5KWYC

Structure of human npc1 middle lumenal domain bound to npc2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Niemann-Pick C1 protein
publication title Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kwyC00
3WEBA 5KWYC 2Z64C 3WEAA 3FXIC 1AHMA 5IJCC 1KTJA 1XWVA 2E59A 1AHKA 3MU3A 3MTXA 1WRFA 3T6QC 2F08A 2HKAA 4G8AC 3B2DC 1NEPA 1A9VA 2E56A 3M7OA 3ULAB 2Z65C 5IJDC 5IJBC 3VQ2C 3VQ1C 3RG1C
chains in the Genus database with same CATH superfamily
3WELA 3LN5B 2FL5B 3TO2B 2X4SA 3LKQA 5I1DA 1KYDA 1OALA 4LP5A 1NC4B 3TNMA 2FO8A 1UCBL 5C0FB 3HA0A 4TKWA 1MWAH 4B9PA 5EFIA 4F5CE 3ERXA 4N90E 4PRBB 5AKRA 1N70A 3VXNA 4E41B 4MZRA 5HYSB 5IIEA 1SYVA 2VXVH 1IKFL 1N0LA 1J8HA 1YLBB 4MA8L 2BFGA 1CURA 3RPKA 1ZXKA 3TEUA 1CIUA 4FMFA 4PJ5B 3D30A 3T77B 1CQKA 1XEUA 3RUGF 3CH1A 4N4YB 5IJDC 4WUUE 5J89A 4HD5A 2XKSA 2VLRE 4WFGE 3BD5A 1JGLH 4I2XA 3WIIH 2XA3A 3V4UL 5KYYB 3PPEA 3BO8A 2MSPA 2CDFA 2FJGB 3L1OH 3PIQA 3Q9PA 3TV3H 2GJJA 5HPMA 3CNKA 3EYOB 1J7VR 5LHDA 4POUB 1KENL 4OF5A 1FGNH 1SOQA 2QQLL 2OMTB 3HZKB 3PF2A 4YE4L 3ISYA 2PW2A 4KXAA 1J9QA 2J6EA 3STLB 5F7HA 5D5MF 1QWNA 5CZXD 2OXGB 5LKNA 1E67A 1DL7L 5ISZB 1GS7A 1QSED 3BESR 4ZSOB 3T0EE 2L7JA 4N1CA 4TS6A 2EYRB 2KLSA 4WTZA 1PX8A 3NCMA 1W0WA 4N3UA 4XODA 3V0VB 1WBYA 4R90L 4AEIH 4WK4B 3VX1A 3VH8A 3BQUC 5DHYB 4CUCA 1I85A 3DPBB 1FYTE 1PSKH 4NN5C 2YSTA 1ES0A 2V17H 4QHUA 1FI8C 3KCWA 5AVWB 1UKTA 5D1ZA 5HDQL 3LAFA 5ID0A 5B39A 1MWAA 3N42B 4ANVA 3FN0H 1OF0A 2D0GA 4BKTC 4MZ3A 2HLFC 4DZ8A 1S7SB 2R0ZH 4XB7A 4HH8A 4LVNC 2GK0A 4PLNC 2WN2A 1EJOH 4Z8FL 2XWZA 4ELDA 1MCNA 3UYOD 3Q44A 1KCUH 4IBQA 4O51A 3MV11 5E4OA 4KKZA 2DJMA 2YXMA 3MV01 2WSKA 3GMNB 4KFMA 4JO8A 1AJ7H 4NENA 1RZFH 3EIFA 3V5DB 3FSOA 5MHSD 3HI6L 3CK0H 4JHBA 3HMWL 4RFOL 1WAAA 2BVUA 3IDIA 4IOIA 1JGUH 2BSSA 5C0RL 3PYCA 4K8RD 1Q1JL 3MRIB 1KY7A 5H8DA 3WEOA 2MNUA 5FFOA 5IB3B 4O02H 3BQUA 4HBQA 5IMOA 3UX9B 1RZ8A 3NMEA 1AIFA 3QIBD 5BOZG 3MVSA 4L4TA 3BIBX 4ZFFA 3UAFA 1XBRA 1H3TA 2FGZA 3MLVH 1JWMB 2PYEB 2OXHA 3P4NA 4GO6B 1BAFH 3HZMA 3Q5YA 4LCIL 4PGJA 3SJVA 4AITA 1A6UH 5L8KB 1X7QA 1RD6A 1T21B 2HTLD 3LIZA 1DSYA 4Y4HD 1UEMA 5I24A 2VDRL 4PJXB 4Q9QH 1HN1A 2VDQL 2RALA 1F90L 1M4KA 5C0BA 1Q8MA 1SJHA 4KZEL 2Z7ZA 1AFVH 4F15C 4H1LB 3H9SD 4KQ4H 4TXVB 1YPZB 3VXUD 4H26B 1VFAB 4S1RL 4RSYA 4IOFD 1BV8A 3BEWB 4EAEA 1L4IA 1AS7A 2QVMA 5CGMA 1TXKA 3G6DH 3MYZA 3GKWL 4NIKB 2LT9A 2JCCF 5D2LF 4Z3JA 4TL5A 4K3EH 4HPYH 1PZUB 4FFZH 5DVOA 4X4YB 1RPQA 4J3SA 1FV1B 2AJ3B 4K55A 1OTTC 3UG4A 3OKMA 1HOEA 4APQB 3QAZB 3RIFF 2P5ED 2BP5M 3BZFB 2R15A 3KM2A 2CK0H 3GJFB 4B3EA 4QYOA 5BMFL 1EGJL 3RPIB 4N0CD 1F4WH 3GM0A 3R19A 4PCKA 3BUYB 4RZCA 1S7WA 4B96A 3IFPA 5C7ZA 4NP4L 3PLYA 3BGFC 2Y6TE 4O02A 4IIZA 3BUBA 4Q56A 3T6QC 4KZDH 3AXHA 3QDGD 3G5WA 2HMIC 4G8FA 3QDJB 4HGWA 1F3DH 2WXLA 3O6KL 2NY1D 1ZVNA 3W37A 4N6RA 4PBXA 3DO7B 3GC3A 2ENSA 1P7KA 1S5HA 2N56A 8FABA 2BOCB 2WPGA 3RVUD 5F1KC 5LB1A 2Y5TA 2EH8H 5EIIB 2AJVL 4M6MH 1KTJA 4KTGA 5C0NC 5DD1L 1WWAX 3HG1A 2YC1A 4TLSA 2X9YA 1NMBH 4XCFH 1JZ3A 1F6AA 3KL5A 5IJKA 4KRNA 4MB5A 5CN3A 3QQXA 1IBFA 2VN4A 1U3HD 2BC4B 3HCVB 3VGAB 4MCZA 2XN0A 4FFZA 2R27A 3VQLA 2NSXA 1HZHL 3HG5A 3O3UN 2X9XA 3FU8A 1IGTB 1RVFL 1XIWD 3ZDZB 1LWRA 4AQ1C 4DKFL 5KSBE 3GBLA 3FCTB 1NDGA 3TT3H 2OJ1A 4RNRB 4DWHA 3PL6A 3FT3A 3V0DA 4L8CA 2C1PA 3JV0A 3L4YA 1QD0A 5JR1H 5IKCA 1PFCA 1MFBL 3DJSA 2Y7LA 4PJIA 4PJ9D 4CVZA 2XIIA 1GAFH 3O9WA 4BQBA 1BMZA 1DVUA 3NAAL 2F7RA 4ZPVB 2YOAA 1BX2B 1JVKA 1ACYL 1V7MH 3EFDL 1LMIA 4XT1C 2EUZA 1P84K 2WVVB 2OJEA 5E51A 1JHLH 1JHKH 4Y5VB 1TJGH 3VMNA 5ANMB 1P6AB 4FXGB 4YOKA 4A2MA 4RAUA 3VD4A 4OTXL 5DJCB 3MODH 2EDWA 2YD7A 1U3JA 4NKOA 3W57A 1QNZL 4RFNB 1OL0A 3SDDD 1C5CH 3EOTH 1KXTA 1PEWA 1QO3A 3HN8A 1TQCC 3ARFC 3PCYA 4LVHC 4NNXB 5CILH 5H94A 3VM5A 3NZ8A 1IFRA 1X9RA 4IBYA 3UBXB 3J8F7 3MV7E 4HXBL 1DDHB 1RL1A 2VR3A 4Y4KB 3HMXH 4YS4A 2K4AA 5MEPA 1I1CA 1BQKA 4KH9A 5FYJU 3R4DA 1YEDA 5T5NG 1SFDA 5D6CB 3QRBA 2VR9A 3CSTA 5E70A 5J13C 1VZGA 1WHOA 1HAWA 1KTBA 4Z7OF 1P4IL 2OPCA 4XP4H 4QRRD 3IE9A 4TVPD 2IPUG 1VHPA 1ZWIA 2Q1EA 3QZPA 5BZWA 4MMYB 1LO4L 1GVIA 1XCXA 2IOOA 2MTPA 2Q7YB 4NKMB 2W60B 3MCLL 4ONGL 5IWLA 1EDHA 6FABL 1H3PL 3VSVA 5L4MA 1JTPA 3C5XA 4IRSC 3IJ9A 4R5VA 3CBJB 2VXQH 5D7IA 3P77B 4UQ2B 4Y19D 4X80H 5FDWB 2P3YA 4WKZB 3RA7L 1TG8A 3MRNB 4UB0L 3OKKB 4FHKA 4JL1A 1AXTL 4OM0L 5K9OB 1D5BB 2Y69B 3CDCA 4TSBL 1PCXA 1L9PA 3ARYA 3LS4H 3QUZB 5BW7C 1EQWA 4OV5B 1URLA 3S2AA 1Q9LB 1UB6A 1GGBH 4TLUA 4GQPH 2A4EA 4MJIE 4LSDA 4TSAL 3SBRA 3TFKC 2WKLA 2WBXA 5AW9B 1RMFH 1GZHC 2VMFA 1D6VH 32C2B 3PGFL 2Z91A 3KLHC 1IKOP 4F2MA 4DEWA 4M8RA 1BFVL 5IB1B 3LRMA 3HMXA 5IEKB 1JNHB 1FGVH 4KKQA 1LXMA 5EU4B 1HZLA 3CZEA 4NM8H 1W0YT 4P5TA 3T8XA 3MLSH 3MRDB 5I76B 3GS0A 4YSTA 1ZEAL 3ARBC 2XY2A 1JL8A 3MCKB 5E6ZA 4ZQKA 5JW5A 3RP1A 4HHAA 1HE7A 4IK6A 2R59A 4JFYB 1ACZA 1XGYH 5AVQB 2WJ7A 3ZKND 4AENB 1PYWA 2J73A 2FLBT 2F61A 3TFBA 2WQSA 1ZT1A 3ZL2A 1RP9A 3N1FC 2DYPD 1N7MH 1YMME 2VXQA 3DVFA 4QHLA 4W9JC 5B4MD 2VABB 5IQNA 3U6XA 2FX9H 4DESA 4FQLH 3WIFB 5EEZA 1K5WA 1F3JA 3MRBB 4MMZC 1HXMA 1E3XA 2E7CA 1PZBA 1NAMB 4XC3L 3V6OA 3SPCA 3DTXA 1AC6A 1BAGA 2XN9E 5I30H 1OK8A 1YYLL 5TQ2H 5IESH 1I8UA 1PG7W 3GSXA 3MLXL 3FCGA 4MAUL 2FYYA 3WFEH 1GH7A 4JPQA 1NBCA 2VJ8A 3UYRL 4DZBA 3PFQA 2B1HL 4DIXA 3WN5C 4M62L 5ECJE 2K78A 1ULVA 3S37H 2JQZA 3CFEA 4KI5D 1AG0A 2VMDA 3D0LA 3HUJF 5TFSL 3T2NL 4E0RA 5DS1A 1QI5A 5AOKA 4HUKB 3WENA 5LNEA 2VM9A 3UIYA 5FWRA 4W93A 1QLRB 2ZWSA 4KK9C 4ES9A 5CEZE 2DI7A 4MFHA 2ICWB 2X2YA 3R8BB 1FNEB 1A6TB 1YYCA 3NG5A 3ULVD 2XV2A 1WZ1H 4AYBA 4R7DB 4U0RC 4F5CA 2EDFA 5AW1B 3CFBA 1LHZA 3F7KA 2AEPL 1KCSL 2J8UB 3IDMA 3B6SA 3SSGA 1B4LA 2P52A 1P1VA 1FNAA 5LGYA 1PZCA 3QEUA 3VU1A 4CAGA 4EN2A 5SWQB 5C07E 1YCSA 4WWKA 5CNHA 5E4EB 5EUOF 4OZFG 2XVLA 4O4YH 5AAPA 4EIGB 5IOPB 2G60H 4LLUB 4R0LB 4R3SA 3IGAA 3P4OB 4WUUA 5LO7A 2VLRA 3VUAA 4M6OH 1GPOH 2V7HB 1ZJBA 3MBWB 2EUVA 1X7SA 1KJMA 3SY6A 3KW8A 4OY9A 2HB0A 5F9WC 3NJJA 2Y23A 3BH8A 1C16A 3AW5A 4AZUA 3C6SB 4Q97A 2N01B 5I1GL 2P8PA 4JRYD 1TEYA 3WYRA 2Y06H 5CHNA 3BVTA 1KEMH 1FPTL 1T6VN 2DWYA 1W80A 4EDXA 2BS9A 2XWCA 3BDXA 3T0EA 3RHWK 3BW9A 1E3ZA 3KYNA 3L9YA 2P5PA 1FIGL 3LZQA 3SEPA 1SGKA 3BMVA 3PGDB 3T4YA 3CN0A 2EDEA 4H88H 2AXHA 4A7SA 1Y6MR 1FYTA 4FQXB 1E40A 1OGPA 2FSEB 3T3MF 1ET7A 5EBWA 1U4FA 5D1QA 4D9QD 4HWZA 1E9PB 4Y2DA 2VCOA 5INDB 5HHXH 5C0EA 3MBEC 1F1AA 2IPUK 3HB3D 3A5VA 2VT0A 1MQ8A 2YBRA 1XHHA 3K8LA 1JF1A 2YZ1A 4AUUA 3BVDB 3O6FA 3OGOE 3BI9X 3L81A 1E42A 3PY9A 4GRWF 2BSEA 3V5KB 1GOHA 4NJ9H 4JFWA 5CJ8A 2W91A 3IAPA 2EIBA 1H8SA 2YPVH 2D7NA 3DUHA 5HHVL 1UJTA 5C8JA 3TA4D 1ASOA 3KEDA 1JGEB 1JGVH 3CFTA 1IVTA 2P80D 4JDTL 3K6NA 1P4LB 3O2DL 4JMNA 3F7VB 2F54E 4LLVA 4MAYD 4EIUA 2GSIA 3LTVA 4RDQF 2KT6A 4J3XA 2VSKB 3FULA 2HFGH 1TZGH 4ANKA 4ZMLA 1FG2A 4FXKC 4A37A 1RJZA 2VLMD 4OLXH 1A2YA 1KTLA 1VLXA 1MRFH 1UGKA 1V54B 4OLWL 2PWGA 2EO9A 3QXDA 5IHUL 3ES6A 2W0FB 1AD9A 4KAQL 5E2VL 2R51A 5CMAA 1CU4L 4YBLC 4PWGA 4ZUSB 5K33A 3QXVA 1AR1D 2V9UA 3PUUA 4JAMB 1JRHH 2XA8L 3DMMB 4N6QA 4XCNA 3M7OA 3O0RH 1DVFD 4QJ5B 4JPSA 2OR9H 4ILDA 2BS71 4AEHH 1IILE 1MHCA 3HI5L 2OP4L 2P7TB 4HCIA 4Z18A 3S36X 2DQDH 4TNWK 5FHBH 1TT6A 5E6UB 1GY1A 4YQXL 5MENE 1LE9A 2EUWA 3DTDA 1F1GA 3BKMH 4MJ4A 3VFTB 2LTQB 1WZKA 4WVRA 1BJMA 1I7TA 2X1PA 1BZDA 4BWTA 3MUUA 5HHPB 5MEOA 1F8TH 3ULUD 4GAJL 3TZVB 4MDIB 2BDNL 4KUZL 3LRSA 1LO5B 5DHDA 2GC7C 3M45A 3AQXA 1F0LA 4FXKA 4WHTA 2CHZA 5CJBA 2E9IA 1ACXA 3BZ4A 3HS0B 3R1GL 3CX2A 4K9EH 1URZA 5G5DB 4JFDD 3VWKA 4XMZA 2JQMA 3MRRA 4TPRL 4U6VL 2YPVA 5EOTA 5DD5H 5F1OB 4AVKA 3GXPA 1DYZA 4JPVL 3VB8A 2BNUB 3O3DB 1IO4C 1MCSA 3D2UA 1G0DA 4DQAA 1BJ1J 4AE1A 1MNUL 5JW3H 2CJUH 5KBLA 1RPKA 3VXMD 1PDKA 3ZE1E 3VX0A 2D7TL 1M6OB 3ZMRA 5KVDH 5BV7C 4YHPB 1D7CA 2FX7L 2YBGA 4YBHA 3QIWB 2BJML 2WLZA 3FUKA 1FG9C 4FQCH 5CR1A 5JIIA 2XIBA 2YAMA 2G5BB 3B5TA 3KPOA 1UCTA 2C7UB 1YDPB 4ODUB 3JTSB 1EXUB 3QI9A 3O2WL 1KJ2L 2Y7QB 4UDUA 4YZWA 5KS9A 4NUGL 4B5EA 2OA9A 4LLDA 3ZT6A 4MB1A 1PG7X 4LMQE 5GS1C 5T1KB 1DFBH 3WFZA 1OB1A 3HI1A 4KK6C 1H8NA 5PAZA 1WDAA 4RGNB 4HQQL 4CVXB 5E8NB 4L4VE 1VERA 4GKLA 1BLNA 2CRIA 4HAGA 3UTZB 5EF3A 5HDWA 3OAUH 4UQ3A 5TE7L 4FL4C 2NXZD 4DTGH 1M53A 4GRLA 5AFAA 1HHKB 1J8KA 5CD5D 2CKBH 3BP5B 5LG1A 4P2OC 1T5KA 2I60L 4LBEA 4HPHA 5FF6A 1HNGA 1BZ9B 3T3PF 5GZNC 3V0HA 4RCAA 2DQIL 4TNEA 1F58H 4NJAH 5FS5A 4DW2H 4PY8J 5KSBA 15C8L 2KL6A 1AI1L 4U0QB 1WITA 8PAZA 2X4UA 3LRLA 1FL6A 4PJBF 1A6PA 2WWKT 1D6EB 1EFXD 5EEXA 1YECL 3FUEA 4PG2C 2JB5L 4K23L 1RUPL 5HP5A 3LHAA 3GBEA 1SMDA 1OAJA 2BIPA 2GBVA 1I1RA 2A74A 2E8YA 4XNXL 3U2IA 2WXGA 1M71B 1OT2A 3MLUL 3FU6A 1BEXA 4JKNA 4FQIH 2Z4QA 1DQJB 4WI0A 3MRKA 4MQXC 1QEXA 4XN9A 1SJVA 4YZFF 1BVKB 2J4WL 4UF7C 1NBQA 3KD4A 2CO7A 4YR6B 3F3HA 5KG9B 1CDYA 2W81C 4YDKL 1L7TH 4YWGH 2K3HA 1MJ8H 1I9IH 2W38A 1T3FA 3LQAL 4BQ8A 1YSOA 4PRDA 4AT6B 2MRYA 2OMUA 1KIRB 2DH3A 2E7HA 2IWFA 3LX9A 3B1TA 4U2ZA 4PRHA 5IMLA 1PGRB 3DDGA 2OSLA 1AGBB 3FUIA 5HGAA 5I6XC 1DCLA 1QPXA 2ZOLB 3L9BA 4JM2C 4QRSB 4WWNA 2CKBA 2HRPH 3KR3L 3L3JA 2KLRA 1SJXA 3RG1C 3LXUX 1I8LA 3DOHA 3ROLA 2WXNA 4QRPB 2BY0A 1F02I 4XMWA 1OGAD 2WUCL 1P9MC 4WAFA 5SX5H 1DN0B 2HLAB 4XBPA 2MNWA 4DOHE 5FUOH 1MH5A 3BWAB 3MUHL 4MJ6B 1NWPA 2VMCA 5JO5B 5C0DA 5AB2A 3GI8H 2CMRH 2DBJA 4Y16B 3REWA 4M7ZC 1IX2A 4FTVB 4BZ1H 4MJ5A 4FG4A 1MZZA 5JOFB 5IHHA 1T4KA 1KV3A 1NCOA 1Z9PA 5TF1H 2R23A 1A9EB 4XHQA 3V4PH 5BXFA 3MV8B 4OLVL 4NXKA 4Q8BA 3O81A 4QWWD 4LQ1A 2PETA 2QQNH 2AK4D 3PWJA 1TJIH 2FQGA 3ZLQC 1E4XL 1FE8H 4HF5H 4FQQA 3VG9B 4V1DB 3QEQB 3GHEL 4XPAH 5AB9A 1J9SA 1HKLL 1REIA 5DMKB 1RJCA 3TEZA 4PVLA 2ERJC 3A6CL 3RWGB 1H3XA 3SYAA 3ILQD 2VDOH 3FCBA 3RGVC 1D9KB 3VGHA 1MFEL 4FKKA 5CEZH 4PJDE 4NQDD 4WU7A 4QRUB 5MHSE 1Z0MA 1FAKT 1IGFL 1DBBL 2NTFA 2CUMA 3CHSA 2XTJB 2C3VA 4IRJB 3UAJA 2VUKA 3GSVA 3AREC 5IROC 5K9QG 3EJCA 3FB5A 3GXMA 3T1WA 3DJTA 4XNYL 3DURA 2FATL 4LNVA 1CE6B 3BPCA 4S11A 3NA9L 1J0IA 1JPTL 4M48L 4E42A 4MWFB 5E6SB 5C3TA 4KK5C 4ZAKC 1VGEH 1F42A 4AMKL 4HX1B 5IJVB 4NT6B 3UTSD 1TF4A 1WPCA 2FE0A 5BZZA 3SD2A 3BRGC 4BZ1A 4HUUA 1D5IH 1LP9E 2QSCH 5K1JA 3DROB 4OZIF 4KPHL 5E8EA 2WZ5A 1U91B 1MLBA 2PKDA 3RWJB 2F8OA 2VXSL 4YVUA 3V4PA 2XN9A 2WLMA 1JI2A 1LM8V 4BFOA 3KXFB 4G5ZL 4M6NL 3BAJA 3Q5TA 4IEFB 4IJTA 5F9AC 3ZRSA 2J8OA 1Z3GL 2ZOTA 4K94H 2JXMB 5HDBB 4CNIA 5LWYL 3TZVD 3VD0A 5IROA 5ICUA 4CGTA 3GSOA 3JTTB 2H32H 3PFUA 5BS0B 3PDDA 3S7GA 1FNLA 5CGYC 3KWTA 4HV8A 3EKCA 1OTUD 3RWHB 3BX7C 3K0WA 3TCLB 2P5EE 5KVEL 4FNPA 1O5PA 3KJ6L 2DN7A 1TCRB 3KWVA 3GI9L 3MRHA 1NCTA 2CXKA 3HE7C 3QPQD 2HFFA 3IU3A 3LXCA 1OTSC 4KTEH 5CZKA 1N3NB 1OAQH 1IE4A 4TUKL 1YJDL 5ILTL 5D72H 3B5GA 1TZIA 2YUXA 3QA3B 5IQLA 2ADJA 4MA3A 2X09A 4JGJA 4JFQB 5DQ9B 2Q76B 4GBXB 3CVBA 4UQIM 4AQZA 1KPVB 3QDGE 3VWJB 1ZT7A 4EQ2A 3SDCC 5IFHH 3WUWB 4QXUH 4Z95H 4ELKA 4YXHL 3UMNA 2PLTA 2VC2B 1BXXA 2ESVD 2KLTA 1TFPA 1KELL 1IAIH 5D71L 5BOJA 3N41B 4YHOH 1IZJA 4XN4A 4X8GA 4I3GA 2UUDH 4PCTA 5MP6H 5HGDB 2OMYA 4WO0A 3NSXA 1L7IL 2A77H 2BXYA 2FGWH 1B0GB 3MRGA 2A6IA 4FCHA 4ZJ9A 2EE2A 2QHLA 3CVIH 4I0PC 3ULAB 3WDJA 3ZE0B 3NTCH 4DAGL 3H9YA 1JDDA 4Z77B 2Y36L 3G5VA 2NNCA 3W9DA 1K8DB 3CDFA 1M3JA 1A7RH 2VXTH 4U3HA 3WNIA 2F53E 1HXYB 3ARUA 5ERWA 3FQXA 1R3IH 3UPRB 3BVWA 5CWSA 3HG4A 3RVXD 2A9MH 3L7FB 1J1XL 3T71A 3DVGB 3RUGB 4F2EA 1T0NB 1BXAA 2AW2A 4N8VB 3NH7H 3ZTNL 2X2IA 4KO7A 4YFLF 1KV7A 5ANHA 3C8HA 4CMHB 3JWOH 5A3IC 1LEKB 2YK1L 3SE8H 1TZ8A 1S3KL 1UXWB 2R0WL 2ZP8A 4YHKH 1E27A 2QLYA 4OIAA 3FYEB 4NHUA 2XWJA 1G7PB 2F18A 3QUXC 5T1DH 3ZTJG 4ZW3A 4NOBA 5IFJA 2X1WL 2GIXA 4F1ZA 1WFNA 4LPXA 3ARRA 4MXWL 2Q3AA 2EYTB 1EZVY 5TE6L 1A1MB 4JZOA 5AVSB 2FWSA 4ZFOL 3SDAD 1NZRA 5EZLA 4MZIA 3JWOC 4HS6A 3FRUB 2ICWI 5CP3H 4S2SB 4GJTB 2YQBA 2YOCA 4ANXA 1OANA 1S8DA 3FQ4A 2H6PB 4G71B 3WMSA 3UGXA 1QTPA 5CBEB 3CFMA 3TWCL 5TK4A 4RH4A 2XBTA 1TVDA 3A6OA 2EH7H 5EO9B 1XGQB 4N2DA 2DMBA 5DEZA 2X70A 4L1TA 1B4JL 4LEOA 4MNGB 3O45B 4RDQG 4S1QL 3GEFA 1BZ7A 1QSFB 3ZKXC 3CSFA 4QRRE 4DN4H 4J3WA 4TVPE 2ZTBA 1DO5A 2KZKA 1UXSB 5L9DH 2EIZB 2IPTL 1AGDB 2ZSVB 1G7QB 3Q0HA 3FU0A 1H15A 2PO6C 4OGQC 1P2CA 3FO1A 3U36B 5MEQA 2DEXX 1ND0B 3BHBB 1M1XB 2HPTA 5F3FA 3K2UH 4Y19E 2C3HA 1INQB 4LGPB 3ZIYA 1ED3A 3T0XA 1AGEA 3IE4A 3LPWA 5E94B 1DBJH 3WTYA 2JTDA 2Z7YA 1JZ7A 2W9EL 3CFCL 3WFDH 4GG6E 4OQTL 1DQIA 2EZ0D 3WHXB 5J6HB 2ITCB 4W9IC 1VADB 2FAUA 1LO3L 2NUPB 4X0KB 2GTQA 2R69H 4PRNA 4XGZB 3PAZA 1QFWL 4QPEA 4Z7NF 5DHEA 2I24N 4CSTA 1J8SA 4YSUA 4JRXD 2XXGA 5CP3A 3FU3A 1T22A 3Q6GH 3KLKA 4NZUH 5A2JH 5I1EH 5KYXA 4UV7H 2UZXA 1CUOA 3JBG7 4RBPK 3L3OB 5D2LB 4GG8A 5E1HB 4DNLA 5ITFB 2E27L 4H8QA 2HVKB 4HS8H 1AXSB 3G5XA 2FLRT 4QTHA 3L2NA 5D7SH 4EUPH 5A2KH 1IQWL 3I75B 5DK0B 5AB0A 1ZLVK 2KC0A 2LFGA 3WI9A 5IEHB 4KK8D 4L4VA 3EHBC 4L0YA 4I87A 1F45A 1G7LA 4S1SH 5JHDB 4AJVA 4F57L 1RHHB 2NR6C 3VD9A 3QCTH 4PWJA 4F58H 1BZQK 1L3NA 1YQVH 2F7OA 4M6AA 5I2IA 1E8YA 1G4MA 1OARL 4FCAA 2UZYB 1OQOA 3TO4D 5DSCB 1HEZB 1A3ZA 4LRIC 5FO8B 2D8KA 4DKDC 2N4IA 2CBQA 4QXVA 3VDCA 1ZV9A 2NYZA 4K3JH 2IOMA 2A5UA 2XNAA 1GYCA 3PWNB 4NNYA 2ZUSA 3UABA 3QHZH 2L7QA 2X6BA 1FQ9C 1NC2B 3QQDB 3UCRA 1I7RA 1KFAH 2EQDA 4ZX3A 2Y3AA 2R69A 3QULB 4PRAB 3ARGA 2MCPH 1CZ8L 3T4AA 1GC1H 1M05A 3BSGA 2AGJL 4B9FA 1FFQA 4KI5E 4KV5F 1RK0B 3MO1A 5IBUG 2OYLA 5HVWA 4OIIH 2V3FA 1PY4A 2FQDA 2WK2A 3I6SA 2H3NA 3SQOH 1W8NA 1WHPA 4J6IA 3GSNB 4AYSA 5H2BA 4IGBD 4NO3B 4P4KB 3QIUB 2EDHA 5CUSH 5HHMD 5DJXB 5F0JB 2OK0H 25C8H 1BYNA 4MASA 1TTRA 2X28A 5F6HI 5HI5D 3ULVE 3T8VA 3BYYA 2VXUH 5CZXC 2UYLA 3OF6A 1VRSA 1GC1C 1C12B 3BXNA 3GMOB 4O5LL 2XZCH 4N2BA 1OP4A 4L2LA 2JB6A 4J3VA 4LLQA 3BWUC 5D8JH 3DX6B 2VDMH 4EZKA 1OPGL 3GMMB 1CVRA 2QVIA 1T1YB 4FNSA 2K0RA 1WAAF 3EW3B 3C5ZA 4KU1A 2GAZA 1BGXL 4FEIA 1MRCH 3L95B 1NCCH 3MX0A 2DQHL 2APBA 3E38A 4K8RH 2CBTA 4AY0A 3GUTB 2R2CA 1KCKA 4FDWA 2DWEA 2NYYD 1N67A 1EO8L 3QJHA 2YN3A 5IY5B 4AH2A 4EDWL 2CHXA 4PQXA 2X44D 5JPMA 2DD8L 4JRYE 5FGRA 1NGPL 5ESAA 4JG0L 4LSSL 3LKSB 3EJSA 5JQ6L 5AW5B 2ARJQ 4QOKD 1F3RB 4UM8A 4L29B 3T2QA 4AQEB 3B9VA 5KYUB 4MDJA 1V7NL 2XRAL 1TLKA 3ABGA 4K8RC 4LHUB 1FZOB 2QDVA 1MAML 3BUIA 4OKDA 4Z6AT 5TPWH 1KLUA 4XAWH 1ZLEA 3QIBC 4CA4A 4TYUA 3RX9A 4BM7A 4D9QE 2IAMD 4RMUA 5L6YL 4O2FB 4D94A 3CHXA 2D3JA 4HHWA 1NL0L 2WTRB 3BPNB 4Z7OB 3LEXB 4XNMB 3AB0B 2HTLC 1OGTB 4Y4HC 2QADB 3IDYB 1DJGA 4ODHH 3WE6A 2Y1YA 1CDBA 1FVCB 4PJHF 4EI6B 2PP7A 3OZ9L 1A3QA 3LEVH 1IQDA 4CILA 4LKXA 1XD0A 4JK0D 1OO2A 5DJ2B 1P6FA 3OPZH 1ASQA 3DV4A 1I75A 4PJDA 4U6HB 2XN1A 1NJ9A 3MJ6A 3OXRA 3Q1EA 5CO1A 5JIHA 3CU1A 1FRGH 1OWWA 1L9RA 2P45B 1P84J 1TQTA 4Y9EA 4EN3D 2CKNA 4Y9GA 2WUBH 4IMLA 3NN8A 1DE4B 3HBZA 4PW4A 3GJEB 4LCYB 3A0OA 3GJFK 5I1HL 1G1OA 3C60D 4GKNB 1HHHA 5E5LA 2EAEA 3NPSB 3Q1SL 4N2IA 5C92A 4JO2L 3I84A 4FC3E 1HHIB 2H45A 1K9TA 2DBLH 3THMH 4Y4HA 4AC4A 2R1WA 2YR3A 3U9WA 3TF7C 1X4YA 4HT1L 3WKQA 2EE9A 2ZIDA 2FJHB 4XOBA 2Z34A 3QUYB 3RWEA 1ZSDB 5DUPH 4K7PY 1CS6A 2XLLA 1EMTH 3TURA 5IV2A 2UXGA 2NY1C 3A67H 2DWXA 1BMWA 3BMWA 5ICXB 3V7MA 3ULUE 2Q6WA 3L5WB 4QUOA 4YE0A 1OAKL 3P0VL 3O3BA 2OR7A 3RVUC 4FA6A 1TPXC 3PP3K 2A6DB 5BUAA 1FDLH 3LRGA 5J6GB 4LHJB 4QF1A 2B4CC 4JFDE 2DF3A 5EB9A 3QJFA 3A3YB 4OLUH 2BVOA 4M7KL 4HUVA 3TA3B 2G4EA 3B2MA 3QH3B 4JFPA 4XHJD 3S3PA 5EO0B 5LGHL 3SBQA 5KSAA 1CLVA 5AYUH 1DHKA 1OOWA 3BKJL 4XPHL 3VXME 1GJUA 2QMJA 3V9CA 3LH2H 2F1EA 1U3HC 4H25A 1FJ1B 4X9IA 2OX5B 4G7YH 5HHOD 4JFFB 3ZHLA 1N0XL 1ORSB 1AXIB 1ZA3B 1ZHKA 3FTVA 2BFVL 4ZUWB 3QNFA 1G43A 4JFUA 4RWYL 1KIUA 2XC8A 1XIWC 4PJ7E 4XN7A 4BK4A 1ECZA 4P04A 5I1KH 4LCWD 2ZX8A 3HAEH 5D7JA 3MRQB 4W9LC 5F6HJ 5I9QB 4UQCA 3FO0L 1U95B 3FB8B 3BKCL 4GIOA 3GD1C 2JE8A 4NO0B 1E6OH 4LAQL 4PJ9C 5J12C 5T3XL 3HUJB 1PFOA 1RZKH 5AAWC 1DQML 1A4KA 4PS3A 5EPMA 5CU9A 3V2AR 3TONA 5FECB 3P11L 3RIAK 5A43C 5F96L 3SKOB 2EIKB 4PGEA 5DYFA 1MJUH 3CZFA 3DARA 1YEJH 1Q9WB 2F53A 5GRJL 3CX5J 4V2BA 1U6AH 2RFXA 3FT9A 1H0DA 1D7BA 3QHFL 2X4RB 2D03L 2IDSA 3SDDC 1XIWA 4C56B 1JWSB 1RZKC 4TVPH 1P69B 4ONFH 1PY0A 4JEGB 2W65B 4A7GA 3PDOB 4A1RA 2VLJB 4L37B 5EUOB 5SX4H 2CLRA 5I0ZA 2VDKH 5IHLB 1IC7L 2ZXGA 3FT4A 4P07A 3UXFA 5D7IF 2ZKMX 4OJCA 4WLCA 4N1HB 4RMQA 1JXJA 3LDBC 1P7QB 4GINA 4NDMA 2NY3D 1F6LL 1UD6A 4FYSA 1K2DB 3BAEH 1PNCA 3BIKA 3TJEH 1AKJD 3MV9A 3UZVB 2IMMA 2R4SL 4NHCH 5DR5H 3HAEA 1AHWC 1MREH 4GSRA 4K5OA 4N0FB 2Q0ZX 5JYLA 1O9ZA 2J57A 3CLWA 5FIEA 4DQOH 3SDYH 5DUJA 1KEGL 4P4KD 2OULB 5AWNH 3N85H 2OJZL 3DXAD 4ZO6A 4D0BA 2O4EA 3MZTA 1YYML 1U2YA 1FBIH 4M5ZL 2X1XR 4FABL 4XXDB 3JYBA 4FYRA 4AV4A 1QBMH 4D8PA 5DQDH 4IBSA 1CBVL 3T3MB 4LSUL 1CMOA 4X99A 2HH0L 1H8OA 3K5SA 4HFUL 1NAML 3HC3L 4UNTA 4X6DE 2FWOA 1Q9KB 3DOIA 5DZJA 3V4VB 2BH0A 3VG0H 5HPOA 5L7XL 4OCNC 3UAAA 4OB5L 1QW9A 2YPLA 3FTGA 3V10A 2MPAH 5IB2B 4JQIL 4GP5B 3SGDH 3LNEA 3INOA 4Y1AB 2YARA 1S9YA 1U4EA 4GRWB 3KPLA 3KPRD 4NZFA 1CDUA 2ATPB 1OGAE 4U1LB 2HFTA 5F7UA 2K3TA 12E8H 5J1AA 5K5YA 2H1XA 3LQZB 4I1RA 3VD7A 2VRAA 3HC0A 1WYJA 3MNWA 4PLKD 2FQFA 4GW5B 4Y19A 1HH6A 3KPPA 2VH5L 4NZRL 4HOZA 2BX5A 3MXVL 5DJZB 1JYWA 3GZQA 3R18A 1CLCA 4M1GL 4M43H 3QFDA 4UAOC 4E9SA 4ONHA 3GO1L 4QDGA 3SGEI 3IJ7A 3QQ4A 4MNHA 4KOCA 3TBTA 3DIFA 5E95B 3ZKNC 2AK4E 1OZUA 2IH3B 2VITA 4OBSA 4XVUD 5DA0B 1M7XA 2QR0A 1GW6A 3CMOH 4HIXH 43C9A 3MLPA 1KB5L 4Y9BA 5DD6B 3W0WB 3STZB 2XI9A 4QHNA 4J3UA 2UZIH 4LRNH 3F7LA 4C57C 3GXNA 5B4MC 4W9ZA 4B9KC 2JV6A 2VSMB 4DEUA 3IAQA 5CBAA 4N87A 9CGTA 2WINA 2X6UA 5FV2A 3FQWB 4JS7A 4WGVB 3GMLA 5EO1B 2DDQL 2HYMA 1IC4H 1NCAH 1IM9D 4NQDE 5CINH 4ZTOH 3N06B 1SLWA 3ULVH 3K7UA 2Y22A 1A9VA 1B6UA 3FUMA 1IEAB 1NMAH 1UT9A 1NCDH 2XBDA 3NFNA 4JZJA 5AZEL 1U8KB 1WS8A 4KI5C 4ZDHB 1O9WA 2DQJH 3U2SB 4EMZA 5JA9A 3E8UH 1WIPA 4HK0B 4PJCE 5E6IB 3RB5A 5I0WA 5J11C 4LSVH 3VSTA 4Z0XA 1WVZA 4HLEA 3CTTA 2CZNA 2AXGA 3S4SB 3UTSE 1KJVB 3H7BB 3D52A 3M1CA 4DGWC 3FU5A 4YDIL 4YSEA 4HK3J 2FZ3A 3RDTD 3ULVC 3PWLA 2RAMA 4NUJA 2BNRB 5AOMA 3S35X 4BELD 3QUYD 4HZLB 1FORL 3W11D 3B2VH 4NQUA 3V6FB 4A55A 1IGMH 1ETZA 1VESA 4Q9CA 1XR9A 3DPDA 1E65A 2XV0A 4Y89A 1F4YH 1E9OB 3S5LA 4BCYA 2YS4A 1TJXA 1NFAA 3ZRFC 1D5MB 3QRLA 5DMIL 1I7UA 1BM3L 1QRND 4OD2B 1FYHB 3ME0B 1IBYA 4QRTB 4E68A 2V4LA 2YQ3A 5KVMC 1U8LA 3ZRCC 4ES8A 1U58B 4PFEA 2H2PD 3K1KC 1FH5L 4L9LB 5CIPH 1ICTA 3FOMA 5D4IA 4U6TA 2PCXA 2ZOKB 2YMTA 4I48A 3P30H 3QJSB 4KO5A 3T3PB 3ZKMD 5GZOA 2PPDA 4PGDA 4GY4A 4KHXL 3VD3A 3GEWB 4P3CH 1Y18B 4Z7WA 4WTZG 1E7UA 4G83A 1TKWA 5AZ2H 5B8CB 3UAEA 5FOBA 2PCFB 3VH8G 4RFEA 2F5AL 5GRXG 5EG6C 2XOTA 3BH9A 3HKFA 4PJBB 2OV0A 1JV2B 1IZKA 3P4MA 4GP8B 4UTAH 5JXAH 2CIKA 3LH8A 2NY7L 3IJYA 5CZRA 2ESVE 1TIUA 1EEYA 1G9NL 3HB3C 3N9GL 5B39G 4K71B 3UC2A 3KCPA 1EX0A 2CU9A 4IRZL 4C4UA 3VFSB 5IR1A 2JELH 3F00A 3Q6FA 1WS7A 1HSBB 1YUHB 1NIEA 5EH1A 4FQ2H 5HGBA 1G0YR 4HC1H 2HX9A 4MA7H 3FS9A 4GKZB 4H5SA 4AIXA 1T6BX 1GZPA 4G6KH 4Z78B 4N25A 1UUNA 3TIDA 3MMEB 3O4LD 4OM1H 5LJYH 2X0VA 2DMHA 3E6FB 5L2JB 5TDNB 4UINL 4MB4A 2GJ6A 1MXDA 3ARSA 4XN2A 2CHDA 2PTTA 3LV3B 3RNKB 5B7FA 1QPPA 5H35A 4MAYC 1UACH 2AITA 4X6EB 3UBGA 3OJDB 4P9ML 5JLZA 2RH0A 1W6WA 2VISB 4ZK8A 3QNXA 1MEXH 4OV6F 1AQMA 5CIPA 1UASA 4UOQA 1A5FH 2Z0BA 5ETUB 3IAGC 5DMYA 2PPCA 5GGTL 1PCSA 2EDYA 4X42A 2N0KA 3C6EA 3CGTA 4OFYD 1OCWL 5DTFA 3OKYA 3T0VA 3RZCA 1SVZA 5I17A 3QUKB 4ZS7L 5CD3B 3D4CA 3NJLA 1BFOB 1IM3B 3W5MA 3ARXA 2AZAA 4NWUL 1D5ZB 4YSOA 4YHNB 3HW7A 1DVFC 3WD5L 2APVA 3EAKA 5EBGA 3QDMA 4MA8H 2DKUA 4UTAA 3MJWA 5DS2A 4XCYB 1RSFA 3FYIB 4NNPL 2WBJB 3E2HC 4XVTH 5IK3A 1KPRB 3RNQB 1T2XA 2X88A 4MAYA 2X7LB 3ULUC 2OI9B 4HG4J 3FH5A 1N5AB 1RFDL 1WC7A 3QG6A 4CJ1A 4NN6C 2H3XC 2B59A 4PB9H 2DAVA 1AC0A 3PXJA 1JK8B 2D31B 4HC1A 2QQLH 3TBVB 4QMEA 4M1DL 4YE4H 3S3SA 5I8EA 4JFVA 4YDVB 3R8QA 2Y07L 4JL2A 2WLIB 2ADGB 5GGSA 3P3YA 4R90H 3KYMA 4EI0A 4GW1B 3NP3A 3C87A 2GBTA 2BSTB 4KROB 4YHML 2F7PA 3L5XH 4OF0A 4F93B 1IAKA 3ABMB 3ECWA 1XF5B 2AV7B 3FUFA 4OFPA 1HQ4B 5HJGA 3CXDL 4HJ0C 5CSZA 3VI4A 4EI5B 4JR9L 1J0HA 3CVHB 2AHIA 5HDQH 5I66A 1V8HA 5FB8B 2UXTA 4JN2A 4TL4A 2EDLA 3Q13A 3FTSA 1E8XA 3AXIA 5D2NE 4N86A 3VFPB 1Z9NA 3GNML 3PGCA 3GIVA 5KSBF 4H20L 4Z8FH 2AV1A 3D39B 4JFDA 1HHJA 5TDPB 3ARDB 4BFGA 1HL9A 3NOIA 4NGHL 1NICA 1CVSC 4GKOA 2OMXA 5BRPA 3HI6H 3HMWH 3VD5A 1DQLL 2NY6B 5KJRL 5C0RH 2NXZC 4U1NA 1Q1JH 4YL4A 3VTAA 3P9LA 5CD5C 4OZIB 3QWNA 5FKPA 2WZPD 4G11A 1U8PA 3EH5B 4U1SA 5CP7B 4KHTL 4JFOB 1LNUA 5FM8A 1CGTA 3MJGX 4PJ7A 3EJUA 5EORL 1CK0L 4F8PA 1JFQL 3VACA 5EBMA 5IVNA 4W1TA 5CLZA 5DEGB 3VRJB 4LCIH 4P48A 4ZPTB 1WZAA 2LW3A 2NX5A 1X5JA 3RFZA 3S36L 2VZSA 5C0CA 2VDRH 1P7BA 2VDQH 2Z92A 4KZEH 1F90H 1WP6A 4ABWA 2WYIA 5HGHB 4PW3A 2QTVA 4AM0A 1TTBA 3CFKB 4HKZB 4S1RH 4XVSL 5HXMA 3NBNA 1S46A 4PGBA 4FQHB 3WL9B 4MQTB 2ZPKL 3EGXB 3L13A 4Z1PA 2UVFA 3FQNB 4YEEA 5AAMC 2ED9A 3F6IA 2NW3A 5HVHB 5DURD 2Z9TA 5KSVA 2YXVA 4HUCA 2KHAA 5KBPA 1U93A 4WI2A 3RWIA 4UIMB 4P46A 3GSQA 3H7LA 1WBXA 4P2RD 1OCCB 3SE3A 5BMFH 5K9QI 3IKCB 4KX9A 4G7SB 4HKJA 1CL7I 4NP4H 1E5ZA 3KGUA 1OM3L 2FECL 1NFKA 2CLZA 4HH9B 4L3EB 1OSZB 1DZ0A 2V3DA 3VXOA 1P5VA 4NO2A 2HFEB 3Q05A 3B34A 3S9DB 3FO9B 4U6XA 2ZQKA 3EYSL 1UC6A 1HNFA 1UD4A 3QXAB 5IB4B 1KYOK 5I74C 4KUCF 4JM2F 3CFNA 3O6KH 1WICA 1XH0A 4M8QB 2MQCA 4G43B 3EO1A 1OVZA 3WJJC 1H6EA 5ICYA 1KCVL 1PG7L 4JHAL 1FNHA 3TBSB 2EP6A 2AJVH 5HHME 3DX3A 3NCXA 5DD1H 2XWTB 7TAAA 3OR7B 2R9HD 3OX8B 2J21A 3DI3B 3WY4A 1BECA 1B4TA 1UJ3B 1UH4A 3FTUA 1EAPB 3B8SA 2SEBB 3TJHD 1HVXA 4ZOAA 4WI8A 3KLAA 5HBBA 2J55A 1Q72L 4RAVB 4AC2A 3ORJA 5DQJB 5EBLB 2IPKB 3O11B 4QWWC 2ENPA 2K6ZA 2X89D 1HZHH 3NFPA 2H1LM 1P6WA 1S78D 1RVFH 4C58B 4DKFH 3UO1H 3D18A 4X5PA 3AXLB 4AYFB 1EGJA 4LCCB 2EACA 4R9HA 1HINL 1GS8A 2PXYB 5I5MA 2CE6A 1MFBH 5HYJB 5E8PA 4TNVF 4UCFA 3K8MA 1VEMA 2EKSA 2Z35B 3U30C 3ZL4L 3NAAH 5FM5M 4L0ZA 4QOKE 1ACYH 4M4RB 3EFDH 1A8ZA 1YRKA 4R7NA 5EIQA 5JIMA 3L9RB 4HLZH 4JLRB 1WTLA 1I3GH 3DOSA 1CDJA 3MNZB 1R5IA 2JJTC 4OTXH 2FR4A 1M56B 3GINA 4LASL 1AD0B 2VZOA 4RISL 4PRID 4MX7B 1NBZB 4R6UA 1JPSL 2AK4A 1KGIA 3EYFB 2QVKA 2N0MA 5I0DA 1G1KA 2BSRB 1IGIL 4Z7QE 4G80B 2F5BL 2R39A 4JHUA 3MFFA 5E5MB 2ZXBA 3N43F 4AGQA 1IC1A 3C12A 4GQ9L 3WJMA 5KSUA 2IV8A 2ZX5A 2J5WA 4HXBH 2VO8A 3PHQA 1OAZL 4KMTH 4X5QA 2A6JA 4I4WA 3VSUA 2ZG1A 3ZMEA 1JK9A 1OHQA 4NQDA 5D5ME 5JHBA 3GGWB 1WA0X 2G3XA 3HE6A 4Y5YA 2WXJA 5FO9A 1FFRA 2D9QB 4FLRA 3TZVC 4W6WB 1A4JA 2NY0B 5GS3A 2JJTA 1G4RA 1J05B 5ESQB 1LO4H 4FP8L 2O5XL 1R3JB 4G9FE 1OAXL 4ZW8A 3HS0C 4B7IA 1OTUC 1PQZB 2ATKB 4ONGH 3MCLH 4XP1L 2NY4B 2WGNB 1H3PH 2LVEA 4PHZA 1MDTA 3HC4L 3UTSA 5G4NA 1FHGA 5T1LB 4Z7NB 1KYAA 1VEPA 1XEDA 2V5SA 4Y4FD 2IXQB 1Z7JA 3MXWL 4AIZB 4OLYL 2ODIA 1U8IA 3JV4B 2XKNA 4YMPA 1NKGA 3QIWC 3DUSB 4RX4D 1XFPA 4UB0H 1CGYA 3STBA 4E5XA 4TUUA 4JHWL 1AXTH 4OM0H 3ZKSD 1IGYA 2DLIA 4TSBH 3EOYG 5I1DB 3BDBA 2X4SB 4LO9A 3J07A 3B3IA 3TNMB 1LK3L 3DO3A 4JGUA 3SCMD 5EFIB 2OTWA 2MTAA 1L0YA 3IKKA 4TSAH 5JMOC 2I7OA 4Q14A 1L6ZA 4G8IB 4R7XA 1SYVB 5LGJA 4Q2ZB 3CIQA 4UU9A 5K9KA 3FSAA 3IJHA 3ARDD 2WC7A 4U3XA 1E5BA 5AW7B 4YHLL 1FWXA 3L3KA 4TUJB 3MGOA 3HLAB 3VXRA 3HG0A 4NUPA 3HFML 1CF1A 4O58L 4U3SB 2JF1A 3KW7A 4I2XB 3MJ8A 1ZEAH 4DP7X 5F7MC 1GZQA 4ODTL 3BO8B 2CR6A 3K72A 1O6SB 3QNZA 1S2EA 5A7EA 4AL8L 4GSUA 3F6JA 3QYCA 5F6IC 3QJQB 5JXED 2PW2B 3RTQA 5GJTL 3AG1B 3F5WB 4KRMB 4LCWE 4X9FA 1OLZA 4XR8C 1RI8A 3QISA 4XMXA 5DF0A 4ZUUA 3RVXC 3EGSB 1DJSA 3NRFA 1TNNA 4KDTC 2PWEA 2BIOA 2GUYA 1B6DA 4GPVA 4XC3H 3JWNE 3RVWD 3D3VD 4NQEA 4YSCA 3RBSA 1YYLH 1ES0B 1RLWA 4QHUB 4DVRL 3MLXH 1Q1PA 4MAUH 2CJSA 5EWIL 1RZJL 4BSVA 3Q06A 3QWRD 3BPOC 1S7RA 1CGXA 1BEYH 1NGQH 3BCFA 3P73B 1HU8A 3D0VA 2FK9A 1XB3A 3MNMA 4DZ8B 4M62H 2GK0B 2I5YL 4UOW1 5DRZA 4ZX5A 4PRPB 5JHLL 1GIGL 2F7IA 5TFSH 1B2WL 3T2NH 4A6YB 3SDAC 5M7QA 4O51B 1IB5A 4OZHA 1J5CA 2PWFA 1WH0A 4NENB 4EOWL 3NCWA 1GOGA 3OG6B 3RPBA 2DZEA 4IOIB 2WP3O 2DL9A 2WV3A 4L0PB 5DYOB 1UZ8A 1AKPA 2ZXWB 3BQUB 5C2BH 4BSWA 3FOLA 3T0WA 5CM1A 3QXTA 2AEPH 1KCSH 3IDGA 3OAYH 2V33A 2WLLB 1YG9A 1SF5A 1YMHA 4ZFFB 5F9OH 1MHEA 4X83A 4X7TB 2Z8VC 5DT1L 4M56A 4CBPA 2GTWB 3U9UA 3B9EA 1X7QB 1J48A 3ZE1F 1ZVSA 4Q9RL 4LVNB 2LAGB 3X1FA 3DXAE 1PKQB 4DO4A 3JWDL 2VLKB 1CFBA 2A9DA 2X40A 3DBSA 3CHQA 1IC5H 3NCEB 3LKRA 5HY9B 5D2NC 2G2NA 1OF2B 1FVEB 3ILEA 3KDMA 3BUQA 1FZJB 5I1GH 1V05A 4QKTA 1DUZA 4UMGA 5DGQA 1AGCB 1BVNP 2NQ3A 1FPTH 1X44A 1AACA 2NDFA 2EZ0C 4ZW6A 2R56L 3WFHA 1FIGH 4ENED 3I9GL 3CCHB 1RU9H 3H2QA 1A1NA 4HA1A 3EBHA 3C5JA 4PJHB 2XSKA 5EZJA 5IZ7A 3DYOA 3Q2WA 3VI3A 1VKXB 2C9SA 4PJFA 5SV3A 3KPMB 5BRZB 4HIHB 3A6BL 2VW6A 1EEZA 4L48A 3RURA 1H6TA 2F8IA 2GJZA 4EIZC 4PV8A 5AQ0A 4CMMA 5I6LA 4F15B 3RU8L 5AVVB 5IMKB 2R29L 4KXBA 3QZWG 1J12A 1XGPB 3FQRA 3FFOA 2Q9OA 4JO1L 2C9UA 1I1AD 1NEZG 4KK8C 1R5WA 4HCFA 2IANA 4R8WL 3TN0A 2Y7NA 3ECVA 4G8AC 3V55A 3WGUB 4QKXB 2B39A 3ABLB 4AEEA 4JDTH 3O2DH 4BYHA 3DK0A 3ZYJA 3OHXC 3MLZH 1VAHA 4JDEB 1RZQA 3F12B 3V6ZB 3MR9A 3SOBL 3TO4C 2MHAA 4Q7DA 1MCPL 2F74A 1JSYA 5E99L 3WXWL 1OT1A 1TLMA 3Q8EA 4OLWH 4NC1E 3WBDA 3IT8D 5IHUH 4KAQH 5E2VH 2JIXB 4JHVA 2B2XL 2GY5A 3BGFB 1XL6A 4PR5B 5JUEL 3SGJA 5A2IH 3CZNA 3HPLA 1ZTXE 1KG0A 1LVEA 4MKMA 1AZUA 2RCSL 2XA8H 5DK2B 4EVNA 1G7MB 4YPGA 3D4GA 2CWRA 1PMYA 5GSVA 3HI5H 2OP4H 3GM8A 1NDGB 1X7TA 1ZLDA 3BKYH 2ZWLT 5IKCB 1QR1A 3W9EB 1FA4A 4IYKA 2A9CA 4MD0B 3WO4B 2UY7A 4CVZB 3IS1X 2VOTA 4G6JL 2BDNH 4GAJH 4KUZH 1JZHA 4IGBC 2ICEC 4HSQA 5JYMA 5CR8A 3AG3B 4UM9B 5GJSH 3WLBA 1NBYA 4WCYH 4TQ8A 5HI5C 1G6RL 2FH6A 1SN5A 3EDEA 4JPVH 3OJVC 5EUKB 4OI7A 4CC1A 2IIJA 4XNZB 3T0AA 5CGBA 3VWJC 3UZQA 4OZFH 7PAZA 1G9MC 2WOYA 5IQ7L 4MLSA 3O2DA 3WEXB 1DBML 3H9HA 3FU7A 2D7TH 3K3QA 3PQYD 4AQ1B 2AQTA 2O6FA 2FX7H 1JPFA 1QO3B 3P3SA 4MJHA 1DVTA 1YEIL 2AFNA 2BJMH 3NZ8B 3CZLA 3BWUF 1J8HD 2CSPA 1XAUA 4ODSL 2OSYA 2QKIC 3L2LA 3L7EB 7PCYA 2G2RA 4NPKA 2VAJA 2ZF8A 2NYYC 1KJ2H 1YEDB 1N2RB 2QHRL 2JH2A 4NUGH 1BIIA 2BVQA 3ECBB 4F8QA 3US9A 3IGKA 5F7KC 2XX0A 4WI9A 3DX7A 5HHQA 3AQYA 3VE0B 1MLCA 5FW7A 2OMBA 3WAJA 2P49B 2YHGA 1ZGLA 2XG5A 3AC0A 2PTUA 2GABA 3SKNA 1J0JA 5DZOA 5TE7H 4PJDF 1IBZA 1TZHB 2WNWA 5D7IB 5FFGA 3ZMNA 1TQCB 2H1PL 3ARFB 5AW8B 2IAMC 3I9IA 3MLTA 4QTIH 2R8SL 2CO6B 1XR8B 2BNQA 2TRHA 4PS7A 2DQIH 4AYDC 2XFXA 1AI1H 2E47A 1T7VA 2YD4A 3EGDB 4OZFA 5F8QC 1YECH 3O3AA 3MRPA 3PHOA 5E2TL 2W0KA 5J13B 2I9TA 2JB5H 4K23H 5F7BA 1RUPH 3BD4A 5D1ZD 4WNQA 1TQVA 3WDIA 4CSZA 5TGBA 3O4LE 1S9XB 1LP9F 4XNXH 1HT6A 3N1MC 1RUKL 1ZXQA 1KNOA 1TZOA 3Q2LA 5FGBC 3UH8A 4EN3C 1PLCA 2Z91B 4F2MB 2XCMC 3OMZA 2J4WH 4DP4X 1ZLWH 2H26A 4IRSB 1KBVA 3GLEA 1KJ2A 5ALCL 2AEQL 3LN9A 4C8XA 5CEXB 3C60C 5SWZB 1KOAA 1FNGA 4KKBD 1JG9A 3OVUB 4GUPA 1BREA 1TNMA 1BXUA 1RK1A 3UTTB 5CCGE 5IGXH 4WWOA 1EVUA 3BUTA 2Q20A 3L3DA 4HPOL 1C7TA 1HSAA 5JW5B 5EEUA 1K4DA 1INEL 3KH3A 4HHAB 3CQFA 5C08B 1FFOA 4L4TD 2YD1A 4E9XA 1A9BB 2L7UA 5EOCL 5FO7B 3UC0L 1IKNC 4EKJA 3KR3H 5PCYA 3SJVD 5FA3A 2HG5B 3HS8A 2MQ3A 5E9DA 1Z9MA 4AXWA 2NQDA 1F3JB 1BWWA 5C0BD 1CGVA 1HXMB 1HHGB 1OSPL 2WUCH 3IJEA 4L3CA 3SGKC 4F7PB 2Y1ZA 4WGKA 2EDMA 3B37A 5EMYA 5EEWA 4G9FA 3D25B 4XZUA 2X05A 3IJ8A 3OGCA 2FYYB 3DX9A 3KM1A 3C60A 4ZUTA 5DHVH 3TWYA 4DZBB 2J88L 2B9BA 4ALAC 3ARBB 1QR4A 4PBVC 4XHJC 3B9KD 4HJEA 2FIKB 4JFEB 1W91A 2DIAA 2FJUB 4GEIA 4AQ8C 4J4PA 4Z76B 4P4RA 1BMGA 2XZAL 1JMXA 4PJAA 3H53A 4QAWA 3JWNH 1X5KA 3HN3A 3L6FA 3KGTA 3LKNA 4YFLI 3APFA 1TTUA 1DSFL 2ZUWA 2CA4A 1E4XH 4RMSA 4BUGA 4MMZB 3H56A 2E7MA 2AJYL 3GHEH 4PB0L 1HKLH 2JJSC 5CJXC 1QLFB 3JV6A 3TTSA 3IDMB 5K93A 3U1SL 4K7FA 4KJWD 1UA6L 4IU2B 3RILA 3A6CH 3OWRA 3KPNB 4A7GF 3ZIMA 1H5BA 4I0KA 5F9JB 3WN5B 3TEXA 1H8LA 4WUUB 4AE0A 1R17A 5FOJA 2F1BA 1P4UA 1XGRA 4QEGA 4WFHD 5EZOH 1IGFH 1DBBH 1FZKB 1JPGB 5ENWA 2C5DC 5J1TC 5F7DB 3HG1D 5I6KA 3GDBA 1N59B 3ESNA 2GT9B 1GGYA 4PV1C 4XNYH 2C3GA 2X1QA 2IQ9L 2ZF9A 2FATH 3FQTB 3ZN6A 3BH8B 1C16B 1T20A 3NA9H 3JQOB 3D06A 1OSEA 4AZ8B 1JPTH 4M48H 4YSPA 2P8PB 1LEIB 2CALA 2E3VA 5DHVA 1GR7A 4LOEA 1B0RA 1E50A 2EXYD 3GSWB 3WEMA 4BZYA 4EZLA 5E2WL 2A99A 2QKSA 3BW9B 4U0RB 3QQ9D 1KIPA 1QBLL 4OFIA 1J9TA 4Q74A 4WDIB 1W16A 4XBGB 1V3KA 3LEYL 3T4YB 3EJTA 3M8OL 4KPHH 1DJHA 1IFGA 1HTYA 1FYTB 1NOAA 2VXSH 4PBWD 2B7DT 3PL6D 1ZGLM 2NY3C 3BLPX 3FU9A 4M6NH 4Y2DB 1UVQA 5C0EB 2IDQA 2AK1L 3IFLL 3VFNA 3B2DC 1BQLH 1CFSA 1JD9A 4PEEA 5T5FL 3O9WD 2E56A 1XF3A 2WB7A 3SOTA 3O6FB 3HR5A 2DYRB 1B9ZA 4P4KC 4I1NB 3IS0X 5F9WB 3LZPA 5ADPL 1H6FA 1Y1UA 3D85A 5FKAB 3GPEA 2EDQA 1AO7D 1ID5I 1V55B 3FBKA 1MQKL 2COQA 3PV6B 2O1AA 4UBDD 4GYBA 5C8JB 3KJ6H 2DQTL 4P2RE 4PJ8A 4Z0BL 1QQDB 2UY6A 3H8NA 3BRDA 1A6AA 1GW0A 1R47A 4TUKH 2V2TA 1YJDH 5ILTH 2IALA 5F1IA 4HJUA 2G9HB 1PIFA 4ZMPA 4NQQA 2E86A 3L3IA 3SKMA 1RJZB 4KXCA 3KMDA 4E2OA 3PHSA 4YXHH 3EZJB 3MBEB 1R24A 4M9PA 4GG6F 1AD9B 3QJTB 2F8XC 2BRRH 1TU2A 3TVMA 1YEFL 1CFQA 2VUOA 3RB7A 4I5BA 4OGAD 4KJPC 1O7SA 2H9GA 1KELH 3IDNA 5D71H 5DD0L 5SX5K 4X6CE 2D7OA 4W6XB 4C83A 4JFTA 4QTFA 4UILL 4LHQB 2BY3A 1GMIA 4JANA 3OLIA 1XGUB 4GKSA 2WXIA 1LE9B 4PLKC 4Z3TA 5IT2H 4R2GB 4S0HA 5EC1A 1CFMA 1LEGB 5D1XA 1WG3A 4G6FD 4DAGH 4ADIA 2CLVA 2YKLL 4CC4A 3DVNB 1DLHB 3F6LA 2M1KA 4LDLB 2BSDA 1FVDA 2DM2A 2P5WA 2X3CA 4FXKB 4XVUC 2R7EA 3RWDA 2ZUXA 1V5JA 4ZMXA 1OT4A 1UM5L 2GPZA 1FAIH 3CDZB 4Y2OA 4YBLB 1BQUA 4FRWA 5I82A 3I3BA 4NXSA 1L5GA 4NC1C 1J1XH 4KRLB 3ZHKA 1EZLA 4A7QA 5IQ9B 3FFCA 2MFNA 3ZTNH 3BVNA 1V3LA 1WCBB 3DWTA 3PWPD 2AQNA 2YK1H 1CXEA 1S3KH 2R0WH 4ZO8A 5FYKL 4AWJC 3H42H 4HW6A 1TFHA 2TAAA 5D1ZI 1QUNB 3M86A 3T6ZA 4JUSA 4JKPH 4UZGA 2UXFA 4MXWH 5GRVK 1DO6A 3G5YA 4P5TD 2J6WA 4PRIE 5TE6H 2BHUA 2NW2A 4YL9A 3UTPD 1S7VA 1NUFA 3G5ZA 3SYOA 4D0CA 4XMKL 3NEXA 5T3XE 4ZUVA 2EXWD 4KI5F 3RI5F 1FO0L 3ALXA 1PLAA 1BLIA 1UEYA 5CJOH 3FBQA 3RDTC 2R2HA 3QSKB 1FLRL 2WM0A 4WEBL 1ZIAA 1S7QA 2BZCA 3QUYC 4P57A 2IO5A 1BOGB 3W11C 3TWCH 5BV7B 4B95C 5JORA 4LBEB 4WFFD 4YDLC 4WJ5A 4X6BB 3ULVF 2XQYA 1R6VA 4HUWB 1B4JH 1ZMYA 3TF4A 5IREA 2HKAA 3D69B 1KMGA 4MCMA 3L5HA 2UWEE 4R26L 2Q2LA 4PY7A 3BZEA 1KN4L 1OGSA 4E9RA 2OMZB 2NY5L 2PCYA 4PMEA 1ZLVH 5JIPA 2H2PC 4ODXA 5FYLL 3EF7A 2LV4A 5GS1B 4CGUB 2DLFL 4D9RD 3ATDA 1HCZA 2DIEA 3OV6A 4FL4B 1SVBA 3EYQC 1CXKA 2W9EH 4P2OB 3CFCH 2Y0SA 4OQTH 2ZX7A 4KVNH 3DSNA 4MQSB 5EV7A 3QJVB 5DJ0A 2OSWA 2G4GA 3CXHK 4N0UB 1T3FB 1LO3H 1BF5A 5FYJL 4PRDB 3ZTDC 4ZFOA 1WFOA 1AP2A 4G8GB 4N90D 1Z5YD 2Y72A 5DS8A 1YNTF 4PG9A 1JZ2A 3L4CA 5EF1A 2OAAA 2BP8A 3QR2A 3MV7B 3L17A 4P2AA 4WWKD 5LDSA 2ZCZA 2ITFA 3L3JB 4GW4B 1YN7B 2OR8A 1IBDA 3FQUA 3I85A 5AUMA 2E27H 3AY4A 1BG1A 2V9RA 4WFGD 2VLRD 3ROLB 3UG3A 2VR5A 3FW6A 5ID1A 2ZKHH 3RGBA 1IQWH 1I1FA 4UTBL 1KGCD 4XXCA 2TRYA 2D0HA 3M6DA 1UHVA 2XACC 2ENYA 3VFRA 3HG2A 4ZNEA 3P9MB 4F57H 1MH5B 3BAWA 4Z7UE 2VMEA 4G72B 5I8CB 1IEHA 3SZKC 3CUPA 1JZ6A 4C55A 2NZIA 4V33A 5L2KD 1KZQA 1NGZA 3U9PL 5IJCC 1OARH 4W9DC 2AXFB 1I31A 1AE6H 1NIAA 3DRQB 3H2WA 3T0ED 3MA7A 4S1DD 3REWB 3VCLA 1N4XL 4XO4A 4MJ5B 4L9DA 3S35L 2FL5A 3EDKA 3CVHL 1FFNB 3TO2A 4KVPA 1NC4A 5I6XB 3S3BB 3TP4A 5C0FA 4AG4L 4JM2B 5BXFB 1EO5A 1SUHA 4PRBA 3MREB 4ZTEA 1GHFL 4OQTA 2Z8RA 4E41A 5D1QD 5HYSA 4MCYB 1RZ7L 5AL0A 4AYEC 5BJTB 1BXVA 2JKIS 4KOBA 1AY1L 2XQBH 1CZ8H 4MJIB 2QSVA 3O6FD 5TDOA 4WSGA 2AGJH 3CZKA 3CSBA 1QVOB 2FH8A 4HALA 1C1EL 4JQXA 1DLFL 3AT0A 1Z66A 4ELMB 3DO4A 2FJGA 3VXSB 3EYOA 4H0IA 4WU7B 3I74A 4M7ZB 3HZKA 4L5FE 3ULUF 3STLA 1ROCA 2C3VB 5MERB 3AROA 3E6HB 3PXHA 5JPNC 1JNJA 5ISZA 1PX3A 1AGFB 4O5LH 1E4JA 2EYRA 1JE6A 3HC2A 3NYKA 5A16A 4PJ6A 3V0VA 2ZAIA 5DJYB 3QCUL 2FEEL 4FJ6A 1SN0A 2DIJA 1VB9A 5DHYA 2NZ1A 1OPGH 3DPBA 2MCMA 4F33B 4BGDA 1AYOA 1WRFA 4W9CC 2V8LA 1YMMB 4DKAA 3BISA 1BGXH 4LGRB 5CJ5A 4HUUB 2DQHH 1IRAY 4Z7AA 3IM1A 2K6WA 4MNQB 2ERJB 1MLBB 2H0PA 1CB4A 1V10A 2WXFA 1OP5H 1MPAL 4WK2B 5C7XL 3RGVB 2FX8L 2XN9B 4I9XA 5AEAA 3T8MA 5I18L 1S7SA 4PJ7F 4A39A 1EO8H 3ML9A 3ILPA 3QUGA 4EDWH 2DD8H 3INUL 1NGPH 2AQ3A 3FUJA 4JG0H 2EDKA 3AREB 3GJFH 4UZUA 4UOJA 1VGKB 1MCJA 5EOQL 5JQ6H 1IAOB 3GMNA 5JW4R 3V5DA 1MJJB 3CVCA 1VDGA 3EDJA 1V7NH 2XRAH 2YQGA 4FFTA 3N43B 4HV8B 4WEMB 4BH8B 4ZMOA 3EOBA 3VWKD 2K7PA 3MRIA 5IB3A 2DQFA 2VDOB 1WIOA 1MAMH 5SWSD 2Q7NA 5KW9L 1HZKA 4TOYL 3MRHB 3ZZ1A 3D2UD 4AVIA 1UB5B 4U1HB 1MFDL 2AABH 4ETQA 1XX9C 3V0WH 5L6YH 3WTUA 1JWMA 2PYEA 4X5XB 1TZIB 1R1CA 2FWLB 1SEQL 3HKZA 1T21A 4IOSD 1SLXA 5GS0L 2YAEA 1TO5A 3VYNA 3ET9F 2C8NA 3GPSA 4PJXA 3LN4B 5IQOA 3OZ9H 3X14B 5C07B 4CDGC 1TQUA 4H1LA 5D7LE 2G0LA 3QI9D 3ETSA 4WEEA 1YPZA 4H26A 3I9AA 2BLFA 3PP3H 5BQDA 4M8VA 1JN6A 1SHWA 3FB6A 5E6IC 2LFEA 4KITB 3T0DA 5C09D 2IG2L 4WKXA 1EFQA 3DRTB 2OL3B 1UD5A 3MRGB 2J5LC 2VWEE 1U8HA 1PEZA 4PI2A 2RACA 1FV1A 3HE7B 5I1HH 2COVD 3DX0A 1E4KC 2VJXA 2QDWA 4CADA 3BZFA 4RSVA 3S96B 4GRLD 4JO2H 1D2OA 3GJFA 5TE4L 4N2AA 3EO0B 4OF8A 3RPIA 4F3FB 5IW1A 2H32B 4H0LC 1UT2A 3VFOB 2I32A 3BUYA 2CNZA 2Q8BH 3AS0A 4HT1H 3SDCB 4WW2C 1EIBA 4DPRA 1ACCA 2WSDA 1UURA 4F7CB 4YFEA 4XO3A 1BQHG 5CSGA 5I1CL 2HN7B 2VZTA 4RGOL 4EPSA 4X6DF 2MMXA 3QDJA 2OBGA 4UYQA 1ADQL 4TQEL 3FT2B 5E5RB 1TJMA 3OAWA 5JIKA 1NLBH 3ZHFA 5BZXA 2DWTA 4J2QA 2YQ2A 3O8XD 3J27A 4LOVA 1OAKH 2WKOA 3LS5L 3P0VH 4GAYB 2BOCA 2BERA 3A22A 3RY6C 4UANA 5EIIA 1FLTX 5GIRA 1DBAH 2XWJB 3P02A 1GYAA 5AL8A 3TBYB 2DL2A 4M7KH 2R9HC 5F7EL 4BKLA 3RFRA 1OAYH 3L08A 4P2RA 2DPKA 5LGHH 4A2FA 3UTOA 1QFOA 1T1XB 2F54B 4XOAA 2CGYA 3BKJH 4XPHH 3TJHC 3VGBA 1MRDL 4V2CB 1GTFA 4N2MA 5DZNA 2BC4A 3PQYE 1E2ZA 4MJJA 4HS6B 1AZVA 1QFWM 3HCVA 3WXVL 4PRHD 4BZ2L 1N0XH 4YLQT 2BFVH 4MA1B 1A7BA 1D5XB 4N5UA 1S78C 1IGTA 1QOKA 4RWYH 2GSGA 1THCA 2CUIA 4JQVA 2VDPB 3EJQA 3U7YL 1JF5A 2X6VA 3FCTA 4JN1L 3DBXB 1KXVC 4LBAA 4ZMQA 3FO0H 1HESA 3TIEB 1FP5A 4W4OA 3BKCH 4PUBL 2WQWA 2ZAGA 4KY1L 1G5AA 3RY6A 1BQRA 1Q0XL 2NXYD 3LRHA 4HXAL 1BF2A 3O41B 4LAQH 4ZS6D 3TYFB 2XJLA 3QUXB 5T3XH 3T9WA 3T6WA 2H0EA 5MENB 3DI2B 2O26U 3P4LA 4G6AD 1DQMH 4Y0GA 1QEWA 4ZPVA 1BX2A 4QXWA 5DI8A 4ACTA 2ZWNA 3CXFA 3KLDA 5DWUL 3P11H 5HYIA 4ZI8A 5F96H 2WVVA 4Y5VA 1N18A 3HNVL 4FXGA 3LZRA 4P9HL 5ELIA 3FO1B 5DJCA 4NO5B 5I6PA 5GRJH 3NJIA 2M2DA 1BBDL 1GGCL 2X89A 1AGEB 2D03H 4DT2A 5KWYC 1CJYA 4XMPL 4PJCF 4Z9KB 5B38B 1HILA 2ZONA 1IC7H 2YGOA 3UBXA 3ZE1B 2YRLA 1WGOA 3AGWA 4BFIB 1T5WB 4LSQL 4PRNB 4Y4KA 2AJZA 3EJJX 2V5YA 5DJ6B 3QFJD 1IL1B 5D6CA 1RCYA 2IWGA 2VN3A 3RKDD 2X0WA 2D2OA 2AQSA 2OI9C 3QG7L 4LL4A 2PO6B 2C3XA 3GLDA 3LPOA 4MMYA 3AQDA 2ZOUA 2PUQT 2YD2A 4AM0Q 4M5SA 1R3LB 2OJZH 2JJWA 4YBQD 3EG9A 2Q7YA 4NKMA 1CN4A 4NZJA 4QTHB 4RAUB 4TVSa 3UAJD 3O2VL 1YYMH 4M5ZH 3FC8A 1MZYA 4L4VB 4JRLA 4N2EA 4UQ2A 2QGBA 3T2LA 4Y4FC 4WKZA 1BWMA 1LK2B 3HBQA 4L4TE 5I2IB 2HH0H 4HFUH 1NAMH 5L7XH 1A14H 3MRNA 1K8IB 4OB5H 2APWA 3SJVE 1TOXA 1F41A 4JQIH 1D5BA 4DVBA 4HJTA 3QUZA 3E9UA 3SCMC 5C0BE 1Q9LA 4DERA 1NCGA 4V1DE 3RX7A 2A1WL 5EC2B 4NNYB 3EBGA 1MCQA 3SKJL 4DKEL 5I5RA 5DCCA 4Q0XL 4A6YL 3OAZH 1I7RB 32C2A 3ZW3A 1TQBC 5L0QC 3ARDC 2OQJB 3W2DL 1J10A 5IB1A 2ZUYA 2CDEB 1ZIBA 5AB1A 2DICA 5I28A 3I2CL 5EU4A 3EHBB 5J0BA 1NCUA 2DEWX 3QORD 4QHKJ 5CCJA 1VACB 1I8KB 1XH3A 2J44A 3MRDA 2VH5H 4NZRH 2IBZX 2XTJE 2Q2EB 1A7PL 3MXVH 1J0ZA 5KZCD 5CEZD 3FPYA 4JFYA 3CN2A 2K9FB 1FGNL 3U4EA 3JUYA 4PJGB 1KGWA 4W9FC 4EUPB 4N22A 1KB5H 3L1EA 5IF0B 1I82A 2XPZA 4QIRA 1R46A 2AJUL 2YD5A 5E1AA 2RIKA 2JB6B 4O00A 3WIFA 4LLQB 5GS2H 4C54A 1CI3M 3MRBA 2HLEB 5F3BA 1NAMA 4OGXH 3RVWC 1AOZA 1SDAB 3ZYOA 4DEPB 1MI5D 5K1VA 2V17L 2DDQH 4MQ7B 5IBTL 2GAZB 4KRPD 4JQIA 2W9DL 3IWUA 4WFHE 3DETD 3LKPB 3DKHA 2A83A 3HG1E 4JPWL 3GIZH 3HBGA 4HMDA 1JXFA 3SQBB 3X3FL 4DOHB 2EEFA 3QJHB 5AZEH 2J25A 3B1UA 3VFMB 4AH2B 1JRHI 1EJOL 1UWEL 5JXEA 1RUMH 5JPMB 1KB9K 4HWBL 5ESAB 1YEKL 3V0EA 3Q8AA 3BYTA 5B1JA 1QSEB 2W8CA 5AOIA 1FNEA 2C1OB 4YDIH 5FYKD 5GPRA 1XSKA 4K73A 4HKXB 1ONQA 2YA0A 2IDFA 4IJ3C 3F7QA 4R7DA 1FL3B 1C08B 4PWHA 5DZPA 2IFFH 1GSKA 2AQRA 1TTGA 1LQSR 2VMJA 4U1IB 5AVZB 2BCMA 4BA0A 2E4TA 1A21A 3MLVL 4PJIE 1KB5A 2EC9U 1A6UL 1TCMA 5IOPA 5DMIH 3LNGA 1BM3H 4LLUA 4R0LA 3P4OA 4UT9L 3WE6B 3WEBA 2VQUA 4KX7A 3MBWA 4KC3B 2YJLA 1CFTA 5DO2D 4HETA 1IQDB 1AO7E 4JO3L 2VIRA 4LKXB 4KQ4L 4OF3A 3OKNA 4PJDB 2BMKB 4XXWC 5T5NF 1NJ9B 4PWKA 3U46A 3ZE0E 3RJOA 1HQRB 2A73B 4D9LH 4OSUL 4XRCA 3G6DL 4JKKA 4D3CL 1YY8B 2BSBA 3NN8B 1RZIB 2AEIT 2YN5A 4KHXH 1AVAA 2O61B 3QIBB 5MI0C 4B5ZA 4ENEC 3PGDA 1TEGA 1Y07A 2DS4A 2F5AH 3R4RA 4FMVA 5JZ7D 3D7PA 1BSIA 3DSFL 3ZOAA 5L88L 1MNNA 4FQXA 3W81A 1F11B 3BQVA 1OM9A 2FSEA 2DM4A 5I6OA 3ZBMA 2LAAA 1F4WL 4Y4HB 1E5UI 2EIMB 1LP9B 5INDA 1G9NH 3N9GH 4NQCD 1YNKL 1TEFA 1SM3L 4IRZH 3TLRA 4U7MA 5CS7A 2FDBP 4L8DB 5C6TL 2B3IA 2W92A 3VXUB 2C26A 1SHMA 5DVMA 4TN9A 3V5KA 1EPFA 2IBGA 4G7QB 3ESPA 4ZO7A 3GUFA 4R97B 2Q6WB 1NGYB 2VRQA 4UINH 4O9HL 4GLRH 3O3BB 4NQVA 1E0OB 1R33A 4R83A 5DRXB 1U3YA 1XB6A 4M7JL 2EH8L 4YGVB 2D4FA 3T65B 2FB4L 4WGWB 3F7VA 5I16B 1ZV5A 1U21A 3L3HB 4P9MH 3NCYP 2P5EB 5T33L 3QJFB 1JERA 4FXTA 2VWEC 1NIBA 2QJDA 4XCFL 2DKSA 4OD1L 1JZGA 1NKRA 4TNWF 5GGTH 3REVA 4HS3B 2Y24A 2GIYA 3BLKA 3RI5K 4ANUA 1OCWH 1L9NA 5T1MB 4IKIA 4ZUSA 4ZS7H 4WRLA 3PWPE 4JAMA 1ZHKB 1OB0A 3DMMA 3QDGB 4NWUH 3WD5H 3WO3B 2KKQA 2ZXAA 5DJAB 3ASNB 2NY1B 1WF5A 2P7TA 3QXWA 2MQGA 3UDWC 1Z9LA 3CDGA 3TT3L 1I1AA 3MGAA 2ZWZA 5D7LA 4ZW7A 4F20A 4NFDA 4NNPH 4XPBL 4OT1L 4XN8A 3VFTA 3OKOA 3ENEA 1TPXB 3QZMA 4KFZC 1UYWL 4LVOB 3UTPE 2F6AA 5HHPA 1T03L 3EDDA 2ED6A 2WQ8A 4IRZA 4MDIA 1LO5A 1RFDH 5B7MA 4FZ8L 1A4KB 1J9CT 2ALAA 2IWKA 5G5DA 1JHKL 2IBBA 2J7LA 1KLFB 4M1DH 1F5WA 3LZFL 3MCYA 1U3HB 4L05A 4HJIA 3MODL 2GCYA 2BNUA 4HWUA 5I0VA 2Y07H 4WFFE 3DV6B 2RFXB 4ZX6A 5GRZA 3FHQA 4L1SA 3QRGL 1M6OA 1XIWB 4P5KB 4YHPA 1CT8B 3V95A 2CLRB 2V2WA 4L1BA 4AW7A 1SEBA 5I15L 3CXDH 5GGTA 4RQQA 2G5BA 4JR9H 4NKIH 4JY6A 4K7PH 4OIBA 2L8AA 2OLDA 2C7UA 4PJ9B 5E8OB 1YDPA 5J12B 3RE0A 2J20A 2QEJA 3ARGD 3H2PA 3IN0A 3JTSA 3KPSD 2Y7QA 2DEYX 3VXPB 1KB3A 4UQ9A 1A65A 3EH2A 1KXQA 3GNMH 1W8EA 5CCHE 3VAEA 2EVIA 5T1KA 4WI6A 4AJ0A 5KBDA 3F2LA 35C8L 3HAEB 4NC0B 4X4ME 2E9WA 4CVXA 4JW3A 4NGHH 1EWHA 1LTXA 3OTTA 4WW1A 4OD3L 3UTZA 3CFDA 2IGFH 3U6RB 3V4LA 5KJRH 4U6YB 4NWTL 4RA3A 4X6FA 5E1GA 4D0BB 3SDDB 3CMGA 3PQYA 4YHIA 3TXAA 3OF6D 2B0SL 4HJ1A 2BZDA 4ZMTA 1BZ9A 1GMEA 4AVHA 2ZP9A 4KHTH 1WT5A 1ZPLA 3IYLW 2BIIA 2WW8A 3ALPA 3GMQA 2XQ0A 1UATA 3CSGA 4PP2B 5EORH 1CK0H 2VL5A 4M9OA 1JFQH 1I85C 2AXWA 1NPUA 3ZR5A 1BDYA 5EOCJ 3WG7B 3C5ZD 4R4BB 1DQKA 2EDOA 3LDBB 4BGLA 2WLYA 1CLYL 3LS4L 3CZJA 3FRPB 1S9YB 4E36A 3D08A 3DHUA 1C5DA 4Z7QF 5D1ZC 4HUNB 3IVKB 3KPLB 3NGBC 4QRRB 4B41A 1KGCE 1AHWB 2ZUQC 3WU1A 3GBDA 2C9AA 1IU1A 2J1WA 2PR4L 1RV6X 4XVSH 1M71A 3IJSB 5F3HA 2Y2TA 4LLWA 3S34L 1DQJA 2K1MA 2KDGA 5DFAA 5L2KE 1HIML 1FGVL 1P4BL 4PVNA 5KG9A 4NKDB 3LIZH 4NM8L 2WLKA 4Y19B 3NUKA 3MLSL 2V9QA 3KPPB 3KYOB 4KKBC 3C2AL 2EVGA 1TVHB 4NRXB 1R5VA 3NVQA 1YEHH 4AT6A 5EA0H 4YAQA 4G5AA 1KIRA 1EDYA 1Z1WA 4GG6B 5GGRB 3SD5A 3QFDB 4ONHB 2ROYA 4ATTA 5D1QE 1AGBA 3U83A 2VITB 3WGVB 2QR0B 3MRMB 43C9B 3QPKA 1K5NA 2OW6A 2ZOLA 5GSRA 1OM3H 5FUCE 4QRSA 1CXLA 2MWCA 2P26A 2WP3T 4TLKA 3CQPA 2RGSA 1N7ML 3QO0A 4H0HB 4QCIB 1XL4A 1XGZA 1GL4B 1JIBA 3EYSH 4OCYL 5K9JL 4QRPA 1OWRM 5G55A 3C09B 2WINB 1XCQA 4GRMB 4Q58C 4P3WA 1DN0A 2DLHA 1TO4A 2HLAA 4E9LA 5KANI 1KCVH 1CE1L 1PG7H 3NP4A 3FUHA 4JHAH 3BWAA 3M88A 5JO5A 5DRNB 4X8XA 4GQRA 4NQSB 3EFOB 4KQ3L 1AHMA 4Y16A 1MVUB 3B9KC 4P23D 2DMKA 4BDVB 3NSYA 1AQDB 2YKKA 3H6JA 4HLZG 1IAII 4UAOB 1T1WB 4JY5L 4WO4A 5IHBA 4BFEA 4FQ1L 4E5XG 5IG7A 5I5IA 3MV8A 1Q72H 2DYPB 4J23A 4JY4A 3MOBL 5IVZB 2XG4A 5A2AA 1KLGB 4A63A 4BBWA 3PWLB 1TTCA 3BWSA 5H37H 4V1DA 2K45A 2F9BT 2X0UA 1TVBB 2ZYSA 4KJWC 3LNDA 3MBXL 5DMKA 4LOUD 1HINH 3RWGA 3S5LB 3ZZQA 1EBPA 4B27A 1D9KA 2O6PA 2EDRA 3ZL4H 2G60L 1KT2A 3B9KA 3II2A 3IMBA 4YNYB 1XCTA 4QRUA 5JOPD 3H0TB 1U8LB 5AKSA 1GPOL 3LRKA 3PP4H 2HG0A 5J11B 1A47A 5SWSE 1KCRL 1ZT4A 3AWEA 3SYCA 3FOMB 1PAMA 2R0LL 4LASH 5IJKC 4RISH 3N04A 5KSAD 1JPSH 4MWFA 5D7KD 2XZZA 1WJ3A 1DANT 4PGDB 4OBRA 2EXYC 1N19A 2RQEA 4HX1A 3N55A 5CN2A 5F93C 4A38A 2XVKA 5IJVA 2FO4B 1TKWB 1Z32X 2F5BH 4FI8A 3QQ9C 1JCKA 2ZJSL 4JPKL 4XE5B 5FOBB 1ZDSA 4XP5H 4Y1SA 2FSDA 4GQ9H 3BH9B 1A3RL 4PS8A 1M57B 3NIDE 1HC1A 4UDTB 1MW0A 1E28A 1MHHB 5D7JD 3VNZA 5BUPA 1NANH 2WQRA 3HHSA 3PL6C 4MBOA 4WUKH 4MS8D 4RA0C 5JTWA 2CK2A 4DGVL 4FA7B 1U8QB 4IEFA 5HHXL 1WA1X 4ZFZB 4AGOA 4AQAB 5BCAA 5KS9E 3OKEA 3WJLA 2NT1A 3WO4C 5TQ0L 5C09E 2JXMA 4BK5A 3O9WC 5H37A 5ADOH 3VYPA 1KN2L 3Q6FB 4XVJL 5HDOA 3D50A 4DHLA 2ODHA 3JTTA 3PREA 2AP2A 2O5XH 5BS0A 1OAXH 3NDZE 2XKUA 2BOBB 1NBVH 2MH4A 3NSFA 3BZDA 4JRYB 4X7SL 1B9KA 4LMQI 3RWHA 2GTZB 2X6AA 4XP1H 4UBDC 3TCLA 4I3RL 4LKCB 3HC4H 2X4TB 1YA5A 1EBAA 4O2EA 4XNZC 4ZG1A 4H8HA 2F53D 2PTTB 4K2UH 4B0MB 1N3NA 3ESUF 1INDH 1WWWX 1YNTB 3D09A 4RWHA 3MXWH 2FBJL 4OLYH 3ZVVA 2F19L 2FHCA 3QA3A 4WSJA 1TZGL 5CIPB 2WCSA 3BP6B 4JFQA 5DQ9A 2Q76A 4GBXA 4POZD 4JHWH 3LD8C 1KPVA 1XF4B 5KYNA 4KJYA 4F7MB 4FLHA 3HB3B 1WISA 1OHZA 5IBLD 1LK3H 5DTFB 3V0GA 5I17B 5KVDE 1LDPL 4XOCA 1EK3A 3QDAA 1ZGLP 1CICA 1C5BL 4AEHL 4HZ1A 3JSSA 3MV9D 3VTMA 4LSTL 1AO7A 4LNRA 1T66D 5ICZB 2VM3A 3OJ2C 4AKQA 5FHAL 4YHLH 4IMKC 3RLSA 3CZGA 4FNTA 3IB4A 4O58H 2JTYA 3H3PL 5IWLC 4MAYB 4Z77A 1K8DA 4HULB 1KF9B 4ODTH 5BV7L 2HSIA 4HCRH 4DGIL 4PRHE 3FO2B 3GRGA 4AL8H 1HXYA 1R4XA 3QFGA 2CUHA 5IMMB 5E9AA 4H0GA 4F92B 3CXHJ 5GJTH 4KNSA 5DD5L 4C56E 1GCFA 2X5PA 3OKDB 3UPRA 3GMPB 2YPLD 2ZUVA </