB 4IK6A 2D9QB 2FGWL 4M8UA 4EN2A 3HRZB 5FYKE 2ZCZA 1LILA 2WAQA 3HUJA 1VEOA 4B9PA 3G5XA 2Q8BL 1MCKA 3L3DB 3K74B 1IGJB 2JTDA 3RWHA 3IJEB 3RQ3A 4F2EA 2XZQH 2DQJL 3MV7D 4N0FB 1FPTH 4AXWB 2XN2A 4Z7OB 1U8PA 3O3UN 2DL2A 1A7RH 3E80A 3ZUCA 5ESVB 1QRKA 1UCBL 2R59A 3U6XA 5CN2A 2J5LC 4FFYA 4PGEB 4W9CC 5FA3B 4JFOA 4ZO7A 2F5BL 2N7AA 3FRUA 3KYNA 2A99A 2R2CA 4GG6B 1E3FA 2J8HA 5DWUL 4PR5A 4GG8B 5H2BA 2KPNA 2DH2A 3KD4A 3K80A 3VGFA 3KL5A 4ZMNA 2EDOA 5CGBA 4UYPA 2NY7H 1ZHBB 4ABVA 1GAFH 1TG8A 1VFUA 2H7WA 3FU3A 2YPVA 4Y4KA 5IVXA 4NBZB 3RURA 2MMXA 2D31A 4E5XG 4LSTL 4FG2A 3UTQB 5CKAA 3BWUC 5EBWA 3ET9F 3S3JA 2FO4B 1HX0A 2BVOA 3KXFE 3N6YA 4E9TA 3CZNA 3KZ8A 4EZLA 5HYQA 4PJHE 4BEIA 2NOYA 4D3CH 1IVTA 2TRYA 4NSKA 4YDVB 1JDDA 4W1TA 1WITA 2C4XA 5HDLA 4TULH 2FLRT 3G6DL 3J7HA 4Q0XH 4QRPE 4PWGA 4HJ1A 5E94B 4NX0A 1OCCB 3TOPA 2EKSB 3V5HB 1J0HA 2EH8L 3LS5H 5A6IA 4PRBA 3WXWL 4OSUH 3AQZA 3P4OA 2EC9U 1SOXA 1KB9J 5TQ2L 4IBQA 1DQML 3D18A 3WY3A 1FRGH 4OGAC 4OUUA 3VE0A 2GCYA 1T3FA 3DIVA 3V0VA 4N9GB 3SSGA 5SWQA 4AC2A 5J06A 1OTTD 2C9RA 3HC4H 2FQDA 1FGVH 1YNKH 1HWGB 5EC2B 3CK0L 3N0AA 1YAIA 2VXQL 1ZVYA 2GBTA 4EF3A 3LIUA 4TPRL 2P8PB 2KZKA 3NVQA 2VZSA 2EXWC 2H26B 4OCSL 1HHIA 4JGJA 1L0XA 2R1XA 4O4YH 2PYEE 1YNLH 1UA3A 3CQPA 1UOLA 1MFDH 1W72L 1Q0YL 4K3DL 4FP8H 3A5VA 3PL6A 5F1NB 1MW2A 5DJ8A 2ITCA 4TUOB 4GUPB 4A7QA 1XF1A 4OIAA 3H9SE 4OGZA 3ZRSA 1ID2A 3UTPD 4PP1C 3AWFA 1YAZA 3VJ6B 5TE6L 1NA8A 3NN8A 5TH2B 1P4IL 5C08E 2OX5B 1ZK5A 2WXGA 4G8AC 2WV3A 4LARH 3RGVC 2ZYRA 3IYLW 1FH2A 4GKZB 4RLDA 3VG0L 3ATDA 3B37A 5J57B 3MLXL 3V8CA 1RZGA 3AW5A 3H1ZA 3MBWB 5JIMA 2VSKB 2V9QA 1MZZA 1KFAH 1E6JH 3QI9A 4P2RD 4PS7A 3QCUH 1P7QB 4HLZG 4NGHH 4AQOA 3L08A 1IIIA 1A21A 1CDCA 5I74C 2BNRD 2ZCLH 3CQFA 4WV1B 4MMZB 3BC9A 1KTBA 3ECUA 4TVPL 4R96A 3TZVC 4FYSA 4CMMA 1JDAA 5FB8B 5HJ3A 5BW7A 1FZKB 1GZQB 3A4EA 2VDRB </