5KXDA

Wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
238
structure length
238
Chain Sequence
b'KETTSFVFTRFSPDPQNLLLQGDTVVTSSGHLQLTQVKDGEPVYSSLGRALYYAPIHIWDSNTDTVANFVTSFSFVIDAPNKAKAADGLAFFLAPVDTEPQKPGGLLGLFHDDRHNKSNHIVAVEFDTFKNSWDPEGTHIGINVNSIVSRKTISWDLENNEVANVVISYQASTKTLTASLVYPSSSTSYILNDVVDLKQILPEYVRVGFTAASGLSKDHVETHDVLAWTFDSDLPDPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wisteria floribunda agglutinin
publication title Molecular Basis for Recognition of the Cancer Glycobiomarker, LacdiNAc (GalNAc[ beta 14]GlcNAc), by Wisteria floribunda Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 52
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kxdA00
1LHWA 1NLSA 1SLIA 1FATA 1DHKB 3OY8B 4ISQA 2AENA 3WUDA 2E53A 3WG1A 5E88A 2EXIA 5EYXA 2R0HA 2UWAA 2ZMLA 3O0XA 1G9DA 2ERFA 1J1TA 1ULEA 2R1BA 4Q2FA 1MR5A 1MS5A 2A7AA 2CWSA 5CA6A 3BOPA 4YG0A 4YFZA 1LOAA 1Q8QA 2CNAA 4NO4A 5DG1A 4XIOA 3RS6A 4PQ9A 3WCSA 4BQ1A 3ATGA 3RMXA 4ASMB 2ES3A 1DQ2A 4DRRA 2YZ4A 2GMMA 5KXCA 2PHXA 4ISRA 3UJOA 1FNYA 2JDZA 2W52A 4BPZA 5IT6A 1F31A 3ENRA 2HYKA 3T1MA 1SCSA 2A6ZA 2V5YA 5GZGA 1ULFA 2OUHA 3AP7A 3MEPA 1JXNA 4YGDA 1S0FA 1DQ1A 1VAVA 3WVJA 3NWKA 4PBOA 1G9BA 4ITCA 3RSJA 1GICA 1LOFA 2DVFA 2GALA 3ILRA 1QOTA 1LOEA 1SLAA 3WG4A 4YZ2A 3OPZA 3AX4A 3V0AB 3WDYA 2ZHMA 1JW6A 4YGEA 4FPYA 5CB7A 4DQAA 2FMDA 4FQZA 2B7YA 3SLIA 4AVTA 1URXA 2E51A 3WCRA 2PHUA 3C2UA 2AH2A 4DPNA 3AZWA 1CONA 1AXKA 2H0BA 2JKBA 2R49A 5L73A 3WV6A 1LHNA 1DQ5A 2ZGPA 3FBYA 4XJ9A 2W39A 3AK0A 3VKMA 3BTAA 2D6MA 4PCRA 4GXLA 1BJQA 2NN8A 1WLWA 4XDQA 3LCPA 1MVEA 4AGVA 1KJRA 3OBTA 2WJSA 1IKPA 1QDOA 1N1VA 3IKWA 1LULA 4WZFA 3USUB 2ZGKA 3POYA 2W68A 1UKGA 5T5PA 2P2KA 2EALA 4UW5A 3VKOA 1B09A 5IK5A 2WNEA 3IN9A 4FPHA 4XBLA 5H9PA 4BOWA 3AXDA 4FP3A 3IM0A 1ENSA 1LHVA 4XJUA 1S1AA 4YZ1A 2CY6A 2EXKA 1G8WA 4YM3A 1HDKA 1MS1A 1S0CA 1VAMA 4Q8KA 3A0NA 4CRQA 2NM1A 1WLCA 2YY1A 5E8AA 2BQPA 1LENA 1V6JA 1ULDA 1N3QA 1I1EA 4AGRA 3B3QE 3PJQA 3M3EA 1CIWA 3ZSLA 1MVQA 1JOJA 3SH3A 1GV9A 1BYHA 1GNZA 5GZEA 2ZGRA 2GNBA 1H30A 3RMYA 1N47A 2VW2A 2D6KA 3PVEA 4TYSA 1OKQA 5HCBA 4BLJA 1DFQA 2G4IA 2GNDA 2UURA 2YV8A 4Y24A 1KRIA 3PVNA 4XMAA 1Q8VA 1YRZA 4GWMA 4R9AA 4XXPA 1S0GA 5GZCA 4NOTA 1V6LA 3WNXA 2P34A 4FPLA 1LHUA 1C57A 1AX0A 1SACA 1SLCA 5EXOA 5BYNA 2CL2A 1MS4A 4AVSA 2A3WA 2ZGLA 1MS3A 3OYWA 4YZ3A 4RL7A 3O0VA 2FHRA 3WLUA 1G7YA 1WD3A 2UWBA 3UK9A 1LECA 4L8QA 4CZSA 2A6YA 2GN3A 2GNMA 3GALA 5F9TA 4P9XA 2Z42A 5GLUA 1RIRA 2PELA 1SLLA 4FPKA 1VLNA 2DWRA 1U0AA 2OUJA 5FREA 3ZSMA 3WOGA 2ZKNA 5FRAA 4FPEA 3H0OA 5H9SA 1PZ8A 3FLTA 2ZABA 1H9PA 3M2MA 3RQ0A 2JJ6A 4LBNA 4K1YA 1JUIA 1EPWA 1MACA 5GJ6A 5GM0A 1UAIA 3FFZA 1OQ1A 2EXJA 4K1ZA 4MYEA 1UX6A 2I2SA 3LSEA 3GNEA 2YMZA 4WVVA 2A75A 1Q8SA 2EXHA 4JC1A 3AZZA 3RG0A 3AYCA 1Y7BA 3ILFA 1AX2A 3N3HA 1WW4A 4YM0A 5T5OA 4XIKA 3VKFC 3VV1A 2D3RA 5IK4A 5IK7A 3N7JA 5HCFA 4AVVA 1CJPA 4XJAA 2ZGTA 4YW2A 3AXEA 2VH9A 3R05A 4YGBA 1G9AA 3N7KA 1V00A 2GNTA 4M01A 5GZFA 1YXWA 3ZPYA 1QF3A 2DVAA 4XBNA 3W59A 3O5SA 1N1TA 4XJZA 3SITA 2D6NA 1LHOA 3HN1A 4Y22A 1ULCA 1WW6A 3N36A 5JOXA 3OYWB 3UJQA 4Q1PA 1IS3A 4Y26A 1LCLA 1UL9A 1CVNA 1UPSA 5T52A 1W0PA 2XG3A 2NMNA 1W6MA 1AF9A 2ARBA 2NYYA 2WLQA 3ILNA 1YYNA 4YM1A 3T2TA 1W6NB 1SBFA 1AJOA 1KDKA 2E7QA 1DZQA 4I30A 2CWMA 2R1DA 4YZ5A 2DYCA 1C1FA 1KDMA 3AYDA 4JRAA 3AP6A 4XE9A 2ZGMA 1LEMA 2WT2A 4SLIA 5AVAA 3ZSKA 2ZZJA 4LBMA 4CTEA 2PHWA 1S0BA 1RITA 3KQRA 4WV8A 2EAKA 4FOYA 4FPCA 2ZACA 1W6PA 2OW4A 1UZZA 2ZMKA 2D3SA 4K21A 2OVUA 3INAA 1O4YA 2YXSA 1HLCA 3M3CA 5SV8A 1F9KA 2GMEA 5KXDA 3ZVXA 3QLQA 1JN2P 1MS8A 2D6LX 3AP5A 4Y1ZA 2JECA 4UW6A 4Y20A 4LBLA 4YW4A 4LBOA 3V0BA 1CQ9A 1UMZA 2E6VA 2VY0A 1SBDA 4FPOB 4FP2A 5JOWA 2EF6A 1WBFA 1W6OA 2D6PA 3MW2A 4ZXKA 2A71A 3N7MA 2D44A 1IOAA 1LGBA 1GANA 1S0DA 2ENRA 2P3JA 2ZHLA 4Q27A 5CBLA 4GALA 4C1WA 2R0FA 5IK8A 1G9CA 1FX5A 4Y22B 2A70A 4XILA 5T5LA 4LBQA 2D6OX 1Q8PA 2R16A 3IPVA 2ZA9A 5IUQA 2KM2A 1SLBA 2DV9A 2WQZC 1QOSA 3IMNA 3WDUA 5E89A 2LTNA 1AJKA 2DU1A 2AREA 4DRVA 1LGCA 3D5OA 2PHFA 1ENRA 4UW3A 1WBLA 2SLIA 2AGSA 4GKXA 1DIWA 1S0JA 1DGLA 3Q9OA 4XJWA 2JE7A 2DUQA 5HCAA 1MS9A 4YZ4A 1CESA 1QGLA 3WG3A 2UU8A 4FVVA 1G86A 4ZKTB 4Q26A 3ZSJA 1V6KA 3ZXEA 2LALA 5H9QA 4W65A 2ZHNA 3V64A 2D3PA 3OY8A 1FV2A 4D69A 1C1LA 4YW5A 3V65A 3RRDA 1X50A 4XYXA 2ZGSA 5H9RA 1HKDA 3HR9A 5DG2A 1AZDA 1VALA 2YROA 1GSLA 4WVWA 1CR7A 1WUVA 2PHTA 4Y20B 2VXRA 4YFWA 2GN7A 5LK5A 1BXHA 2A5ZA 4M3CE 3M1HA 2NZ9A 3OGGA 1N1YA 3ZXJA 3ASIA 2ZBJA 3OBRA 2DVBA 3B01A 3NV1A 4XBQA 5GZDA 1W6OB 3TAYA 4YGCA 5JDBA 1ULGA 2CYFA 2DUPA 4H55A 1RINA 3POWA 1MZ5A 1Q56A 1QOOA 4M3CA 5JOYA 3WG2A 3T1LA 4Z8BA 2WKKA 2NMOA 1GBGA 3BODA 3APBA 3R4SA 1JYIA 1V6IA 2GDFA 3FUQA 1IS5A 2ZGQA 3AJZA 1JYCA 4XTMA 5DXDA 1A8DA 1GKBA 1N3OA 2AYHA 2CTVA 5DUVA 4YW1A 4IQPA 1FV3A 2DURA 4FOVA 1G9FA 5GALA 1DBNA 2A3XA 3SH5A 3ZXKA 1D2SA 3O12A 1LGNA 3AYAA 1WLDA 3WDTA 4YLZA 3KM5A 4XTPA 4XHBA 4Q8LA 4HANA 5EWSA 1QU0A 1GZWA 2P3KA 5KXBA 4HL0A 5DUUA 1LJ7A 4DFSA 3ZYPA 3WDXA 1UN1A 2ZMNA 4GWNA 4LBKA 1MS0A 5GLTA 1V6MA 4F83A 3V0AA 5JOZA 1PZ9A 4R9BA 2PHRA 3B69A 5JVVA 4M00A 1QNYA 1AX1A 4Y1UA 1LU1A 3NV2A 1IS4A 1ONAA 1F5FA 1WW5A 3UL2A 1TEIA 3I4IA 4YG3A 4YW3A 1DLLA 1ZM1A 1H9WA 4JCKA 4R9DA 1MZ6A 1LOCA 2JD4A 2ZHKA 2TEPA 3AYEA 1AXZA 4U36A 3WDWA 5GLZA 5GLWA 1DQ4A 3AZVA 2DU0A 3FUOA 1QMJA 1LOFC 5F5QA 2VU9A 1APNA 1SFYA 3OJBA 4FOQA 4LBQD 3AJYA 2A6WA 4FPJA 4M3CB 2P37A 3N35A 5DZEA 3USUA 1S0EA 1HQLA 1LODA 3VUOA 3AZXA 1ENQA 3HMYA 1S0IA 4BMBA 1DYKA 2ZGOA 2ZGNA 2ZGUA 3LSDA 4KBBA 2D7FA 4XOGA 2VW1A 2DTWA 4PBPA 1LU2A 3FLRA 5DUXA 1YI7A 1NXD1 4BLIA 1CPMA 1GZWB 1V6NA 1W6QA 1GLHA 1GNHA 1Z78A 2DUOA 3O0WA 4FPGA 4XXAA 1AVBA 5CNAA 1AXYA 1KQRA 4YM2A 3N7LA 1DQ0A 3WHTA 1A3KA 1GYKA 1UZYA 3I8TA 4Q1RA 4XJ8A 5T54A 4U2AA 2DVGA 1SCRA 2W08A 3ZXFA 1R1ZA 4BMEA 3DUIA 1Q8OA 2P3IA 2RHPA 1LEDA 3SH4A 2WT0A 4FOWA 2ARXA 3B00A 1DYPA 1YIFA 2C5DA 3U4XA 4BM8A 1LOBA 3MW4A 1KJLA 3CNAA 3WUCA 3AP9A 3MPPG 1WCSA 3W58A 1Z0HA 1W6MB 4R9CA 4AWDA 1HQWA 1LOGA 1YO8A 2ZAAA 4P14A 5JLVA 2DTYA 3R4UA 4GA9A 3DGTA 1FYUA 3MW3A 1XQNA 5T5JA 5DZGA 4XZPA 1N1SA 2AR6A 4P9WA 2A6VA 2JE9A 5JMCA 2GMPA 5CAZA 3A0KA 4UW4A 4Y1VA 5DUWA 3POSA 3VKNA 4XMIA 1JHNA 4YG6A 4OZXA 1LTEA 1QKQA 5EYYA 4DS0A 1C4RA 2V73A 3QCWA 1BQPA 1W6PB 4C1XA 3L2YA 3FLPA 2A3YA 2EIGA 3SNMA 5DZFA 1V6OA 4XHXA 3WDVA 4ATEA 1W6QB 3PVOA 2Q5TA 3WHUA 1N3PA 3D4KA 3PMEA 2DVDA 3ZXLA 4LBJA 1QNWA 1FAYA 1IKQA 3V0BB 1WD4A 4K20A 5T55A 3AFKA 4ATFA 3NV3A 2E7TA 2AUYA 4TZDA 2C9AA 1O4ZA 3TB0A 1GZCA 1SLTA 3M3QA 3SISA 3ZYRA 4AGGA 5KXEA 3VKLA 2NP0A 1D0HA 1LESA 1CPNA 3WZ1A 3NV4A 4RA0A 1ZA4A 4FQ4A 5T50A 1GZ9A 3B9CA 3JUUA 4LBQB 2XB6C 4Y1XA 3IPVB 5GLVA 4PF5A 4FPFA 1I3HA 1QDCA 3JU9A 2UWCA 1OFSA 1SBEA 2VW0A 1KITA 3BIWE 2WSUA 1W0OA 3D6EA 4M3CF 2WSVA 2WT1A 1A78A 1BZWA 3AP4A 4AYUA 3M3OA 4P9YA 1DQ6A 2VUAA 1BKZA 2A6XA 2SBAA 2D43A 1W6NA 4GKYA 1CN1A 1WW7A 1JBCA 4Y1YA 1FNZA 3AZYA 1IS6A 3A4UA 1PZ7A 1VIWB
chains in the Genus database with same CATH superfamily
1W3VA 1CZSA 1E5SA 5EHDA 5J36A 2R041 3WW3A 1ND2A 1W0NA 4COVA 3D0JA 5EYXA 3MI8A 5FY8A 1R082 2R0HA 1PIV1 1VBC3 2ET1A 1DLCA 4HG6B 4QPGA 3FHAA 1PGL2 2ZMLA 3AMHA 3O0XA 5ERLA 5LRRA 1OD3A 1E57A 2JDHA 3X29B 2V09A 1MR5A 3EJKA 1DYOA 1MS5A 1OVPA 3RI9A 5CA6A 1REEA 4YFZA 1Q8QA 2CNAA 4WBBA 3UGHA 4BXSV 3VD5A 3ATGA 1FMD3 1VBA2 5JAXA 2VGDA 4DRRA 2YZ4A 1AL21 4D3WA 5JPNB 2Z79A 3QOPA 4ISRA 3UJOA 2B46X 2JDZA 5LEKA 2B42B 4NPLA 3U10A 1F31A 1PVXA 5CEHA 5CADA 4GB31 4BISA 4L11A 1RUJ3 3KHCA 2V5YA 5DPNA 1QJU1 3ZIXA 5M0TA 5C8CC 3AP7A 3HNBM 3JB8A 4YGDA 2JB4A 5FO7B 1D7PM 4RS5B 2ZX3A 5I8SA 5EJ3A 4JVAA 4LMFA 1VAVA 2Q8OA 2OX0A 4JQTA 2OIIA 2XJSA 2RM22 3O14A 1H0BA 1AR83 4TWTA 1QOTA 1L7RA 3WG4A 1SLAA 3R6SA 1OXCA 2IXCA 2R062 1W3XA 1VBD3 3TOJA 3WDYA 5ISLA 1JW6A 3CKHA 2PFWA 4YGEA 4JX0A 1ZRCA 2CHHA 2D5HA 3KZ4C 2B7YA 2FQPA 4B7EA 1YFWA 3EQEA 3SLIA 5C8CA 3CO2A 4XF9A 1BK1A 2ZX0A 4DY5A 2FCVA 3WF3A 4F8AA 1URXA 1QJX3 2E51A 5JR2A 1I6XA 1PO21 2X09A 4FTSA 2RS12 4AHZA 1ZX5A 3POBA 4XUPA 3SCGA 5JXHA 2W47A 5T3NA 1OOPC 2KR2A 5ABJC 5L73A 2PTMA 3WV6A 2ZGPA 4XJ9A 5JZGB 1JS9A 3J4UH 4MOAA 2BNOA 2Y60A 4N53B 4GXLA 1KGYA 1BJQA 3LOBA 1RMU3 4YARA 2HWD3 3NSTA 3OBZA 3PUSA 5IFTA 4D6RA 5C5UA 1IPSA 4WM8C 2YBSA 3FC0A 1C5IA 1RB8G 3IKWA 1E5IA 2W94A 4WZFA 2ZGKA 4QX7A 2EALA 4UW5A 4PIZA 1UU4A 2PN5A 3VKOA 3IN9A 5IK5A 4XBLA 2HWB2 4M0HA 1IHMA 5FPZA 5FYYA 3SHRA 3GYDA 1ZZ9A 5ABJA 1ENSA 3VDDB 3GHMA 2QJVA 3ACIA 5HXVA 2EXKA 4A4AA 1BVVA 2X53S 3MFAA 4I09A 2CV6A 2DFBA 1VAMA 4Q8KA 2BGCA 3A0NA 4CRQA 5A7SA 4IERA 4WM8A 1ACCA 1LENA 1V6JA 2XGXA 3Q8BA 3H3UA 4I2OA 5FP4A 3I2GA 3MDPA 2ORXA 2VUJA 3ZSLA 1JOJA 2CSGA 1AR62 5GZEA 4AI9A 3PVEA 4QXBA 5HCBA 1DFQA 2HWF3 2ZKLA 2C0ZA 4OHZA 1Q8VA 1YRZA 2ZS6B 1GFF2 2Y34A 5FY7A 2BNMA 1UW8A 4NOTA 1UY0A 2P34A 2VMCA 3RZZA 1LHUA 5FO8B 5A1AA 4EYUA 4BQ3A 2I45A 4AQ6A 3IIIA 3KT7A 5LZ6A 1FPN2 2DF7A 2ZGLA 1MS3A 1REFA 2WWUA 3QH7A 3VB9A 3WSOA 1QH6A 3FWEA 4NHXA 3O0VA 4WVZA 2WR9A 3ZX7A 5FZ8A 3WLUA 1OVSA 2A73B 4NWWA 1RUG3 3UK9A 1LECA 2WL1A 3B7MA 3U0ZA 1VBC1 5IYYA 3KCYA 5GLUA 3A7QA 5ABJB 5J37A 1WMDA 1VLNA 2VUCA 2GC0A 1ZRFA 2ZPXA 4DXRA 4URTA 3WOGA 3I49A 5FRAA 5FPBA 3FZ3A 4LO8A 3EMRA 1PZ8A 2XWBB 2ZABA 2YBKA 2ZCWA 3FLTA 3RQ0A 4QX1A 3CIHA 2BWAA 1HXS3 5DDJ3 1FMD1 1X8EA 2YPJA 2BZDA 5GM0A 4WM8B 4BE3A 1UMIA 3WD5A 1UX6A 2I2SA 1VRH3 2YMZA 1CAWA 2EXHA 1H4GA 1Q8SA 2A75A 3KVAA 4JC1A 4ET7A 5ACA3 3AZZA 2BP6A 4LE4A 5FMBA 5T5OA 1WW4A 3OPWA 1RUJ1 3T0AA 4A6OA 5IK7A 1QJEA 5FYBA 5HCFA 4AVVA 4COUA 4ZU7A 4CEWC 2ZGTA 5A32B 1QY4A 3R05A 1V00A 1ZZCA 4KU7A 3H1WA 5GZFA 4NN0A 5FZFA 1MQTC 3W59A 1N1TA 4N9HA 3OUHA 3SITA 2VCMA 4Q4X2 1AR81 1LHOA 3HN1A 3VBSB 2R073 4Y26A 1SPPA 1TNRA 4E2QA 1CVNA 1QHDA 3E1F1 4E4HA 3GBFA 1O3RA 3UESA 1VBD1 1W6MA 3ZKUA 2NYYA 1RUI2 1YYNA 3IZOA 5KHJA 1UOGA 4YM1A 1Z7S3 2MEV3 4MGZE 2QFEA 1KDKA 2QQPA 4CEWA 4I30A 2R1DA 2XJPA 2Y6FA 2QUOA 1KDMA 3KCCA 5CU1A 5EZWA 1QJX1 5FKCA 2ZGMA 2VOTA 2WT2A 2Y38A 4SLIA 5AVAA 3K3OA 1OQEA 1NYWA 1W9YA 2AEZA 4LNVA 3GHNA 4COWA 1MQTA 2PHWA 1S0BA 1RITA 1LKNA 5IVJA 1X8MA 2EAKA 4LIVA 2ZACA 3UGFA 4CUGA 1GOFA 4HPKA 3MIHA 5A6XA 1RXFA 3J26N 1HLCA 1UMHA 5SV8A 5IHRA 2HKXA 4QKBA 1RMU1 3QLQA 1JN2P 4MXVA 2HWD1 2XHNA 4GJZA 1JZ2A 4DZGA 2E32A 4Y1ZA 3VZKA 1CAWB 4HKLA 4UW6A 3UKNA 3CQOA 4LITA 4LBLA 3WF2A 2XQXA 4MLOA 2VZUA 5C3QA 5LCWL 3ACGA 2E6VA 1YHFA 4DY3A 2QQJA 4P5HA 3NNLA 5BXXA 2EF6A 4KMQA 3SCHA 3H8UA 4OHVA 4BB3A 3C7OA 1IOAA 4NROA 2ZHLA 3AKQA 4K9SA 4Q27A 4AI3A 2Q1ZB 5JPMB 2R0FA 1G9CA 1F15A 1UOBA 1YJLA 4W50A 4XILA 5DQ0A 5JR7B 1OPOA 1VPHA 1GP6A 2D6OX 1SPPB 2Z2SB 1C28A 4XACA 1EY2A 1RXGA 2DCJA 1QOSA 1WCKA 3POFA 4O61A 5A7PA 2QQIA 2VQ0A 3A21A 2RS53 1XU1A 3WP6A 4QD2A 4AXOA 4QDRA 4XFBA 1H2KA 1KFXL 2R32A 5I0TA 1F5JA 4CEWB 3AKTA 3VDCA 1H1AA 5DMYA 2HWC2 2PHFA 4FXKB 2WS92 4UW3A 2VVEA 3Q9OA 4RQPC 5I0UA 1ZZ7A 1CAXB 2BUKA 5F6LB 2HWF1 4QX3A 1MS9A 4W6WA 5BY5A 5HCAA 4J6GA 1CESA 1MQTB 4FVVA 3ZSJA 3ZN5A 4YVWC 2GC1A 4HPKB 5FK7A 1FV2A 1DZTA 1C1LA 3NJVA 4YW5A 3V65A 4COZA 3ZFFA 3RRDA 4D69A 1X50A 3ALQA 4XYXA 5JIUA 5L9VA 5H9RA 3HR9A 5DG2A 1YQ2A 1AZDA 3N9LA 4WVWA 1GSLA 4LKSA 1W99A 4YRDA 4PLOA 3MLJA 1VBE2 2GC2A 2PHTA 2XBO3 3ZPOA 3POGA 3DF0A 1QWRA 4LHNA 1RUG1 4LO6B 4AVBA 5J48A 4XUNA 4RQPA 3OGGA 1RUH2 4QX8A 3OGVA 2DUPA 1RINA 1CZTA 3E6BA 1QOOA 2XVGA 3BOWA 3HEIA 3T1LA 1GBGA 3R4SA 1HXS1 3IDEA 5DDJ1 1JYIA 1IS5A 3H8XA 4I01A 4NVPA 4S2DA 1O4TA 2Y26A 5EQUA 2BU9A 1GKBA 1N3OA 2CTVA 3ELNA 3DV8A 5DUVA 3VD3A 1FV3A 1VRH1 2BWCA 1G9FA 5GALA 5C5TA 5ACA1 1UOJA 5FLJA 3ZXKA 4E2GA 4LA3A 4AHWA 3O12A 1RHI3 3WDTA 1OLME 4DUVA 2WNVC 4XHBA 4QWNA 2PLV2 3O1OA 1I5PA 1QU0A 1GZWA 1WWYA 3I97A 4XF1A 2BTVC 5IVVA 5KXBA 5DUUA 5JSPA 4NIDA 4C8DA 1UN1A 4LBKA 3THTA 2F4LA 3CJIC 3QH6A 4HKWA 2GC3A 1EUUA 3NNGA 2R7EB 3ZXDA 4UT5A 1NZCA 4LE3A 1M4WA 2QKDA 3THDA 4F7ZA 2CDPA 4R9BA 1ZRIA 3ZFFB 1J58A 1QNYA 2MNGA 2R071 1YLLA 5L9BA 3KGZA 4Y1UA 4PDWA 1NUKA 1WGPA 5AFEA 1IS4A 1RUD3 4MZUA 1US2A 1WW5A 3OPTA 1PK6B 1Z7S1 2MEV1 3TEYA 2WNVA 1H9WA 2OPWA 1H8TA 1ND3C 5C4WC 4UFIA 2JD4A 2ZHKA 4RQPB 4AR2A 5F3EA 4I02A 5FCCA 2Y0IA 1UYYA 3WDWA 3CJIA 3K51A 1DQ4A 5GLWA 3AZVA 5IATA 1M06G 3OF1A 1APNA 1SFYA 3OJBA 1LB2A 3AJYA 3B02A 4FCAA 4UFMA 4D6SA 2E31A 2EAAA 3O1VA 3LZZA 2DBNA 3JQXA 3I59A 2VZ1A 4BWOA 2OKXA 3AZXA 4EROA 3VUOA 1UWWA 1ENQA 2J22A 3HMYA 1S0IA 3HPNA 5FXXA 4XF4A 4KBBA 3B9IA 4XOGA 1ND3A 3AKRA 3POIA 5C4WA 1RVF2 2YGMA 2XWJB 4YW6A 4B1MA 1YI7A 5FZ1A 5JXGA 4Z07A 1PNGA 1GZWB 3QACA 1TE1B 1UD1A 1WCDJ 4UOJA 2RV9A 4FPGA 4NWVA 4Y3OA 2WFF2 2HH9A 3N7LA 4OCTA 1HRV3 2O14A 1U5XA 3NJXA 2XR4A 4XJ8A 5T54A 1J3PA 2DVGA 2XMLA 3FMGA 1SCRA 3OB8A 3WF4A 1QQP2 2X29A 2IVIB 4G3YC 4KNCA 1LEDA 3SH4A 4PDWB 1R093 3VBUA 4LHLA 3N4MA 1XSQA 1YIFA 3POEA 3U4XA 2RS51 4RFRB 4LHKA 3I3BA 1H8TB 1UXZA 2JIJA 3AP9A 3WUCA 3WR0A 3KCXA 4QPYA 4AWDA 2RDQA 1HQWA 1YO8A 2ZAAA 5JLVA 3O1SA 4QM8A 3R4UA 4GA9A 4IUGA 1G6NA 1FYUA 4JTOA 3MW3A 2VTXA 1XQNA 4CE8A 4UBGA 3N9OA 4W6XA 2QQKA 1N1SA 5HV0A 1OLQA 1HV1A 4AEKA 2A6VA 2GH2A 5JMCA 5I8TA 1PVC3 4M0NA 2J1AA 1QIQA 4Y1VA 5DUWA 5AC93 3POSA 4HLTA 4TSVA 4UF0A 2BBAA 4JDMA 5BNPC 2K46A 4IEYA 1LTEA 1X36A 2V73A 3A23A 4AI0A 3QCWA 1W6PB 5FZGA 2XBO1 2YC4A 2W1QA 5C4WB 1RUNA 1YC61 3WNLA 2EIGA 3SNMA 1DGWX 1V6OA 4ATEA 1OA3A 1QXPA 4XZUG 2IXHA 1EPZA 1JUHA 2Q5TA 5I0SA 2QQWA 3D4KA 2PHDA 3PMEA 1FXZA 2DVDA 2IXLA 4LBJA 4PIYA 4N7UA 4A3ZA 4C0BA 3JD72 4CU9A 4BHPA 1HN0A 1WD4A 5FJKA 2IZWA 4EJRA 3FHQA 4ES9A 5FQ0A 3V0BB 3RZMA 2C9KA 5J96B 1WLTA 5BNPA 1O8SA 1F8VA 3U75A 2WAOA 2FCTA 4GULA 4A7YA 1GZCA 4QB6A 4W6YA 1BEV3 5G04L 3VBUB 2X5IB 3J9SA 4DNYA 3NV4A 1ZA4A 3M70A 4FQ4A 4MVTA 1QXRA 1RHI1 2VNGA 2YFZA 2ZAHA 3KD4A 5G05L 1I5ZA 4FPFA 2VOWA 2QDRA 1W9FA 2VBPA 2UWCA 5F5AA 1OFSA 1SBEA 4HSJA 5A3LA 1W0OA 1ZBA2 3H50A 5FZMA 1A78A 1BZWA 1W06A 2D5FA 2YGLA 3M3OA 4MXWB 4P9YA 4AYUA 4CU7A 2YDEA 1DF0A 4OUMA 4E9KA 5JI9A 4XQ4A 4JKLA 1NT0A 2JG9C 4OI4A 4XPVA 1WW7A 1JBCA 2OT7A 4XW3A 4B4QA 3ON7A 1FNZA 3JBG2 2B39A 2ZGNA 3W21A 1RUD1 1PZ7A 2VVDA 1NLSA 3LF7A 4UBHA 3BPZA 1H1MA 3OY8B 3GCXA 4AQSA 5DAXA 3WUDA 3ZLIA 2E53A 4CCLA 4XFGA 2EXIA 3VBFC 2UWAA 4KBZA 1NLRA 1Q43A 3JB4C 4TN7A 2JWPA 2VNRA 1JI6A 1AUYA 2IUWA 1J1TA 2QCSB 1AR72 2R1BA 4QAWA 4EQVA 3THPA 2A7AA 3UT0A 3BOPA 5FQ0B 4YG0A 1LOAA 2B8MA 5DG1A 2JG9A 5BNPB 1ZBE3 4BH9A 1XSRA 4BZ4A 1W2UA 2WNOA 3BUCA 3OUIA 1W8TA 2WO3A 2XJTA 2WIIB 4UWDA 3NKGA 3TBDA 5FZDA 1FNYA 2W52A 4BPZA 5IT6A 3ENRA 2HYKA 2WZ8A 3NKTA 2JENA 5FZ7A 3VBFA 1UU6A 4AFDA 5BV6A 2A6ZA 1IPJA 4CCNA 3ZXGA 4INDA 5GZGA 3H3ZA 5HCHA 4KH9A 3MEPA 4WVMB 2R042 1L7QA 1S0FA 4IGPA 3MF9A 2RR13 2F17A 5F5CA 2P6CA 4HZFA 2WZPP 1HRV1 1G9BA 1TME3 1TG7A 1GU3A 2W2IA 2OYZA 3WP3A 4ARYA 3HBKA 3G6JB 1RUC3 5J7MA 3AL6A 1XYPA 2YB7A 2B9UA 3BU7A 3DXTA 3ILRA 4CDXC 3KV9A 3AKPA 3LEIA 4R4ZA 1R091 3D3AA 3AX4A 3V0AB 3DPRC 1O91A 1J3RA 2QQUA 1O5UA 2UYBA 5CB7A 3ZM8A 4BYYA 3J7NA 4ZZ8A 1DDLA 2FMDA 3I54A 1CAUB 1AL22 3ZN6B 4R52A 4RR3C 5CKNA 1NCQC 4CCCA 3WCRA 2PHUA 4IDZA 1IQAA 2VR4A 4DPNA 4IV1C 2BFUS 1UCXA 2JKBA 1W8OA 4O7XA 2R49A 4RHV3 4GH4C 4QT6A 4MGTA 2JG9B 5F1RA 1PVC1 2IXKA 3IDBB 3BTAA 5D8AC 4AI2A 4PCRA 4CDXA 3VZJA 5AC91 2G9GA 5FMOL 3H8OA 1JOPA 2XL9A 4AZZA 2NN8A 1WLWA 4QQHA 4XDQA 1MVEA 4AGVA 3OBTA 2WJSA 3WF1A 1IKPA 3JZVA 2CGPA 5CVRA 1LULA 2Y6JA 3LDKA 3USUB 4V2WA 4RR3A 1PMHX 2W68A 3THCA 3WNPA 5T5PA 4YVSC 1NCQA 3LA7A 2RJ2A 4AHXA 2E33A 3FHIB 1EAH3 5FPUA 2VBDA 4BOWA 3AXDA 4IV1A 5KHHA 4I3PA 2EIEA 3VBHC 3T30A 4GH4A 1UY3A 4XJUA 5FIXA 1WA4A 5FYMA 1NXMA 4FAGA 4YZ1A 2CY6A 3GZAA 1POV0 5D8AA 3I2FA 5IAVA 4DMIA 2YG0A 3ZFEC 1MS1A 2FBEA 3GZUC 4FFHA 4QB2A 1NX9A 1BEV1 1WLCA 2NM1A 2RDRA 2YC2A 2BQPA 2YY1A 4QKDA 5E8AA 4PT6A 1EP0A 1N3QA 1KXGA 3B3QE 3PJQA 3IMMA 1Y43B 4QU1A 1CIWA 1MVQA 1OHFA 2NQYA 3SH3A 1BYHA 1S2KA 2BDRA 4ZXEA 3RMYA 5A7WA 4URAA 1O3QA 2VW2A 5FP3A 3Q8CA 3VBHA 1OKQA 4RYDA 4BLJA 4C90A 2G4IA 4QQ2A 1S2BA 3PVNA 4XMAA 1W04A 4GWMA 4S2HA 5DABA 3WNXA 3ZFEA 2C24A 4RGKA 2VD7A 4CDXB 2YFUA 3KS7A 5A6ZA 2PAMA 1XOYA 2VCBA 4YYOA 4CDQC 4BQYA 1NE6A 3T2PA 3MIEA 3W5NA 3WW2A 1MZEA 4OHXA 5HXMA 3P3NA 1LNSA 4ASLA 3MBWA 1NCQB 2UY9A 4OZOA 1NG0A 1DGRA 2RE9A 4UFHA 2VOXA 2OXBA 4CDUB 4CP2A 5F9TA 4IV1B 3VBRB 1PMIA 3KF5A 5FP7A 2RMU2 4LUMA 4FPKA 3E5XA 1R083 2O1QA 1U0AA 3MUY1 4OMCA 5FREA 2ZKNA 1J83A 4TXWA 5D8AB 4H7LA 1E5RA 1H9PA 2W46A 2W91A 2FD8A 4CDQA 1A6CA 2JJ6A 1ZBE1 2VECA 5LBBA 3PJYA 1JUIA 1EPWA 1MACA 3MPBA 4A3XA 4AW7A 3FFZA 1OQ1A 3LPGA 4K1ZA 5FY1A 5LWBA 3I2OA 4RGGA 1XPWA 1SDDB 1UZ0A 1ZYBA 1VBA3 1WZXA 2DBIA 2V5DA 3CZJA 1VRBA 4CCKA 3RG0A 5F3GA 3N3HA 3K3NA 4YM0A 5CFCC 2D3RA 1VE0A 3N7JA 4Q0PA 4LULA 4WM7C 1CJPA 4XJAA 5LRSA 3I2HA 4LPLA 3AXEA 3WY6A 2VH9A 1HQNA 2JG8C 2GNTA 1IPKA 2RR11 2BJSA 5LA2A 1YXWA 4OULA 3ZFEB 2ETEA 2E9QA 4A45A 1VBC2 1TME1 1OMIA 3O5SA 3LFIA 3EXUA 4CU6A 4XETA 2FDHA 4I0BA 1RUC1 1PGW1 1C8M2 1RJ8A 3UJQA 1IS3A 1JTZX 1UL9A 3AVRA 2NMNA 3ILNA 3ZMOA 4QKNA 1WCUA 2LW8A 1J3QA 3T2TA 5CFCA 1W6NB 2JDKA 4MV2A 2E7QA 4WM7A 1BCXA 1DZQA 2WWSA 4K8RB 4QHZA 3N9QA 4P9JA 4YZ5A 1C1FA 3AYDA 3DYMA 4JRAA 2JG8A 4XE9A 2WLPA 5FP9A 2VG9A 1ND2B 2RS32 5FJHA 1W2NA 3K77A 5C3PA 1RUJ2 2GH8A 2Z69A 2XPJA 4RHV1 3RZJA 4FT8A 3BVCA 4QPGB 4FOYA 1S55A 2RS13 4MSVA 4CDQB 4HETA 2D3SA 3DYOA 1K3IA 3INAA 1UOFA 2YXSA 3M3CA 3OEAA 4Y4YA 2VMFA 3POJA 4DXTA 2GMEA 2NPIA 5KXDA 4HVOA 3NJYA 1UIKA 2D6LX 2G9ZA 4D6QA 4HT1T 4BQ5A 4DO0A 4Y20A 3FJSA 3GM8A 1HJFA 1AYN3 4EWAA 1UMZA 1EAH1 3I2JA 1L3JA 4E8DA 1VBD2 1SBDA 4GIQA 4YNIA 4PF1A 1W03A 5LEJA 1WBFA 3N9NA 4I3GA 1P8JA 2A71A 5CYYA 1W9WA 3N7MA 3PU8A 4HXCA 5FZ3A 2Q8DA 5C3SA 2HWB3 2P3JA 2VOKA 2ENRA 4UFKA 4A42A 1VP6A 3AC0A 1UKRA 4CEYC 2JE8A 1RUOA 1QJX2 3J7LA 1FX5A 4OHWA 5T5LA 4L0PA 1OOPA 1W2TA 5C7GA 2VTFA 4KU8A 4K6BA 2R16A 3IPVA 2ZA9A 5IUQA 2GU9A 4CVUA 3SMHA 4I0WB 1RGSA 2B9VA 2DU1A 4CPBD 3PHMA 1GUIA 3T08A 2VQAA 2R6QA 1RMU2 5KHKA 4KGQA 4PQQA 2I07B 5IVYA 4GKXA 1DIWA 5FLHA 3S6PA 5FXWA 2DUQA 2VOVA 5F5IA 3LA3A 3NNJA 1YEWA 3K2OA 1G86A 5C8CB 2LALA 2ATFA 5ANNA 5H9QA 3T2OA 1XC6A 2ZHNA 1UPIA 2PAKA 3OGRA 1GQPA 2XVKA 2WRAA 1HKDA 3EYPA 2O0OA 4EN0A 1VALA 4COYA 3U78A 2ADDA 2JDPA 3FL7A 2VXRA 3LPFA 4Y20B 1FPN3 4OI1A 2VXJA 4QX0A 5LK5A 3VDBA 2AACA 4LK7A 5LA0A 3HNYM 2NZ9A 3ZXJA 2ZTNA 4LXLA 3OBRA 1HRI2 2LRPA 2DVBA 4CCMA 5GZDA 3TAYA 2Y33A 4YGCA 4BIFA 5JDBA 2CYFA 4H55A 1R081 1UF2C 1OC1A 5F3IA 1PGL1 1MZ5A 1Q56A 3MLLA 4M3CA 3WG2A 3U37A 1QJZA 2WKKA 4GWIA 4JTNA 2WZR2 3T0DA 3BI3A 1ZREA 1OOPB 4EWDA 2HWF2 2GDFA 3FUQA 4XTMA 1UY2A 2QE3A 4FOVA 1VR3A 1VBA1 3D0SA 5FBJA 2YU1A 1D2SA 1POV3 3AYAA 3KM5A 1FOD2 2YYOA 4H3WA 2L9LA 2P3KA 4HL0A 1LJ7A 2DFCA 4G4FA 5AVPA 3WDXA 3ZYPA 3BTXA 2WQ4A 1BMV2 2F4PA 1O3TA 4K8FA 4NR1A 2FDKA 3WQ0A 5FZ6A 3ES4A 3ZFGC 5A6YA 1OBNA 3UKTA 4W4ZA 5JVVA 4M00A 4RSUA 3LWCA 3DEMA 1KS4A 1PHMA 4HN0A 4LIUA 3NL1A 4NPMA 2C26A 4BQWA 3DXUA 1YFUA 4Q4X3 5FFOC 3UL2A 3ZXAC 1TEIA 5FUPA 1OUSA 4D8MA 2N7GA 4ZZ5A 3WXPA 3C7GA 1TZOA 1DLLA 3P6BA 1JMUB 4R9DA 5JXIA 2QQNA 1RUI3 3CF6E 2VZSA 1SHWB 3LFMA 4QPWA 4LLFA 2EVXA 4EN6B 2DU0A 1QMJA 2WDBA 1LOFC 5F5QA 2BVVA 2VU9A 4P9GA 1EV12 3VL9A 2W1UA 1Y9GA 4FOQA 4LBQD 4M3CB 1ASJ3 5F6KA 3ZFGA 3ZSEA 3CDZB 2RS11 1R1A3 4JQRA 1HN1A 2WFPA 5A7NA 1S0EA 3PU3A 1HQLA 4A7KA 2OQ7A 1UY1A 3AVSA 1GWKA 1DYKA 2V72A 2ZGOA 1OUXA 3LSDA 1PO13 2VUDA 3ZYBA 2DTWA 3WINE 1LU2A 1GWMA 2R072 1GOGA 1AYN1 1NXD1 1CPMA 2BEOA 5HI0A 2XVLA 3MIBA 4OHYA 1W6QA 1AR92 1HB1A 4UFLA 4LOSA 4A7ZA 1GLHA 2MEV2 4MGKE 4MADA 1AVBA 3GGLA 2ZEWA 1RUF2 1DQ0A 3WHTA 1A3KA 2XUMA 2HWB1 4FBFA 3KV4A 4XFAA 2C1FA 2HEYF 4EZHA 2W08A 4LEJA 1R1ZA 5EPAA 3ZXFA 3SXWA 2P3IA 3GXUA 2X10A 2WT0A 3UYJA 2PXJA 4FOWA 2ARXA 3B00A 2JX9A 1OPMA 4BM8A 5DN2A 4W8JA 2CGOA 4LKEA 1KJLA 4NE9A 1WCSA 3W58A 1Z0HA 2P17A 4IE7A 1W6MB 3SEEA 4FFGA 4B7KA 2B5HA 1YQ8A 1NE4A 4XDOA 4Y4RA 5TSWA 4IEQA 5CFDC 5FWJA 1SEFA 3BCWA 4UAPA 5T5JA 4XZPA 1RL3A 2WS93 1XE0A 2AR6A 4P9WA 2G9FA 1JYVA 2JE9A 2GMPA 2JD9A 4DEVA 5CAZA 1D4M3 2XH6A 2TNFA 1YQ6A 3DECA 5F7UA 4XMIA 1JHNA 1SMVA 4OZXA 1QKQA 4YG6A 4DS0A 5E1RA 4N9IA 1C4RA 3H42B 5FKBA 5JMOA 2XKPA 1U5ZA 3F2ZA 3OSDA 5F2SA 5A3NA 3HOBA 3K4DA 1FPN1 3L2YA 3I2KA 1YWKA 4HMZA 2HBTA 4C1XA 4XHXA 2JDNA 4AEDC 1W6QB 1VB4A 5CFDA 4A6SA 1GWLA 3WHUA 2RS52 4PJYA 1N3PA 1YQCA 1QNWA 4QQOA 1OH3A 4LOTA 4D94A 1IKQA 3MV11 1RUH3 2Q4SA 2QVSB 3AFKA 4JHZA 5T55A 4ATFA 5C9AC 4N8MA 3AMNA 2ADEA 2C9AA 4EWEA 3TB0A 1SLTA 3M3QA 2NP0A 4YVWA 1U12A 2XUEA 1X9TA 5FUNA 1D0HA 5C71A 3N9PA 5KWRA 3GCWA 5FPVA 2J1EA 1AYM3 5T50A 4K40A 5LA1A 3LA2A 4AEDA 2J7MA 1POV1 4Y1XA 3MO4A 5IW0A 1YCIA 4Z92B 1I3HA 3JU9A 3IWZA 1PX3A 1V9U2 2XBO2 4JHTA 2EIBA 2WA3A 3C8XA 3CL1A 3EO6A 4M3CF 4GJYA 2WT1A 3HVDA 3AP4A 1O5LA 2VUAA 1BKZA 4G9SB 4LUKA 2SBAA 2VMDA 3GZTB 1ALYA 4Y1YA 3TN92 3RZGA 1TMF3 1BLZA 1GP5A 3FN9A 3NO8A 2D97A 1W8ZA 4AI1A 1BBT2 4ASKA 1FATA 1DHKB 4LK6A 4Q4X1 4Q4Y3 4XAAA 4ISQA 4XCBA 4CP0A 2AENA 4A44A 4XABA 3J8F2 5E88A 5KHGA 1NQJA 2Y6LA 4AQ2A 5CFDB 5KC5A 1RUI1 3GBGA 3MICA 1T6GC 5B4XA 3HD8B 3TWIA 4Q2FA 2BGPA 1JZ5A 4HK9A 2PQQA 1ASJ1 4NO4A 2FZ2A 1TVGA 1ZNPA 4PQ9A 1R1A1 5LATA 3T4VA 4BQ1A 1O7FA 2CAVA 2VAUA 3RMXA 1JOBA 4A41A 3O1UA 1EYBA 1ZZ6A 4YVWB 5EFUA 2A1XA 3WT3A 4DUWA 1JZ8A 1L7LA 4CU8A 2WO2A 4YPJA 1W28A 4IXLA 1PO11 3KQ4B 3ZMNA 3T1MA 4NJ4A 4AEDB 2VZQA 3JQWA 4MGQA 1KD7A 4QXCA 2J42A 3WP5A 3I3EA 3BTZA 3A22A 3H8RA 4HONA 2W0XA 1RVF3 1IQDC 1XNCA 3ZR6A 4JAAA 3RWKX 4H7MA 1DZRA 4CUAA 3KGLA 1XJAA 3WVJA 3NWKA 4PBOA 5GKAC 3RSJA 1QXJA 1GICA 4E4SA 1QJY2 2BW8A 1LOEA 4YZ2A 1QJFA 2VZ3A 5I8YA 3OPZA 2VNVA 1W05A 2ZHMA 3KB5A 3ZDSA 4PLMA 4Q0UA 3ZYIB 4DQAA 2GP5A 2HLEA 3VLBB 4FQZA 3NAPC 5FZEA 3GBWA 4KWUA 5A1FA 3GJAA 4AVTA 3VN4A 4AI8A 2VE1A 1UO9A 4D7YA 3C2UA 2W3JA 3F95A 2WNVB 3AZWA 2HWE3 3IIAA 3NJZA 2H0BA 2RG4A 2WS91 4B3NA 4B1LA 1LHNA 1DQ5A 1VAKA 4JGZC 1FI2A 4QPIC 1CIYA 4IE5A 3AK0A 5LA9A 3VKMA 1D4M1 3CJIB 2D6MA 2HJIA 4QHBA 1LR5A 4D7TA 4FTEA 4DINB 1MEC3 1HV0A 3OG2A 2PMWB 1OKOA 1B35C 1HRV2 2IXJA 1CZVA 1VBB3 3SEPA 3POYA 4YWAA 1QH7A 3I59B 1D2QA 1B09A 1XNKA 2XL7A 4R8HA 4GAZA 2W87A 3PUIA 4NRMA 5H9PA 5J09A 1XB9A 1MZFA 1KS5A 1Y4WA 3HAGA 4I0AA 1ND3B 4FP3A 3MYXA 4S2FA 1LHVA 4QPIA 1CX1A 4JGZA 1WA6X 3I3QA 1RUH1 3LIGA 2JDYA 4CUCA 2IVJA 1G8WA 1IGOA 4OLLA 4YM3A 4ZONA 1K5JA 4E4DX 1JU4A 1S0CA 3JD73 1B35A 3NQHA 2ZEZA 1R64A 2WN2A 3CBNA 4EV0A 1I1EA 1PVC2 4B4RA 1AYM1 2XONA 2ZZQA 1PM7A 2R30A 2E26A 2O8OA 3CU7A 3I7DA 1GV9A 1OI6A 1W39A 1H30A 2GNBA 3WQ1A 4CXYA 2JDUA 3BIEA 1W2AX 4R9AA 5KR7A 4IGQA 5FYZA 5GZCA 3RYRA 3QBQA 4FSJA 3M3IA 4FPLA 4LHSA 5K9YA 1C57A 3LQCA 4LORA 3VDAA 3ME2A 1AX0A 1SACA 1SLCA 4NRQA 4XF0A 2CL2A 4TLFA 4BQXA 4AVSA 5BYNA 3OYWA 1TMF1 1NCRC 5J98B 2E7AA 2FHRA 4Q4Y1 1Q3EA 3T3YA 5C3RA 1WD3A 3HNMA 2H6BA 3Q8EA 4UF0B 3JBG3 3RZKA 5F3CA 1BEV2 5FZIA 1ZRDA 3GALA 2PAEA 3RWNA 4PHZA 4JZRA 4CPBA 1SFNA 3BB6A 3C3VA 4BK5A 2PELA 4GZ9A 3VZMA 1SLLA 3BKZA 2WO1A 4JGZB 2DWRA 2OUJA 3H3LA 1GOHA 2V4VA 1XYOA 1LAJA 5I0RA 4V1PA 4FPEA 3E5QA 4J25A 5DAVA 2JIGA 3M2MA 1AR73 4MGIE 2RJKA 3I2IA 4LBNA 5GJ6A 1B35B 1NCRA 4NHLA 5CG8A 2XOMA 4NIIA 2XLAA 3WW1A 3LB9A 4AFMA 3LSEA 1RUE2 4P9IA 2FDIA 5D21A 2JDAA 4IEOA 2QBXA 5APAA 4WVVA 4HVQA 1O8PA 5KHIA 3RDIA 1OLMA 2J1VA 4HBNA 2WUHA 3MIDA 2JEMA 4Y33A 2Y0OA 4AF9A 4YW2A 3ETPA 1S2EA 4K7JA 4Y5TA 1RVF1 5LBFA 3OGSA 3VHOA 4M01A 2J1SA 2WYFA 4NAOA 2WA4A 4UI9L 3S7IA 4XBNA 4XJZA 3O1PA 2VCAA 3OYWB 4Q1PA 1LCLA 4QX5A 4R4XA 4XAEA 5T52A 1AF9A 2W9XA 1PIV2 3Q8AA 4OFGA 1ZBE2 4LO5B 4L97A 1SBFA 3KT4A 1SZBA 3PNAA 1VJ2A 1XXNA 2DYCA 4GWJA 5K4LA 3PL0A 4X6QB 1POQA 1COV3 1LEMA 3ZSKA 4M4PA 3WQ7A 1O6UA 2HWE1 5F39A 5JWPA 4X6RB 3KQRA 3RZLA 4OUEA 3ZYGA 3JCIA 4FPCA 5BNQA 2XLFA 1I9RA 4GMP0 4PIXA 5AFBA 3WW4A 3TNPB 1NCRB 1MEC1 3BPSA 1XYNA 2GZWA 3E97A 4GB32 1UYXA 4AFAA 3ZVXA 1MS8A 4IEZA 3UV9A 3B5LB 1QJU2 1OURA 5JUVA 1RUC2 1PGW2 1VBB1 5A6QA 4LBOA 1U5YA 5IFPA 3WQBA 3NNMA 3DPRA 1CQ9A 5FZCA 4JRLA 2VY0A 5F2WA 4FP2A 4L9BA 1O3SA 1W8UA 4Q4V3 1W6OA 3PURA 4ZXKA 3VBFB 3MV01 2D44A 1NA1C 5LASA 1UU5A 1LGBA 1S0DA 2WQ8A 5CBLA 1RYYA 4GD4A 1CD3G 2CAUA 5DAQA 2JKXA 5K0UC 5IK8A 1H6YA 2B4KA 3VD9A 2A70A 1GQHA 4LBQA 2KD7A 3JD71 1YFYA 2KM2A 2HYXA 4B8EA 2D98A 2WQZC 2YBPA 5F32A 3WDUA 2GSYA 2K2SA 5JIAA 1T6BX 5L36A 1PO22 2TBVA 4BDVB 4BIOA 3D5OA 5LW9A 3MGUA 4C91A 1W8NA 5EJZB 1S0JA 1AHSA 2WO7A 4AEJA 1NA1A 4YVSA 1CAVA 4LR4A 5SV5A 3SQOA 1QGLA 3WG3A 3KV5A 3M4FA 3CMGA 3FX3A 4Q26A 5FZ9A 5K0UA 1V6KA 3ZXEA 2LM3A 3I3MA 1EAH2 4W65A 4NIGA 3WNMA 3PUHA 2D3PA 2D40A 2AC1A 3FFQA 4NIAA 2QZ3A 4E8CA 3UNPA 4IEUA 1J59A 4KL1A 3MF6A 2YROA 1PM4A 4BJ0A 1CR7A 5I91A 1X7NA 4YW7A 4Q4W3 2GN7A 1DU3D 2OPKA 1BXHA 3JBG1 3DPRB 4M3CE 4BA6A 3ZO0B 4UYBA 2QZ2A 1N1YA 3KF3A 3AM2A 3ASIA 2ZBJA 4RGAA 2VQUA 3NV1A 4XBQA 1W6OB 4RD7A 4RR3B 2Q1MA 5E6HA 4AFBA 1X9PA 2VVFA 3POWA 4B29A 3SKVA 1JZ6A 4M4RA 1CGPA 4Z8BA 2RMU3 1AR71 3T2QA 2BGOA 3ABZA 1V6IA 3HBZA 3BN6A 4GH4B 4IEPA 1HJGA 3AJZA 4QDQA 1JYCA 4HKOA 3M7AA 2AYHA 2DCTA 2F6BA 4YW1A 1W8FA 4IQPA 3BYWA 4E2SA 3OGJA 2ZX2A 3ROUA 4J1XA 1WLDA 3VBOC 3ZN4A 4YLZA 4V2VA 4OVEA 4XTPA 4Q8LA 1PX4A 3RJRA 1XBFA 4HANA 5EWSA 1XRUA 5FMCA 1NA1B 4YVSB 3T09A 5JZGC 2ZMNA 4GWNA 3D8CA 4QQLA 5GLTA 4N53C 3AFGA 2OQ6A 5IK4A 2FCUA 4ZY9A 5FYIA 5LBEA 5A7WB 1PNFA 3VBHB 2KA3A 5CKMA 2GAUA 2WZEA 3DN7A 2VL4A 2FDGA 4Q0QA 1KEXA 1AX1A 2UY8A 4OQ9A 2VCCA 3URFA 2BBVA 4FFIA 5A3TA 2DCKA 5A3OA 1LU1A 1ONAA 1F5FA 1K12A 3NRUA 3I4IA 1C8M3 5FAXA 3UKVA 3VBOA 5EV7A 4YW3A 4QM9A 3PUQA 1D0GA 1ZM1A 4JCKA 1MZ6A 1AL0G 3CZUA 2TEPA 5C8WA 3VDDC 2RM23 3AYEA 5JZGA 4U36A 5I0DA 4KI5M 4BK4A 1COV1 4N53A 3FUOA 3ORJA 4P08A 1FMD2 1NY71 2R063 2P37A 4KGGA 2JICA 1CWPA 1SDWA 2ZEXA 3ITQA 3N35A 2RS33 3LE0A 1O59A 1V70A 2Y8KA 3VHRA 3K46A 4XC9A 1W90A 4IESA 3V56A 4EZ4A 3LKJA 2VW1A 4PBPA 3OD0A 3VDDA 3ZYJB 3D82A 5DAWA 4KG0A 3C7HA 4IE6A 1V6NA 1JHJA 1GNHA 2DUOA 2E63A 3HQUA 3O0WA 4Q4V1 3OD4A 1AR82 2XLGA 1KQRA 5CNAA 4ZPIA 4O65A 3M8LA 4Q1RA 4DXSA 1ZRRA 1OF3A 5FMOS 1NQDA 1YI9A 3SKJE 1CJDA 3DUIA 1Q8OA 2RHPA 2ZX4A 4XUTA 5EIYB 1DG6A 4AAXA 1DYPA 1TQ5A 2C5DA 3MW4A 4IETA 3IDCB 3VBOB 3PIJA 3RPQA 3HIFA 3S7EA 1OFNA 5I93A 2KXLA 1J1LA 1OH4A 1UQXA 3S5AA 4MGYE 4R9CA 2BOIA 4QDSA 4P14A 2DTYA 2ZXQA 5F8PA 2Q0AA 3VHNA 1WMFA 5CFCB 4BQ4A 3KVBA 3PTRB 4AE2A 5FOJB 4WM7B 2WYSA 1AYN2 4CDWC 2HWD2 3A0KA 1OSGA 2JG8B 4IGOA 1F4AA 4UW4A 1JYTA 2ID4A 3VKNA 4H14A 1Y9QA 1AR63 4CEYA 4CYDA 4KWKA 2D93A 2BNNA 2DCZA 1GR3A 5FYVA 5A3UA 5FZKA 5FY9A 4Q4W1 2HEWF 3FLPA 2A3YA 3WP4A 1UYPA 5LK7B 3IAPA 2J1RA 1DGWA 3WDVA 5FY5A 4GMP3 2VULA 5FO9B 1SFPA 4IE0A 4ES8A 1H4HA 1WMXA 3KLSA 3VBSC 3ZXLA 4CDWA 4N43C 1JYXA 1A34A 4K20A 4E4ZA 1ULPA 1HRI3 2Y6KA 3IT8A 1ENXA 1XE7A 2AUYA 2RMU1 3PDQA 3PIGA 3CHXA 4TZDA 4ZU5A 3GF6A 4ZU4A 3SISA 4AGGA 5IVEA 5DAPA 2VBBA 3DKQA 3WZ1A 2WZR3 1ST8A 2P6HA 4QGNA 4RA0A 5A32A 3B9CA 1MPXA 2XB6C 5FPXA 3DCQA 5A33A 3IPVB 5GLVA 4IV3C 1W9TA 2LROA 1H8VA 3W20A 3NVCA 5FZOA 3VBSA 4N43A 2VW0A 3BIWE 3D6EA 5FBZA 5JI7A 4QX2A 1FOD3 2X05A 1JYNA 2WC2A 3OCPA 3FBMA 1DQ6A 2A6XA 1W2OA 2ZOEB 1T2XA 1US3A 1VMHA 4CEYB 1RUG2 4E27A 5FLIA 2IWGB 4AHYA 2PA7A 4BQ2A 1LHWA 4IL7A 1SLIA 4DB5A 5HPOA 2VC9A 3W5MA 1C8M1 3LEKA 4IV3A 1JZ4A 1YQ5A 1W8WA 2VMEA 3WG1A 2VNOA 4AK3A 3LEMA 5C33A 4AQTA 2RM21 3ZIWA 4AEMA 1K45A 1G9DA 2ERFA 1YUDA 1C8NA 1ULEA 2C4XA 1HIXA 4CDWB 1HXS2 5DDJ2 1OD5A 3J7HA 2CWSA 3VZLA 4AOCA 4Z2WA 1HX6A 3C7FA 2QNKA 2R061 4QGLA 5FK8A 2HEVF 3KV6A 4O9EA 4XIOA 3RS6A 3WCSA 3OOXA 2QQLA 1VRH2 2TUNA 3PVBB 4Y5Z0 2RS31 4ASMB 2ES3A 4IW3A 1EV13 5ACA2 1DQ2A 4EN8B 5KXCA 2GMMA 3NNFA 5LB6A 2PHXA 3FE5A 4EN7B 2VMHA 4P5YA 4X8PA 4IE4A 3IBMA 1SG3A 2P1BA 4OUSA 3TEWA 5BPXA 1A8MA 3MIFA 1SCSA 5A33B 1BHGA 2B45X 1ULFA 2OUHA 5FZOB 4N43B 1JXNA 5A3PA 2GP3A 2XJQA 1UIJA 5FZLA 2BYVE 1DQ1A 1VB2A 2W5FA 4JKMA 4AG4A 1AR93 1ZZ8A 2Y6GA 2Z4FA 4ITCA 1TNFA 3P5BA 1LOFA 2GALA 2DVFA 2QQMA 2VMIA 1RUF3 5IVBA 1Z7S2 5A3WA 5FMDA 4D0QA 3MUZ1 5B2GB 3EBRA 1ASJ2 1RTVA 4FPYA 2MPFA 1R1A2 1CAXA 3QD6A 1UZWA 4XFHA 4ORFA 2RJLA 4IV3B 3RZHA 4BXFA 3RNSA 4LLOA 3N9MA 2EA7A 5A70A 1PO12 2AH2A 4EE2A 5FR3A 1H6XA 1U5IA 1CONA 1AXKA 3LOIA 4NIHA 3R4DB 4Y5SA 4YSFA 3FBYA 3E5UA 2W39A 4PLNA 5FDBA 3GJBA 5A80A 5FXZA 2P5BA 1ODMA 2ZX1A 3I2DA 2VJXA 3IAQA 4XVHA 5LY1A 1AR61 2HWC3 3ZFGB 3LCPA 1KJRA 3H7YA 3VV1A 1K5MC 1QDOA 1N1VA 4C0HA 3AKSA 1UKGA 2P2KA 1D4VB 2WNEA 4GMP1 5CIRA 4FPHA 2ZEYA 3DKWA 3G7DA 3O7OA 2BRTA 5KBFA 4RN5A 2CU5A 5C3OA 1DGRN 5D1IA 4AFCA 4CCDA 4F3JA 3IM0A 1WMEA 2ILMA 3ZFFC 1S1AA 3H9AA 1HRI1 1VBE3 3ACHA 1HB2A 1HB4A 1QEXA 1HDKA 4N7IA 4NPRA 4QXHA 4LKFA 4K3UA 4QGMA 3SCFA 4AVAA 1JU3A 1PK6C 5BNOC 1OT5A 1K5MA 1YJKA 2C6SA 3AMMA 1ULDA 2WZR1 4AGRA 3S0MA 1H1IA 3RGBA 1D4M2 3MLKA 3M3EA 4JDNA 4XQWA 4IEXA 3LD8A 1W8HA 3OBAA 1GNZA 2JDMA 2ZGRA 1N47A 3BTYA 2D6KA 4TYSA 5JOYA 3AB0A 2LS6A 3ETQA 2GNDA 2UURA 1KRIA 2YV8A 4Y24A 2YHJA 3BALA 1WKYA 2HBUA 4TLGA 3U4SA 1FOD1 4XXPA 1S0GA 2VPVA 1V6LA 3WEZA 3ZR5A 1V9U3 4OI0A 1UZVA 1PK6A 2H6CA 2YPDA 5CKQA 3ST7A 2QTWB 5EXOA 5FPAA 5BNOA 1BMV1 1MS4A 3EB7A 2A3WA 3RYPA 5C9AA 4YZ3A 5J3UA 2OS2A 2PLV3 4RL7A 4XUOA 1XU2A 3CJXA 5F37A 4L2NA 4H2AA 1G7YA 1NOVA 4MHRA 4JV4A 2X8KA 2UWBA 2VQTA 3TN93 5KC6A 4CXWA 3NW4A 1WCQA 1BBT3 2P3YA 4L8QA 4CZSA 3KWVA 2A6YA 2GN3A 2GNMA 1K42A 2IFRA 4MUVA 4P9XA 2Z42A 1ULOA 1RIRA 2RDSA 1AYM2 5FZHA 3J8F3 4Z82A 2ARCA 4FI9A 4NHKA 3ZSMA 3H0OA 4FFFA 3I3DA 4PDWC 5H9SA 3BU0A 1XNBA 5FTTC 1OA2A 4K1YA 4MGSA 1EV11 3K75B 4QU2A 2Z5WA 1Q5OA 3P1IA 1RHI2 1K5MB 1UAIA 1H8TC 2EXJA 2WN3A 4MYEA 3L9JT 4J1WA 3GNEA 3U11A 4NRPA 3E6CC 3ZKYA 5CZKA 1XNTA 4WZCA 3AYCA 1Y7BA 3HT2A 1AX2A 1C5HA 3ILFA 1JH5A 4GQ7A 4XIKA 5FUIA 3HJRA 5FWEA 5FYCA 1TMF2 2EICA 3RI8A 3VKFC 3TEZA 4ZS2A 2WBKA 4CP9A 4NUBA 4FAHA 1GMMA 4Q4Y2 4CCJA 3MZHA 4YGBA 1G9AA 1Y9MA 1IG0A 3N7KA 1J84A 2WAAA 3ZPYA 1QF3A 2VMGA 1H2LA 2DVAA 1AR91 3KHBA 1VMJA 4L92A 1RUD2 2D6NA 5BNOB 1ZVFA 4Y22A 1ULCA 1BVP1 1RUF1 1WW6A 3IDAA 3N36A 4HSLA 1OQDA 5C9AB 5JOXA 1ZA7A 3S30A 1UPSA 1W0PA 1FT9A 2XG3A 2ARBA 2WLQA 2WABA 3LDBA 2W95A 1QJY3 4KWLA 1ZZBA 3BGAA 2WFF3 2PYTA 5C70A 5EP9A 1AJOA 1IG3A 2IXIA 4KG8A 3LDRA 3AMQA 2CWMA 5BNNC 4HVRA 1DP0A 3AP6A 1BK0A 1QQP3 5FOBB 3TNQA 3ES1A 5IVCA 2ZZJA 4LO7A 3WF0A 4LBMA 1JODA 4XUQA 4NHYA 2AZ5A 4CTEA 4KQ7A 2VM9A 4WV8A 5FZAA 1GP4A 2XHKA 2ARAA 3VBUC 1W6PA 2X5IC 3MIGA 2OW4A 1UZZA 2ZMKA 4K21A 4C1WA 2OVUA 1O4YA 4META 4DXZA 1F9KA 2DDUA 2W1SA 3H7JA 2H0VA 3ZYFA 3SC7X 3UETA 2HWC1 3HQXA 5FV3A 1YNAA 3AP5A 1CX4A 2K0GA 1YIPA 4LJHA 2JECA 4LKDA 4MO3M 4MX3A 5FY4A 5L9RA 5BNNA 4YW4A 4UFJA 4O9GA 5FP8A 1NLQA 3H1YA 3V0BA 3VGIA 4CP9B 4AL9A 1NAEA 1VMFA 3USSA 4FPOB 3CEWA 5JOWA 3KT1A 4QKFA 3ZDVA 3NAPA 2VZRA 3MW2A 2D6PA 5FYSA 4QXKA 2ORZA 2X5IA 1GANA 2VZPA 1EUTA 1R092 5FYTA 3KMHA 4GALA 3K4AA 1VBE1 2BFUL 4UXAA 5C6CA 4Y22B 3H1MA 3TRSB 3AMPA 1RC6A 4XURA 1XNDA 1Q8PA 2HWE2 2LUWA 5FZBA 1SLBA 1UY4A 2DV9A 3LAGA 5A7QA 3IMNA 4NAMA 5A1LA 4FTBA 5E89A 2LTNA 5LY2A 2FDFA 1AJKA 1UNBA 2AREA 2FDJA 4RFT0 3K4ZA 4DRVA 1LGCA 5L7OC 1MEC2 1E5HA 1ENRA 4MXWA 1GQGA 1WBLA 2SLIA 3VD4A 2AGSA 5K7PA 1F35A 1DGLA 2VO5A 4XJWA 1YFXA 2JE7A 3RVHA 4LO4B 4NHMA 2IFWA 4YZ4A 1VBB2 3HQRA 2OA2A 2VZVA 3LEGA 2UU8A 4L99A 2UYAA 4ZKTB 5AC92 5B4NA 4B4PA 2XQRA 1XNAA 1V9U1 2YU2A 3V64A 3OY8A 2J1UA 2Y64A 2CDOA 5E16A 4AAPA 2ZGSA 4ZS3A 1X33A 2PHLA 4OYUA 2PLV1 2XXZA 2XKOA 1WUVA 5L7OA 5BNNB 5HBAA 1HW5A 4YFWA 3B94A 3TN91 4P9LA 1ZBA3 5ANQA 2A5ZA 4Q0SA 1BBT1 3M1HA 2BOJA 3E6DA 3VL8A 3B01A 3NAPB 1X82A 5IJRA 1ULGA 2XJVA 3J8F1 4CUBA 3PMSA 3S57A 4HOOA 3U1XA 1OLRA 2RVAA 3WNNA 2CGNA 3BODA 2NMOA 3TEXA 3APBA 4XEZA 1HB3A 5JSOA 2ZGQA 5D2AA 3ZYHA 4QPIB 4A2UA 1H2NA 1A8DA 5DXDA 2DURA 4OQ8A 2ET7A 1DBNA 1UYZA 2A3XA 4WVMA 3SH5A 3S5QA 2WNUC 4CCEA 1LGNA 2VZOA 3NMBA 3R0RA 1OA4A 2OZJA 2JXAA 1RUE3 2BVBA 4FXGB 3T0BA 3RJ2X 4CCOA 2W1WA 4XFFA 4DFSA 3K48A 4JGYC 1REDA 1MS0A 3ACLA 4XFIA 2NLRA 1V6MA 4F83A 3O1MA 3V0AA 5JOZA 1PZ9A 2PHRA 3B69A 3PTYA 3T4HB 1CAUA 1NKGA 1C3HA 5FZ4A 3ZN6A 3NV2A 2VTXJ 4Q5OA 5CISA 1PMJX 2WNUA 5L7OB 2BV4A 2R043 1QJY1 4YG3A 3TYJA 2Y6HA 2WFF1 5J1XA 1JZ3A 3VHPA 2G19A 5EJ1B 1LOCA 1PIV3 3JXSA 4CA9A 1AXZA 4JGYA 5IVFA 4LT5A 5GLZA 4MG2A 3HWJA 3PUAA 1QQP1 2XDVA 3L2HA 4HN1A 4CP1A 3DYPA 5BUVA 4ZHNA 1GZTA 1LRHA 4OMDA 4EN9B 3LGRA 3VZNA 2A6WA 4FPJA 4CXXA 5L19A 2K9ZA 2FZ1A 4Z2AA 3VD7A 1S4CA 2YC0A 3CLPA 5DZEA 2VZTA 3USUA 4S2GA 3W9AA 3U07A 4MHUA 1NZIA 1AL23 1LODA 4KWJA 3WNKA 4FO9A 4BMBA 4DEQA 2G1MA 2QQVA 4PI0A 4DIQA 4AVCA 2ZGUA 2D7FA 4XDPA 3LIHA 1F2NA 4GB33 2YUEA 4P02B 4P00B 3FLRA 5DUXA 5FXVA 5LBCA 4BCUA 4ONUA 1UX7A 2RR12 2XJRA 3J7MA 3KSCA 1QJU3 4BLIA 2DCYA 2IC1A 3O1TA 1DCSA 1TME2 5K8SA 1Z78A 1KFUL 4XXAA 3WX5A 1STMA 3RFRA 1AXYA 4QHOA 4DUXA 1V0AA 4YM2A 5JXJA 1GYKA 1UZYA 3OEBA 2Q8EA 3HN3A 3I8TA 4LA2A 4U2AA 2Q8CA 5A7OA 2ZJCA 4BMEA 1COV2 4BU2A 3ACFA 5JCTA 2I74A 4SBVA 3ZOIA 1NY72 1ODNA 2WNUB 4XF3A 1LOBA 3U14A 2RDNA 3AL5A 4CDUC 3CNAA 3VBRC 1W9SA 4HK8A 2WWJA 3DL3A 3MPPG 4HFSA 3GDBA 4IEVA 4JGYB 4RHV2 1LOGA 1PO23 5IAXA 1JZ7A 3P3PA 3DGTA 2Q30A 4JKKA 1XE8A 4LTAA 4ARXA 5JSRA 3MHZA 5DZGA 3GZEA 2AEYA 1PGSA 2FMYA 3MFCA 3VZOA 2WINB 2EIDA 2OZ6A 3ECQA 4QB1A 3B93A 3IB3A 3WNOA 1GNYA 4Q4V2 5EYYA 4MH0E 4CDUA 1BQPA 5IWFA 3VBRA 3OUJA 3O1RA 1F4HA 1ZBA1 4N90A 5DZFA 4TTGA 4QQPA 4OI2A 1JYWA 3PVOA 1RJ7A 5A3MA 4NMIA 4XCAA 4XFCA 3PLQA 4DOUA 1FAYA 4RS5C 2Q1FA 1UXXX 2E7TA 2W92A 3NV3A 2BERA 4X8NA 4Q29A 5FPLA 5HV4A 2BPA2 4D7SA 5FZ0A 2PQSA 1O4ZA 2MHFA 5KXEA 1IZ3A 3ZYRA 3Q8FA 3VKLA 4Z1VA 1SQ4A 2V4AA 1LESA 4PI2A 2O8QA 1CPNA 4JDOA 3OTFA 5FYUA 1GZ9A 3JUUA 1Y3TA 4XQDA 4LBQB 4LQRA 3UGGA 4Q0VA 1H2MA 1ND2C 1RUE1 4PF5A 1QDCA 2JB8A 4QMAA 5FYHA 4Q4W2 3EHKA 4QPGC 1KITA 2WSUA 4RS5A 4CSWA 2WSVA 5FY0A 2P4EA 1OF4A 5CG9A 3C7EA 2XJUA 4IEWA 3AZYA 2D43A 1W6NA 4GKYA 1CAVB 1CN1A 2J1TA 3HT1A 3RYKA 2QDNA 5K0UB 2QQOA 1IS6A 3A4UA 1VIWB
chains in the Genus database with same CATH topology
5J36A 2R041 3WW3A 1ND2A 4COVA 3D0JA 5EYXA 3MI8A 1R082 2R0HA 1PIV1 1VBC3 2ET1A 1PGL2 4QPGA 2ZMLA 3AMHA 3O0XA 5LRRA 1E57A 3X29B 2V09A 1MR5A 3EJKA 1MS5A 3RI9A 5CA6A 1REEA 4YFZA 1Q8QA 2CNAA 4WBBA 3ATGA 1FMD3 1VBA2 5JAXA 2VGDA 4DRRA 2YZ4A 1AL21 4D3WA 5JPNB 2Z79A 3QOPA 4ISRA 3UJOA 2B46X 2JDZA 5LEKA 2B42B 3U10A 1F31A 1PVXA 5CADA 4GB31 4L11A 1RUJ3 2V5YA 1QJU1 3ZIXA 5C8CC 3AP7A 4YGDA 3JB8A 5FO7B 4RS5B 2ZX3A 5I8SA 5EJ3A 4JVAA 1VAVA 2Q8OA 2OIIA 2XJSA 2RM22 3O14A 1H0BA 1AR83 4TWTA 1QOTA 3WG4A 1SLAA 3R6SA 2IXCA 2R062 1VBD3 3TOJA 3WDYA 1JW6A 4YGEA 2PFWA 1ZRCA 2D5HA 3KZ4C 2B7YA 2FQPA 4B7EA 1YFWA 3EQEA 3SLIA 5C8CA 3CO2A 4XF9A 1BK1A 2ZX0A 4DY5A 4F8AA 1URXA 1QJX3 2E51A 1I6XA 1PO21 4FTSA 2RS12 4AHZA 1ZX5A 3SCGA 5T3NA 1OOPC 5ABJC 5L73A 2PTMA 3WV6A 2ZGPA 4XJ9A 5JZGB 3J4UH 2BNOA 4N53B 4GXLA 1BJQA 1RMU3 4YARA 2HWD3 3NSTA 4WM8C 3FC0A 1C5IA 1RB8G 3IKWA 4WZFA 2ZGKA 2EALA 4UW5A 4PIZA 1UU4A 2PN5A 3VKOA 3IN9A 5IK5A 4XBLA 2HWB2 4M0HA 1IHMA 5FPZA 3SHRA 3GYDA 1ZZ9A 5ABJA 1ENSA 3VDDB 3GHMA 2QJVA 5HXVA 2EXKA 1BVVA 2X53S 3MFAA 4I09A 2CV6A 2DFBA 1VAMA 4Q8KA 2BGCA 3A0NA 4CRQA 4IERA 4WM8A 1LENA 1V6JA 2XGXA 4I2OA 3H3UA 3MDPA 2VUJA 3ZSLA 1JOJA 1AR62 5GZEA 3PVEA 5HCBA 1DFQA 2HWF3 2ZKLA 2C0ZA 4OHZA 1Q8VA 1YRZA 2ZS6B 1GFF2 3RZZA 2BNMA 1UW8A 4NOTA 2P34A 1LHUA 5FO8B 2I45A 4AQ6A 3KT7A 1FPN2 2DF7A 2ZGLA 1MS3A 1REFA 3QH7A 1QH6A 3FWEA 4WVZA 3O0VA 3ZX7A 3WLUA 2A73B 4NWWA 1RUG3 3UK9A 1LECA 2WL1A 3B7MA 3U0ZA 1VBC1 3KCYA 5GLUA 5ABJB 5J37A 1WMDA 1VLNA 2GC0A 1ZRFA 2ZPXA 4URTA 3WOGA 5FRAA 3FZ3A 4LO8A 1PZ8A 2XWBB 2ZABA 2ZCWA 3FLTA 3RQ0A 2BWAA 1HXS3 5DDJ3 1FMD1 1X8EA 2YPJA 5GM0A 4WM8B 4BE3A 3WD5A 1UX6A 2I2SA 1VRH3 2YMZA 1CAWA 2A75A 1H4GA 1Q8SA 2EXHA 4JC1A 5ACA3 3AZZA 4LE4A 5T5OA 1WW4A 1RUJ1 5IK7A 4AVVA 5HCFA 4COUA 4ZU7A 4CEWC 2ZGTA 5A32B 1QY4A 3R05A 1V00A 1ZZCA 4KU7A 3H1WA 5GZFA 4NN0A 3W59A 1MQTC 1N1TA 4N9HA 3SITA 3VBSB 4Q4X2 1AR81 1LHOA 3HN1A 2R073 4Y26A 4E2QA 1TNRA 3LOBA 1CVNA 1QHDA 1O3RA 3GBFA 1VBD1 1W6MA 2NYYA 1RUI2 1YYNA 5KHJA 4YM1A 1Z7S3 2MEV3 4MGZE 2QFEA 1KDKA 2QQPA 4CEWA 4I30A 2R1DA 2XJPA 2QUOA 1KDMA 3KCCA 5CU1A 5EZWA 1QJX1 2ZGMA 2WT2A 2Y38A 4SLIA 5AVAA 1OQEA 1NYWA 4LNVA 3GHNA 4COWA 1MQTA 2PHWA 1S0BA 1RITA 1LKNA 1X8MA 2EAKA 2ZACA 4HPKA 3MIHA 3J26N 1HLCA 5SV8A 2HKXA 1RMU1 3QLQA 1JN2P 4MXVA 2HWD1 4DZGA 4Y1ZA 3VZKA 1CAWB 4HKLA 4UW6A 3UKNA 4LBLA 4MLOA 2E6VA 1YHFA 4DY3A 4P5HA 5BXXA 2EF6A 3SCHA 3H8UA 4OHVA 1IOAA 2ZHLA 3AKQA 4K9SA 4Q27A 4AI3A 2Q1ZB 5JPMB 2R0FA 1G9CA 1YJLA 4XILA 5JR7B 1OPOA 2D6OX 2Z2SB 1C28A 1EY2A 2DCJA 1QOSA 1WCKA 2VQ0A 2RS53 1XU1A 3WP6A 4QD2A 4AXOA 4XFBA 1H2KA 1KFXL 2R32A 5I0TA 1F5JA 4CEWB 3AKTA 1H1AA 2HWC2 2PHFA 4FXKB 2WS92 4UW3A 2VVEA 3Q9OA 4RQPC 5I0UA 1ZZ7A 1CAXB 2BUKA 5F6LB 2HWF1 4W6WA 1MS9A 5BY5A 5HCAA 4J6GA 1CESA 1MQTB 4FVVA 3ZSJA 3ZN5A 4YVWC 2GC1A 4HPKB 1FV2A 1DZTA 1C1LA 4YW5A 3V65A 4D69A 4COZA 3ZFFA 3RRDA 5JIUA 1X50A 3ALQA 4XYXA 5H9RA 3HR9A 5DG2A 1AZDA 4WVWA 1GSLA 4YRDA 4PLOA 3MLJA 1VBE2 2GC2A 2PHTA 2XBO3 3DF0A 1QWRA 4LHNA 1RUG1 4LO6B 4AVBA 5J48A 4RQPA 3OGGA 1RUH2 2DUPA 1RINA 3E6BA 1QOOA 2XVGA 3BOWA 3T1LA 1GBGA 3R4SA 1HXS1 3IDEA 5DDJ1 1JYIA 1IS5A 4I01A 4NVPA 4S2DA 1O4TA 2Y26A 1GKBA 1N3OA 2CTVA 3ELNA 3DV8A 5DUVA 1FV3A 1VRH1 2BWCA 1G9FA 5GALA 5ACA1 5FLJA 3ZXKA 4E2GA 4LA3A 4AHWA 3O12A 1RHI3 3WDTA 2WNVC 4XHBA 2PLV2 1QU0A 1GZWA 4XF1A 2BTVC 5KXBA 5DUUA 5JSPA 1UN1A 4LBKA 3THTA 3CJIC 3QH6A 4HKWA 2GC3A 3ZXDA 1NZCA 4LE3A 1M4WA 2QKDA 4F7ZA 4R9BA 3ZFFB 1J58A 1QNYA 2MNGA 2R071 1YLLA 3KGZA 4Y1UA 4PDWA 1WGPA 5AFEA 1IS4A 1RUD3 4MZUA 1WW5A 1PK6B 1Z7S1 2MEV1 2WNVA 1H9WA 1H8TA 1ND3C 5C4WC 2JD4A 2ZHKA 4RQPB 5FCCA 4I02A 2Y0IA 3WDWA 3CJIA 3K51A 1DQ4A 5GLWA 3AZVA 1M06G 3OF1A 1APNA 1SFYA 3OJBA 1LB2A 3AJYA 3B02A 4FCAA 2EAAA 3LZZA 3JQXA 3I59A 4BWOA 4EROA 3VUOA 3AZXA 1ENQA 3HMYA 1S0IA 4XF4A 4KBBA 3B9IA 4XOGA 1ND3A 3AKRA 5C4WA 1RVF2 2YGMA 2XWJB 1YI7A 4Z07A 1PNGA 1GZWB 3QACA 1TE1B 1UD1A 1WCDJ 4FPGA 4NWVA 2WFF2 3N7LA 1HRV3 1U5XA 4XJ8A 5T54A 1J3PA 2DVGA 3FMGA 1SCRA 1QQP2 2X29A 4G3YC 4KNCA 1LEDA 3SH4A 4PDWB 1R093 3VBUA 4LHLA 3N4MA 1YIFA 3U4XA 2RS51 4LHKA 1H8TB 3WUCA 3AP9A 3WR0A 3KCXA 4QPYA 4AWDA 1HQWA 1YO8A 2ZAAA 5JLVA 4QM8A 3R4UA 4GA9A 1G6NA 1FYUA 4JTOA 3MW3A 1XQNA 4UBGA 4W6XA 1N1SA 1OLQA 1HV1A 4AEKA 2A6VA 2GH2A 5JMCA 5I8TA 1PVC3 4M0NA 4Y1VA 5DUWA 5AC93 3POSA 4HLTA 4TSVA 4JDMA 5BNPC 4IEYA 1LTEA 1X36A 2V73A 4AI0A 3QCWA 1W6PB 2XBO1 5C4WB 1RUNA 2EIGA 3SNMA 1DGWX 1V6OA 4ATEA 1OA3A 1QXPA 2IXHA 1EPZA 1JUHA 2Q5TA 5I0SA 3D4KA 2PHDA 3PMEA 1FXZA 2DVDA 2IXLA 4LBJA 4PIYA 4N7UA 4C0BA 4EJRA 3JD72 4BHPA 4ES9A 1WD4A 3V0BB 2IZWA 5FQ0A 5J96B 1WLTA 5BNPA 1F8VA 4GULA 4A7YA 1GZCA 4W6YA 3VBUB 1BEV3 2X5IB 3J9SA 4DNYA 3NV4A 1ZA4A 3M70A 4FQ4A 4MVTA 1QXRA 1RHI1 2VNGA 2ZAHA 3KD4A 1I5ZA 4FPFA 2VOWA 2QDRA 2UWCA 1OFSA 1SBEA 4HSJA 5A3LA 1W0OA 1ZBA2 3H50A 1A78A 1BZWA 2D5FA 2YGLA 4MXWB 3M3OA 4AYUA 4P9YA 2YDEA 1DF0A 4OUMA 4E9KA 5JI9A 4XQ4A 2JG9C 4OI4A 4XPVA 1WW7A 1JBCA 4B4QA 4XW3A 1FNZA 3JBG2 2B39A 2ZGNA 1RUD1 2VVDA 1PZ7A 1NLSA 4UBHA 3BPZA 1H1MA 3OY8B 4AQSA 3WUDA 2E53A 4XFGA 2EXIA 3VBFC 2UWAA 1NLRA 1Q43A 3JB4C 2VNRA 1AUYA 2QCSB 1J1TA 1AR72 2R1BA 3THPA 2A7AA 3BOPA 5FQ0B 4YG0A 1LOAA 2B8MA 5DG1A 2JG9A 5BNPB 1ZBE3 4BH9A 4BZ4A 1W2UA 2XJTA 2WIIB 3NKGA 3TBDA 1FNYA 2W52A 4BPZA 5IT6A 3ENRA 2HYKA 3NKTA 3VBFA 2JENA 1UU6A 4AFDA 5BV6A 2A6ZA 1IPJA 3ZXGA 4INDA 5GZGA 3H3ZA 4KH9A 3MEPA 4WVMB 2R042 1S0FA 3MF9A 2RR13 4HZFA 2WZPP 1HRV1 1G9BA 1TME3 2OYZA 3WP3A 3G6JB 1RUC3 5J7MA 3BU7A 1XYPA 2B9UA 3ILRA 4CDXC 3AKPA 4R4ZA 1R091 3AX4A 3V0AB 3DPRC 1O91A 1J3RA 2UYBA 1O5UA 5CB7A 4BYYA 1DDLA 2FMDA 3I54A 1CAUB 1AL22 3ZN6B 4R52A 4RR3C 1NCQC 3WCRA 2PHUA 1IQAA 4DPNA 4IV1C 2BFUS 1UCXA 2JKBA 2R49A 4RHV3 4GH4C 4QT6A 2JG9B 5F1RA 1PVC1 2IXKA 3IDBB 3BTAA 5D8AC 4AI2A 4PCRA 4CDXA 3VZJA 5AC91 2G9GA 5FMOL 2XL9A 2NN8A 1WLWA 4QQHA 4XDQA 1MVEA 4AGVA 3OBTA 2WJSA 1IKPA 3JZVA 2CGPA 5CVRA 1LULA 3USUB 4RR3A 2W68A 5T5PA 4YVSC 1NCQA 3LA7A 4AHXA 3FHIB 1EAH3 4BOWA 3AXDA 4IV1A 5KHHA 4I3PA 3VBHC 4GH4A 4XJUA 1WA4A 1NXMA 4FAGA 4YZ1A 2CY6A 3GZAA 1POV0 5D8AA 4DMIA 3ZFEC 1MS1A 2FBEA 3GZUC 1BEV1 1WLCA 2NM1A 2YY1A 5E8AA 2BQPA 1EP0A 1N3QA 1KXGA 3B3QE 3PJQA 1Y43B 1CIWA 1MVQA 1OHFA 2NQYA 3SH3A 1BYHA 1S2KA 3RMYA 1O3QA 2VW2A 3VBHA 4BLJA 4C90A 1OKQA 2G4IA 4QQ2A 1S2BA 3PVNA 4XMAA 4GWMA 4S2HA 3WNXA 3ZFEA 4CDXB 3KS7A 2PAMA 4YYOA 4CDQC 1NE6A 3MIEA 3WW2A 1MZEA 4OHXA 3P3NA 4ASLA 1NCQB 2UY9A 1NG0A 1DGRA 2RE9A 2VOXA 4CDUB 4CP2A 5F9TA 4IV1B 3VBRB 1PMIA 2RMU2 4LUMA 4FPKA 3E5XA 1R083 2O1QA 1U0AA 5FREA 2ZKNA 5D8AB 4H7LA 1H9PA 4CDQA 1A6CA 2JJ6A 1ZBE1 2VECA 3PJYA 1JUIA 1EPWA 1MACA 3MPBA 4A3XA 4AW7A 3FFZA 1OQ1A 4K1ZA 4RGGA 1ZYBA 1VBA3 3RG0A 3N3HA 4YM0A 5CFCC 2D3RA 3N7JA 4Q0PA 4LULA 4WM7C 1CJPA 4XJAA 5LRSA 3AXEA 3WY6A 2VH9A 1HQNA 2JG8C 2GNTA 1IPKA 2RR11 1YXWA 4OULA 3ZFEB 2ETEA 2E9QA 1VBC2 1TME1 1OMIA 3O5SA 3EXUA 4XETA 4I0BA 1RUC1 1PGW1 1C8M2 1RJ8A 3UJQA 1IS3A 1JTZX 1UL9A 2NMNA 3ILNA 3ZMOA 1J3QA 3T2TA 5CFCA 1W6NB 4MV2A 2E7QA 4WM7A 1BCXA 1DZQA 2WWSA 4P9JA 4YZ5A 1C1FA 3AYDA 4JRAA 4XE9A 2JG8A 2WLPA 2VG9A 1ND2B 2RS32 1RUJ2 2GH8A 2Z69A 2XPJA 4RHV1 4FT8A 4QPGB 4FOYA 1S55A 2RS13 4MSVA 4CDQB 4HETA 2D3SA 3INAA 3M3CA 2YXSA 4Y4YA 2GMEA 2NPIA 5KXDA 4HVOA 1UIKA 2D6LX 4HT1T 4Y20A 3FJSA 1AYN3 4EWAA 1UMZA 1EAH1 1L3JA 1VBD2 1SBDA 4GIQA 4YNIA 5LEJA 1WBFA 4I3GA 2A71A 3N7MA 2HWB3 2P3JA 2VOKA 2ENRA 4CEYC 1VP6A 1UKRA 1RUOA 1QJX2 1FX5A 4OHWA 5T5LA 1OOPA 4KU8A 4K6BA 2R16A 3IPVA 2ZA9A 5IUQA 2GU9A 3SMHA 4I0WB 1RGSA 2DU1A 3PHMA 2VQAA 2R6QA 1RMU2 5KHKA 4KGQA 2I07B 4GKXA 1DIWA 5FLHA 3S6PA 2DUQA 2VOVA 3LA3A 5C8CB 1G86A 2LALA 2ATFA 5H9QA 2ZHNA 1UPIA 2PAKA 2XVKA 1HKDA 2O0OA 4EN0A 1VALA 4COYA 4Y20B 2VXRA 4OI1A 1FPN3 5LK5A 2NZ9A 3ZXJA 2ZTNA 3OBRA 1HRI2 2DVBA 5GZDA 3TAYA 5JDBA 4YGCA 4BIFA 2CYFA 4H55A 1R081 1UF2C 1PGL1