5KXDA

Wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
238
structure length
238
Chain Sequence
KETTSFVFTRFSPDPQNLLLQGDTVVTSSGHLQLTQVKDGEPVYSSLGRALYYAPIHIWDSNTDTVANFVTSFSFVIDAPNKAKAADGLAFFLAPVDTEPQKPGGLLGLFHDDRHNKSNHIVAVEFDTFKNSWDPEGTHIGINVNSIVSRKTISWDLENNEVANVVISYQASTKTLTASLVYPSSSTSYILNDVVDLKQILPEYVRVGFTAASGLSKDHVETHDVLAWTFDSDLPDPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for Recognition of the Cancer Glycobiomarker, LacdiNAc (GalNAc[ beta 14]GlcNAc), by Wisteria floribunda Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
molecule keywords Wisteria floribunda agglutinin
total genus 52
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kxdA00
2AYHA 2VY0A 4K1YA 2NZ9A 2BQPA 5DUWA 1MZ5A 3OBRA 4Q8KA 2YXSA 2ARBA 1Q8SA 3NV3A 3PJQA 3PVEA 4FPHA 5T5OA 4YG3A 3V0AB 2NYYA 1MS8A 1LEMA 1OKQA 2WT2A 1QF3A 3N7MA 2R0HA 1BZWA 1LOBA 3W59A 3WDUA 3WNXA 5JOWA 2A70A 1IS3A 4GA9A 4XIKA 1VAMA 3O0XA 2R1BA 4JRAA 1MVEA 1G9CA 4M3CA 2KM2A 1QDCA 1AZDA 4ATEA 2I2SA 4GWMA 1MS3A 1C4RA 1IOAA 1AXKA 5KXDA 1FAYA 2D44A 3AJZA 3V64A 1W6PA 3HR9A 1H9PA 4YLZA 2PHXA 3ZXEA 1D0HA 4R9DA 4P9YA 2ZGOA 3WHUA 4YG6A 5LK5A 4Y1YA 1YI7A 5T50A 1Q8OA 5JVVA 1Q8PA 2GMMA 3TAYA 4K21A 1AJOA 1JW6A 2CYFA 2A71A 2P34A 2XB6C 3FUOA 3O0VA 4FPGA 4Q26A 4XJWA 4Y1XA 1CR7A 4P9WA 2GN7A 3DGTA 1HKDA 1NLSA 4F83A 1GZWB 1LGBA 4PBPA 1CVNA 3C2UA 4YM0A 1KDKA 1WBFA 1I1EA 1N1VA 4GXLA 1LHOA 1H9WA 2PHFA 1S0CA 2PHWA 5IK8A 1SBEA 2Z42A 1VIWB 2EAKA 3V65A 1GBGA 2NMOA 4XBNA 1N3PA 2FHRA 5EYYA 4XIOA 5DUUA 5IUQA 2WJSA 3WDVA 4HL0A 1LOFC 3ZSLA 3ZXJA 4BPZA 5IK5A 4ISRA 4AGGA 1G9FA 1FX5A 2ZBJA 1AXYA 4XBQA 2DVBA 2GNMA 5F9TA 4JCKA 2YZ4A 4XJ8A 1PZ8A 2JECA 4AGRA 4YZ5A 2ZHNA 1N3QA 1DQ1A 2D7FA 2R0FA 4XYXA 2ENRA 2D3RA 5SV8A 3DUIA 3OYWB 3AP6A 3SISA 4I30A 4Y20B 1BKZA 3AYAA 1C1FA 5CA6A 1GZ9A 1GZCA 1W6OB 3ZPYA 3I8TA 2PELA 3AZYA 1WBLA 1SACA 3AZWA 5L73A 4ITCA 5JMCA 3M1HA 2UWAA 4FVVA 2D6KA 1SLTA 1SLIA 2WSUA 1BYHA 4ASMB 1JBCA 3KQRA 2DUPA 4YG0A 4YZ1A 2C5DA 1YIFA 1RIRA 1N1TA 4WVWA 1GNZA 1CJPA 5DUVA 2P37A 1V00A 3PVOA 1LTEA 3NV1A 4Y22B 2P3JA 4C1XA 3OY8B 4OZXA 3PVNA 1W6MB 3M3OA 4UW5A 3WDWA 2ZGRA 3GNEA 1MS5A 4LBOA 2EALA 3AXDA 3VKOA 1QGLA 4FP2A 1CQ9A 1JOJA 2ZMKA 2JD4A 1S0BA 4PF5A 3W58A 1GKBA 2ES3A 2YROA 2VW0A 4XJZA 1GV9A 2RHPA 2ZA9A 4UW3A 5KXCA 1DIWA 4RA0A 4UW6A 4XXAA 4LBQA 1WW7A 4FOWA 4YM1A 1WW6A 4U36A 5T5JA 3KM5A 4FPKA 1KJRA 1R1ZA 1SBFA 4DS0A 1MS9A 1JN2P 1I3HA 2P3KA 3ZXLA 1CN1A 1GANA 2CWMA 1LGNA 2AH2A 5CNAA 4DRVA 2CTVA 3ILRA 4Q1PA 5T5PA 1FATA 3WVJA 1GSLA 2D3PA 3OY8A 2OVUA 2OW4A 2ZAAA 1G9BA 3M3EA 4XXPA 4AVSA 1ENRA 3D4KA 2R16A 1QOTA 1IKQA 2ZHMA 3M3QA 1LULA 2OUHA 2UU8A 1MS4A 2CWSA 2EIGA 1SCRA 5H9PA 1UPSA 2AENA 4WZFA 1LGCA 5HCAA 2DVGA 2FMDA 2WLQA 3ASIA 4BOWA 5JOYA 2W68A 3VUOA 1DGLA 3LCPA 5JOZA 2ZGMA 3AYCA 1ULEA 3R05A 5GLZA 4Q2FA 4Y1VA 2YMZA 3MEPA 2ZKNA 4YW2A 4Y1ZA 1W6NA 1FV3A 1ULDA 4Q27A 1OQ1A 1O4YA 3POWA 2E51A 3SNMA 3UK9A 2ZGLA 4IQPA 3WDYA 4XJAA 3N3HA 3AP7A 2A6WA 2XG3A 2YY1A 3MW2A 5GM0A 4HANA 4LBQB 4XHBA 3D6EA 1QU0A 2R49A 4XHXA 1JYCA 5E8AA 1GICA 3NV2A 1WD3A 1JUIA 2VUAA 1LENA 3H0OA 1V6IA 4JC1A 4M3CF 3T2TA 4LBQD 3U4XA 1C57A 1MS0A 1ZM1A 2DTYA 4Y22A 2AR6A 2JJ6A 4FQZA 4YGEA 2VXRA 4TZDA 1BXHA 3WLUA 1GLHA 1ULGA 2A7AA 2H0BA 4NOTA 5GZGA 4YGBA 4MYEA 3ZYPA 1LHWA 2A3YA 1CONA 2NMNA 4NO4A 3N7LA 2WKKA 4Y24A 4AGVA 1RITA 5BYNA 3VKFC 4TYSA 4XDQA 3WHTA 1URXA 4LBNA 2GDFA 1LJ7A 2SLIA 1W6NB 1GZWA 1ULCA 1QNWA 1W6OA 2A5ZA 5DXDA 5GLVA 3BTAA 4YZ4A 1YYNA 3RS6A 1W6MA 2GNDA 5T52A 2DYCA 1YRZA 1U0AA 3IKWA 3Q9OA 3UJQA 1DQ5A 3PMEA 2DURA 1Z78A 3WOGA 1QMJA 4YW1A 1WCSA 1WUVA 3OBTA 1RINA 3WG2A 1LOFA 1LOAA 3N7KA 3SH3A 1A78A 1XQNA 1GYKA 1DZQA 2VW2A 2E7QA 2VH9A 3VKLA 4YM2A 1EPWA 1SFYA 4U2AA 2GN3A 1ONAA 2JDZA 4FPCA 3RQ0A 4M3CB 4XILA 1UKGA 4Y1UA 1DQ2A 4BQ1A 2C9AA 4DRRA 1OFSA 1SLBA 1G86A 1DYPA 2ZZJA 1APNA 2ZGUA 3N7JA 4Y20A 1W0OA 3RG0A 3TB0A 3B9CA 5F5QA 2GMEA 3OYWA 5E89A 4AWDA 1BJQA 1LCLA 2PHUA 2Q5TA 1HLCA 2D43A 3AXEA 3AP4A 1LEDA 1LOGA 4FOQA 2GNTA 3VV1A 1AVBA 2ZMNA 4UW4A 4PBOA 1YXWA 1WLDA 2D6OX 2E53A 3POSA 4XZPA 2ZHLA 1V6KA 1S0IA 3BIWE 2AGSA 1MZ6A 1JXNA 3RRDA 4BMBA 1LOCA 1DFQA 4YFWA 1FYUA 1PZ9A 3WCRA 3AZXA 3QCWA 3WUCA 1VALA 4K1ZA 1AXZA 4FPLA 5E88A 1LESA 4ZXKA 1QDOA 2W08A 2ZGKA 1LU2A 5HCBA 1DQ0A 2ZGTA 3A4UA 3AYDA 3LSDA 3RSJA 5IT6A 4XTPA 1Y7BA 4XOGA 2WQZC 5GZFA 3WZ1A 1WW4A 4Q8LA 4C1WA 5IK4A 5GZEA 5EXOA 3ZSJA 4ATFA 4WVVA 2VU9A 1HQWA 4CRQA 2DTWA 1NXD1 1CIWA 1WLCA 4FPYA 1F31A 3O12A 2UURA 2NN8A 5CB7A 1Q56A 2OUJA 3I4IA 1MS1A 5IK7A 1VLNA 5EWSA 3WG4A 1LHVA 1LODA 2VW1A 3AX4A 2NP0A 1F5FA 1DYKA 4PCRA 2CL2A 1V6MA 2A6YA 2ZHKA 2ZGPA 3SH4A 1V6JA 1ZA4A 4YZ2A 3A0NA 1AX0A 3R4SA 1F9KA 4Y26A 1SBDA 1UAIA 2DVFA 2UWCA 1S1AA 5FRAA 3B00A 4DPNA 2ERFA 4BMEA 2CY6A 5T54A 3T1LA 2GALA 5AVAA 3USUA 4YZ3A 4GWNA 4P14A 3V0AA 5DG2A 1V6LA 3VKMA 1AX2A 2EXKA 1SCSA 4RL7A 4YGCA 4XJUA 1N3OA 1A3KA 3B3QE 1UZYA 4LBJA 1GNHA 4M00A 1IKPA 2ZGQA 3AP5A 2D6PA 5EYXA 1O4ZA 3UL2A 2W52A 3M2MA 1Q8QA 3FFZA 1UL9A 2DVAA 3V0BB 4XMIA 1AF9A 3APBA 4XJ9A 1S0DA 3MW4A 3ZYRA 2D3SA 3POYA 1KJLA 4GKYA 3FUQA 1CPMA 4R9BA 1Z0HA 3FLPA 4LBLA 2HYKA 3OPZA 2PHRA 4Q1RA 1W6PB 3D5OA 4GKXA 4XE9A 4D69A 5CAZA 4XMAA 4H55A 2A75A 3IPVB 1SLCA 3JUUA 4L8QA 4BLJA 3WUDA 2LALA 3NV4A 3HN1A 1C1LA 1W6QB 2UWBA 2R1DA 5GZCA 4ZKTB 2ZMLA 3B69A 3ZSMA 3B01A 4W65A 2W39A 1IS5A 1G8WA 2D6NA 1JYIA 2AUYA 4DQAA 1H30A 5H9RA 3N35A 1X50A 4M3CE 1ULFA 4Z8BA 2DU0A 2B7YA 3AZZA 3ILFA 3WG1A 1Q8VA 3OJBA 4KBBA 4AYUA 2V5YA 1MR5A 4PQ9A 1DQ6A 2GMPA 1FNZA 1S0GA 2EXHA 3WCSA 3IMNA 1YO8A 1N1YA 1WLWA 4FP3A 3FBYA 3UJOA 1KQRA 4FPJA 5FREA 3WDTA 3GALA 3WDXA 2LTNA 1S0EA 1SLAA 4DFSA 1DBNA 1FNYA 2ZGNA 3AFKA 5GLWA 4AVTA 1DHKB 2WSVA 4XBLA 3ZSKA 2WT1A 1HQLA 5CBLA 1D2SA 5T55A 2D6LX 2ZABA 3T1MA 1KITA 2EXIA 4YW3A 1WD4A 2ARXA 1LHNA 3N36A 3O0WA 5JOXA 2EXJA 2DUOA 4FOVA 2CNAA 2DU1A 5GLTA 2WNEA 2NM1A 1MVQA 1LU1A 4YW5A 3AJYA 3IN9A 5DZEA 1B09A 4LBMA 1LOEA 3RMXA 2A6ZA 4XTMA 1TEIA 4P9XA 2GNBA 5DZFA 3VKNA 3WG3A 3RMYA 3L2YA 3OGGA 1WW5A 2JE9A 5DZGA 1S0JA 2DWRA 3AK0A 4R9CA 3FLRA 3MPPG 2A3WA 1G9DA 5GALA 4CZSA 3ZVXA 4WV8A 4YW4A 3MW3A 1LECA 3BOPA 2P3IA 3R4UA 1W6QA 3ZXKA 1MACA 3ATGA 1QNYA 2WT0A 1DLLA 1KRIA 4BM8A 1ENSA 3IPVA 2PHTA 2YV8A 4CTEA 2ZACA 3ZXFA 5HCFA 3ENRA 4AVVA 3AYEA 1HDKA 2JE7A 1V6OA 1KDMA 3INAA 3NWKA 5JDBA 5H9SA 1CESA 4YM3A 2G4IA 2A3XA 1IS4A 5KXBA 4SLIA 1IS6A 4R9AA 1AX1A 1QOOA 1N47A 2AREA 4FPEA 3V0BA 3JU9A 3IM0A 2DUQA 3M3CA 5H9QA 5DG1A 2E7TA 1UZZA 3HMYA 4K20A 4YGDA 4BLIA 5GZDA 2D6MA 1JHNA 1UN1A 1LHUA 5DUXA 1G9AA 1BQPA 3SITA 1S0FA 2TEPA 4ISQA 1UMZA 3O5SA 3SLIA 4YFZA 1QKQA 5KXEA 1FV2A 2EF6A 2E6VA 2DV9A 4FQ4A 2P2KA 1QOSA 4FPFA 2V73A 5GLUA 2DVDA 3LSEA 4GALA 1G7YA 2ZGSA 1DQ4A 3USUB 1N1SA 3A0KA 5GJ6A 2A6VA 1SLLA 3AZVA 5JLVA 4M01A 1CPNA 1PZ7A 1V6NA 1AJKA 4LBKA 1UX6A 3CNAA 3QLQA 3AP9A 3SH5A 5T5LA 1A8DA 2SBAA 3FLTA 1ENQA 3ILNA 1VAVA 3BODA 2JKBA 1W0PA 1J1TA 2A6XA 4FOYA 3WV6A 4FPOB
chains in the Genus database with same CATH superfamily
2R041 2AYHA 2PLV3 3UGHA 4K1YA 2V72A 1OURA 5B4XA 3SKJE 2CU5A 3PJQA 2ARBA 4A3XA 4KI5M 1AYN2 2BGOA 5F7UA 1OKQA 2Z5WA 4IEYA 1QF3A 2X5IA 3N7MA 4LHSA 4QQOA 3W59A 3WDUA 4DIQA 5CISA 4NHLA 4H7MA 2A70A 4R4ZA 4GA9A 4L92A 1QQP2 4AEMA 4UXAA 4ES8A 2WZPP 4RR3A 3IZOA 1D0GA 3BUCA 1JOPA 5HCHA 1F2NA 1FAYA 2BYVE 4NPLA 2VAUA 2VOVA 3AMMA 1H9PA 5FZOA 3H1WA 4Q5OA 4ZXEA 5K0UA 4AAXA 2ZGOA 3T3YA 5LK5A 4Y1YA 5KWRA 3TEYA 1YI7A 2LS6A 3IDCB 5CG8A 2GMMA 2W47A 2VC9A 3TAYA 1JW6A 2CYFA 2MHFA 3ELNA 1PGL2 1J3RA 4E2SA 3RZGA 1HKDA 4JAAA 5EJZB 1I5PA 1YFYA 1COV2 1LGBA 1RUH3 1RUG2 1TQ5A 1F8VA 1KDKA 2IWGB 2RS11 1Y9QA 1O3QA 5CKMA 1H9WA 2XONA 3H3ZA 1KGYA 1JYNA 1R091 2VTFA 1W8NA 2L9LA 3D0SA 4META 1PMHX 5A7PA 1AYM1 2WA4A 2WFF1 4BCUA 3ZSLA 2GAUA 2YBSA 4XAAA 3ZXJA 1ODNA 4E4HA 4CXYA 3BU0A 2G1MA 1HV1A 2DCJA 3OG2A 5D8AC 3KHBA 3POIA 4NMIA 5FMOS 5L9RA 4Z2WA 5FO7B 2GNMA 4JCKA 2YZ4A 4XJ8A 1HRV3 1PZ8A 3KGZA 1OVSA 4AGRA 2Y6HA 4YZ5A 1N3QA 5IVYA 5FWJA 5FZ9A 2ENRA 2D3RA 5SV8A 4NRQA 4GMP0 3C8XA 2WN3A 5LEKA 4Y20B 4Q4W2 5A6XA 3NAPC 3Q8EA 3GYDA 1GFF2 1WCKA 3JXSA 3VBOA 5JMCA 4CDWA 1OHFA 1OLRA 2YG0A 3FBMA 2Q8DA 4Q0PA 1Q5OA 4NWWA 3ZFEC 1MEC1 1SLTA 2D6KA 2UY8A 4XACA 2VOXA 1YQ5A 4ASMB 3K77A 3Q8BA 5FYYA 1V9U2 2X09A 1XU1A 2R7EB 1H1IA 1W9SA 1UWWA 2GP3A 4NJ4A 4K40A 2YUEA 1GNZA 1R083 5FP4A 5APAA 5DUVA 4TN7A 3KVAA 5EFUA 4EN6B 1LTEA 3HEIA 2R30A 4AQ2A 2WABA 3OY8B 4QXHA 5DDJ2 2B4KA 4QHZA 2BUKA 4CCNA 3AXDA 5CIRA 5LWBA 2FDKA 3O14A 1RUD1 4FP2A 1CQ9A 3BOWA 2BRTA 3FN9A 1OUSA 5FZ6A 4XJZA 2VW0A 1HN0A 1GV9A 2RHPA 2ZA9A 4IE5A 5CFCC 1DIWA 4RA0A 5A3OA 4MXWB 5SV5A 4LBQA 1GQHA 1WW7A 3QD6A 2Y60A 2DBIA 1XPWA 3MIBA 4P9JA 1O8SA 2CSGA 2KA3A 3BKZA 1KJRA 1STMA 1ST8A 5FZ3A 1SBFA 2YHJA 4IEOA 3IWZA 4UOJA 3I54A 1CN1A 2MEV2 5FYTA 1KS4A 2B45X 3I7DA 4HN0A 4XDOA 1WGPA 2OQ7A 1LGNA 2CAVA 3ZXDA 1PM4A 2EVXA 2CTVA 4Q1PA 3K3OA 1FATA 4XF9A 2D3PA 2X8KA 5A7WB 2OW4A 4D7YA 1NKGA 2VCCA 1XNCA 3D4KA 2VNOA 1JU3A 2BU9A 1QOTA 3M3QA 3MIGA 4UBHA 4EJRA 2AC1A 2RMU2 5LY1A 1MS4A 4IUGA 1VBA2 2IZWA 4KG8A 3T2OA 5HCAA 4WZFA 1LGCA 5A7WA 4N8MA 4B4QA 3WP3A 2W68A 1DGLA 2X5IC 1OOPC 3NO8A 1GQPA 3NNFA 2VZVA 2YMZA 1B35C 4MH0E 5ISLA 1PK6C 4OZOA 1ND3A 5FZHA 3LA2A 3ZSEA 2XLGA 4RSUA 3OGSA 2B42B 4Q4X3 5DN2A 5FFOC 3POEA 1C8NA 3WDYA 3BTYA 5FZBA 1J84A 2A73B 3S5AA 2XG3A 4HMZA 1TE1B 2FCVA 3TNQA 1RUD3 2QZ2A 4JHZA 5C3PA 4HANA 4XHBA 2VOWA 1QU0A 1ZBE1 1OLMA 5IVJA 1JYCA 1RVF3 2Y26A 1NQDA 4AQ6A 1SEFA 1WA6X 3NV2A 4INDA 1HRI3 2VUAA 1ZZ8A 2R063 3GZAA 5F5IA 3RJ2X 3H0OA 4PIYA 4UFLA 1CX4A 2WINB 2PHDA 5EPAA 2WRAA 4MUVA 1BLZA 1GMMA 2Y8KA 4JRLA 3N9QA 4M0NA 4PJYA 2WYFA 4Y22A 3P3PA 3ZYFA 3WY6A 3GF6A 4TZDA 1KS5A 4LITA 1BXHA 4LKEA 3WLUA 1ULGA 3DPRB 2H0BA 4NOTA 4LKFA 4YGBA 2NMNA 3E6BA 1K5MA 2C6SA 1RITA 2ZJCA 5JMOA 4AVCA 4MXWA 3VKFC 4GWIA 3DV8A 4ASLA 1S2BA 3I3BA 1O3RA 4LBNA 1NZCA 4CCOA 1OPMA 5FDBA 4QX0A 1GZWA 5CG9A 5FZFA 2A5ZA 2JG9A 3O1TA 2LROA 4HT1T 1S2KA 2RV9A 1PMJX 4J1WA 3RS6A 2NLRA 1W6MA 1AR82 3HNMA 2DYCA 3LPFA 1JZ2A 3IKWA 4EROA 3WQBA 3Q9OA 1J1LA 1DQ5A 3DF0A 2RS52 4IEWA 3PMEA 1Z78A 3TN93 1AYN1 4PDWB 3WQ0A 4Z2AA 3S5QA 1YQ8A 1RINA 4ASKA 4Q4W1 1LOFA 3U37A 2OQ6A 4FOYA 1XQNA 2VH9A 1OFNA 3VKLA 4YM2A 3VBHC 1HRV2 2GN3A 1ONAA 2Q1FA 3C7EA 4QB2A 2JDZA 4FPCA 5FY5A 3ON7A 3HQRA 4XCAA 3AFGA 4ZONA 4XILA 5FP8A 1SMVA 4BWOA 2XGXA 4DRRA 2CGPA 1BMV1 1G86A 4EYUA 4KU7A 2H6CA 1XNBA 4Y20A 4LIVA 4K8RB 3RWNA 3H3LA 3SEEA 5E89A 2ETEA 1LCLA 5DG1A 2XUEA 1HB1A 3LKJA 4UFJA 4CDQC 3J7LA 4KBZA 2QQVA 3ME2A 2ZTNA 1GOGA 4PLOA 4S2DA 5ABJA 1YXWA 1RHI3 3VBSA 5B4NA 3WNOA 2ARCA 4DZGA 3RDIA 1JXNA 4NR1A 4BMBA 3EB7A 1RMU3 1DGWA 1WCQA 3ZYBA 1OXCA 2VOKA 5JZGB 1ZX5A 4HKLA 3KV4A 1VALA 3URFA 4MHRA 4FCAA 3GBGA 4B4PA 4AVAA 3PUAA 2HWE3 3FMGA 1PO11 5I8YA 2WO3A 2WQ8A 2ZS6B 1LESA 5F6LB 2BWCA 1W28A 1H2KA 4QGNA 5HCBA 2ZGTA 4I01A 5LA2A 1UF2C 3AM2A 4XTPA 4E4SA 2VQTA 1Y7BA 4RHV2 3KZ4C 2RS33 5F8PA 3WZ1A 1GR3A 1WW4A 5J36A 4Q8LA 4FTSA 3OBZA 5LB6A 3HAGA 2X5IB 2WWSA 4FT8A 4Q4X1 4DOUA 1D4M2 1OH3A 3ZSJA 1L7LA 1MQTB 4WVVA 1AR72 4OLLA 4A44A 1VB2A 5I0UA 1W9FA 4P5YA 2NN8A 5CB7A 4B1LA 4XW3A 3QACA 3J7NA 1ZYBA 5L7OA 1MS1A 3I2FA 3WR0A 2OZJA 4CCCA 1LODA 3HN3A 1CD3G 3BCWA 3AKTA 1D4M1 3CIHA 2IXKA 1FOD3 1BBT2 3EHKA 1ND2B 2XR4A 4O9GA 2R042 2TUNA 4E4ZA 1SBDA 3H1MA 4NIHA 2UWCA 1S1AA 2OXBA 1LR5A 2HEYF 4NPMA 3ZYGA 1VBC2 3B93A 1F5JA 4UF0B 4YZ3A 1PO12 2PAMA 5DG2A 5F5CA 5JXHA 5J48A 2R072 1E5IA 4QKNA 2XVLA 3JCIA 2OKXA 2RM21 1GNHA 3GJBA 1IKPA 2ZGQA 4RN5A 3T4VA 5E1RA 2Z4FA 3KGLA 4RYDA 3WINE 1XYPA 3ROUA 1UL9A 2YFZA 3V0BB 1QJY2 4UFIA 4B1MA 4OQ9A 1ASJ1 1S0DA 4WM7B 3POYA 1Y9GA 1US2A 5FMOL 3FUQA 1CPMA 1TMF1 3NRUA 4RQPB 1QJX2 1XSRA 3K48A 4Q1RA 4XE9A 1IHMA 1W6PB 2DCZA 3D5OA 2FDGA 5CAZA 4HFSA 5A3TA 3RFRA 1A6CA 1HB3A 3UNPA 1RUI3 1SFNA 4JGZB 4XFGA 3FC0A 4AHWA 1RMU2 3NV4A 2G19A 3HN1A 1OC1A 3KF5A 4QPIC 4HXCA 2VZ3A 1UIKA 3WW2A 1UIJA 5EIYB 4QQLA 5CKNA 3LEIA 2YFUA 2D6NA 2HWF2 4KWJA 2AUYA 3OEBA 1R1A1 1FOD1 1H6XA 2B7YA 2PHLA 3K75B 2VVEA 3ILFA 4XQWA 2GC2A 5FK8A 3OJBA 1NA1B 3ACGA 4OCTA 3ZFFA 4NHYA 1H8VA 4FO9A 5FYCA 5IVBA 3CL1A 4PF1A 4CXXA 5IVCA 2QQWA 2VCMA 1WLWA 4FP3A 3HNBM 1X7NA 3FBYA 1AR81 3WF0A 2WNVB 4E8DA 1NE6A 1S0EA 3KS7A 3HBKA 3IIAA 1FNYA 1W06A 4AVTA 1QJFA 4QPWA 1L3JA 4XBLA 5A7NA 4RQPA 1HQLA 2J1EA 4OFGA 4GH4C 5JSRA 5T55A 3VDDC 1CAWA 3C7HA 1KITA 4RGGA 1NLRA 3N36A 3OUHA 4I09A 2EXJA 4IEZA 1DZRA 2FDHA 1W8WA 1MVQA 4NIIA 2AEYA 2J1VA 3I2DA 4BZ4A 1BBT3 3TEWA 3IN9A 5DZEA 1IPKA 5JZGC 2BEOA 2A6ZA 2E7AA 2QBXA 1TEIA 4P9LA 4QB6A 4YVWC 4BQXA 5ACA3 2KR2A 2XWBB 2XQXA 2PAEA 3OGGA 3DXUA 5ERLA 1FMD1 4QPIA 3UETA 1S0JA 4SBVA 4IEQA 3HT1A 2JENA 3SEPA 3AK0A 4BIOA 1ACCA 3ZN4A 5FJKA 2A3WA 3WF3A 3H42B 1G9DA 4QB1A 1U5IA 1VMJA 3DL3A 3PIGA 2HJIA 5FY1A 4IESA 3EMRA 2P3IA 5FYBA 1W6QA 5DAPA 4ZU5A 1MACA 1M4WA 2JIGA 2WA3A 1QNYA 4QAWA 3ZXKA 3R0RA 2Y0OA 3U11A 3VDDA 4MG2A 1ENSA 3AMNA 4OMCA 5IW0A 2PHTA 2YV8A 3BPSA 5FXZA 1AL21 4MOAA 3WF4A 4AW7A 4CTEA 4QX2A 5K0UC 1QXRA 4I3PA 3AYEA 3MLKA 4IEVA 1VBB2 5LBCA 4CUBA 1V6OA 1O59A 1VBD2 1JI6A 4RS5C 3UT0A 2AEZA 4AHXA 4RR3C 1MQTA 1IS4A 4SLIA 4AK3A 4DUXA 1QOOA 2YC2A 3VHOA 4HN1A 1K42A 3ABZA 4FPEA 1RUOA 2VZUA 2DUQA 5H9QA 3FZ3A 1Q43A 4YGDA 3ZXAC 2J1TA 3MBWA 1XNDA 5FPBA 2YBPA 3JB4C 1FI2A 4JGYB 1NLQA 1VBB3 2P2KA 1QOSA 2XJQA 4CDXC 4OI4A 3LSEA 1QHDA 1G7YA 2WC2A 2WO1A 5A1LA 4COUA 5GJ6A 1SPPB 2HEVF 4LEJA 3JBG2 4WM8A 2FBEA 2Y38A 3ZYJB 2ZX2A 3B94A 1IG3A 1W9YA 4JKMA 1PZ7A 4BISA 1V6NA 1AJKA 5A3WA 4OI0A 3CNAA 3K46A 3AP9A 3OPWA 4QDQA 3BTXA 2O1QA 2ZX3A 5F3EA 1ENQA 1DYOA 3FE5A 3ILNA 2X05A 3MZHA 1PVXA 5G04L 3ZMOA 1WKYA 3GBFA 3MIDA 3WNNA 1UZVA 1EV13 1JH5A 4GIQA 4QHBA 1OI6A 2QCSB 2NZ9A 3GDBA 4BXFA 1OT5A 3OBRA 1H2LA 1RXGA 2YXSA 3NV3A 1AL23 1GNYA 4J6GA 4L97A 2QQPA 4YG3A 4CVUA 1WMDA 1MS8A 2NYYA 5DDJ1 3AMHA 1JYVA 3CF6E 1LOBA 3WNXA 4CYDA 3J8F2 4CE8A 3DYPA 3RNSA 5JOWA 1QXJA 4B29A 4HBNA 5CU1A 3KMHA 1PMIA 4XFFA 4XIKA 1VAMA 3MUY1 2PTMA 5FJHA 1IQAA 1QJX1 3JQWA 1K3IA 1MVEA 4QPGC 1JYTA 1Q3EA 3UGGA 4IDZA 4QQPA 3HBZA 1C4RA 2VQAA 4MGIE 2OA2A 5FXWA 4LTAA 2QKDA 4YLZA 1QXPA 3CZUA 4P9YA 3WHUA 4FSJA 1SZBA 1PGW2 4YG6A 2ZEWA 1ZBA3 1BEV3 2J1SA 4HPKB 2ZAHA 4CCJA 3LEMA 4TLFA 1U5YA 3FUOA 5FY7A 5A3LA 4Q26A 5A3UA 1XNAA 4RHV3 4P9WA 2JEMA 4WBBA 4D3WA 1IPSA 4AZZA 4F83A 1UOFA 1GZWB 2XHKA 3U07A 5FZ1A 2Y6GA 1HXS2 1LHOA 1POV0 3OD0A 5K9YA 2XBO1 4ARYA 5IK8A 4FAGA 2BVBA 2EAKA 1GBGA 2NMOA 1K5MB 2FHRA 5EYYA 4ZU4A 5FZEA 5FLIA 1O8PA 2B8MA 2BP6A 2YPJA 2ZKLA 3DPRA 3NKGA 3K2OA 5JPMB 3WDVA 5IK5A 5FTTC 3N9NA 4ISRA 1XYOA 4AEKA 3POGA 5A6QA 1NCRA 1G9FA 2WZR3 4L99A 3OF1A 2VBDA 4RGAA 1PVC2 4RS5A 2DVBA 2YDEA 3RWKX 4AI3A 1CAXA 5F9TA 3VDBA 2WNOA 2O8QA 5FOBB 3WX5A 4A7YA 5BUVA 1KEXA 2F4PA 3CJIA 4CDUC 2R0FA 2RDQA 4TSVA 4XYXA 4K6BA 3OYWB 3ZKYA 5ACA2 4E2QA 4I30A 3WEZA 3ZM8A 1X9PA 4BH9A 2E31A 1C8M3 3AYAA 4DY5A 1GWKA 5FZLA 1GZCA 1G6NA 3OTFA 2PELA 1SACA 1WBLA 3AZWA 4W4ZA 3MF6A 3M1HA 2UWAA 4HOOA 2R071 1ZREA 2GP5A 2XLAA 1RUH1 4YVSA 1BYHA 1RJ8A 4H7LA 5ANNA 5C33A 4YG0A 3KQRA 1DGWX 3HIFA 4AFBA 2C5DA 1CAUB 3MICA 4PLNA 5JZGA 3SQOA 4ZY9A 3VBRA 1D4M3 2ORZA 5C3RA 2H0VA 1CJPA 2JX9A 3OD4A 3P5BA 5BPXA 3NV1A 1XB9A 4XVHA 1NX9A 4OZXA 1IZ3A 4D8MA 5FYIA 2ZGRA 1E57A 1MS5A 3GNEA 4IL7A 2WBKA 2ZX4A 2O14A 1HXS1 1C5IA 4JQTA 1QGLA 2OPKA 4TLGA 1JOJA 4A6SA 5KHIA 3O1RA 3I3MA 4PF5A 1GKBA 2GH8A 4Z07A 4OHZA 1ND3C 3TEZA 3BIEA 1D7PM 4FOWA 3W20A 2ATFA 4LHNA 4FPKA 4XETA 1R1ZA 5I0TA 4XPVA 3LOBA 1MS9A 2P3KA 4RHV1 1GZTA 1XXNA 2BNMA 4L2NA 2BJSA 5JI7A 3ZXLA 1LAJA 4PIZA 1VRH1 1XOYA 4BK4A 4LA3A 3FL7A 3ILRA 5T5PA 4FTEA 1RUF2 1V0AA 1REDA 4O65A 3OY8A 1UYZA 4HG6B 1PIV2 1WWYA 1G9BA 4X8NA 3GJAA 3S0MA 4AVSA 1C8M2 1QIQA 1RUD2 4WVZA 2ET7A 4NWVA 1TME3 2UU8A 3DN7A 4XF3A 5FZMA 3RI8A 4HVQA 2VG9A 1SCRA 4YNIA 3O1OA 3OGRA 3ASIA 5JOYA 2QQLA 3KF3A 5FXXA 3VUOA 2WNUB 3Q8AA 1GOHA 1ULEA 2W1WA 3E97A 4Q2FA 4Y1VA 3PMSA 3MEPA 1O7FA 1CZTA 2E26A 2FZ1A 1W6NA 1ULDA 4N7IA 4QPYA 4CDWB 3CJIC 4BYYA 4CDUA 4ZS2A 4IGOA 2WS92 1YQCA 3SNMA 2ZGLA 2WWUA 3OB8A 2JDPA 5K7PA 2HWC2 2RMU3 2WNUA 4GMP3 2VVDA 1TME2 2A6WA 4K9SA 2YY1A 3TN92 2PQSA 1PK6B 3NMBA 5L19A 3D6EA 3H8RA 2R49A 5A1FA 1DCSA 1NCRC 1GQGA 1JUIA 1OOPA 3DCQA 5I0SA 4GQ7A 1W3VA 1O6UA 3RZKA 3ZIWA 3THPA 1V6IA 2WWJA 1UKRA 3T2TA 4LBQD 3EYPA 1MS0A 2D5FA 2XOMA 1OPOA 3RI9A 4YGEA 4FQZA 3VBFA 4ZHNA 2Y64A 2LRPA 5GZGA 2BPA2 3VBOC 5HPOA 1CONA 1RUJ2 3OPTA 5LY2A 3N7LA 3KCYA 4N90A 4Y24A 2HWB2 4AGVA 2XBO2 4YVSB 5BYNA 3JD73 1FPN2 1SDDB 3THDA 1O91A 4HLTA 3CU7A 4TYSA 2W94A 4XDQA 4IGQA 3WW3A 3WQ7A 1NY72 2SLIA 2WO2A 2XBO3 2VXJA 1W6OA 2QNKA 3BTAA 4N43C 4YZ4A 3ZFGC 4S2HA 3SMHA 1YYNA 1WMXA 3RZZA 1QQP3 1YRZA 3CEWA 1YFXA 5CFCA 4CCKA 2P5BA 3FWEA 1UU5A 2BBVA 1WLTA 2R32A 3KSCA 3WOGA 4BQ2A 2G9ZA 4K3UA 4QPGA 5C8CA 4IERA 3MUZ1 5FZOB 1UOBA 1IQDC 1JS9A 4NIAA 1JZ4A 1A78A 1CAXB 2Z2SB 1GYKA 3NNLA 5F32A 4GWJA 1RVF1 1SFYA 1QY4A 1ZBE3 4KNCA 2XXZA 4M3CB 4KGQA 1GOFA 4BQ1A 3OBAA 3LF7A 3TOJA 2DBNA 1DYPA 2ZGUA 3AKRA 3VBHB 3BB6A 3HNYM 1BCXA 3MGUA 3N7JA 3WSOA 5F5QA 2GMEA 3OYWA 4KWKA 1LRHA 4HSLA 5LASA 1UOGA 1LB2A 3U14A 3F2ZA 2D97A 2Q5TA 1HLCA 3AXEA 1W2UA 1NY71 1LOGA 3FHQA 4FOQA 5FYZA 3S7EA 4BDVB 4NIGA 3UV9A 3VGIA 4XC9A 4NHXA 4NPRA 4OYUA 2V5DA 3T30A 2BVVA 3J9SA 3ES1A 1WLDA 4N53A 2E53A 3OGVA 1DF0A 4JZRA 4XZPA 3JQXA 1V6KA 5DMYA 1S0IA 3BIWE 4HPKA 1MZ6A 4BQ4A 1UX7A 5FLJA 1LOCA 1DFQA 4YFWA 1FYUA 3WCRA 2LUWA 4CDQB 3C7FA 2VMGA 3WUCA 2BTVC 1ENXA 4AF9A 2K9ZA 5LCWL 2ADDA 1GP6A 3ZFFC 4AG4A 5E88A 3UGFA 2VTXJ 1QEXA 2HWF1 5BNPA 3A4UA 3RSJA 5IT6A 5DDJ3 1W2NA 4XOGA 1W03A 5FO8B 2WQZC 3RYKA 1NAEA 4KWLA 4P02B 2X29A 1JHJA 3ALQA 5IK4A 2ZPXA 1JTZX 1W8TA 1J3QA 4ATFA 3PHMA 3CMGA 3W21A 4C0HA 2J1RA 1UMHA 2JWPA 4FPYA 1WLCA 3NJXA 1YEWA 3I97A 4A45A 2DF7A 4LOTA 5F3CA 2OUJA 1CZVA 3I4IA 2DFBA 1RUI1 5JIAA 2ZOEB 2I74A 3T0DA 3CKHA 4JHTA 5EWSA 3WG4A 2FZ2A 1LHVA 2VW1A 3AX4A 4CCEA 4D0QA 1C5HA 2Y34A 1EAH2 3U0ZA 3K51A 3PNAA 2YU2A 2VCAA 4EZ4A 1ZA4A 4I0BA 4YZ2A 3MF9A 3A0NA 1UAIA 1FMD3 1XBFA 2RS12 3MLLA 4XFBA 1OMIA 1OD3A 2ERFA 4NHKA 2CY6A 4IEPA 4MGZE 3ZMNA 1MZEA 2D98A 4GWNA 3VB9A 4GJYA 4P14A 4Y3OA 4EQVA 1V6LA 4RFRB 1AX2A 5FZCA 5FZ7A 4RL7A 1GP4A 1AUYA 4R4XA 4AOCA 4LBJA 4DXZA 4XDPA 3LEGA 3POFA 5K8SA 1O4ZA 3IBMA 4LR4A 2W52A 4TXWA 3M2MA 5LBFA 2AACA 2IFRA 1Q8QA 4O61A 3SCGA 4AL9A 1DU3D 3N9MA 4XJ9A 1QQP1 3EJKA 1R1A3 2RG4A 5EJ1B 5BNOC 1VPHA 4BE3A 5KHGA 5FYMA 3O1MA 1WCUA 1B35A 4QD2A 3OPZA 2YU1A 1PM7A 4MGQA 3CZJA 2VMDA 1HXS3 4Q4V3 2A75A 4BLJA 5C9AA 4W6WA 3A22A 4JGYA 3VHPA 2BBAA 2UWBA 3BGAA 3MI8A 3PUIA 4BJ0A 1RUE3 2JDHA 5C4WC 2R1DA 2OYZA 3UYJA 3TBDA 3ZSMA 3VBUC 1ZZ7A 1ULPA 4A42A 2W1SA 4W65A 4R8HA 1H4HA 1G8WA 4JGZC 1RYYA 1O5LA 1X8MA 1H30A 1XYNA 4M3CE 5L9VA 4AQSA 4QPIB 4OI2A 1M06G 4Q4Y1 1XC6A 1H8TA 3CLPA 2ET1A 3BU7A 2R073 4KBBA 1WZXA 2V5YA 1TNFA 4MO3M 5IJRA 4PQ9A 4F8AA 2BNNA 3QH6A 2VMEA 2W3JA 1JU4A 4NAMA 5A6ZA 1COV1 1JYXA 1S0GA 3WCSA 5C8CC 4IV3B 3LB9A 3PU8A 1YO8A 3D82A 4QXBA 5FREA 2IXLA 5C9AB 3GALA 3WDXA 3E5XA 3THCA 1ALYA 1MPXA 1OF4A 1SLAA 3AFKA 1ZRCA 5KR7A 1DHKB 3MYXA 2WSVA 5F2SA 5JR7B 3NVCA 5CBLA 5A7OA 5JI9A 3VLBB 4EZHA 4URAA 5IAXA 2EXIA 4YW3A 2ARXA 2WNVA 3O0WA 5JOXA 2DUOA 2DU1A 2EICA 2NM1A 4LKDA 4A6OA 2UYAA 3AJYA 5EZWA 2ILMA 1IG0A 1S4CA 3I59B 4FFGA 4WM8C 2Y33A 3NSTA 5FYUA 3RVHA 4AFDA 2GH2A 2E63A 4COVA 5DZFA 3ZXGA 1V9U1 4LIUA 3ZFFB 5J1XA 2JE9A 3J26N 1RUC3 3POBA 2Q1MA 4NROA 1BVVA 3RYPA 3JBG3 2QVSB 3X29B 4QKFA 4B3NA 4D94A 5C8WA 1JZ6A 4YVWB 3OEAA 3FLRA 3MPPG 5GALA 4CZSA 4ZU7A 4W50A 4WV8A 2XJRA 1LECA 4YW4A 2YC4A 3BOPA 4S2FA 4Z92B 2Q30A 4GULA 5A7SA 1KRIA 1UU6A 1RUE2 3K4ZA 4NVPA 3IPVA 4MVTA 4AQTA 2QDNA 3JZVA 2ZACA 3IDEA 3PUQA 4IEUA 4XAEA 2IFWA 5HCFA 3ZXFA 4FAHA 4BK5A 2JG9C 4CP2A 1UO9A 5FZAA 1ZZ9A 4WM7A 4YM3A 3GBWA 1HRI2 4V2VA 5KXBA 5K4LA 1IS6A 4Q29A 1CAVA 2QE3A 4A3ZA 3JU9A 3IM0A 5FKCA 2YBKA 3M3CA 4QGLA 2RE9A 3HMYA 4K20A 2RDSA 1CZSA 4LE4A 5FZDA 2XVGA 5GZDA 1AYM2 2WFF2 5DUXA 1RUI2 4Z1VA 2TEPA 2WZEA 4YFZA 5KXEA 1QKQA 5HBAA 1FV2A 2DV9A 3MIFA 1HV0A 3BI3A 5L9BA 5C71A 2I07B 2WLPA 4BQWA 1PO21 4LORA 5C5TA 4LO4B 5CFDC 5C4WA 5JLVA 2BFUL 5I0DA 4LBKA 5F5AA 1UX6A 3ZLIA 1ND2A 3H50A 3SH5A 5JXIA 1A8DA 3FLTA 2DDUA 3VD4A 3AL6A 1PHMA 1UYYA 1W0PA 1J1TA 2JIJA 3A7QA 3H8UA 3WV6A 4FPOB 2ZCWA 4KQ7A 2VY0A 1HJFA 2BQPA 2V4AA 1RUC2 2QTWB 3NAPB 5JXGA 1MZ5A 3MLJA 4P5HA 2HH9A 4A7KA 3E6CC 4DUWA 1Q8SA 3PVEA 4FPHA 4F3JA 5T5OA 4CCMA 1BK1A 4N7UA 2JD9A 1J59A 2PLV2 3IDAA 4MSVA 2IVIB 2R043 5EJ3A 3VBHA 3SCHA 1UCXA 3IMMA 4OHYA 1IS3A 4CU6A 1QJU3 4OQ8A 1CGPA 2R1BA 4JRAA 5AFEA 1G9CA 1MQTC 3M4FA 4M3CA 2KM2A 4YPJA 1QDCA 4HVOA 2I2SA 3HT2A 1MS3A 1W8ZA 2PLV1 4GWMA 2HEWF 2XLFA 3MPBA 4FTBA 2D44A 2IXHA 5FWEA 2MEV1 3HR9A 4IV1C 1L7RA 4JV4A 1XNTA 1OLQA 4XFIA 4R9DA 3WP6A 3U4SA 4QPGB 2HWD1 3IIIA 5T50A 1TNRA 5F3GA 3WP5A 5JVVA 4N9IA 3GM8A 2OIIA 2XB6C 1RXFA 2YC0A 2A71A 3J7MA 3O0VA 5LA9A 4FXGB 4XJWA 1CR7A 4Y1XA 5FUNA 5BV6A 3DGTA 4KMQA 4NIDA 5J98B 1W90A 1NLSA 3AVRA 1RHI2 1OD5A 4P08A 4AI2A 3OUIA 1CVNA 4UFKA 4FFHA 2WIIB 3DECA 1WBFA 4YM0A 3DXTA 3J4UH 5FUPA 4GXLA 4OHVA 1I1EA 1NYWA 4Z82A 2PHFA 4CEYA 2PHWA 2H6BA 1SBEA 2MPFA 2Z42A 2BNOA 3HVDA 3PTRB 4XBNA 3ZX7A 3ACIA 4XIOA 5EV7A 5DUUA 5IUQA 4GAZA 3MFCA 3GZTB 1YJLA 2J1UA 1ASJ2 4AGGA 1PIV1 1JZ7A 1W9WA 3SC7X 1UYPA 3ZO0B 2ZBJA 3OCPA 5ABJB 1AXYA 3B5LB 4XBQA 2FQPA 5FZ0A 1FPN1 1HW5A 3IB3A 4GJZA 5FUIA 2VM9A 3RZMA 3IT8A 5IVVA 3G6JB 1OOPB 3LIHA 1W8HA 1C28A 2WAOA 1DQ1A 2D7FA 1VBE2 4CPBD 3C7GA 3AKPA 2XL7A 3JD71 4W8JA 3AP6A 4JTNA 2XL9A 3E5UA 3SISA 5JSPA 2DCKA 1I9RA 3N9OA 5IFTA 1POV1 1KFXL 4HSJA 2ZEXA 5A33A 4LJHA 2TNFA 5CA6A 2JG9B 5E6HA 3ZPYA 2VR4A 4NHMA 3AZYA 3KD4A 1XE7A 4ONUA 4FBFA 3TN91 4AHYA 2BW8A 2Y6FA 2PMWB 1W8UA 5D2AA 1SLIA 2WSUA 4QM8A 5FMDA 3PDQA 2QQKA 2DUPA 4UYBA 3NW4A 1QJZA 5LZ6A 4CCDA 1YIFA 1N1TA 3D3AA 3O1PA 3E6DA 4KWUA 1AR71 1Y4WA 3PVOA 1VRBA 4C1XA 4Y22B 2P3JA 4GD4A 5J37A 3PVNA 1ZRIA 4CP9B 1W6MB 3WDWA 3T2QA 4LBOA 4ES9A 4QQHA 5CFDB 3NJYA 2ZMKA 3E1F1 2XPJA 2YROA 1Z7S1 1RB8G 5IAVA 4H2AA 1H4GA 2Y6JA 4A4AA 4DO0A 3I2OA 4YM1A 1J58A 1TG7A 4U36A 3T0AA 1ZZBA 5T5JA 3KT1A 1JYWA 4K8FA 4X8PA 4BQYA 3A23A 4J25A 1JN2P 4GZ9A 5FMBA 1BMV2 2GSYA 2XKPA 3V56A 2HWC3 2HWE2 3TRSB 2QQUA 3I2GA 1GANA 4LT5A 5JXJA 1J83A 3WNKA 4IV1A 1PVC1 4XABA 3WVJA 1GSLA 3O1UA 2OVUA 5DAWA 2QDRA 3M3EA 1W2TA 4JDOA 1VBC1 1GWMA 3AB0A 1ENRA 3T4HB 1IKQA 3OUJA 1HB4A 4KL1A 3ORJA 3VD5A 1CAUA 5H9PA 2EIGA 1BBT1 1XE0A 3NNJA 1UPSA 5B2GB 2J1AA 5HXMA 2DVGA 2FCTA 2FMDA 2WLQA 4WVMB 5FBZA 3LCPA 2ZGMA 1R64A 4IV1B 4V1PA 4EN0A 5GLZA 4G3YC 2ZKNA 4YW2A 1ZBA1 2ZEZA 2ZEYA 3I2JA 3I49A 2XJVA 1OQ1A 3POWA 1VP6A 4CU9A 2WZR2 3CO2A 1VBC3 4IQPA 3AL5A 4XJAA 2IXJA 5A3MA 3AP7A 3ZR6A 1J3PA 1XJAA 4A2UA 3BYWA 4LBQB 2EIDA 2Q8CA 3LFIA 1UNBA 3CJIB 3HOBA 1GU3A 1OQDA 4XHXA 3H9AA 3KQ4B 3VBFB 1GICA 3LFMA 1WD3A 1JZ3A 2HWE1 4P9IA 1LENA 3WQ1A 3ZYIB 4JKLA 5CFDA 2EAAA 3L2HA 2JDUA 5JWPA 2RR12 4M3CF 5DQ0A 4E9KA 2I45A 4HK9A 3FHIB 3U4XA 1C57A 3J7HA 4BA6A 2AR6A 3W9AA 2VXRA 3S7IA 3FHAA 4XF0A 4A7ZA 1GLHA 1LKNA 2YYOA 3ZYPA 4B4RA 2A3YA 1YLLA 4IW3A 1RUNA 3PURA 4AFAA 2P3YA 2WKKA 1OBNA 1YFWA 4X6RB 3TNPB 4IETA 4C0BA 1XE8A 2BZDA 4J1XA 4CPBA 1W99A 3LA7A 1E5HA 1URXA 2WUHA 4UI9L 2FDIA 4PHZA 5EQUA 4PI2A 1W6NB 2QUOA 4C91A 1E5RA 2GU9A 4XQ4A 5GLVA 5A33B 4MZUA 5T52A 4CP9A 1U0AA 2ZX1A 3CBNA 3VZJA 2P1BA 2VNGA 5IVEA 2DURA 1PX4A 4XUQA 1NCQA 4AEDA 1QMJA 4YW1A 1WCSA 1WUVA 1AR93 4MGTA 3OBTA 3WW1A 5FY9A 4CEWC 3BALA 3WG2A 1LOAA 2EIBA 2WYSA 3SH3A 2VW2A 1Y43B 3N9LA 3L9JT 1VJ2A 2YPDA 1AR61 4Q0SA 5C5UA 5C7GA 3I3EA 1DQ2A 1W8OA 2XVKA 4Q4W3 1PVC3 2WR9A 1OFSA 1SLBA 2QZ3A 3KHCA 4UFHA 5J09A 2BFUS 5CKQA 4AR2A 4HKOA 1Z7S3 3RG0A 3TB0A 2VZ1A 3B9CA 4QX7A 5FZ8A 4CEYB 2VUJA 5C6CA 3KV5A 1W3XA 3C3VA 2PHUA 2D43A 2B9VA 3AP4A 1LEDA 1TMF2 2Z79A 5D1IA 5FPLA 2GNTA 3GCXA 3VV1A 5L36A 3MV11 4OHWA 2ZMNA 1RUG3 3T08A 1YC61 3GXUA 4QX8A 3LDKA 5BXXA 4GMP1 3VL9A 1EYBA 2AGSA 3RRDA 2TBVA 1W8FA 3FJSA 1PZ9A 3QCWA 3NNMA 4QX5A 2P17A 3DYMA 2VMIA 5FR3A 1SPPA 3EXUA 1HN1A 4AI9A 3P1IA 1PGSA 3B7MA 4FPLA 4EV0A 4DXRA 2PAKA 1QDOA 1VRH2 3ZN6B 1LU2A 3N4MA 1DQ0A 3AYDA 2VQ0A 3LDRA 3LSDA 2V4VA 3LGRA 5F6KA 4BIFA 5BY5A 3NKTA 4JKKA 3PVBB 1HB2A 2B5HA 3LA3A 3Q8FA 4QMAA 5GZFA 3KV9A 5LW9A 5EP9A 3JB8A 5FZGA 3JBG1 5E16A 2VU9A 1Y3TA 1NXD1 1CIWA 4BHPA 5FMCA 1UMIA 1F31A 3O12A 5DPNA 5BNQA 3H1YA 2RS31 1Q56A 5LRRA 5A1AA 2XH6A 3TEXA 5IATA 4GB32 5A6YA 2NP0A 3I2IA 2O8OA 4ZPIA 1F5FA 1YWKA 2P6HA 4PCRA 2BERA 5T3NA 2A6YA 2ZHKA 3M3IA 2ZGPA 1RUJ1 4CDXA 1VBA1 1V6JA 4YWAA 4W6YA 1F9KA 4Y26A 1CJDA 4LQRA 5FRAA 3EO6A 4MGSA 3B00A 1POV3 4BMEA 5T54A 1POQA 3VDCA 4RGKA 4IEXA 2GALA 1H1AA 5AVAA 3USUA 5D8AA 3VD9A 3VD3A 1A34A 3TYJA 3LWCA 4XFAA 3VKMA 3U10A 2EXKA 4XJUA 5A3NA 5JPNB 4M00A 2DCTA 4Q0UA 4P00B 3AP5A 5EYXA 5FKBA 2D6PA 5CZKA 3T09A 2ZZQA 4IGPA 4MADA 4F7ZA 2VZQA 4C8DA 3FFZA 3K4DA 5A3PA 1CAVB 4CUAA 3APBA 3MW4A 3ZYRA 3VBSC 1PIV3 2D3SA 4GKYA 2UY9A 3IAQA 1CAWB 4M4RA 4TWTA 4R9BA 1Z0HA 3WNMA 1U5ZA 1UOJA 4GKXA 1EV11 4Q0QA 3VHRA 3P6BA 1HRI1 2BWAA 2CGNA 1SLCA 3IPVB 4L8QA 1WCDJ 1COV3 3WUDA 1R081 1KXGA 2VZSA 2AZ5A 2HKXA 4XQDA 2B9UA 2WZ8A 2VPVA 2FCUA 1RHI1 2ZMLA 3B69A 2O0OA 4AFMA 4CCLA 3B01A 2XJPA 2W39A 3KB5A 1IS5A 3S57A 2CGOA 1BEV2 3VBUA 4DQAA 1VBD3 1JYIA 5H9RA 3EQEA 1X50A 5KHKA 2K46A 2DU0A 4CUCA 1MEC2 1V70A 3WG1A 1OF3A 4CDWC 4JGYC 1KD7A 2JB4A 2Y6LA 4IE6A 5BNNA 4EWAA 3VBUB 2JICA 2W0XA 4UBGA 5FYHA 1FXZA 2X53S 3VZLA 2GMPA 1JOBA 3HPNA 1FNZA 2LM3A 4FI9A 4GH4A 2EXHA 4UFMA 2D5HA 3R4DB 4MXVA 4EWEA 2RS51 4EN9B 1GUIA 1NUKA 4QKBA 1N1YA 3KCCA 4X6QB 1UPIA 3M7AA 1ZA7A 1REFA 3Q8CA 4FFFA 1KQRA 1AR91 3VHNA 3F95A 3LDBA 4G4FA 3WT3A 1V9U3 4WZCA 4DFSA 5CEHA 1VBE1 2ZGNA 2CHHA 4R52A 2JG8B 3LAGA 3S30A 4N9HA 4QXCA 3WD5A 1PO22 2D6LX 2VGDA 3ZN5A 3BVCA 1WD4A 1US3A 4HONA 2GC3A 2VOTA 2XWJB 2VNVA 2IVJA 2CNAA 1EV12 4FOVA 2WNEA 5GLTA 4YW5A 1B09A 4IV3A 2XDVA 3RJRA 1LOEA 1R093 3GZUC 3RMXA 1YNAA 1NOVA 2HYXA 3H7YA 1YIPA 3VKNA 2WDBA 4YVSC 3J8F1 3WG3A 3L2YA 4HK8A 1QJY1 5IYYA 3VZOA 5DZGA 3RZHA 2W2IA 3HD8B 4S2GA 1VRH3 1OLME 1UY3A 4R9CA 3UESA 3WW4A 3ZYHA 1HQNA 3ZVXA 4I2OA 5JSOA 5JR2A 2QQMA 3MW3A 1ASJ3 1DP0A 4Q4Y3 1W05A 1YFUA 3B02A 4OUEA 2XMLA 4YSFA 2WT0A 5AC91 1DLLA 1XU2A 4BM8A 4RQPC 5F39A 3N9PA 3VZMA 2VL4A 2HBUA 2VCBA 1VR3A 4RD7A 2HLEA 3DKQA 2C26A 1YQ6A 3B9IA 3ENRA 1B35B 3MO4A 3O1VA 3NWKA 5I91A 1AR63 1H8TB 5H9SA 4BB3A 5C3SA 1NQJA 2K2SA 2G4IA 4CXWA 1H0BA 4XFHA 2VE1A 5C3QA 1AX1A 1SQ4A 2RDRA 4D6SA 1EP0A 5EHDA 2E7TA 1X9TA 4BLIA 1JHNA 2VVFA 1UN1A 1LHUA 4UT5A 2BGCA 2Z69A 1HJGA 1S0FA 4Y4RA 3SLIA 3OSDA 1JZ5A 2WN2A 2EF6A 4LOSA 4FQ4A 3SHRA 3OGJA 3MFAA 2V73A 3HQUA 4FPFA 3O1SA 4GALA 1N1SA 3A0KA 1VBD1 2A6VA 4CA9A 1EY2A 3KT7A 4LMFA 1JUHA 2JG8A 2IUWA 1QWRA 1CPNA 1IGOA 2ID4A 3DEMA 3QLQA 1T6GC 2IC1A 4XEZA 2WFPA 2WNVC 5T5LA 4LO5B 2HBTA 2W92A 4MHUA 4LLOA 3VBSB 3AMQA 1VAVA 3IAPA 2JKBA 5TSWA 4E2GA 4JVAA 2WS91 1FOD2 4QX3A 4GH4B 1K45A 3RPQA 1EAH3 1PGW1 2GC0A 5DUWA 4LUMA 5FYVA 1P8JA 2D93A 2ZXQA 4Q8KA 1PO23 2QFEA 4IE4A 3V0AB 1LEMA 1FMD2 1XSQA 3FX3A 3ZKUA 2WT2A 4HZFA 2R0HA 1BZWA 2PXJA 5FOJB 1RL3A 3U78A 1QH7A 4E8CA 1A8MA 3O0XA 2RM23 4PDWC 1AZDA 1DGRN 4ATEA 1SDWA 3I2HA 4QHOA 5FBJA 1W9TA 5DAXA 4ZS3A 1IOAA 1AXKA 2Q0AA 4PQQA 5I8SA 3UKNA 5KXDA 2CDOA 1ZNPA 3AJZA 4LO6B 3V64A 2E32A 1W6PA 1UXXX 2VUDA 4KH9A 2PHXA 4OUSA 5ANQA 1D0HA 2ORXA 3ZXEA 1X33A 2Q1ZB 4UAPA 1F4AA 4CDQA 1Q8OA 2HWF3 2XQRA 1Q8PA 4K21A 1AJOA 2P34A 4LHKA 4FPGA 2VZPA 5JUVA 2W87A 2GN7A 3GGLA 3PIJA 1H2MA 2JG8C 1K12A 1YI9A 5LA0A 3M70A 1MEC3 5BNOA 2OX0A 4HVRA 3C2UA 4OUMA 1OKOA 2OPWA 3LD8A 4PBPA 3ZIXA 4L0PA 1N1VA 2DCYA 1UZ0A 4LK6A 4LHLA 5A32B 1S0CA 4QKDA 3H3UA 1VIWB 4V2WA 5D8AB 3V65A 4GB31 4NN0A 1N3PA 1R1A2 4QM9A 2CAUA 2WJSA 4CU7A 1W04A 4HL0A 1LOFC 2W91A 4BPZA 5F1RA 4YRDA 3SXWA 5AVPA 4CEWA 2XJSA 3T2PA 4CDXB 2YGMA 3EBRA 5G05L 2JDMA 1FX5A 4Q4X2 1TMF3 5C70A 4C90A 3AMPA 3K4AA 1UY2A 3ACHA 1SG3A 3WF1A 4OULA 4COZA 2JECA 5L7OB 1O3SA 5HV0A 4PIXA 2ZHNA 3GHMA 1OA3A 1VMHA 5FK7A 2C1FA 2FDJA 2MEV3 3DUIA 1AHSA 3LQCA 2VBBA 4DEQA 1BKZA 4XF1A 5AFBA 1C1FA 1DG6A 2G9GA 1GZ9A 1W6OB 2VTXA 1NT0A 2G9FA 1ZBE2 3I8TA 3CJXA 1H8TC 5FPZA 4ITCA 4L9BA 5DABA 2N7GA 5L73A 3ZN6A 5FO9B 2R6QA 3IDBB 3K3NA 3VD7A 4FVVA 4OHXA 4K7JA 4YW7A 2W9XA 5FCCA 5JAXA 2VMFA 3RYRA 4BU2A 1JBCA 4UWDA 1F35A 4YZ1A 4LLFA 1YHFA 3LIGA 5C8CB 4WVWA 1F4HA 1RIRA 4IV3C 1AR83 1KFUL 2F17A 1TZOA 2P37A 1Y9MA 1V00A 4QT6A 4YW6A 4B7EA 1MZFA 3SKVA 2QQIA 2HWB1 4GB33 4CUGA 5A70A 5C9AC 5CFCB 1RUF1 2VZOA 2CV6A 2LW8A 3T0BA 4ZZ5A 3M3OA 4UW5A 1PX3A 2IXIA 2EALA 5A80A 1OVPA 1SHWB 1UW8A 3ITQA 3VKOA 3ZOIA 2JD4A 1S0BA 4NUBA 2RMU1 3W58A 1DLCA 2ES3A 4AHZA 5KXCA 5F2WA 1HRV1 4UW3A 3VN4A 1BK0A 4UW6A 2R062 4JQRA 4XXAA 4D7TA 1PK6A 4AXOA 1ZRRA 1QJU2 2OS2A 2PA7A 3PLQA 4N43B 1WW6A 2WAAA 3ZFGB 4D6QA 4M4PA 1UZWA 1QH6A 2D40A 3KM5A 4H3WA 4XF4A 5CADA 3AKSA 4DS0A 3CDZB 4JTOA 1I3HA 1EUUA 1TME1 2AH2A 1K5MC 2CWMA 4KU8A 4XCBA 4LO8A 3NJVA 5CNAA 4DRVA 3BTZA 1RVF2 4QDRA 2KXLA 4AEJA 2ZAAA 4LK7A 1YUDA 4XXPA 3AKQA 2HWC1 2VO5A 3VL8A 2A1XA 2R16A 2ZHMA 4PDWA 1LULA 1Z7S2 2OUHA 1NCQB 4AEDB 4Y5TA 4I02A 4HKWA 1DGRA 2CWSA 2BDRA 5FPAA 5LBBA 1XNKA 2AENA 3KV6A 5FZ4A 2C0ZA 4M0HA 2QQNA 4BOWA 5JOZA 3AYCA 3R05A 1W39A 3KWVA 4Y1ZA 3POJA 2PQQA 4LUKA 1FV3A 2GC1A 2W5FA 4CDUB 4DXTA 4LNVA 1NA1C 2FMYA 2J42A 1O4YA 4Q27A 3NQHA 2E51A 3UK9A 4AI8A 3N3HA 3TWIA 2RS13 3VZKA 4OVEA 5KBFA 4N43A 1D2QA 3ZFGA 5ACA1 3MW2A 5FP9A 5GM0A 1X8EA 5J3UA 1IPJA 2RS53 4QGMA 4MX3A 2OT7A 1UXZA 5E8AA 2VUCA 4BXSV 2EA7A 2XJTA 3FFQA 3S6PA 4MGKE 1PNGA 3HQXA 3RZLA 3DPRC 4A41A 1S2EA 1PNFA 4JC1A 3UKVA 5FPXA 4L11A 1BVP1 2QQOA 2VD7A 5F3IA 5FXVA 1QJEA 2F4LA 1OSGA 1ZM1A 4LPLA 1ULOA 2DTYA 2F6BA 4MLOA 2DFCA 2JJ6A 3VBFC 3QOPA 2QQJA 2WZR1 4Y5SA 1EUTA 2A7AA 4MYEA 2JDYA 1U5XA 2NPIA 4D6RA 1LHWA 1U12A 4ARXA 3VZNA 3GHNA 1ZBA2 4NO4A 5F37A 1UQXA 2VZRA 1YQ2A 5L7OC 4LKSA 4NRPA 4PI0A 3UKTA 3WHTA 2GDFA 1LJ7A 1RUC1 1ND3B 2VQUA 1DDLA 1AYN3 1ULCA 5LRSA 1QNWA 5DXDA 3MDPA 5KHJA 1RUJ3 3A21A 2J7MA 4IE7A 2GNDA 2RJLA 2XKOA 3D8CA 4WVMA 1OA2A 3UJQA 3KLSA 4PLMA 3ST7A 5FZKA 2VULA 2FD8A 1UY0A 3NNGA 3VBRB 2ZX0A 4CP1A 5K0UB 5LBEA 3THTA 3N7KA 2WS93 2C24A 1D4VB 5FPVA 1DZQA 2VECA 2E7QA 5M0TA 4LXLA 4ZZ8A 1EPWA 4RS5B 4U2AA 3KCXA 3ZDVA 4MV2A 1DZTA 4XUOA 4JDNA 3RQ0A 5LA1A 4XUTA 2W1QA 4RR3B 2ARAA 5IFPA 3ZPOA 1K5JA 1UKGA 4QU1A 4Y1UA 4CEWB 4CSWA 2C9AA 1ZZCA 4O9EA 3C7OA 2HWD2 2ZZJA 5IVFA 1APNA 2XUMA 2WO7A 1W0OA 4YARA 2J22A 1CIYA 3PU3A 3I3DA 4COYA 5A32A 4CU8A 2CDPA 4AWDA 2WQ4A 1C8M1 1BJQA 1BHGA 4DY3A 3LE0A 3NAPA 3PL0A 1JZ8A 5DAVA 5BNOB 4DUVA 3NL1A 1JODA 3WXPA 1AVBA 1RJ7A 3CHXA 5DAQA 5JCTA 3LPGA 4Q0VA 4UW4A 4PBOA 4IE0A 1EPZA 2D6OX 3POSA 2C9KA 1NCRB 1VE0A 2ZHLA 3RGBA 3ACLA 5FAXA 5FP3A 3W5MA 3MHZA 1XRUA 4E4DX 1RUF3 3AZXA 1O3TA 4I0WB 3NJZA 4QU2A 5C4WB 4K1ZA 1AR62 1RGSA 2JB8A 4EN7B 4XURA 1AXZA 5BNNC 1RTVA 5FY8A 5FLHA 5AC92 1YCIA 1HX6A 1BEV1 1I5ZA 4ZXKA 3R6SA 2W08A 2ZGKA 2K0GA 1NCQC 3JD72 1JMUB 1ZVFA 5FY4A 3VBOB 4AEDC 5A7QA 1UD1A 3QH7A 4Y5Z0 3MIHA 3H8OA 4DXSA 1LNSA 3DYOA 4C1WA 3I3QA 2FDFA 5GZEA 3H7JA 5EXOA 2P4EA 2E33A 2W95A 5C3OA 1HQWA 1W2OA 4CRQA 2DTWA 2W1UA 5FQ0A 2UURA 2MNGA 1ND2C 4QDSA 5IK7A 1VLNA 1AL22 2ADEA 4E27A 1H1MA 1T2XA 1DYKA 4PT6A 2VBPA 2CL2A 4B8EA 1V6MA 4LULA 1R092 3SH4A 1X82A 5FY0A 1X36A 1AX0A 3ACFA 3R4SA 5KC5A 2WL1A 4EE2A 2DVFA 3LEKA 4JX0A 1RUG1 4DPNA 4YVWA 3T1LA 4WM8B 4O7XA 3WNPA 4KGGA 2B46X 5BNPC 3U1XA 3V0AA 3AVSA 1PGL1 3P3NA 2VJXA 4Q4V1 1SCSA 3ZDSA 1HIXA 4YGCA 1N3OA 1A3KA 3B3QE 1UZYA 4WM7C 2Y0IA 4XUPA 3KVBA 3I59A 3UL2A 1NG0A 3AC0A 4CP0A 1VBA3 3ES4A 5JIUA 1OH4A 2B39A 2DVAA 4IXLA 2JDKA 4XMIA 1AF9A 1WMEA 3CQOA 4XFCA 3WF2A 4RFT0 2JE8A 4KG0A 4N53C 2PFWA 1KJLA 2R061 4LE3A 2Q8OA 5FPUA 4AI1A 5AC93 5CVRA 4D7SA 3FLPA 4LBLA 2HYKA 5FIXA 2PHRA 2VMCA 4D69A 3W5NA 4COWA 4XMAA 2BV4A 3LZZA 4H55A 3JUUA 2KD7A 3BN6A 4NE9A 1T6BX 3DKWA 2LALA 5I0RA 1C1LA 1W6QB 2VNRA 4FXKB 4I3GA 3VBRC 2IXCA 5GZCA 1H6YA 3KT4A 4ZKTB 3G7DA 1H2NA 1QJY3 4AI0A 5LEJA 1ZRFA 1VBB1 2RDNA 3WP4A 4Q4V2 2X10A 5FZIA 3WNLA 4EN8B 3N35A 1ULFA 2PN5A 4XUNA 5KHHA 4Z8BA 1RUH2 1UYXA 3AZZA 3PUSA 1Q8VA 4AYUA 1S55A 4HETA 5FP7A 1MR5A 1DQ6A 1PO13 1UY4A 5IWFA 2RJ2A 4Y4YA 3IMNA 4Q4Y2 2UYBA 2BGPA 2BOIA 5D21A 1ZRDA 2RM22 4ORFA 2HWD3 3VDDB 1R082 3QBQA 1EAH1 3UJOA 2JKXA 4FPJA 4BQ5A 4B7KA 3WDTA 3RZJA 2LTNA 3J8F3 1GP5A 4AVBA 3D0JA 1DBNA 2YB7A 4NRMA 5GLWA 1OUXA 3O7OA 3LOIA 1FT9A 4P9GA 1C3HA 2VZTA 2WT1A 3ZSKA 1D2SA 1O5UA 2ZABA 3T1MA 3PUHA 2JXAA 2BOJA 1LHNA 4ET7A 5I8TA 4QX1A 2EIEA 4DB5A 3HJRA 5LATA 4AFCA 1LU1A 4URTA 1AL0G 4LBMA 1NE4A 5I93A 5IHRA 1E5SA 2NQYA 4XTMA 4I0AA 4XZUG 1RUE1 4P9XA 2GNBA 1SFPA 4DMIA 1VBE3 3RMYA 2RS32 5FYSA 3ZFEA 1WMFA 2V09A 5BNNB 1WW5A 2PYTA 3BPZA 3GCWA 4YYOA 2DWRA 1NZIA 2QJVA 3H8XA 2XJUA 1AR73 4LA2A 1FPN3 5J7MA 2JDAA 1I6XA 2C4XA 2JDNA 2Y6KA 4DINB 1CWPA 4TTGA 2HWB3 3ECQA 2XHNA 1F15A 3PTYA 3R4UA 3ATGA 4FFIA 4NAOA 1OA4A 1VMFA 2RJKA 3ETQA 5GKAC 4AE2A 2WNUC 2YGLA 4QQ2A 4QXKA 1VAKA 2RVAA 2RR13 5HXVA 4AVVA 4DNYA 2E9QA 1HDKA 1RMU1 2JE7A 3INAA 1KDMA 1NA1A 4OMDA 1ZZ6A 5FQ0B 3ZR5A 4MGYE 1CESA 5CYYA 1REEA 1W2AX 4EWDA 1QJX3 5JDBA 2A3XA 5KC6A 1AYM3 2WFF3 4OI1A 2Q8EA 4R9AA 5FV3A 1GWLA 3ZFEB 1N47A 2AREA 4Y33A 3V0BA 2W46A 3VDAA 4QWNA 2P6CA 2Q4SA 1UZZA 4AAPA 2D6MA 3GZEA 1G9AA 2VMHA 3MV01 1BQPA 3SCFA 3SITA 2GZWA 4DEVA 3I2KA 1UMZA 3O5SA 3HWJA 4ISQA 4CEYC 5BNPB 5HV4A 2RR11 2E6VA 5GLUA 4BQ3A 5LK7B 4JGZA 2DVDA 4UF0A 1W0NA 1DQ4A 2ZGSA 1OQEA 3USUB 4JDMA 3USSA 4W6XA 5ABJC 1SLLA 3ETPA 1TVGA 3AZVA 3OOXA 4M01A 1UY1A 1UU4A 1VB4A 3PJYA 1RC6A 3U75A 1NXMA 4LO7A 5J96B 2SBAA 3M8LA 3MIEA 1AR92 4N53B 1QJU1 4H14A 1CX1A 3BODA 1O4TA 1YJKA 3E5QA 4G9SB 1ODMA 1WA4A 2A6XA 2OZ6A 1L7QA 5HI0A
chains in the Genus database with same CATH topology
2R041 2AYHA 2PLV3 4K1YA 3PJQA 2ARBA 4A3XA 1AYN2 1OKQA 2Z5WA 4IEYA 1QF3A 2X5IA 3N7MA 4QQOA 3W59A 3WDUA 4NHLA 4H7MA 2A70A 4R4ZA 4GA9A 4L92A 1QQP2 4AEMA 4UXAA 4ES8A 2WZPP 4RR3A 1D0GA 1F2NA 1FAYA 2BYVE 2VOVA 3AMMA 1H9PA 3H1WA 5K0UA 2ZGOA 5LK5A 4Y1YA 5KWRA 1YI7A 3IDCB 5CG8A 2GMMA 3TAYA 1JW6A 2CYFA 2MHFA 3ELNA 1PGL2 1J3RA 4E2SA 1HKDA 4JAAA 1YFYA 1COV2 1LGBA 1RUH3 1RUG2 1TQ5A 1F8VA 1KDKA 2IWGB 2RS11 1Y9QA 1O3QA 1H9WA 3H3ZA 1R091 3D0SA 4META 1AYM1 2WA4A 2WFF1 4BCUA 3ZSLA 2GAUA 3ZXJA 1HV1A 2DCJA 5D8AC 5FMOS 4Z2WA 5FO7B 2GNMA 4JCKA 2YZ4A 4XJ8A 1HRV3 1PZ8A 3KGZA 4AGRA 4YZ5A 1N3QA 2ENRA 2D3RA 5SV8A 4GMP0 5LEKA 4Y20B 4Q4W2 3NAPC 3GYDA 1GFF2 1WCKA 3VBOA 5JMCA 4CDWA 1OHFA 1OLRA 3FBMA 4Q0PA 1Q5OA 4NWWA 3ZFEC 1MEC1 1SLTA 2D6KA 2UY8A 2VOXA 4ASMB 1V9U2 1XU1A 1H1IA 4K40A 2YUEA 1GNZA 1R083 5DUVA 5EFUA 4EN6B 1LTEA 2R30A 4AQ2A 3OY8B 5DDJ2 2BUKA 3AXDA 5CIRA 3O14A 1RUD1 4FP2A 1CQ9A 3BOWA 4XJZA 2VW0A 1GV9A 2RHPA 2ZA9A 5CFCC 1DIWA 4RA0A 4MXWB 5SV5A 4LBQA 1GQHA 1WW7A 3QD6A 3MIBA 4P9JA 2KA3A 1KJRA 1SBFA 2YHJA 4IEOA 3IWZA 3I54A 1CN1A 2MEV2 1KS4A 2B45X 3I7DA 4HN0A 1WGPA 1LGNA 2CAVA 3ZXDA 2EVXA 2CTVA 4Q1PA 1FATA 4XF9A 2D3PA 2X8KA 4D7YA 2OW4A 1XNCA 3D4KA 2VNOA 1QOTA 3M3QA 3MIGA 4UBHA 4EJRA 2RMU2 1MS4A 1VBA2 2IZWA 4KG8A 5HCAA 4WZFA 1LGCA 4B4QA 3WP3A 2W68A 1DGLA 2X5IC 1OOPC 3NO8A 2YMZA 1B35C 4MH0E 1PK6C 1ND3A 3LA2A 3ZSEA 2XLGA 4RSUA 2B42B 4Q4X3 5FFOC 1C8NA 3WDYA 2A73B 2XG3A 4HMZA 1TE1B 3TNQA 1RUD3 2QZ2A 4HANA 4XHBA 2VOWA 1QU0A 1ZBE1 1JYCA 1RVF3 2Y26A 1NQDA 4AQ6A 1SEFA 3NV2A 4INDA 1HRI3 2VUAA 1ZZ8A 2R063 3GZAA 3RJ2X 3H0OA 4PIYA 1CX4A 2WINB 2PHDA 4MUVA 4JRLA 4M0NA 4PJYA 4Y22A 3P3PA 3WY6A 3GF6A 4TZDA 1KS5A 1BXHA 3WLUA 1ULGA 3DPRB 2H0BA 4NOTA 4YGBA 2NMNA 3E6BA 1K5MA 1RITA 2ZJCA 4AVCA 4MXWA 3VKFC 3DV8A 4ASLA 1S2BA 1O3RA 4LBNA 1NZCA 1OPMA 5FDBA 1GZWA 5CG9A 2A5ZA 2JG9A 4HT1T 1S2KA 4J1WA 3RS6A 2NLRA 1W6MA 1AR82 2DYCA 3IKWA 4EROA 3Q9OA 1J1LA 1DQ5A 3DF0A 2RS52 4IEWA 3PMEA 1Z78A 3TN93 1AYN1 4PDWB 3WQ0A 1RINA 4Q4W1 1LOFA 4FOYA 1XQNA 2VH9A 1OFNA 3VKLA 4YM2A 3VBHC 1HRV2 2GN3A 1ONAA 2JDZA 4FPCA 3AFGA 4XILA 1SMVA 4BWOA 2XGXA 4DRRA 2CGPA 1BMV1 1G86A 4KU7A 2H6CA 1XNBA 4Y20A 3RWNA 5E89A 2ETEA 1LCLA 5DG1A 3LKJA 4CDQC 3ME2A 2ZTNA 4PLOA 4S2DA 5ABJA 1YXWA 1RHI3 3VBSA 4DZGA 3RDIA 1JXNA 4NR1A 4BMBA 1RMU3 1DGWA 5JZGB 2VOKA 1ZX5A 4HKLA 3URFA 1VALA 4FCAA 3GBGA 4B4PA 4AVAA 2HWE3 3FMGA 1PO11 5I8YA 2ZS6B 5F6LB 1LESA 2BWCA 1H2KA 4QGNA 5HCBA 2ZGTA 4I01A 1UF2C 3AM2A 4XTPA 4E4SA 1Y7BA 4RHV2 3KZ4C 2RS33 3WZ1A 1GR3A 1WW4A 5J36A 4Q8LA 4FTSA 3HAGA 2X5IB 2WWSA 4FT8A 4Q4X1 4DOUA 1D4M2 3ZSJA 1MQTB 4WVVA 1AR72 4OLLA 1VB2A 5I0UA 2NN8A 5CB7A 4XW3A 3QACA 1ZYBA 5L7OA 1MS1A 3WR0A 2OZJA 1LODA 1CD3G 3BCWA 3AKTA 1D4M1 2IXKA 1FOD3 1BBT2 3EHKA 1ND2B 4O9GA 2R042 2TUNA 4E4ZA 1SBDA 3H1MA 2UWCA 1S1AA 3ZYGA 1LR5A 2HEYF 1VBC2 3B93A 1F5JA 4YZ3A 1PO12 2PAMA 5DG2A 5J48A 2R072 2XVLA 3JCIA 2RM21 1GNHA 1IKPA 2ZGQA 5E1RA 3WINE 3KGLA 1XYPA 3ROUA 1UL9A 3V0BB 1QJY2 1ASJ1 1S0DA 4WM7B 3POYA 5FMOL 3FUQA 1CPMA 1TMF1 4RQPB 1QJX2 3K48A 4Q1RA 4XE9A 1IHMA 1W6PB 2DCZA 3D5OA 5CAZA 4HFSA 1A6CA 1RUI3 1SFNA 4JGZB 4XFGA 3FC0A 4AHWA 1RMU2 3NV4A 3HN1A 4QPIC 1UIKA 3WW2A 1UIJA 4QQLA 2D6NA 2HWF2 4KWJA 2AUYA 1R1A1 1FOD1 2PHLA 2B7YA 4XQWA 2VVEA 3ILFA 2GC2A 3OJBA 1NA1B 3ZFFA 1H8VA 4FO9A 3CL1A 1WLWA 4FP3A 1X7NA 3FBYA 1AR81 2WNVB 1NE6A 1S0EA 3KS7A 3IIAA 1FNYA 4AVTA 1L3JA 4XBLA 4RQPA 1HQLA 4OFGA 5JSRA 4GH4C 5T55A 3VDDC 1CAWA 1KITA 4RGGA 1NLRA 3N36A 4I09A 2EXJA 4IEZA 1DZRA 1MVQA 4BZ4A 3I2DA 1BBT3 3IN9A 5DZEA 1IPKA 5JZGC 2BEOA 2A6ZA 2E7AA 4YVWC 1TEIA 4P9LA 5ACA3 2XWBB 3OGGA 2PAEA 1FMD1 4QPIA 1S0JA 4SBVA 4IEQA 3HT1A 2JENA 3AK0A 4BIOA 3ZN4A 2A3WA 1G9DA 1U5IA 3DL3A 2HJIA 4IESA 2P3IA 1W6QA 4ZU5A 3ZXKA 1MACA 1M4WA 2WA3A 1QNYA 3R0RA 2Y0OA 3U11A 3VDDA 1ENSA 3AMNA 2PHTA 2YV8A 4CTEA 4AW7A 1AL21 5K0UC 1QXRA 4I3PA 3AYEA 3MLKA 4IEVA 1VBB2 1V6OA 4RS5C 1VBD2 4AHXA 4RR3C 1MQTA 1IS4A 4SLIA 4AK3A 1QOOA 3VHOA 4HN1A 4FPEA 1RUOA 2DUQA 5H9QA 3FZ3A 1Q43A 4YGDA 3ZXAC 1XNDA 3JB4C 1FI2A 4JGYB 1VBB3 2P2KA 1QOSA 2XJQA 4CDXC 4OI4A 3LSEA 1QHDA 1G7YA 2WC2A 4COUA 5GJ6A 2HEVF 4LEJA 4WM8A 3JBG2 3ZYJB 2FBEA 2Y38A 2ZX2A 3B94A 1PZ7A 1V6NA 1AJKA 4OI0A 3CNAA 3AP9A 2O1QA 2ZX3A 1ENQA 3FE5A 3ILNA 3MZHA 1PVXA 3ZMOA 3GBFA 3MIDA 1EV13 1JH5A 4GIQA 4QHBA 1OI6A 2QCSB 2NZ9A 3OBRA 1H2LA 2YXSA 3NV3A 1AL23 4J6GA 4L97A 2QQPA 4YG3A 1WMDA 1MS8A 2NYYA 5DDJ1 3AMHA 3CF6E 1LOBA 3WNXA 4CYDA 3J8F2 5JOWA 3RNSA 1QXJA 4B29A 4HBNA 5CU1A 3KMHA 1PMIA 4XFFA 4XIKA 1VAMA 2PTMA 1IQAA 1QJX1 3JQWA 1MVEA 4QPGC 1Q3EA 4QQPA 3HBZA 1C4RA 2VQAA 4MGIE 2OA2A 4LTAA 2QKDA 4YLZA 1QXPA 4P9YA 3WHUA 4FSJA 4YG6A 1PGW2 1ZBA3 1BEV3 4HPKB 2ZAHA 4TLFA 1U5YA 3FUOA 5A3LA 4Q26A 4RHV3 4P9WA 2JEMA 4WBBA 4D3WA 4F83A 1GZWB 2XHKA 3U07A 1HXS2 1LHOA 1POV0 3OD0A 5K9YA 2XBO1 5IK8A 4FAGA 2BVBA 2EAKA 1GBGA 2NMOA 1K5MB 2FHRA 5EYYA 4ZU4A 5FLIA 2B8MA 2YPJA 2ZKLA 3DPRA 3NKGA 5JPMB 3WDVA 5IK5A 5FTTC 4ISRA 1XYOA 4AEKA 1NCRA 1G9FA 2WZR3 4L99A 3OF1A 4RGAA 1PVC2 4RS5A 2DVBA 2YDEA 4AI3A 1CAXA 5F9TA 2O8QA 5FOBB 3WX5A 4A7YA 5BUVA 2F4PA 3CJIA 4CDUC 2R0FA 4TSVA 4XYXA 4K6BA 3OYWB 5ACA2 4E2QA 4I30A 4BH9A 3AYAA 1C8M3 4DY5A 1GZCA 1G6NA 3OTFA 2PELA 1SACA 1WBLA 3AZWA 3MF6A 3M1HA 2UWAA 2R071 1ZREA 2XLAA 1RUH1 4YVSA 1BYHA 1RJ8A 4H7LA 5C33A 4YG0A 3KQRA 1DGWX 3HIFA 4AFBA 2C5DA 1CAUB 3MICA 4PLNA 5JZGA 3VBRA 1D4M3 2H0VA 1CJPA 2JX9A 3OD4A 5BPXA 3NV1A 4OZXA 1IZ3A 2ZGRA 1E57A 1MS5A 3GNEA 4IL7A 2ZX4A 1HXS1 1C5IA 1QGLA 2OPKA 1JOJA 5KHIA 4PF5A 1GKBA 2GH8A 4Z07A 4OHZA 1ND3C 4FOWA 2ATFA 4LHNA 4FPKA 4XETA 1R1ZA 5I0TA 4XPVA 3LOBA 1MS9A 2P3KA 4RHV1 1XXNA 2BNMA 4L2NA 3ZXLA 5JI7A 4PIZA 1VRH1 4LA3A 3ILRA 5T5PA 4FTEA 1RUF2 1REDA 3OY8A 1PIV2 1G9BA 3S0MA 4X8NA 4AVSA 1C8M2 1RUD2 4WVZA 2ET7A 4NWVA 1TME3 2UU8A 3DN7A 4XF3A 3RI8A 4HVQA 2VG9A 1SCRA 4YNIA 3ASIA 5JOYA 3VUOA 2WNUB 1ULEA 3E97A 4Q2FA 4Y1VA 3PMSA 3MEPA 1O7FA 2FZ1A 1W6NA 1ULDA 4N7IA 4QPYA 4CDWB 3CJIC 4BYYA 4CDUA 2WS92 3SNMA 2ZGLA 5K7PA 2HWC2 2RMU3 2WNUA 4GMP3 2VVDA 1TME2 2A6WA 4K9SA 2YY1A 3TN92 1PK6B 5L19A 3D6EA 2R49A 1NCRC 1GQGA 1JUIA 1OOPA 5I0SA 4GQ7A 3ZIWA 3THPA 1V6IA 1UKRA 3T2TA 4LBQD 1MS0A 2D5FA 1OPOA 3RI9A 4YGEA 4FQZA 3VBFA 5GZGA 2BPA2 3VBOC 1CONA 1RUJ2 3N7LA 3KCYA 4N90A 4Y24A 2HWB2 4AGVA 2XBO2 4YVSB 5BYNA 3JD73 1FPN2 1O91A 4HLTA 3CU7A 4TYSA 4XDQA 3WW3A 3WQ7A 1NY72 2SLIA 2XBO3 1W6OA 2QNKA 3BTAA 4N43C 4YZ4A 3ZFGC 4S2HA 3SMHA 1YYNA 3RZZA 1QQP3 1YRZA 3CEWA 1YFXA 5CFCA 3FWEA 1UU5A 2BBVA 1WLTA 2R32A 3KSCA 3WOGA 4K3UA 4QPGA 5C8CA 4IERA 1A78A 1CAXB 2Z2SB 1GYKA 1RVF1 1SFYA 1QY4A 1ZBE3 4KNCA 4M3CB 4KGQA 4BQ1A 3TOJA 1DYPA 2ZGUA 3AKRA 3VBHB 3BB6A 3MGUA 1BCXA 3N7JA 5F5QA 2GMEA 3OYWA 4KWKA 1LRHA 4HSLA 1LB2A 2D97A 2Q5TA 1HLCA 3AXEA 1W2UA 1NY71 1LOGA 4FOQA 3S7EA 3UV9A 3VGIA 4NPRA 2BVVA 3J9SA 3ES1A 1WLDA 4N53A 2E53A 4XZPA 1DF0A 3JQXA 1V6KA 1S0IA 3BIWE 4HPKA 1MZ6A 5FLJA 1LOCA 1DFQA 4YFWA 1FYUA 3WCRA 2LUWA 4CDQB 2VMGA 3WUCA 2BTVC 1ENXA 4AF9A 2K9ZA 3ZFFC 4AG4A 5E88A 2HWF1 5BNPA 3A4UA 3RSJA 5IT6A 5DDJ3 4XOGA 5FO8B 2WQZC 3RYKA 4KWLA 2X29A 3ALQA 5IK4A 2ZPXA 1JTZX 1J3QA 4ATFA 3PHMA 4C0HA 4FPYA 1WLCA 2DF7A 2OUJA 3I4IA 2DFBA 1RUI1 5JIAA 2ZOEB 2I74A 5EWSA 3WG4A 1LHVA 2VW1A 3AX4A 1C5HA 1EAH2 3U0ZA 3K51A 3PNAA 1ZA4A 4I0BA 4YZ2A 3MF9A 3A0NA 1UAIA 1FMD3 2RS12 3MLLA 4XFBA 1OMIA 2ERFA 4NHKA 2CY6A 4IEPA 4MGZE 3ZMNA 1MZEA 2D98A 4GWNA 4P14A 1V6LA 1AX2A 4RL7A 1AUYA 4R4XA 4LBJA 4DXZA 5K8SA 1O4ZA 3IBMA 4LR4A 2W52A 3M2MA 3SCGA 2IFRA 1Q8QA 1DU3D 4XJ9A 1QQP1 3EJKA 1R1A3 5BNOC 4BE3A 5KHGA 1B35A 4QD2A 3OPZA 1PM7A 1HXS3 4Q4V3 2A75A 4BLJA 5C9AA 4W6WA 4JGYA 3VHPA 2UWBA 3MI8A 1RUE3 5C4WC 2R1DA 2OYZA 3TBDA 3ZSMA 3VBUC 1ZZ7A 4W65A 4R8HA 1H4HA 1G8WA 4JGZC 1O5LA 1X8MA 1H30A 1XYNA 4M3CE 4AQSA 4QPIB 4OI2A 1M06G 4Q4Y1 1H8TA 3CLPA 2ET1A 3BU7A 2R073 4KBBA 2V5YA 5LRSA 1TNFA