5KXDA

Wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
238
structure length
238
Chain Sequence
KETTSFVFTRFSPDPQNLLLQGDTVVTSSGHLQLTQVKDGEPVYSSLGRALYYAPIHIWDSNTDTVANFVTSFSFVIDAPNKAKAADGLAFFLAPVDTEPQKPGGLLGLFHDDRHNKSNHIVAVEFDTFKNSWDPEGTHIGINVNSIVSRKTISWDLENNEVANVVISYQASTKTLTASLVYPSSSTSYILNDVVDLKQILPEYVRVGFTAASGLSKDHVETHDVLAWTFDSDLPDPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wisteria floribunda agglutinin
publication title Molecular Basis for Recognition of the Cancer Glycobiomarker, LacdiNAc (GalNAc[ beta 14]GlcNAc), by Wisteria floribunda Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 52
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kxdA00
3WV6A 2DUPA 2EXIA 2OW4A 3AXEA 5DG2A 4XE9A 4FQ4A 1HQLA 1UZYA 3IMNA 4FOVA 1MVEA 2DUQA 3FBYA 4GKXA 4UW4A 5JDBA 3B01A 5DZEA 3BOPA 4FP2A 2D3SA 3DUIA 3WDYA 1A8DA 3AJZA 4CRQA 2ZZJA 3ILNA 1FV2A 1QF3A 3POSA 5DUXA 1LHWA 5CBLA 2D6MA 4YZ2A 3IPVA 1VAMA 1G7YA 1CONA 2UU8A 2H0BA 3IPVB 4H55A 4YG0A 4DFSA 2ZHKA 3N7KA 1AXYA 3PVNA 1ZA4A 3M3EA 1ENRA 2OUJA 4P9XA 1CJPA 2ZGNA 2GMEA 1JUIA 2GMPA 5F9TA 1Q8OA 2DVAA 2EAKA 2E7TA 1LOBA 3TAYA 4Y20A 1IS6A 4XXPA 2GN3A 2DYCA 3IKWA 1SBDA 1IKQA 1JXNA 5DUVA 1VLNA 2XG3A 3MW4A 4IQPA 3VKNA 3FUOA 2DURA 4C1WA 2ZHLA 1W6OA 1GV9A 1AF9A 3OBRA 4Y1XA 3BTAA 5IT6A 4YW1A 2VW2A 3SNMA 2ZGMA 1DQ4A 2P2KA 4ZXKA 4AVVA 4LBOA 4YW3A 3SISA 1FAYA 5E88A 4WV8A 2A3YA 3ENRA 5H9SA 3ZXLA 1S0CA 4Q2FA 1W6NA 4AYUA 5T5OA 3NV4A 1NLSA 4LBMA 4XOGA 2WQZC 4FVVA 2P3IA 3ILRA 1I3HA 2YMZA 4XBNA 4FOWA 4XJ9A 4Y1ZA 1URXA 3UL2A 4JRAA 3WG1A 1WW5A 4YM1A 2R16A 2AENA 3O0VA 4FPFA 3AYAA 5T5LA 4PF5A 2PHFA 3INAA 1C1FA 4Q1PA 2I2SA 3GNEA 5FREA 1GLHA 5GLVA 3WUCA 1SBEA 3POYA 4R9BA 4YGCA 1MS3A 1CVNA 2ZGOA 3JUUA 1WW7A 3N36A 1C57A 1DQ6A 1YO8A 1MS8A 1NXD1 3OJBA 1AX2A 2DVDA 2UWBA 3I8TA 1A3KA 4LBJA 2DU1A 1KQRA 4K1YA 1Q8VA 2NP0A 3QLQA 3V0AA 3OY8B 4BPZA 3PMEA 2PHUA 1S0BA 4KBBA 2DUOA 4YZ5A 4WVWA 3V0BA 2PHXA 1UN1A 3L2YA 3PVEA 2VU9A 2WSVA 2XB6C 3N35A 5H9PA 5HCBA 3AP6A 3VKLA 4TZDA 4M3CA 2E6VA 5H9RA 5KXCA 1X50A 1MS5A 1DQ2A 2DTWA 5T50A 5DUUA 1WD3A 4Q27A 1W0OA 3UJOA 4AWDA 5SV8A 4FOQA 1JHNA 1KJLA 2SBAA 5H9QA 1WW6A 5GJ6A 3T1MA 1JN2P 4ZKTB 2PHTA 1HKDA 1SLIA 1CESA 1SLTA 2DU0A 1LECA 2E7QA 1V6IA 3NV1A 4FPCA 4BQ1A 4XJ8A 3R05A 2AYHA 2LTNA 4YZ1A 4FPKA 1H30A 1CPNA 4GWNA 3WDXA 2R1BA 4BOWA 2WJSA 1Z0HA 3ZXFA 3DGTA 5JMCA 3AP4A 4XMAA 3LSEA 5JOYA 1Y7BA 2GNBA 4XJUA 5JOWA 1WUVA 4YFWA 1B09A 3FLRA 1FYUA 2A71A 2B7YA 2C5DA 2ZKNA 2AH2A 1AXZA 2A70A 3MW3A 5CAZA 2WNEA 2ERFA 2R49A 4YFZA 5IUQA 1I1EA 1UMZA 1AVBA 1DIWA 3M1HA 3N7MA 1SLCA 3H0OA 3APBA 3LCPA 4YM3A 1PZ7A 3WDUA 4Q26A 4WZFA 1ENQA 1FX5A 3ZXKA 1QOTA 2EXHA 5DZGA 1F9KA 3AX4A 1LOFC 4NOTA 1GANA 4I30A 1ULFA 4ITCA 4XJWA 1QNYA 3O5SA 1SLAA 4W65A 2E51A 4YM0A 2VXRA 5EXOA 4P9YA 2JE9A 3WDWA 1QOSA 3WG2A 1IS3A 3AYDA 5F5QA 4U2AA 1GYKA 1VALA 1Z78A 2EF6A 2DWRA 1DBNA 4XDQA 1LESA 1S0DA 4HL0A 4K20A 5AVAA 1MACA 2EALA 2WKKA 4FPHA 4JC1A 1V6MA 4BMEA 3B9CA 1DQ5A 3WHTA 3ZYPA 1FNYA 1KITA 3WCRA 1DQ1A 3OBTA 1ULDA 2W08A 5IK8A 2CNAA 3R4SA 2DVBA 4PCRA 2BQPA 4Y24A 3WHUA 2SLIA 4HANA 4WVVA 2A75A 4ISRA 2P3JA 5EYXA 1CIWA 1LHUA 3MPPG 1SACA 3FFZA 3WUDA 3AP9A 3HN1A 4Y1YA 4XILA 2DTYA 5CNAA 1S0EA 1V6LA 1XQNA 1LEMA 3V65A 1CQ9A 4YM2A 4XHBA 3M2MA 1DFQA 2YZ4A 5DZFA 4ISQA 5T54A 4AVTA 1R1ZA 2PELA 2EXKA 4DQAA 1BXHA 1LENA 1S0JA 1UPSA 2W39A 4R9AA 2TEPA 2GALA 3A4UA 3I4IA 1ZM1A 3WVJA 2VH9A 3SH4A 4R9DA 2EXJA 1BZWA 1LOCA 2WT1A 2NM1A 4P9WA 4YGEA 3O0WA 3VKMA 5T5JA 5GALA 4FPGA 1SFYA 2ZGTA 4YZ4A 3WZ1A 2DVGA 1AX1A 1Q8QA 1VIWB 1G86A 1N1TA 2ZMLA 1N3PA 4YW4A 4UW5A 3T2TA 3NV2A 2VUAA 3AZXA 2ZAAA 2JJ6A 1G9DA 1C1LA 1GZWB 1GKBA 1IS4A 3AZZA 1G9CA 4NO4A 2ZMNA 4GWMA 5LK5A 4FPEA 5GZEA 1DLLA 4ATFA 5BYNA 3VUOA 5IK4A 3M3QA 3OY8A 4LBQD 1SLBA 1V6KA 4M3CF 5DUWA 3TB0A 1MS1A 2V5YA 4FOYA 1W0PA 3AZWA 3D4KA 3SH5A 1GNZA 3ZSKA 1YYNA 2ZMKA 4JCKA 4DPNA 3QCWA 5JLVA 1CN1A 3ASIA 4RL7A 2P3KA 1AX0A 3LSDA 5T52A 4Z8BA 2PHRA 3ZPYA 1ULCA 1GBGA 4LBQB 1MS9A 3M3CA 3UK9A 2A3WA 4YZ3A 2W68A 1QOOA 2D3PA 4GALA 4RA0A 3MW2A 2D43A 2P37A 2ZGKA 2D3RA 4Q8KA 5CA6A 1A78A 1S0GA 3JU9A 3GALA 4GA9A 2D7FA 4U36A 2P34A 2GDFA 1AJOA 4AGRA 4LBKA 3U4XA 5IK7A 1W6MA 4Y1VA 3HMYA 1N1YA 1SCSA 3ZSMA 2ES3A 2A6ZA 1W6MB 2ENRA 2ZHMA 3C2UA 5FRAA 1N1SA 1HDKA 2D6KA 3CNAA 1V6OA 5T55A 2JD4A 2VW1A 3USUB 1QU0A 1UL9A 2GNDA 1V6JA 2DVFA 2LALA 4XYXA 1QKQA 5GZDA 1WD4A 1EPWA 5HCAA 4YLZA 3ZXEA 1LULA 1LTEA 2FMDA 4Q8LA 4C1XA 1LOGA 4XIOA 1KDKA 5L73A 2C9AA 2FHRA 3ZSJA 4FQZA 3ZVXA 1LEDA 5CB7A 4DRRA 4XMIA 5JVVA 4BM8A 2A3XA 1WCSA 3AZYA 2A6XA 2CYFA 2W52A 4FPYA 3O12A 4AVSA 4UW3A 2R0FA 1MZ5A 1S1AA 3ZXJA 2NN8A 2CWMA 2E53A 2ZGPA 3B3QE 2JECA 2YV8A 1LOEA 1U0AA 2EIGA 4M3CE 3WNXA 3V64A 1S0IA 3ATGA 1ENSA 1QMJA 1DYKA 1SCRA 1W6PA 2R1DA 4XBQA 1UZZA 4PQ9A 3RG0A 3OYWA 2PHWA 1W6PB 1FATA 3NV3A 5T5PA 3OYWB 2VY0A 2AGSA 4XZPA 1CPMA 3O0XA 3RMYA 1LHVA 5EYYA 3RSJA 2JKBA 5E8AA 2YY1A 3ZSLA 4XJAA 3AYCA 1LOFA 1MR5A 4FPOB 4PBPA 3SH3A 1Q56A 1D2SA 3FLPA 2AUYA 2NMNA 3N3HA 1JYIA 3IM0A 3R4UA 1WBFA 2HYKA 4M00A 4XBLA 1LCLA 1N1VA 5GLWA 4DS0A 4XIKA 1D0HA 1QDCA 1WBLA 2WT2A 2AR6A 2ZGRA 3D6EA 1F31A 1FV3A 2NYYA 2GNMA 1YI7A 2R0HA 1CR7A 4GKYA 1UKGA 3VKFC 1LHOA 5EWSA 1WLCA 2UWCA 1G9AA 2A6VA 2WLQA 5GZFA 1Q8PA 4P14A 4XXAA 4BLIA 5GZGA 1MZ6A 4BMBA 3AP5A 3W58A 2UURA 3WG3A 5KXEA 1S0FA 1GZ9A 2CTVA 2CL2A 4YGDA 3SLIA 3AJYA 3T1LA 3A0NA 1YXWA 4FPLA 1QNWA 2D6LX 2NMOA 4TYSA 4UW6A 4YW5A 2D6OX 3SITA 1DYPA 1F5FA 1AJKA 1LU1A 1ULGA 2WT0A 4Y20B 2D44A 4CTEA 5GZCA 3RQ0A 1ULEA 1AZDA 1WW4A 2JE7A 1GICA 4GXLA 2G4IA 3BODA 3WDTA 1JW6A 2DV9A 5E89A 3FLTA 4OZXA 1ONAA 3N7LA 1W6OB 1VAVA 1HLCA 1MVQA 1RINA 2KM2A 2YXSA 1UX6A 1GZWA 1QDOA 4Y1UA 1G8WA 2GNTA 2JDZA 2ZGQA 1OQ1A 4ASMB 2A6WA 4YW2A 4R9CA 5DXDA 5GM0A 1JYCA 1DGLA 1PZ9A 1UAIA 1W6NB 2RHPA 3BIWE 5HCFA 3WG4A 1DHKB 3A0KA 1H9WA 3VV1A 3UJQA 4FP3A 4L8QA 5IK5A 1OFSA 2ZHNA 2Q5TA 1WLDA 4XHXA 2GN7A 3RS6A 2CY6A 1J1TA 1N47A 3AXDA 3NWKA 4LBQA 1GZCA 3VKOA 3PJQA 4BLJA 1QGLA 4XJZA 4YGBA 4XTPA 1G9FA 3HR9A 3IN9A 3WCSA 3M3OA 3AYEA 1KRIA 5GLUA 1N3OA 5JOXA 3D5OA 4D69A 4PBOA 1IOAA 1YRZA 3AFKA 4XTMA 1LJ7A 1LOAA 1BYHA 1O4ZA 1O4YA 2D6NA 2OUHA 3AP7A 4K1ZA 2V73A 1JBCA 1IKPA 1AXKA 2ZGLA 1V6NA 4Q1RA 3RMXA 3N7JA 3W59A 4CZSA 1V00A 2WSUA 4YG6A 4YG3A 2ARXA 1JOJA 1LU2A 4LBLA 3V0AB 1MS0A 4DRVA 1WLWA 1BQPA 1GNHA 1TEIA 2ZGSA 3USUA 2NZ9A 3WLUA 3Q9OA 2A6YA 3KM5A 5JOZA 1Q8SA 3V0BB 1SBFA 3PVOA 2AREA 2ZABA 1LGNA 4K21A 3POWA 1IS5A 4M3CB 1RIRA 1YIFA 2UWAA 1C4RA 4LBNA 2ARBA 5GLTA 2ZBJA 5GLZA 1MS4A 3ILFA 3AZVA 1N3QA 2YROA 1LGBA 3MEPA 5DG1A 4SLIA 2A5ZA 3WOGA 2OVUA 3WDVA 3ZYRA 1KJRA 1SLLA 1LODA 4F83A 3OPZA 2ZACA 1BJQA 1KDMA 2ZGUA 2VW0A 2Z42A 2ZA9A 3FUQA 1OKQA 1LHNA 4FPJA 4Y22A 3B69A 2GMMA 3B00A 3RRDA 1BKZA 4Y22B 2A7AA 2D6PA 1W6QA 5KXBA 1GSLA 2CWSA 1HQWA 1APNA 4Y26A 4AGGA 1LGCA 1PZ8A 4M01A 1W6QB 1DQ0A 3AK0A 3KQRA 4AGVA 1G9BA 1FNZA 1DZQA 4MYEA 3OGGA 1H9PA 5KXDA 1RITA 4ATEA
chains in the Genus database with same CATH superfamily
2DUPA 3AXEA 2OW4A 4A4AA 1J84A 4FAGA 4XE9A 4FQ4A 1HQLA 2G19A 4UW4A 3LIGA 1MVEA 3SKJE 4IERA 4QD2A 1J3RA 5F5AA 4A42A 4NIAA 1UD1A 3ITQA 3R6SA 2RM22 2WN2A 4YVSA 4QXCA 3WDYA 1S2EA 1O5LA 2WZR2 3GBFA 1NAEA 1OT5A 1FV2A 4RS5C 3POSA 4PLMA 5DUXA 2D6MA 2WZR1 4XDOA 4HFSA 1F4AA 4YG0A 5ANQA 3H9AA 4NRQA 4M0NA 4NIGA 3N7KA 3WF4A 2ZX1A 4S2DA 2RDRA 4RS5A 1ND2C 2X5IC 2GMPA 4LT5A 2DVAA 4IGOA 1XYNA 5K4LA 1GQHA 4RS5B 3I2FA 2CDOA 2WO7A 4Y20A 4XXPA 2IVIB 3VZLA 2VQAA 2GN3A 2DYCA 1NXMA 3IKWA 4NAMA 4OZOA 3SCGA 1UYYA 2HWE3 1ODMA 3PNAA 3T0AA 2EIBA 2XONA 3VKNA 1PVC3 2DURA 4QDRA 4C1WA 4RQPC 2RG4A 2ZXQA 3OBRA 1AF9A 4G4FA 1ND2B 1MZFA 2X5IB 1CAWA 1VMFA 2A1XA 3BTAA 2LUWA 4ZXKA 3UGFA 1US3A 1JH5A 1WA4A 2JB4A 4COVA 1FAYA 2B46X 4EWDA 3FHQA 5A3TA 3ZXLA 2A3YA 3ENRA 4HVQA 1S0CA 1Q43A 4Q2FA 1JMUB 4DINB 4DUWA 5FZHA 4AYUA 1JHJA 3KV5A 1GMMA 2WQZC 4RQPB 5J48A 2B5HA 1PK6A 2MEV3 4Y1ZA 3UL2A 1URXA 5C3PA 3S7EA 1HB2A 1WW5A 2R16A 2AENA 2WYSA 2E31A 1PX3A 4FPFA 5T5LA 3B93A 4PF5A 2HWC1 1JZ8A 4LIUA 4LOTA 1WMFA 2PHFA 3SEEA 4B29A 4LA2A 3INAA 1C1FA 4LKDA 3C7HA 4LEJA 4O9EA 4E8CA 4EJRA 3ECQA 3MIEA 1K12A 5KHIA 1W9TA 2VZUA 2IXLA 2UYAA 1DQ6A 3VBSC 5A70A 4NPMA 1COV2 1QXPA 3OJBA 5LCWL 2DVDA 2UWBA 4BU2A 4LUKA 3NKGA 1AL0G 1Q8VA 3K77A 4MX3A 3OY8B 3O14A 4JKKA 5FDBA 1EUUA 1JU4A 1UY1A 2Y6KA 3TNQA 4YZ5A 5L9VA 4OHWA 1VBD1 2XB6C 3N35A 2W46A 2WQ8A 2WA3A 4KU8A 1CD3G 2Y64A 4FXKB 3VBSB 2P17A 3VKLA 4TZDA 5KXCA 1X50A 4QQLA 1UY4A 3VBHC 2WZ8A 5LBFA 5E16A 1VMHA 3KGLA 5A80A 4A41A 4CDUC 2WZR3 1DGRA 3VBUC 4AI1A 3HVDA 3UJOA 2JIJA 5C5UA 3BKZA 3B9IA 4OYUA 5SV8A 4QKDA 1JHNA 3E97A 4BQ3A 4CP9B 4UI9L 4BDVB 1QJEA 1JI6A 2DU0A 3VDBA 5DMYA 4I3PA 4K6BA 3NV1A 3VBHB 3E6DA 4N43A 4PI0A 3VBUA 4XJ8A 3H8XA 1ZZCA 4MGQA 4CDUB 2TNFA 4CCNA 3H8OA 3I3MA 3VBUB 4N43B 4LPLA 4GWNA 4MH0E 4MXVA 3T08A 4XW3A 3LOBA 5FUIA 3GCWA 4D3WA 4OI0A 4EWAA 2BFUL 3ZXFA 3DGTA 2P6CA 2XJTA 5A1AA 3LSEA 2VCBA 3POIA 1AYM1 4XQWA 2C6SA 4XQDA 5A7WA 4JZRA 1BEV1 2A71A 5FYCA 4GJZA 3NNLA 3FFQA 5CG8A 2AZ5A 5B2GB 4QX1A 2E32A 3ZKYA 3RWKX 3E5UA 1CZVA 2PLV2 2IXCA 2VNRA 3LD8A 5IUQA 4TLGA 4Y3OA 3N7MA 3VDDC 3E5QA 1SLCA 2YG0A 5FKCA 3H0OA 2PLV1 4XUPA 1J1LA 3TBDA 3LEKA 1PZ7A 2ORZA 4RGAA 3WW3A 2BPA2 1FX5A 4PDWC 5E1RA 3ZXKA 5DZGA 4OQ8A 1CWPA 4NOTA 4DZGA 1LOFC 2HWC3 1GANA 2J7MA 4ITCA 3JB4C 5T3NA 3ZO0B 4AZZA 3VDDA 2JG8C 3WF1A 5C33A 3VL8A 2OX0A 2RJ2A 3VDDB 2YC2A 1OA4A 3H1YA 4A45A 5EQUA 4NAOA 4XAEA 3I2IA 2J1RA 4PDWA 2W9XA 1QXRA 4I01A 1O91A 1TQ5A 2AC1A 4PDWB 2X53S 4BMEA 4N9HA 2CSGA 1DQ5A 1UNBA 2Y0IA 4V2WA 2YB7A 2JG8B 1FNYA 3AFGA 1SQ4A 5L7OC 1DQ1A 2XVGA 3K3NA 5B4XA 2W08A 5A32A 2RDSA 2R041 5EFUA 5A32B 3FJSA 3H1WA 2ID4A 2VQUA 4MXWB 1VBD3 4DXZA 4Q0SA 5A3MA 4QMAA 5K8SA 1W04A 3AP9A 2BVVA 5F6LB 5FMDA 3BTZA 4XF0A 4Q0QA 4QX3A 4IETA 5DAPA 3CL1A 5CNAA 2D97A 5C5TA 5HV4A 4ET7A 1XQNA 1O3SA 4LQRA 5BNPA 4FAHA 3AMQA 4XHBA 3O1TA 3TN92 2BV4A 1DFQA 3JQXA 5DZFA 4JKMA 3QD6A 5IYYA 4QX5A 2EXKA 4QU1A 3DYOA 1LENA 3TN91 2W39A 3DKQA 4LIVA 4AOCA 1LNSA 1YLLA 2GALA 2JKXA 3A4UA 3I4IA 4MGTA 3WVJA 4KI5M 2VH9A 4HG6B 1JOBA 3IZOA 4R9DA 1LOCA 4BJ0A 2ZKLA 5A6ZA 3PHMA 1UXXX 4P9WA 1FOD1 1CZSA 4A2UA 5T5JA 5GALA 4W8JA 3WZ1A 4YZ4A 4JQTA 1ULOA 3KWVA 4H7LA 1N1TA 2ORXA 1AYM3 4UW5A 5J96B 4E8DA 1BEV3 3P5BA 4GZ9A 4K7JA 4I0WB 2D5HA 3D3AA 3PIJA 4CUAA 4J6GA 2FDJA 4FPEA 2OQ7A 2VOKA 4I02A 4NWWA 3VUOA 2J22A 3M3QA 4XZUG 1O8PA 3HNYM 3TB0A 5J37A 4QDQA 3M3IA 4P9JA 2Q8CA 2V5YA 5SV5A 2PLV3 1GNZA 3NO8A 4DPNA 3QCWA 3I59A 2OYZA 5FO9B 3PVBB 2DCKA 4RL7A 2ZEWA 4Z8BA 3POJA 2QQMA 1OC1A 4OHXA 2PHRA 3ZPYA 1EUTA 4DUXA 5LWBA 4EN8B 1GBGA 1Y9QA 2XPJA 1MS9A 3M3CA 2ZZQA 3UK9A 1OH3A 2A3WA 1HJFA 1QOOA 4YZ3A 5JI7A 4HBNA 1ZBE2 3LA2A 2ZS6B 1H2NA 2HWD2 2XJRA 2FQPA 5F37A 3EYPA 1A78A 3N9PA 1H2MA 4QQHA 1ZBE1 4QHOA 2HWD1 1ULPA 3IDCB 4LBKA 4QAWA 4AG4A 2CAVA 1W6MA 3FHIB 4Y1VA 3I49A 3HMYA 1ZZ9A 4QX2A 3H3LA 1QQP2 1W6MB 4IW3A 2ENRA 5CFCC 4S2GA 3RJ2X 2R043 2FZ2A 5FMCA 4GWJA 5J09A 3USUB 1UL9A 3E1F1 1V6JA 5JSOA 5FCCA 1QKQA 1OBNA 1WD4A 3KHBA 2VZTA 1X33A 1LULA 3P1IA 2W1WA 2YGMA 5JMOA 3PIGA 4R4ZA 5CFCA 1KEXA 5C3RA 4QXHA 4AVAA 3QH7A 2E33A 3EHKA 1M4WA 5CFCB 1CJDA 1IG3A 4FO9A 2A3XA 3AKRA 5F32A 3UT0A 3WNNA 4Q4X2 5FZCA 1S55A 2W52A 4ARXA 3O12A 2Y26A 3EBRA 3TN93 2R0FA 1S1AA 4XAAA 3GDBA 4PHZA 3KV6A 4Q4X1 1XNAA 3B3QE 3T09A 1W9SA 3WEZA 2YV8A 1LOEA 1R1A2 1PNFA 3I2GA 2XQRA 3WNXA 1GWMA 4XBQA 1SCRA 1DYKA 5FZBA 3T2QA 5LB6A 1UY2A 2XLAA 4PQ9A 5J3UA 1FOD3 3KF3A 3ST7A 1GR3A 2PA7A 3T4HB 1SHWB 4GWIA 4Q4V2 2WBKA 1K5MC 5BNQA 5C3SA 3LEIA 1LHVA 4Q4V1 4INDA 3RSJA 2BWAA 3I2HA 4GB32 4JTNA 4META 1MR5A 2AUYA 3NJVA 5K7PA 3IM0A 3R4UA 1O6UA 1OD5A 3OB8A 2HJIA 4LLFA 4RGGA 2O0OA 1VBC2 2CV6A 1K5MB 1PO12 2Y60A 4XBLA 4XFBA 1N1VA 4XUQA 5F5CA 4DS0A 1D0HA 1QDCA 5BV6A 1BLZA 1VBC1 4AHZA 3IBMA 3FX3A 1PO11 2FMYA 1VBA2 3K75B 4CDWC 1Y9GA 3H42B 1XNDA 4GKYA 1UKGA 1YQ2A 4N9IA 2FDFA 3AMNA 1OKOA 4NHYA 1G9AA 4BLIA 3K2OA 3WT3A 2HEWF 3JB8A 1LR5A 4BMBA 2JEMA 2GC1A 2UURA 3W58A 3LAGA 1ZBE3 4CYDA 5KXEA 2HWD3 2VZOA 2QE3A 4CDWB 2CTVA 3SLIA 3E5XA 2W92A 3MLKA 5F3CA 3N4MA 2NMOA 4JQRA 4ZS3A 3VBRA 2RS52 1HJGA 3ZYJB 2RDQA 1AJKA 3TOJA 2AACA 2V5DA 3ES4A 3FBMA 2RS51 1GICA 1OURA 3HPNA 3WDTA 5E89A 3FLTA 2OIIA 2GU9A 1HN1A 2YGLA 3C7FA 2BZDA 3N7LA 1EY2A 3OPWA 4GH4A 1VAVA 2P3YA 1RINA 1UX6A 1GZWA 2NPIA 3V56A 3WINE 2GNTA 2XVKA 2PHDA 4LO5B 3FHAA 2Q8DA 5DXDA 5GM0A 3BIWE 1XNTA 1FT9A 4I0BA 3WXPA 2XGXA 5FLHA 2ZCWA 3VV1A 4JDMA 2YBKA 3SHRA 5C3OA 2Z5WA 1FI2A 1JYWA 4Q4X3 1UX7A 2X29A 2ZHNA 4J1XA 1JZ2A 4CUCA 3NNJA 1TMF1 4W50A 3RS6A 1DCSA 3VZNA 3NWKA 1SFPA 4W6WA 4QU2A 1GZCA 5ERLA 2VMDA 4XVHA 4IV1C 3VKOA 4MG2A 3GHNA 1W06A 4LKFA 4E2QA 1SG3A 3WCSA 3AYEA 1MQTA 1KRIA 1RHI2 1YWKA 1D2QA 2RMU2 3D5OA 4Q4V3 4XFIA 5GKAC 1LOAA 1MQTB 4XXAA 1O4YA 2XJUA 2V73A 3I2OA 2ZGLA 2ZEXA 3RMXA 2TUNA 1C8M2 1OF4A 2HWB2 4IV1B 5FZ8A 4YG6A 2DBIA 4XUOA 1C8M1 1GP6A 2FDHA 1BQPA 2JDHA 2HWB1 1TEIA 5APAA 3G6JB 3WLUA 2HWF1 3Q9OA 2A6YA 5JOZA 5FPAA 1IHMA 1GUIA 1RUH2 1VBC3 3POBA 1PO13 3PVOA 2AREA 1CAXA 3HQXA 4IEQA 4K21A 3POWA 2WWSA 3DECA 1QY4A 1CAXB 4GQ7A 4BA6A 4RFT0 2VG9A 1C4RA 4LBNA 5C6CA 1H1IA 3AZVA 5BNNC 3CJIC 2WWUA 5C8CA 5DG1A 1WWYA 2A5ZA 3ACIA 5LA0A 5FAXA 3LA3A 3WDVA 3ZKUA 1KJRA 5FQ0B 1IQDC 1SLLA 1WCDJ 3ZIXA 1X9TA 3VBFC 2VZ3A 5IVCA 2YUEA 1GU3A 1WCQA 5FV3A 3TEZA 4IE7A 2ZA9A 2GH8A 4AAXA 2WA4A 1OKQA 4CUBA 2VOWA 1VBE2 3CBNA 2RS53 3Q8BA 3B00A 4EQVA 2VQ0A 1JU3A 4HONA 5FXWA 5BNNB 3CJIB 1KXGA 1ZA7A 1ZZ6A 1GSLA 3I3BA 1HQWA 3VBFA 2ADEA 2PAKA 1DQ0A 4J1WA 3VBFB 1WLTA 3FN9A 3KQRA 1DZQA 2F4PA 3JBG2 4KGQA 3PUIA 1RUF1 4CPBD 3RZHA 1RITA 5A3UA 1UMIA 3JBG1 1W9FA 5DG2A 3MV01 3VL9A 4FOVA 3IMNA 2XKPA 4O65A 3OGVA 4DXSA 1GWLA 1OUXA 5DZEA 4AE2A 1JYVA 1YI9A 3BOPA 1ZYBA 3DUIA 3WP3A 4L2NA 5CG9A 4ZONA 5F3GA 3OGJA 1L7QA 2XBO2 1TMF3 1E57A 2JDNA 4IE5A 1D4M1 3ILNA 3M7AA 1RUJ1 3AVSA 2XKOA 2XBO1 3MBWA 4LO8A 1OLRA 4KG0A 2O8QA 5F5IA 4JDNA 2B39A 1Q3EA 1UYPA 2XVLA 1QJFA 1J83A 3PVNA 1ZA4A 3UV9A 5C4WA 2ZGNA 5KHGA 3H50A 4XPVA 3POGA 2R6QA 2VL4A 1J59A 4DY3A 2VMGA 1UW8A 1LOBA 1L7LA 3WNLA 5FYIA 1C8M3 2VM9A 1IKQA 4B1MA 1PO21 1W39A 2HWB3 4COZA 5DUVA 2ET7A 3B02A 5F2SA 2HWF3 3MW4A 4FTBA 4IQPA 3NJZA 3PUHA 2OT7A 3FUOA 3OEBA 1V70A 2F17A 2ZHLA 1W6OA 3QACA 4P9IA 4XUNA 4AFDA 4Y1XA 5D2AA 3VHPA 4Y5SA 4IEXA 2N7GA 5JR7B 3CEWA 3OUIA 5IT6A 2VW2A 4D94A 3SXWA 2ZGMA 5IVVA 3J7MA 4LBOA 4QPGC 4YW3A 3SISA 5E88A 3S57A 4WV8A 5CKQA 5F1RA 1HRV1 1PGL2 4XOGA 2JE8A 2HYXA 4UFMA 4FVVA 4D0QA 1XJAA 1PGL1 1W0NA 2K46A 2R072 3BVCA 4QPGB 3GBWA 2R7EB 3RZGA 3N9LA 2QUOA 4UFIA 4A7YA 3CLPA 2R071 2PAMA 4Q1PA 1GLHA 5FREA 5I8TA 5GLVA 3AVRA 3FL7A 4RD7A 3POYA 1VBE3 2ZGOA 5K0UC 2EIEA 2D93A 1C57A 4JHTA 4LHSA 1YO8A 3OBZA 2WDBA 1NXD1 1RUF3 4YVWC 4QHZA 1IPJA 3I8TA 1A3KA 5FYSA 3WY6A 2DU1A 2BNMA 3JBG3 1KQRA 4JGYA 4AEDA 3ORJA 1PMIA 2VQTA 2VZSA 1E5HA 2KXLA 4Z1VA 1VJ2A 4KWLA 2VZVA 2RE9A 2BUKA 3C8XA 5K0UB 1DDLA 4KBBA 5FY4A 4RYDA 4XCAA 3S6PA 4ASLA 4WVWA 3O1RA 2CGPA 2A73B 3U0ZA 4YVWA 2BP6A 3PVEA 1NE6A 2WSVA 4KU7A 1FMD2 5FTTC 3O1PA 3RI9A 5H9PA 5HCBA 1NQJA 3AP6A 4YVWB 4M3CA 4LHNA 2E6VA 2WZEA 5IFPA 1D4M3 2DTWA 1FMD1 5T50A 1RUJ3 3KSCA 4E2SA 2XBO3 2XQXA 4IEWA 2EVXA 2XJPA 2JXAA 2QQIA 4RHV1 1AR82 3M70A 3UNPA 2SBAA 2WINB 1R082 2CAUA 1AR81 4CSWA 4MV2A 1POV1 1UXZA 1RUI2 1SLIA 2E7QA 1SLTA 4HPKA 1I5PA 3NAPC 1R081 4JX0A 1NOVA 3VZOA 4HPKB 1UIKA 5A33A 2LTNA 3RPQA 2FD8A 4FPKA 2G9FA 2QQOA 4MGKE 3NJYA 4RR3C 5FPVA 1PO23 2R1BA 4BOWA 5A33B 5HPOA 2R32A 1Z0HA 4B4RA 4UFJA 4DY5A 4QGMA 4XMAA 3JD72 5JR2A 1UU4A 2QZ3A 3NAPB 5JOWA 5FY7A 1XU1A 4RR3A 4YPJA 5JIUA 5LBCA 4NWVA 3JD71 3KZ4C 5CFDC 4TTGA 2DDUA 3ZFEA 2AH2A 2A70A 4RR3B 4ZS2A 4D7YA 4DXTA 5CAZA 2VE1A 2R49A 1HRV3 2WNEA 5J1XA 1I1EA 4IESA 2BDRA 1DIWA 1PHMA 1XBFA 5CISA 2OPWA 3LCPA 4YM3A 2PN5A 5FZ1A 4K40A 4UYBA 4CPBA 1ENQA 1QOTA 4ONUA 1F9KA 2WR9A 3AX4A 2Z69A 4XJWA 5EV7A 1ULFA 1AR62 4OULA 1BMV2 5FBJA 4IGPA 1W03A 4QKBA 5FMOL 2E51A 2BBVA 2R073 1O3TA 2RM21 2VXRA 3LPFA 5EXOA 5FUNA 2YU2A 4MGZE 3CZUA 1IS3A 3KVBA 2IXHA 1GNYA 4U2AA 5KBFA 4XQ4A 3W21A 1VALA 4GAZA 5JIAA 3MUY1 2ZX0A 4XDQA 1YIPA 4HL0A 4IUGA 1MACA 2EALA 4JC1A 2ZOEB 5FZ3A 1GOHA 1RXFA 1RB8G 1DGRN 2JDMA 4LHLA 4XFHA 5A3PA 4IEPA 5JXHA 4SBVA 4LE3A 3I3QA 3KVAA 1UU6A 2VZPA 4PCRA 2BQPA 1ODNA 2Z4FA 2SLIA 4HANA 4WVVA 3WHUA 3AL5A 3DXUA 2IXJA 4LO4B 1LHUA 1DU3D 1SACA 3FFZA 1ND2A 2X5IA 2CHHA 3HN1A 4UFKA 4Y1YA 1YQCA 1VRBA 1RYYA 1FMD3 2DTYA 5DDJ2 1ZRDA 4E2GA 1S0EA 1H4HA 3K4AA 4KMQA 1M06G 4N53C 4C91A 4RHV3 5C7GA 1CQ9A 1L7RA 2GSYA 1W28A 3M2MA 4AVTA 1ASJ2 1AR92 3GZAA 5ANNA 4OHVA 2ADDA 4DMIA 3FMGA 3OGSA 4RQPA 1AR83 3KV9A 1POV3 1ASJ1 1R083 1X36A 4IGQA 4AI9A 1ZM1A 4N53A 1W99A 4BK4A 5IVJA 1RL3A 1BZWA 2W1UA 4N53B 4PQQA 3NJXA 3LE0A 3VKMA 5FFOC 5K9YA 4Q4Y2 2DVGA 1Q8QA 1UPIA 5FZIA 3ZDVA 1NQDA 5EJ3A 1VIWB 4IEOA 1N3PA 4EE2A 4YW4A 4Q4Y1 4D8MA 3IB3A 2E9QA 3MHZA 1WMEA 4IV3C 4JDOA 4NMIA 3NV2A 4R52A 3U37A 1TZOA 3AZXA 3J7LA 1IGOA 2ZAAA 3JD73 1C1LA 2VTXA 2LS6A 1IS4A 3AZZA 4NO4A 5JUVA 1NLRA 2DF7A 4XUTA 1HN0A 2WABA 3OY8A 1SLBA 4OUSA 4M3CF 1IZ3A 1U12A 1RUNA 4EN0A 1COV1 1A8MA 5FY5A 3T0DA 3MICA 4UBGA 3AZWA 5FWEA 3ZSKA 1W2NA 3HQUA 5I0SA 1YYNA 1B35C 4DIQA 5FPBA 4IV3B 4QB1A 3VBSA 5JLVA 1REDA 1CN1A 2P3KA 1AX0A 2WQ4A 2IUWA 5T52A 1NA1C 2GAUA 5FZ4A 4KGGA 4CP9A 4XACA 1W8ZA 4AL9A 2D3PA 2RM23 4RA0A 2BYVE 1T2XA 2V72A 2ZEZA 2OPKA 2D43A 3KMHA 3MW2A 4GULA 4NHLA 4PIYA 5LA9A 3NQHA 3WQ7A 1YQ6A 5IAVA 3W20A 5CA6A 1B35B 2Y6FA 4GA9A 1GFF2 4CUGA 2GDFA 4I0AA 3VD7A 1AJOA 4AGRA 4O61A 4JAAA 1NA1B 5BUVA 3EMRA 3VBHA 1N1YA 4B7KA 4CDUA 2A6ZA 4LE4A 2FCUA 2JDYA 4PIZA 3C2UA 1NUKA 3HD8B 3KGZA 3MLJA 2W2IA 5T55A 2VW1A 1PGSA 1HW5A 2HEYF 2IC1A 2VULA 5GZDA 3ELNA 1EPWA 3O7OA 2XLFA 3ZN4A 5HCAA 1K42A 4Q8LA 4MSVA 2G1MA 1REEA 4FBFA 2JWPA 3KCYA 4COUA 3O1SA 3VHRA 5CKNA 4FQZA 4OUMA 4YRDA 4XMIA 2VPVA 4AVBA 4AQ2A 1TE1B 5JVVA 2BGCA 3WNMA 3MIFA 5FJHA 4LLOA 4AVSA 4L0PA 3S5QA 4LKEA 1HQNA 1ASJ3 2CWMA 2E53A 2ZGPA 2VMCA 3OG2A 1X8EA 3NKTA 4AXOA 1S0IA 2KR2A 1ENSA 1BK1A 1PIV2 1UZZA 3NL1A 3OYWA 2HH9A 5T5PA 2TBVA 3OYWB 4MHUA 5AVPA 4CP1A 4K8FA 5ABJC 3BTXA 1ST8A 3RMYA 4Q4Y3 5F2WA 2O8OA 3KT4A 5EYYA 2K9ZA 1ZRRA 1QJZA 5JI9A 1LOFA 3RI8A 2QBXA 5CZKA 2PMWB 4QQPA 5HI0A 4CCKA 1CGPA 2JG8A 3W5MA 1JYIA 4NUBA 5FP8A 1IQAA 3W5NA 4AK3A 3L9JT 1COV3 3ZDSA 1RUG2 4M00A 1LCLA 4QM8A 3TNPB 2BOJA 1WBLA 1ZBA2 2WT2A 3DPRC 4XIKA 4MXWA 4PI2A 1NY72 1RUG1 2ZTNA 3U78A 4P9GA 5HXVA 1T6GC 3N9MA 3WNKA 1H4GA 4WM8C 5BY5A 4RSUA 4ZXEA 5JXGA 2XJVA 5LBEA 1NY71 5FPUA 5L7OA 5GZFA 2WLQA 1Q8PA 3DN7A 5C9AC 3MYXA 1CIYA 1MZ6A 5L7OB 3B7MA 3ZR5A 2HBTA 3D82A 5IVEA 4HN0A 4B3NA 2JG9C 3DPRB 5FZ0A 2VOXA 1HXS2 3DKWA 1S0FA 2JX9A 5A6QA 2VMIA 2CL2A 3P3PA 3T1LA 3AJYA 3G7DA 4WM8B 1QNWA 2D6LX 4TYSA 3ZMNA 1I5ZA 1OLME 1DYPA 1LU1A 1ULGA 1U5XA 5C9AB 3RQ0A 2EAAA 4FT8A 4M4PA 3RZZA 2G4IA 4HT1T 2WNUC 1J3PA 2JG9B 4X8PA 5I93A 1JW6A 4QWNA 2I07B 1RUD2 5FYHA 5EJ1B 5JWPA 4OZXA 2WS92 5F8PA 4ES8A 2EICA 4L9BA 1OA3A 1MVQA 1LKNA 3WW1A 2YXSA 1OMIA 1QDOA 5I0RA 1VBB2 1W8OA 1OQ1A 2WNUA 4M4RA 2B8MA 4CU9A 3WG4A 4UFHA 1W6NB 5HCFA 1VBB1 2VCAA 2WNUB 1UIJA 1DYOA 5A1FA 4CEWC 1H9WA 2KA3A 3HEIA 4DEQA 5CVRA 4FP3A 5LEJA 4BXSV 4X8NA 3PLQA 3LOIA 2CDPA 1WLDA 2R30A 2ZPXA 2GN7A 2BFUS 1OOPC 1VPHA 2BEOA 3GJBA 2CY6A 3F95A 4LA3A 3BI3A 4C90A 5BNOC 3N9OA 1QXJA 1Y9MA 4QX7A 1GWKA 1A6CA 3OD4A 5L36A 5LRRA 1K5JA 2WNOA 1G9FA 2L9LA 3IN9A 5CKMA 3HAGA 2VC9A 1X9PA 1N3OA 1U5ZA 1YRZA 4PBOA 3AFKA 4CEYC 1VAKA 1BYHA 2QJVA 2D6NA 4FFIA 4Q1RA 4K1ZA 3TYJA 1V6NA 3BB6A 4CZSA 3N7JA 3W59A 3J7HA 1TVGA 2WSUA 3UGHA 1ZVFA 4Q5OA 5BNOB 1JOJA 4H7MA 4LBLA 3V0AB 1MS0A 1WLWA 1EV12 4RFRB 4XF3A 4ZZ8A 5FZMA 4P9LA 3USUA 4CEYA 4EN7B 2PHLA 5FIXA 1QQP1 1W9WA 4CEYB 1EV11 3WF2A 4YSFA 3V0BB 1RUG3 2WFPA 3H7YA 2WRAA 1LGNA 1IS5A 3IIAA 2W94A 4D7TA 3RZMA 3ZMOA 1STMA 4UBHA 3LA7A 4IDZA 2ZBJA 3KCCA 4Z82A 3DCQA 1ACCA 1N3QA 1XYPA 2GP3A 5FZOA 2Q30A 3JQWA 3H1MA 5EP9A 2IFWA 4AI3A 4BIOA 1UYXA 4B1LA 1NZIA 1SPPB 2XL9A 5FZOB 2WZPP 4AW7A 1ENXA 1WGPA 4XFCA 1LODA 1H8TC 3MIGA 5FZAA 3T4VA 5FOJB 4V1PA 2OA2A 1BJQA 1KDMA 3GYDA 5DAVA 4ASKA 2Z42A 4ES9A 4OI4A 4FPJA 4Y22A 3ABZA 4AI2A 3RRDA 1BKZA 2FCTA 1OVSA 3A7QA 2ZAHA 3K48A 1R1A1 2D6PA 4Y22B 1UOFA 3HNMA 3OUHA 4Y26A 1H8TA 3CQOA 4QPWA 2IZWA 1UYZA 5F3IA 4AGGA 1PZ8A 4ZPIA 1ZRCA 2YYOA 1H8TB 1CZTA 3POFA 5IATA 3U4SA 2X09A 2BW8A 1JOPA 1XSQA 1PM4A 3W9AA 5F7UA 3J9SA 4QXBA 2FCVA 2I45A 4ATEA 2DCYA 3ACLA 4Q0VA 3WV6A 2IFRA 1VBB3 4ZU7A 4GB31 3K51A 4DO0A 5FZLA 1K5MA 1UZYA 2VBBA 1XU2A 5JCTA 5C8WA 3PMSA 4QPIC 4IEUA 2OZJA 2WNVC 4CXYA 5IVBA 1J58A 4EZHA 4HXCA 1XPWA 4FSJA 4CRQA 4AHYA 1QHDA 2ZZJA 1HB3A 1TNFA 1NLQA 2F4LA 4P08A 5LA1A 4YZ2A 3IPVA 4MADA 1BBT2 1VBA1 4FFHA 4W4ZA 1G7YA 1CONA 5EPAA 2DBNA 5FK7A 2WNVA 1C28A 2H0BA 3IPVB 4H55A 1HB4A 4DFSA 2GZWA 4W6XA 2IXKA 3DEMA 2VNOA 2WNVB 1X7NA 2Q4SA 4CDWA 1ENRA 1QJY2 5FP9A 1NCRC 1CJPA 4P9XA 4GMP1 2QQUA 2GMEA 4IE0A 3UYJA 1UZ0A 4COYA 1JUIA 5CIRA 2EAKA 2Y33A 5HCHA 4J25A 2E7TA 5EIYB 2YU1A 3TAYA 2W3JA 2G9ZA 2J1UA 3HWJA 1BCXA 3Q8AA 4LTAA 1NCRA 1QQP3 4UT5A 1EV13 3A23A 3CU7A 2QDNA 5A3NA 4QX0A 1NCRB 4G9SB 4H2AA 4XF1A 2JENA 2QZ2A 1ZZBA 4LJHA 4Y4RA 4H14A 4AVVA 1L3JA 2XDVA 3KCXA 4NROA 1Q5OA 2YDEA 5KWRA 4DXRA 1YCIA 1RUE2 3TEXA 4C8DA 3ZXGA 5T5OA 4LBMA 1W90A 3K3OA 2BRTA 2W0XA 1G6NA 3ILRA 4LUMA 4XBNA 4XJ9A 3O1OA 4JRAA 2C1FA 2WYFA 4YM1A 4N7IA 1UQXA 3J8F2 5IHRA 2Y8KA 1SZBA 2BGPA 3PUSA 1V9U2 1KFXL 2W95A 2I2SA 3J8F1 2WO2A 1R1A3 4JTOA 1U5YA 3ZYFA 3HBKA 4R9BA 1MS3A 1CVNA 2IWGB 4CXWA 4KG8A 3JUUA 1WW7A 3N36A 3FWEA 3R4DB 5HBAA 5LBBA 4HVOA 3JCIA 1XXNA 1AX2A 2BNOA 1RHI1 4IV1A 2RMU1 2VXJA 3BYWA 5IWFA 5FYTA 4K1YA 4N8MA 1EPZA 3QLQA 4GD4A 2PHUA 4GB33 2ZX2A 1CX1A 1VRH2 4XCBA 2DUOA 4X6RB 3E6CC 2PHXA 5L19A 1UN1A 3L2YA 5LRSA 1VRH1 2VU9A 2VO5A 1VB2A 2J1EA 5A7OA 2D40A 4RGKA 2QDRA 3M4FA 4TN7A 4P5YA 5H9RA 2VD7A 3DYPA 1MS5A 5FY8A 3ZLIA 2VUCA 5DUUA 2VMFA 3LDKA 3WX5A 1FPN2 1OFNA 1WD3A 3I3DA 1RUH1 4A6OA 5C70A 5KHKA 1VBA3 1Z7S2 5A6XA 5FR3A 1W0OA 4UXAA 1US2A 3CIHA 5LEKA 4HOOA 3UETA 5H9QA 4DNYA 1WW6A 3OGRA 3N9NA 3T1MA 5FQ0A 2D98A 4GMP3 5FUPA 4LORA 1LECA 3AKTA 1V6IA 4FPCA 3R05A 2AYHA 3NNMA 5A7PA 1RUOA 1H30A 2RR12 2RV9A 4XABA 3IDEA 4BXFA 4CE8A 4GJYA 3WDXA 5BNNA 2WJSA 3FZ3A 3CJIA 3MFCA 4NPLA 2RR11 2W47A 5CADA 3SCFA 5JMCA 3IT8A 5JOYA 1VBE1 3NW4A 3ZFGC 3R0RA 2GNBA 4B4QA 1WUVA 2RS12 3AMMA 3FLRA 1FYUA 4BB3A 2B7YA 2C5DA 1HX6A 2ZKNA 5DAQA 3MW3A 1AR72 2RS11 3KV4A 4YFZA 3RWNA 3O1MA 3HT2A 2JDKA 1UMZA 2IXIA 1AVBA 3BN6A 1PM7A 3IDAA 3M1HA 4XDPA 4OI1A 1RVF2 3WQ0A 4F3JA 1W2UA 5LASA 3APBA 4F7ZA 3KT7A 3PU8A 3ZFGB 3ZN6B 3WDUA 3ZXDA 5JZGC 4Q26A 1EAH2 4E27A 4WZFA 5FO7B 2EXHA 1CX4A 4I30A 1QNYA 3O5SA 4HKOA 1X8MA 3J8F3 2P1BA 3GXUA 4P9YA 3ZFFC 1QOSA 2Q8OA 2XHKA 3AYDA 3WG2A 2J1VA 4E4DX 1OVPA 3RYKA 5JXJA 1GYKA 4C0BA 1NX9A 2QQVA 5B4NA 2EF6A 3LDBA 4K3UA 3T3YA 5JZGB 1LESA 5DAXA 3BPSA 3KD4A 4K20A 4XFFA 2WC2A 1F4HA 5FMBA 5KHHA 1W8TA 1RHI3 2RMU3 3WHTA 4NPRA 2PQQA 3ZYPA 3WW4A 1KITA 3WCRA 3OBTA 1ND3C 3AM2A 4QM9A 3ZFFB 4C0HA 2CNAA 3H3ZA 1P8JA 4HKWA 1MPXA 1XNKA 4Y24A 2EIDA 4N90A 2A75A 1KS5A 1VRH3 4TSVA 4WVZA 2P3JA 5EYXA 1RMU2 4FI9A 5A3WA 1ZRIA 5I8YA 1F8VA 1O59A 3VGIA 3BU7A 3O1UA 3S0MA 4XILA 1SDDB 2WFF2 1RUH3 2ILMA 1ND3B 1LEMA 2JDAA 3MF9A 4F8AA 4MGIE 5I91A 4YM2A 5FZFA 2WFF1 3VZJA 2P6HA 1R1ZA 3UKNA 4N7UA 3POEA 1S0JA 2QFEA 4CCLA 1UPSA 2ARCA 4OFGA 4R9AA 3WNOA 3UGGA 2YHJA 4QPGA 1QJX2 1ZX5A 3I2JA 4OMCA 4ZY9A 2NM1A 4YGEA 3O0WA 3CKHA 2RR13 1AX1A 4B8EA 3D8CA 2ZMLA 3MI8A 3OSDA 4XHXA 2AEZA 1F35A 4QQOA 5D8AC 2Y6GA 4XC9A 5L9RA 1BVP1 2VUAA 3T2TA 3CMGA 2MNGA 1I9RA 2JJ6A 2PAEA 2VAUA 2X8KA 3OUJA 1GKBA 4NIIA 1G9CA 4FFFA 2ZMNA 2RS13 4Z07A 4YYOA 2WO1A 2Q8EA 5BYNA 3MZHA 5F39A 2GC3A 5FKBA 3VZKA 5IK4A 1NZCA 5DUWA 2I74A 5D8AA 5IVYA 2W91A 5K0UA 5FYMA 3EXUA 1POQA 2IVJA 5D8AB 3HJRA 4XURA 3ROUA 4NJ4A 1H6XA 3ASIA 2XR4A 1BVVA 4BQWA 3CF6E 4LBQB 4A3XA 4MUVA 3AMHA 2FZ1A 3THDA 1PVXA 1OQDA 2D3RA 4Q8KA 2WAAA 1S0GA 4BQ5A 3C7OA 1YJKA 3GALA 4ZZ5A 1KFUL 2VMHA 3DF0A 3M8LA 3U4XA 4MLOA 2HWE2 5J7MA 3MUZ1 1SCSA 3ZSMA 2ES3A 2XH6A 3T0BA 4BQ4A 2ZHMA 3AKPA 4XFAA 5FRAA 1N1SA 3KQ4B 2D6KA 1RUI1 1EYBA 1V6OA 3CNAA 2JD4A 3CJXA 2GNDA 2LALA 1VB4A 4YLZA 3ZXEA 1AL22 1YC61 1LTEA 3QBQA 4COWA 3ZYBA 4C1XA 2YC4A 3NAPA 1LOGA 4LOSA 4QGNA 4XIOA 2ZJCA 4HSJA 5L73A 3HT1A 5F3EA 4A3ZA 3RJRA 3ZOIA 5FZDA 2FHRA 3ZVXA 3LWCA 2MEV2 4TXWA 2WFF3 3AZYA 2A6XA 2CYFA 4URAA 1J3QA 1K45A 1TME2 2YPJA 3OPTA 4OQ9A 4UW3A 1MZ5A 1RJ7A 3X29B 2JECA 1TME1 1U0AA 1H2KA 1SEFA 4HETA 2F6BA 4PF1A 5CFDA 3V64A 1QMJA 4KWKA 1W6PA 2R1DA 4JGZC 3SMHA 1UOGA 5CFDB 1NYWA 3LIHA 3ACGA 1W6PB 4QXKA 4Z2AA 3NV3A 4ZU5A 2VY0A 2Y0OA 3T2PA 4CCJA 1BMV1 1AR61 1CPMA 2YPDA 3O0XA 1K3IA 3AMPA 4LK7A 4BCUA 2JKBA 5E8AA 4JGZA 4CCOA 4XJAA 4YVSC 1LAJA 1CAVA 3SH3A 4FPOB 2XLGA 1Q56A 4JGZB 5FXVA 3FLPA 1CAVB 3N3HA 3ZX7A 3F2ZA 1UOJA 4GMP0 4AHWA 1WBFA 4XETA 4JKLA 4LXLA 2HBUA 2DFBA 2QQPA 2WN3A 5FBZA 3A21A 3I97A 5DABA 3D6EA 1IPKA 1FV3A 2NYYA 4YVSB 2GNMA 2R0HA 1CR7A 3SCHA 3OBAA 2RVAA 3VLBB 3EB7A 5EWSA 3J26N 1WLCA 3OEAA 2UWCA 4RN5A 3ETPA 2O14A 5TSWA 4PLNA 2A6VA 5A7QA 2C24A 4P14A 2VR4A 2VUJA 2VCCA 4UOJA 4E4SA 1HRI2 2QNKA 3I2KA 2MPFA 1R092 3AP5A 4NN0A 4LK6A 1DG6A 5DDJ1 5DQ0A 3BCWA 4AEMA 2YBSA 1XB9A 2ARAA 1HRI1 4KH9A 4WM7C 1R091 4HK9A 4P5HA 5CYYA 5FZKA 1JODA 2V4VA 4YW5A 1WA6X 2D6OX 4XEZA 5I0TA 1AR91 2MHFA 3SITA 1F5FA 4Y20B 5ISLA 2D44A 3VDCA 4CTEA 1ULEA 3ZYHA 4CVUA 1RUI3 4NIDA 3U14A 3PU3A 4GXLA 2J1SA 4WM7A 1BHGA 3D0SA 2DV9A 4AR2A 5FJKA 1JYXA 1PGW2 4WM7B 3VBOC 4ZU4A 3GZTB 1PK6C 1HLCA 5A3LA 1CAWB 2W1QA 1PGW1 1AL23 3DYMA 4OI2A 4Y1UA 4S2FA 2E63A 3I3EA 3U07A 1JZ6A 1CAUA 3J4UH 2W5FA 2Z2SB 4YW2A 4R9CA 3U11A 1DGLA 1PZ9A 1CAUB 1C5HA 1UAIA 1W3XA 1DHKB 4P02B 3VBOA 4K9SA 2HWC2 3PTRB 3VBOB 4L8QA 5IK5A 3HBZA 4IV3A 1OFSA 2WAOA 1PK6B 4WVMA 3TWIA 1TME3 3WR0A 2VVFA 2EA7A 3KHCA 1JTZX 2H6BA 1J1TA 5FP3A 3AXDA 4OLLA 4LMFA 4IEZA 3PJQA 3VD9A 1QGLA 2HEVF 4XJZA 4YGBA 2JIGA 2LROA 1AR63 2V4AA 2JD9A 2VZQA 3SQOA 1B35A 5JOXA 4XFGA 3OCPA 3CDZB 1IOAA 1YJLA 1DZTA 1E5IA 2DCTA 1O4ZA 1RUC2 2OUHA 2X10A 2KD7A 3AP7A 1JBCA 2WO3A 3DV8A 1NA1A 2PXJA 5FZGA 3SKVA 5LZ6A 1OQEA 1V00A 2E26A 1OUSA 1RUC1 4Q0UA 1LU2A 1VBD2 3BALA 2NLRA 1GNHA 2ZGSA 2YBPA 5D1IA 2NZ9A 2BOIA 2ET1A 5F6KA 2PFWA 4BQYA 5LY2A 3J7NA 3KM5A 5FMOS 2WL1A 4AQTA 4MOAA 1W2TA 4R4XA 3RDIA 4D6SA 2Q1MA 2ZABA 1O4TA 2QCSB 2VJXA 5FPZA 1RIRA 2DCZA 2WWJA 2UWAA 1DP0A 4N43C 1D7PM 4UFLA 4YWAA 2QQNA 4EN9B 2QQJA 5GLTA 1XNBA 4LITA 4OVEA 1UZVA 3LFIA 3ILFA 5DDJ3 1LGBA 1FXZA 4SLIA 2VNVA 1HRI3 2OVUA 3LPGA 1NG0A 3ZYRA 1R093 3VHNA 4A6SA 3OPZA 4F83A 2GP5A 2Q1ZB 4FXGB 1JZ4A 1UCXA 3H8RA 4L99A 4MHRA 1AR93 2VW0A 3VZMA 3FUQA 2XUMA 3WP4A 1LHNA 3NSTA 2BBAA 1AYM2 3B69A 5IW0A 3WP5A 1DF0A 1BEV2 3BIEA 2A7AA 3HIFA 5KXBA 3TEYA 4AHXA 1APNA 4HLTA 1ZREA 2VBPA 3EQEA 1PIV1 3S7IA 5A7WB 3ALQA 3P3NA 2VUDA 2Q0AA 4AGVA 3OGGA 5I0UA 3IMMA 4DB5A 1YEWA 4LO6B 1LB2A 2GC0A 2EXIA 5LA2A 2XHNA 4EYUA 4GKXA 5JDBA 5ABJA 5IFTA 2DUQA 1ZZ8A 3FBYA 1T6BX 1XE0A 3B01A 4HVRA 4UF0A 3DL3A 4AEKA 4A44A 5ABJB 4FP2A 2D3SA 4AFCA 4CDQC 4UF0B 4E4ZA 4Z2WA 1A8DA 3AJZA 3QH6A 3Q8EA 2XJSA 2C0ZA 3RGBA 2V09A 1ZBA1 1QF3A 1YFYA 1OPOA 1LHWA 3GHMA 5CBLA 3ACHA 1VAMA 2UU8A 2HLEA 4CDQA 3BUCA 2OXBA 1YFUA 2ZHKA 3DPRA 4CDQB 4D7SA 1AXYA 3M3EA 2RS32 2OUJA 4YW7A 2J42A 2R042 4ZHNA 1NT0A 4WM8A 2XL7A 5F9TA 1Q8OA 1RUC3 2RS31 5FYYA 2B42B 3FC0A 1HXS1 5C9AA 1IS6A 3MLLA 1HV0A 2QTWB 1SBDA 5BNPC 1JXNA 4Z92B 1O3QA 1JS9A 1VLNA 2XG3A 4KBZA 2JG9A 2J1TA 3ACFA 3GM8A 3TRSB 3HN3A 3THCA 4BQ2A 1GV9A 3AKSA 1W8UA 4YW1A 3SNMA 3RZJA 1DQ4A 2P2KA 4XF9A 1RUD1 4PIXA 2WS91 5FK8A 2Y6JA 3RFRA 4JHZA 4LR4A 5H9SA 5A3OA 3SC7X 5BNPB 1W6NA 3JXSA 1JZ5A 4AVCA 2CGNA 1QIQA 5CU1A 3NV4A 1NLSA 3RZLA 3DXTA 5AC92 2QQKA 2P3IA 1I3HA 2VCMA 2YMZA 4FOWA 1FOD2 3WG1A 3ES1A 3K46A 1HIXA 2B4KA 5AC91 3O0VA 4IE4A 3AYAA 4R8HA 3HNBM 5L9BA 3VB9A 2O1QA 2P4EA 2HKXA 4PJYA 4DUVA 3GNEA 2ETEA 1XC6A 3IWZA 2PYTA 4IXLA 3WUCA 4CEWA 2Z79A 1SBEA 4CCDA 3LFMA 4YGCA 4IEYA 4CEWB 1PIV3 2J1AA 4M0HA 5LW9A 4CA9A 1OOPA 1MS8A 3I54A 1H1MA 3LKJA 3Q8CA 5BNOA 3ZM8A 1OOPB 4LBJA 1VE0A 4CCCA 4QQ2A 1JUHA 3LEMA 4EWEA 3V0AA 2NP0A 4BPZA 3PMEA 4EROA 3LEGA 1POV0 3NNFA 3GBGA 5BPXA 1F2NA 1S0BA 3H7JA 4IE6A 4PLOA 4BQXA 1YNAA 2OZ6A 5FXZA 3V0BA 1OHFA 3BGAA 3I59B 2WIIB 3NMBA 4NE9A 5FZ9A 2XMLA 4MGYE 1F15A 4AI0A 1DQ2A 4L11A 1ZBA3 4Q27A 1REFA 3KB5A 4GIQA 5J98B 3ZR6A 4AWDA 3KLSA 4FOQA 1KJLA 4HMZA 4V2VA 3K4DA 2UYBA 1SPPA 5GJ6A 1H1AA 1JN2P 4ZKTB 2PHTA 1HKDA 5A7SA 1CESA 4JRLA 1UF2C 1WCKA 2RDNA 4BQ1A 4CU7A 4S2HA 2RS33 1O5UA 3MIBA 1DZRA 1HXS3 4KWUA 5FZ7A 1UMHA 4YZ1A 3RVHA 3ZN5A 2VBDA 4TWTA 1CPNA 1TG7A 3B94A 2YC0A 4HKLA 1W8NA 4HN1A 3AP4A 2XWJB 1OI6A 1QH6A 1KGYA 4I2OA 1Y7BA 5FY1A 1IG0A 4Q4W2 4XJUA 4BZ4A 4L97A 4YFWA 1B09A 5FO8B 2QVSB 2B9VA 1RUD3 5AFEA 2WS93 2VZ1A 4NVPA 1AXZA 4Q4W1 3L2HA 4WBBA 4QDSA 3U10A 1SMVA 2ERFA 2B9UA 4BE3A 2H0VA 3WF3A 3C3VA 4BISA 1TNRA 3P6BA 4QX8A 3VD3A 1E5RA 5JPMB 5EHDA 4BH9A 4NRPA 1HB1A 4URTA 3N9QA 5AC93 3ZXAC 2BERA 3BOWA 3PTYA 3RYRA 2W1SA 4QGLA 1W2OA 1OLMA 2BJSA 1SLAA 4W65A 1UY0A 4YM0A 4CCMA 2GC2A 2VNGA 3A22A 2BWCA 2JE9A 5FYVA 5FZ6A 3WDWA 4B7EA 5KC5A 1UKRA 1XOYA 3NVCA 4KWJA 5F5QA 4QPIA 1Z78A 2DWRA 2XXZA 1DBNA 5FWJA 5FZEA 1S0DA 5AVAA 4QPIB 1BBT1 4Y4YA 1SFNA 2WKKA 4FPHA 5FY0A 1V6MA 3FE5A 4LULA 3T30A 1JYNA 2PQSA 3B9CA 3PUAA 1Y3TA 1YFWA 3T2OA 2CGOA 2XWBB 3U1XA 1W2AX 3KS7A 4BWOA 1ULDA 1PMJX 1QJY1 2VOVA 1BK0A 3R4SA 5IK8A 2CU5A 2DVBA 3GJAA 1Y4WA 5G05L 4ISRA 1UWWA 2C4XA 2W87A 2QQLA 3UESA 1CIWA 1JYTA 1IPSA 4MGSA 3MPPG 5FLJA 1QJU2 1XE8A 2RJKA 3WUDA 3KT1A 3AC0A 2XUEA 3VBRC 4CCEA 1UO9A 1GP4A 1QJU1 2Y6LA 3H8UA 1V6LA 3BPZA 3MFAA 5EZWA 3V65A 4AI8A 1W9YA 4NRMA 3GCXA 5DN2A 5FOBB 5T54A 2YZ4A 4Q29A 1QH7A 4ISQA 3WF0A 1A34A 1RTVA 1ALYA 2PELA 4DQAA 2OQ6A 4KNCA 2VGDA 1BXHA 4GH4C 1RUE1 4W6YA 2TEPA 3TEWA 4AQSA 2VVEA 3VBRB 4D6QA 1O7FA 2ZEYA 1XE7A 3SH4A 3EO6A 2EXJA 2WT1A 4NIHA 4FPGA 1SFYA 2ZGTA 2D5FA 1KS4A 3SEPA 4AEJA 1G86A 4WVMB 3PL0A 4GH4B 3VD5A 4OHYA 5FY9A 1V9U1 3PDQA 4YNIA 4BK5A 1D4VB 2NQYA 2Y38A 2K0GA 1XSRA 1G9DA 1NKGA 5JSRA 3OTFA 1GZWB 1RJ8A 5FYUA 2BNNA 1NE4A 1S4CA 4Q4W3 2JB8A 4GWMA 2VOTA 5LK5A 5GZEA 1DLLA 5DAWA 4ATFA 4LBQD 4FTEA 1V6KA 3IAPA 1WMXA 1MS1A 1TMF2 1D0GA 4EZ4A 1C3HA 5HXMA 4FOYA 1W0PA 3D4KA 1MQTC 1PMHX 3SH5A 5LY1A 1W8FA 2ZMKA 2BU9A 4JCKA 3LZZA 4QKNA 2JDPA 3LSDA 5EJZB 3WQ1A 4CP2A 2FDGA 4LHKA 1ULCA 2WLPA 4CU6A 1W3VA 5FP7A 2W68A 4GALA 5FPLA 3THTA 4ORFA 3HOBA 2P37A 2ZGKA 2R062 1OPMA 1YHFA 3UKVA 4XF4A 4B4PA 3JU9A 2D7FA 4U36A 1FPN1 2P34A 2R061 3CZJA 1QEXA 4LO7A 4OCTA 1BBT3 5FYBA 1Z7S1 1GOFA 5IK7A 4IL7A 3LF7A 1OF3A 4G3YC 2HWF2 1GOGA 1OSGA 4NR1A 4AFBA 4AFMA 1QJY3 4O7XA 2ZX3A 5E6HA 1HDKA 3MV11 5I8SA 5KHJA 4NHKA 1QU0A 2BTVC 2OS2A 2DVFA 4XYXA 5ACA2 5C8CC 4CU8A 2UY8A 2WUHA 5LATA 4D6RA 4UWDA 3B5LB 5DPNA 2FMDA 5ACA1 1GQGA 3PURA 1E5SA 1KDKA 4QKFA 3WW2A 3IAQA 1RXGA 3MGUA 1S2BA 5BXXA 2DCJA 1QJU3 1ZNPA 2C9AA 3LB9A 4OMDA 4Y5Z0 3ZSJA 1LEDA 2VMEA 5CB7A 4DRRA 2VZRA 3D0JA 3WQBA 4AFAA 3QOPA 2XOMA 4BM8A 5AFBA 1AHSA 1ZZ7A 1WCSA 4EN6B 1AYN2 4AAPA 5C8CB 2AEYA 4FPYA 2BVBA 4JVAA 3ZSEA 2UY9A 3ZFGA 1AR71 1DLCA 3MO4A 3ZN6A 3ZXJA 1RUE3 1AYN1 2NN8A 2YFUA 4DOUA 3THPA 4M3CE 1I6XA 2EIGA 1HV1A 1OH4A 1RVF1 1H6YA 1NCQC 3ATGA 2Y6HA 2QKDA 3RG0A 4WZCA 2PHWA 1EAH1 1FATA 3I2DA 4L92A 5C71A 4KQ7A 3ETQA 1RUF2 3IDBB 4KL1A 1OA2A 2AGSA 4XZPA 4E4HA 3VDAA 2FDIA 4CDXC 3NNGA 3URFA 5JZGA 5JSPA 1V9U3 1NCQA 4TLFA 2YY1A 3ZSLA 2GH2A 3AYCA 3VHOA 4PBPA 1NCQB 4A7ZA 1D2SA 1JZ3A 2NMNA 4I09A 3ZFFA 4CDXA 2K2SA 1H2LA 3H3UA 2HYKA 1YQ8A 1D4M2 5GLWA 5D21A 2P5BA 1UY3A 3ZYIB 1RUJ2 4P00B 4CDXB 5FXXA 2ZGRA 2AR6A 4BIFA 1F31A 1Y43B 5IJRA 1YQ5A 5C4WC 1YI7A 2XJQA 3OOXA 4AF9A 4I3GA 3VKFC 4QHBA 1LHOA 3GGLA 3ZPOA 3MIHA 1ND3A 5GZGA 2ZX4A 1RMU1 1EP0A 4CXXA 4H3WA 3BTYA 3AL6A 3RZKA 4K8RB 1UU5A 3EJKA 3WG3A 1U5IA 1OXCA 1FPN3 1V0AA 2R063 2VTXJ 5JXIA 2LRPA 1GZ9A 1Z7S3 1PO22 4YGDA 5C4WB 4HSLA 1GP5A 3A0NA 1YXWA 2G9GA 4FCAA 2ATFA 2JICA 4FPLA 4UW6A 5A7NA 2X05A 2LW8A 3JZVA 2OKXA 3GZUC 2Q1FA 2DFCA 2WT0A 1XNCA 3NRUA 4OHZA 3S30A 5GZCA 1AZDA 1WW4A 2JE7A 3CO2A 4HZFA 1VMJA 3BU0A 2JDUA 3BODA 1JZ7A 4HK8A 4LNVA 5JAXA 3O1VA 1QJX1 2VTFA 3HQRA 4MO3M 1ONAA 1W6OB 4EV0A 5ACA3 1HRV2 3AB0A 3ZYGA 1OLQA 3VD4A 1MEC2 2KM2A 2E7AA 3OF1A 5G04L 5FPXA 1G8WA 3I7DA 1PNGA 1UOBA 2JDZA 2ZGQA 4ASMB 5CEHA 4A7KA 2A6WA 3S5AA 1ZRFA 1MEC1 5IAXA 4QT6A 1JYCA 1O8SA 2B45X 1OD3A 2RHPA 3WSOA 2C26A 5FP4A 3A0KA 1SDWA 1F5JA 3ME2A 5A6YA 3UJQA 1AR73 4AQ6A 3PJYA 3ZIWA 2VECA 2H6CA 1AYN3 3MDPA 5I0DA 3C7EA 4QPYA 5A1LA 3RNSA 2Q5TA 2BGOA 5HV0A 1RVF3 1GZTA 3E6BA 3USSA 1MZEA 1N47A 3PUQA 4LBQA 4BLJA 4JGYC 4AEDC 1EAH3 2LM3A 3MF6A 1XYOA 1DGWA 4PT6A 1RC6A 4UAPA 4XTPA 3HR9A 5KR7A 3M3OA 4X6QB 4YARA 2YFZA 3AKQA 1H8VA 5GLUA 1YFXA 4D69A 4E9KA 3K4ZA 4XTMA 1WKYA 1LJ7A 3VN4A 4BYYA 5C3QA 1AXKA 1IKPA 2FDKA 2VVDA 1LRHA 4JGYB 3MPBA 2ARXA 1C5IA 4YG3A 4AEDB 4IEVA 5M0TA 1W8WA 4DRVA 1PVC2 4Y5TA 1GQPA 1WZXA 1X82A 2HWE1 3IIIA 3ON7A 4NHXA 5J36A 1S2KA 5FYZA 1Q8SA 4YW6A 3LQCA 4CP0A 1PVC1 1UZWA 1W8HA 1SBFA 3WP6A 1AUYA 1W05A 2C9KA 4MZUA 4RHV2 2QQWA 1DGWX 1WCUA 4FFGA 4M3CB 4DEVA 4ARYA 1QWRA 1YIFA 1XRUA 3WD5A 5KC6A 5IVFA 2FBEA 1VP6A 3LGRA 5LK7B 3CHXA 4FTSA 1RMU3 1AL21 2ARBA 1PX4A 5GLZA 1MS4A 3LDRA 4OUEA 1VR3A 3Q8FA 3MIDA 4O9GA 2YROA 1YUDA 3MEPA 3WOGA 1WMDA 5FLIA 2MEV1 2ZACA 4MVTA 4QB2A 3UKTA 1O3RA 2ZGUA 3RYPA 5JPNB 2PTMA 3GF6A 2Y34A 3ZFEC 1R64A 2GMMA 3GZEA 1KD7A 3KF5A 3WNPA 1W6QA 3C7GA 2CWSA 1QJX3 4Y33A 4BHPA 4Q0PA 1LGCA 3OD0A 1H0BA 1C8NA 4JV4A 4M01A 1W6QB 3AK0A 1RGSA 1G9BA 1FNZA 4MYEA 4LKSA 4QB6A 1H9PA 5KXDA 3U75A 4NHMA 2RJLA 3ZFEB 1MEC3
chains in the Genus database with same CATH topology
2DUPA 3AXEA 2OW4A 4FAGA 4XE9A 4FQ4A 1HQLA 4UW4A 1MVEA 4IERA 4QD2A 1J3RA 1UD1A 3R6SA 2RM22 4YVSA 3WDYA 1O5LA 2WZR2 3GBFA 1FV2A 4RS5C 3POSA 4PLMA 5DUXA 2D6MA 2WZR1 4HFSA 4YG0A 3H9AA 4M0NA 3N7KA 2ZX1A 4S2DA 4RS5A 1ND2C 2X5IC 2GMPA 4LT5A 2DVAA 1XYNA 1GQHA 4RS5B 4Y20A 4XXPA 3VZLA 2VQAA 2GN3A 2DYCA 1NXMA 3IKWA 3SCGA 2HWE3 3PNAA 3VKNA 1PVC3 2DURA 4C1WA 4RQPC 3OBRA 1AF9A 4G4FA 1ND2B 1MZFA 2X5IB 1CAWA 3BTAA 2LUWA 4ZXKA 1WA4A 1JH5A 4COVA 1FAYA 2B46X 4EWDA 3ZXLA 2A3YA 3ENRA 4HVQA 1S0CA 1Q43A 4Q2FA 4DINB 4AYUA 2WQZC 4RQPB 5J48A 2B5HA 1PK6A 2MEV3 4Y1ZA 3UL2A 1URXA 3S7EA 1WW5A 2R16A 2AENA 4FPFA 5T5LA 3B93A 4PF5A 2HWC1 1WMFA 2PHFA 4B29A 4LA2A 3INAA 1C1FA 4LEJA 4O9EA 4EJRA 3ECQA 3MIEA 5KHIA 2IXLA 2UYAA 1DQ6A 3VBSC 1COV2 1QXPA 3OJBA 2DVDA 2UWBA 4LUKA 3NKGA 1AL0G 1Q8VA 4MX3A 3OY8B 3O14A 5FDBA 3TNQA 4YZ5A 4OHWA 1VBD1 2XB6C 3N35A 4KU8A 3VBSB 2WA3A 1CD3G 4FXKB 2P17A 3VKLA 4TZDA 5KXCA 1X50A 4QQLA 3VBHC 5E16A 3KGLA 4CDUC 2WZR3 1DGRA 3VBUC 4AI1A 3UJOA 3B9IA 5SV8A 1JHNA 3E97A 2DU0A 4I3PA 4K6BA 3NV1A 3VBHB 3E6DA 4N43A 3VBUA 4XJ8A 1ZZCA 4CDUB 2TNFA 3VBUB 4N43B 4GWNA 4MH0E 4MXVA 4XW3A 3LOBA 4D3WA 4OI0A 4EWAA 2BFUL 3ZXFA 3DGTA 2XJTA 3LSEA 1AYM1 4XQWA 4XQDA 1BEV1 2A71A 3FFQA 5CG8A 2AZ5A 5B2GB 3E5UA 2PLV2 2VNRA 2IXCA 5IUQA 3N7MA 3VDDC 3E5QA 1SLCA 3H0OA 2PLV1 1J1LA 3TBDA 1PZ7A 4RGAA 3WW3A 2BPA2 1FX5A 4PDWC 5E1RA 3ZXKA 5DZGA 4NOTA 4DZGA 1LOFC 2HWC3 1GANA 4ITCA 3JB4C 5T3NA 3ZO0B 3VDDA 2JG8C 5C33A 3VL8A 3VDDB 1OA4A 3H1YA 4PDWA 1QXRA 4I01A 1O91A 1TQ5A 4PDWB 2X53S 4BMEA 4N9HA 1DQ5A 2Y0IA 2JG8B 1FNYA 3AFGA 1SQ4A 5L7OC 1DQ1A 2XVGA 5A32A 2W08A 2R041 5EFUA 5A32B 3FJSA 3H1WA 4MXWB 1VBD3 4DXZA 4Q0SA 5A3MA 4QMAA 5K8SA 3AP9A 2BVVA 5F6LB 4XF0A 4Q0QA 4IETA 1O3SA 3CL1A 2D97A 1XQNA 5BNPA 4FAHA 3AMQA 4XHBA 3TN92 1DFQA 3JQXA 5DZFA 3QD6A 4QX5A 2EXKA 1LENA 3TN91 2W39A 1YLLA 2GALA 3A4UA 3I4IA 3WVJA 2VH9A 4R9DA 1LOCA 2ZKLA 3PHMA 4P9WA 1FOD1 4A2UA 5T5JA 5GALA 3WZ1A 4YZ4A 4H7LA 1N1TA 1AYM3 4UW5A 5J96B 1BEV3 4K7JA 4I0WB 2D5HA 4J6GA 4FPEA 2VOKA 4I02A 4NWWA 3VUOA 3M3QA 3TB0A 5J37A 3M3IA 4P9JA 2V5YA 5SV5A 2PLV3 1GNZA 3NO8A 4DPNA 3QCWA 3I59A 2OYZA 5FO9B 3PVBB 2DCKA 4RL7A 4Z8BA 4OHXA 2PHRA 3ZPYA 4EN8B 1GBGA 1Y9QA 2XPJA 1MS9A 3M3CA 2ZZQA 3UK9A 2A3WA 4YZ3A 1QOOA 5JI7A 4HBNA 1ZBE2 3LA2A 2ZS6B 1H2NA 2HWD2 2XJRA 2FQPA 1A78A 1H2MA 4QQHA 1ZBE1 2HWD1 3IDCB 4LBKA 4AG4A 2CAVA 1W6MA 3FHIB 4Y1VA 3HMYA 1ZZ9A 1QQP2 1W6MB 2ENRA 5CFCC 4S2GA 3RJ2X 2R043 2FZ2A 5J09A 3USUB 1UL9A 1V6JA 5JSOA 5FCCA 1QKQA 1WD4A 1X33A 1LULA 2YGMA 4R4ZA 5CFCA 4AVAA 3QH7A 3EHKA 1M4WA 5CFCB 1CJDA 4FO9A 2A3XA 3AKRA 4Q4X2 1S55A 2W52A 3O12A 2Y26A 3EBRA 3TN93 2R0FA 1S1AA 4Q4X1 3B3QE 2YV8A 1LOEA 1R1A2 1PNFA 3WNXA 4XBQA 1SCRA 1DYKA 2XLAA 4PQ9A 5J3UA 1FOD3 3ST7A 1GR3A 2PA7A 4Q4V2 1K5MC 5BNQA 1LHVA 4Q4V1 4INDA 3RSJA 2BWAA 4GB32 4JTNA 4META 1MR5A 2AUYA 5K7PA 3IM0A 3R4UA 1OD5A 2HJIA 4LLFA 4RGGA 2O0OA 1VBC2 2CV6A 1K5MB 1PO12 4XBLA 4XFBA 1N1VA 4DS0A 5BV6A 1D0HA 1QDCA 1VBC1 4AHZA 3IBMA 3FX3A 1PO11 2FMYA 1VBA2 4CDWC 1XNDA 4GKYA 1UKGA 4N9IA 3AMNA 1G9AA 4BLIA 3WT3A 2HEWF 3JB8A 1LR5A 4BMBA 2JEMA 2GC1A 2UURA 3W58A 3LAGA 1ZBE3 4CYDA 5KXEA 2HWD3 2QE3A 4CDWB 2CTVA 3SLIA 3E5XA 3MLKA 3N4MA 2NMOA 4JQRA 3VBRA 2RS52 3ZYJB 1AJKA 3TOJA 3ES4A 3FBMA 2RS51 1GICA 3WDTA 5E89A 3FLTA 2OIIA 2GU9A 2YGLA 3N7LA 4GH4A 4WVMA 1EY2A 1VAVA 1RINA 1UX6A 2NPIA 1GZWA 3V56A 3WINE 2GNTA 2XVKA 2PHDA 4LO5B 5DXDA 5GM0A 3BIWE 1FT9A 4I0BA 3WXPA 2XGXA 5FLHA 2ZCWA 3VV1A 4JDMA 3SHRA 2Z5WA 1FI2A 4Q4X3 2X29A 2ZHNA 4J1XA 1TMF1 3RS6A 3VZNA 3NWKA 4W6WA 4QU2A 1GZCA 4IV1C 3VKOA 3GHNA 4E2QA 3WCSA 3AYEA 1MQTA 1KRIA 1RHI2 1YWKA 1D2QA 2RMU2 3D5OA 4Q4V3 4XFIA 5GKAC 1LOAA 1MQTB 4XXAA 1O4YA 2XJUA 2V73A 2ZGLA 3RMXA 2TUNA 1C8M2 2HWB2 4IV1B 4YG6A 1C8M1 1BQPA 2HWB1 1TEIA 3G6JB 3WLUA 2HWF1 3Q9OA 2A6YA 5JOZA 1IHMA 1VBC3 1RUH2 3PVOA 1PO13 2AREA 1CAXA 3HQXA 4IEQA 4K21A 3POWA 2WWSA 1QY4A 1CAXB 4GQ7A 4BA6A 4RFT0 2VG9A 1C4RA 4LBNA 5C6CA 1H1IA 3AZVA 5BNNC 3CJIC 5C8CA 5DG1A 2A5ZA 5FAXA 3LA3A 3WDVA 1KJRA 5FQ0B 3ZIXA 1SLLA 1WCDJ 3VBFC 2YUEA 2ZA9A 2GH8A 2WA4A 1OKQA 2VOWA 1VBE2 2RS53 3B00A 2VQ0A 5BNNB 3CJIB 1KXGA 1ZZ6A 1GSLA 1HQWA 3VBFA 2PAKA 1DQ0A 4J1WA 3VBFB 1WLTA 3KQRA 1DZQA 2F4PA 3JBG2 4KGQA 1RUF1 1RITA 3JBG1 5DG2A 3VL9A 4FOVA 3IMNA 2XKPA 4AE2A 5DZEA 1YI9A 3BOPA 1ZYBA 3DUIA 3WP3A 4L2NA 5CG9A 3OGJA 2XBO2 1TMF3 1E57A 1D4M1 3ILNA 3M7AA 1RUJ1 2XKOA 2XBO1 4LO8A 1OLRA 4KG0A 2O8QA 4JDNA 2B39A 1Q3EA 2XVLA 3PVNA 1ZA4A 3UV9A 5C4WA 2ZGNA 5KHGA 3H50A 4XPVA 2R6QA 1J59A 4DY3A 2VMGA 1UW8A 1LOBA 1C8M3 1IKQA 1PO21 1W39A 2HWB3 4COZA 5DUVA 2ET7A 3B02A 2HWF3 3MW4A 4FTBA 4IQPA 3NJZA 3FUOA 4AFDA 1V70A 2ZHLA 1W6OA 3QACA 4P9IA 4EN0A 4Y1XA 3VHPA 5JR7B 2N7GA 3CEWA 5IT6A 2VW2A 4D94A 3SXWA 2ZGMA 4LBOA 4QPGC 4YW3A 3SISA 5E88A 4WV8A 5F1RA 1HRV1 1PGL2 4XOGA 4FVVA 1PGL1 2R072 4QPGB 3GBWA 2QUOA 4A7YA 3CLPA 2R071 2PAMA 4Q1PA 1GLHA 5FREA 5I8TA 5GLVA 4RD7A 3POYA 1VBE3 2ZGOA 5K0UC 2D93A 1C57A 1YO8A 1NXD1 1RUF3 4YVWC 1IPJA 3I8TA 1A3KA 3WY6A 2DU1A 2BNMA 3JBG3 1KQRA 4JGYA 4AEDA 1PMIA 4Z1VA 2KXLA 1VJ2A 4KWLA 2RE9A 2BUKA 5K0UB 1DDLA 4KBBA 3S6PA 4ASLA 4WVWA 2CGPA 2A73B 3U0ZA 4YVWA 4KU7A 3PVEA 1NE6A 2WSVA 1FMD2 5FTTC 3RI9A 5H9PA 5HCBA 1NQJA 3AP6A 4YVWB 4M3CA 4LHNA 2E6VA 1D4M3 2DTWA 1FMD1 5T50A 1RUJ3 3KSCA 4E2SA 2XBO3 4IEWA 2EVXA 2XJPA 2JXAA 4RHV1 1AR82 3M70A 2SBAA 2WINB 1R082 2CAUA 1AR81 4MV2A 1POV1 1RUI2 1SLIA 2E7QA 1SLTA 4HPKA 3NAPC 1R081 1NOVA 3VZOA 4HPKB 1UIKA 5A33A 2LTNA 3RPQA 4FPKA 2G9FA 4MGKE 4RR3C 1PO23 2R1BA 4BOWA 5A33B 2R32A 1Z0HA 4B4RA 4DY5A 4QGMA 4XMAA 3JD72 1UU4A 2QZ3A 3NAPB 5JOWA 1XU1A 4RR3A 5JIUA 4NWVA 3JD71 3KZ4C 5CFDC 3ZFEA 2AH2A 2A70A 4RR3B 4D7YA 5CAZA 2WNEA 2R49A 1HRV3 1I1EA 4IESA 1DIWA 1PHMA 3LCPA 4YM3A 2PN5A 4K40A 1ENQA 1QOTA 4ONUA 1F9KA 3AX4A 1BMV2 2Z69A 4XJWA 5EV7A 1ULFA 1AR62 4OULA 5FMOL 2BBVA 2E51A 2R073 1O3TA 2RM21 2VXRA 5EXOA 4MGZE 1IS3A 2IXHA 4U2AA 5KBFA 4XQ4A 1VALA 5JIAA 2ZX0A 4XDQA 1YIPA 4HL0A 1MACA 2EALA 4JC1A 2ZOEB 1RB8G 1DGRN 4LHLA 4XFHA 4IEPA 4SBVA 4LE3A 1UU6A 4PCRA 2BQPA 3WHUA 2SLIA 4HANA 4WVVA 2IXJA 4LO4B 1LHUA 1DU3D 1SACA 3FFZA 1ND2A 2X5IA 3HN1A 4Y1YA 5DDJ2 1FMD3 2DTYA 1ZRDA 4E2GA 1S0EA 1H4HA 1M06G 4N53C 4C91A 4RHV3 1CQ9A 2GSYA 3M2MA 4AVTA 1ASJ2 1AR92 3GZAA 4OHVA 4DMIA 3FMGA 4RQPA 1AR83 1POV3 1ASJ1 1R083 1X36A 1ZM1A 4N53A 1RL3A 1BZWA 4N53B 3VKMA 5FFOC 5K9YA 4Q4Y2 2DVGA 1Q8QA 1UPIA 1NQDA 5EJ3A 1VIWB 4IEOA 1N3PA 4YW4A 4Q4Y1 4R52A 2E9QA 4IV3C 1WMEA 4JDOA 3NV2A 3AZXA 1IGOA 2ZAAA 3JD73 1C1LA 3AZZA 1IS4A 4NO4A 1NLRA 2DF7A 3OY8A 1SLBA 4OUSA 4M3CF 1IZ3A 1U12A 1RUNA 1COV1 1A8MA 3MICA 4UBGA 3AZWA 3ZSKA 5I0SA 1YYNA 1B35C 4IV3B 3VBSA 5JLVA 1REDA 1CN1A 2P3KA 1AX0A 2WQ4A 5T52A 1NA1C 2GAUA 4KGGA 2D3PA 2RM23 4RA0A 2BYVE 3KMHA 3MW2A 4GULA 2OPKA 2D43A 4NHLA 4PIYA 3WQ7A 5CA6A 1B35B 4GA9A 1GFF2 2GDFA 4I0AA 1AJOA 4AGRA 4JAAA 1NA1B 5BUVA 3VBHA 1N1YA 4B7KA 4CDUA 2A6ZA 4LE4A 4PIZA 3C2UA 3HD8B 3KGZA 3MLJA 5T55A 2VW1A 1PGSA 1HW5A 2HEYF 2IC1A 2VULA 5GZDA 3ELNA 1EPWA 3O7OA 2XLFA 3ZN4A 5HCAA 4Q8LA 4MSVA 1REEA 4FBFA 3KCYA 4COUA 3VHRA 4FQZA 4OUMA 4YRDA 4XMIA 2VPVA 4AVBA 4AQ2A 1TE1B 5JVVA 2BGCA 3MIFA 4LLOA 4AVSA 1HQNA 1ASJ3 2CWMA 2E53A 2ZGPA 1X8EA 3NKTA 4AXOA 1S0IA 1ENSA 1BK1A 1PIV2 1UZZA 3NL1A 3OYWA 5T5PA 2TBVA 3OYWB 5AVPA 4CP1A 4K8FA 5ABJC 3RMYA 4Q4Y3 2O8OA 3KT4A 5EYYA 2K9ZA 1ZRRA 1QJZA 5JI9A 1LOFA 3RI8A 4QQPA 5HI0A 1CGPA 2JG8A 1JYIA 1IQAA 4AK3A 3L9JT 1COV3 3ZDSA 1RUG2 4M00A 1LCLA 4QM8A 3TNPB 4XIKA 1WBLA 1ZBA2 2WT2A 3DPRC 4MXWA 1NY72 1RUG1 2ZTNA 4P9GA 5HXVA 1T6GC 1H4GA 4WM8C 5BY5A 4RSUA 2XJVA 1NY71 5L7OA 5GZFA 2WLQA 1Q8PA 3DN7A 5C9AC 3MYXA 1MZ6A 5L7OB 3B7MA 3D82A 4HN0A 4B3NA 2JG9C 3DPRB 2VOXA 1HXS2 3DKWA 1S0FA 2JX9A 2VMIA 2CL2A 3P3PA 3T1LA 3AJYA 3G7DA 4WM8B 1QNWA 2D6LX 4TYSA 3ZMNA 1I5ZA 1DYPA 1LU1A 1ULGA 1U5XA 5C9AB 3RQ0A 2EAAA