5KXDA

Wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
238
structure length
238
Chain Sequence
KETTSFVFTRFSPDPQNLLLQGDTVVTSSGHLQLTQVKDGEPVYSSLGRALYYAPIHIWDSNTDTVANFVTSFSFVIDAPNKAKAADGLAFFLAPVDTEPQKPGGLLGLFHDDRHNKSNHIVAVEFDTFKNSWDPEGTHIGINVNSIVSRKTISWDLENNEVANVVISYQASTKTLTASLVYPSSSTSYILNDVVDLKQILPEYVRVGFTAASGLSKDHVETHDVLAWTFDSDLPDPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Wisteria floribunda agglutinin
publication title Molecular Basis for Recognition of the Cancer Glycobiomarker, LacdiNAc (GalNAc[ beta 14]GlcNAc), by Wisteria floribunda Agglutinin.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 52
structure length 238
sequence length 238
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5kxdA00
1MS1A 1W6OA 2ZGKA 5BYNA 4AVVA 2GALA 4Y1UA 4Z8BA 4YM2A 4H55A 1QKQA 1LOAA 4DFSA 2WJSA 1LOFC 2NYYA 4YLZA 5KXDA 2EXJA 2D6KA 3UK9A 3ZVXA 3ENRA 1UKGA 3OYWA 3WCRA 2PELA 3D5OA 4XIOA 1SACA 4FOYA 3ZXJA 1EPWA 2EF6A 3BIWE 5E89A 3N7JA 4DQAA 3V0AA 1ZA4A 2DTWA 3AYAA 3OBRA 1Q8PA 2SLIA 3JUUA 3KQRA 5GLTA 3RMYA 4C1WA 2DU1A 2UURA 3MEPA 2AH2A 3FLTA 1F31A 3AX4A 1LU2A 1A3KA 5H9SA 3AJZA 3LSEA 5GZDA 1D2SA 1MVEA 1Q8VA 3R05A 3PVNA 1APNA 1CN1A 1A8DA 1NXD1 1N1TA 2DTYA 2DUOA 5LK5A 2YZ4A 1HQWA 5JOXA 1KDKA 1JYCA 1W6PA 2JE9A 4IQPA 1DGLA 5H9RA 1QOOA 4ATEA 4RL7A 1W6NA 1G9CA 1SBFA 1B09A 3AXEA 4Y1XA 1AXYA 5F5QA 2JD4A 5GLUA 2D6OX 3WG2A 3M1HA 4XHXA 4XBQA 1GV9A 1LEMA 3BTAA 4GA9A 4K1YA 1JYIA 2VW1A 3N35A 3O0VA 4Q8KA 1YYNA 4YW4A 4XIKA 1JHNA 1CIWA 5JDBA 1SLTA 4XYXA 3D4KA 5DXDA 1G86A 5JOYA 1ULGA 2ZABA 4FPHA 1G8WA 2WSVA 2PHWA 1IS6A 2TEPA 4P9YA 3WDTA 4BLJA 1CVNA 1LENA 5GJ6A 3A0KA 2A75A 1N3PA 5E88A 3FFZA 4Y1ZA 3JU9A 5CA6A 1AZDA 4YG0A 2NMNA 3SISA 3USUB 4ATFA 5T5JA 1ONAA 3WLUA 1MS9A 3AYEA 4LBQB 1FAYA 1URXA 4FQZA 4NOTA 1FYUA 4Y22A 5GZCA 2DVFA 3WZ1A 1W6QA 1BKZA 1GBGA 2G4IA 2W08A 5T55A 1LHVA 3B69A 1PZ9A 2V73A 1CESA 3OBTA 3NV2A 2P3KA 4Q1RA 3U4XA 1PZ7A 1N1SA 1N1VA 4YGEA 1VIWB 1N47A 1CONA 4Q27A 4JRAA 5SV8A 1HDKA 5AVAA 5DG1A 1ULCA 5GLWA 4GWMA 1KJRA 4XILA 3V0BA 3ILFA 1G9DA 1CQ9A 4ZKTB 1S0CA 3AZYA 5HCFA 4YG3A 3L2YA 1AXKA 1MVQA 1V6JA 3AYDA 5GLVA 1AXZA 1LOGA 4BMBA 1MS5A 4M3CB 4Y26A 1W0OA 3RQ0A 2E7QA 4GKYA 3OY8B 2D3PA 5T50A 4K20A 3WUCA 1WCSA 4TYSA 2EALA 3N36A 5FREA 4FPCA 4YZ5A 2AENA 2LTNA 1SLCA 2PHTA 2UWBA 1V6MA 1DQ2A 4Y1YA 2W39A 2DU0A 1UMZA 4DPNA 1DHKB 4XBLA 1C57A 1ENSA 2ZGQA 2ENRA 2A5ZA 1SBEA 2FHRA 2WKKA 1GSLA 4FPKA 1DIWA 2EXHA 2CY6A 3QCWA 4AVTA 2D6MA 1Q8OA 4SLIA 3NV1A 2E51A 2ZBJA 4XTMA 3LSDA 5DUWA 4LBKA 4PCRA 4OZXA 1BQPA 1LECA 1WW5A 1ZM1A 1HQLA 3GNEA 4YM3A 1GZCA 1S0GA 1DQ0A 1LGNA 3I8TA 4L8QA 5KXEA 1LHWA 1QF3A 2WNEA 2B7YA 4Q1PA 2E53A 3AP5A 4CZSA 3B9CA 5DUXA 2ZGUA 1IKPA 1WW6A 2CWMA 2PHXA 3T1LA 3M3EA 1KITA 1WLWA 3M2MA 5GZEA 1VAMA 3W58A 1V6OA 3IPVB 1Q56A 1C1FA 1I3HA 1WLCA 4XHBA 2ZHLA 4U2AA 3AZXA 4WV8A 1Q8QA 1Z78A 3AYCA 3R4UA 1DYPA 1SFYA 1QDOA 1UZYA 2D7FA 1LGCA 1LHNA 1MS4A 2GN3A 4YGCA 5EYXA 4XTPA 4BM8A 1KJLA 4LBMA 1BJQA 1W6MB 4FPLA 2CTVA 2P3JA 4CTEA 5FRAA 4ISQA 2ARXA 2JDZA 4AGVA 2ZGLA 2OUHA 3RG0A 1LHOA 1JXNA 4XOGA 4LBLA 3PJQA 2WT1A 2FMDA 3USUA 1SLBA 2ERFA 2RHPA 2VH9A 3NV4A 3ZPYA 4AYUA 5H9PA 2A6ZA 5F9TA 2JECA 3I4IA 1D0HA 2D44A 5L73A 3INAA 4C1XA 2GDFA 1WBFA 4BOWA 4FP2A 2A6XA 4R9CA 1KRIA 1BZWA 1SCSA 4D69A 2OW4A 3MW3A 2ZAAA 2VW0A 2XB6C 4FOQA 4AGRA 1R1ZA 4PQ9A 5IK7A 3WHTA 3HMYA 3OGGA 1JUIA 1G9FA 1S1AA 1GZWB 3DGTA 2H0BA 2PHRA 2R1BA 4MYEA 4WZFA 3VV1A 2P2KA 4AGGA 1HLCA 2D3RA 2NMOA 2R49A 3FUOA 4FQ4A 1DQ6A 1LESA 2AYHA 3AFKA 3ZSLA 2W68A 5GZFA 2VUAA 1FNZA 3WVJA 1V6IA 1FX5A 3MW4A 3O5SA 4XXAA 4M3CA 3ZXKA 2I2SA 3ILRA 2JE7A 4UW6A 3ZSJA 3OY8A 1WBLA 4M3CE 4PBPA 2WLQA 2GMMA 5EXOA 4YM0A 1QNYA 1I1EA 1KQRA 3IKWA 4Q2FA 1CR7A 5T5LA 4YG6A 4XMAA 4YGDA 4YFZA 1RITA 3AJYA 1IKQA 2CNAA 3IM0A 4JC1A 2SBAA 2EIGA 2R0HA 2GNMA 1DZQA 5JVVA 2NZ9A 4R9AA 4YFWA 2YMZA 1LGBA 2A6VA 1WUVA 2WSUA 2PHUA 5CB7A 4HANA 1MS3A 2AUYA 1YO8A 3SNMA 1CPMA 3IMNA 4XJWA 4U36A 3WG4A 2GNTA 1V6NA 2D6PA 2DYCA 4NO4A 5CNAA 3T1MA 4LBJA 3SH5A 1ENQA 1AJKA 1AF9A 1KDMA 2DURA 1TEIA 1DQ4A 2Z42A 2A70A 2GN7A 4KBBA 2A3WA 4FVVA 1LOCA 4P9XA 4ITCA 5GM0A 3M3QA 3N7LA 1QGLA 5IK4A 1O4YA 1WLDA 1SLAA 5CAZA 3A0NA 1JBCA 2V5YA 4P9WA 4BQ1A 1XQNA 1AX1A 3AP7A 4K1ZA 4LBQD 3AP4A 3IPVA 4FPFA 1QOTA 1OFSA 2EXIA 5DZFA 5HCBA 3H0OA 2JKBA 1DBNA 2EAKA 1DQ1A 3TAYA 2A3YA 2ZMNA 5IT6A 2VW2A 5GLZA 1IS5A 1DLLA 1C4RA 5GZGA 3VKNA 4YZ2A 5JOWA 1H9PA 2E6VA 1W6MA 4M3CF 2A3XA 2YROA 3HR9A 5DG2A 1MS8A 2GNBA 2A6YA 3B3QE 4YZ3A 3AZVA 5JMCA 4YZ4A 5EYYA 1QMJA 1H30A 4FPEA 4W65A 1JN2P 4YW1A 5T54A 4RA0A 3WV6A 3OJBA 4Y20B 1UN1A 4FOWA 2ZZJA 3M3CA 2DVAA 5DZEA 4Y1VA 2C5DA 4XJ8A 4Q8LA 1VLNA 2YXSA 2D43A 3C2UA 3ZXFA 1HKDA 3V64A 4XZPA 2EXKA 1N3QA 4GALA 4XBNA 1G9BA 3PMEA 3PVEA 1LJ7A 2C9AA 1GZWA 3A4UA 2DVGA 1WD3A 3NWKA 1UPSA 1LU1A 2R16A 1LOFA 1OQ1A 1N1YA 4YGBA 3WOGA 1Y7BA 2P37A 2ZHMA 3SH3A 1S0EA 3WDWA 3WUDA 5DZGA 4TZDA 1G7YA 5IUQA 4FPOB 3O0WA 3OPZA 4FPYA 3ZSKA 4LBNA 4YW5A 4XMIA 5JOZA 1WD4A 2GMEA 4JCKA 5T5PA 2GMPA 2HYKA 3WG1A 1MS0A 2OVUA 1JW6A 3WNXA 4BPZA 3AZZA 2WQZC 5IK5A 1LOBA 1SLLA 3AK0A 5E8AA 2YY1A 3MPPG 4UW3A 4YM1A 2ZGTA 3R4SA 3ATGA 2CYFA 4GXLA 1A78A 3WDYA 4LBQA 1UZZA 2ZHNA 1GZ9A 4I30A 2Q5TA 3B00A 1RINA 1YIFA 2ZKNA 1WW4A 4FPJA 2PHFA 3VKMA 4XDQA 2UWAA 5IK8A 5GALA 1Q8SA 4P14A 2DVBA 2ZGOA 1ULDA 2ZA9A 1DYKA 1UX6A 1FV2A 1LEDA 4XJ9A 3GALA 1ULFA 4ISRA 2UWCA 3TB0A 1F9KA 2ZGNA 1GLHA 3WDVA 5KXCA 1BYHA 1QDCA 2KM2A 2WT0A 4FOVA 3O12A 1AX0A 2D3SA 1V6KA 2ZACA 2ZMKA 4HL0A 1N3OA 2R1DA 1YRZA 2AGSA 2ZHKA 3B01A 4AWDA 4YZ1A 4XXPA 3WHUA 3V65A 4ASMB 1MACA 4FPGA 2WT2A 1UAIA 3UJOA 3FLPA 1G9AA 1LULA 1WW7A 3D6EA 2A6WA 1AVBA 4Y24A 4BMEA 1W6OB 5T5OA 2W52A 1MR5A 3AXDA 1IS3A 3RSJA 1GNHA 2ZGMA 3ILNA 1H9WA 2DUPA 2XG3A 2DV9A 3W59A 3PVOA 2DVDA 2ZGRA 4XJAA 1LOEA 2VXRA 3DUIA 1JOJA 1SLIA 1V6LA 2GNDA 3OYWB 3QLQA 1CPNA 3POYA 4CRQA 2VY0A 2ZGPA 3N7MA 1GYKA 1OKQA 4DS0A 3WDXA 3V0AB 1GICA 1ULEA 1ENRA 1GNZA 1S0JA 1YXWA 2CWSA 1LCLA 2DUQA 1U0AA 2ES3A 3POSA 4XJUA 1LTEA 1QOSA 5DUUA 3IN9A 4DRVA 3FUQA 4M01A 1FATA 4YW2A 3BOPA 1SBDA 4Y20A 1RIRA 3WG3A 3SITA 3ZXLA 3AP9A 4GKXA 3NV3A 4XE9A 1LHUA 3SH4A 3WCSA 2D6NA 3BODA 1GKBA 1W6PB 4AVSA 3N3HA 4R9DA 1S0IA 1PZ8A 1W6NB 3Q9OA 2OUJA 1DFQA 1S0DA 4Q26A 2VU9A 2P3IA 1LODA 2A71A 1QU0A 4WVWA 3APBA 4BLIA 1DQ5A 4R9BA 2A7AA 4XJZA 1W0PA 3RMXA 3UL2A 1C1LA 2E7TA 2JJ6A 1GANA 3N7KA 4F83A 4WVVA 3AZWA 5H9QA 4K21A 4M00A 5JLVA 1V00A 1MZ5A 3ZSMA 4PBOA 3VKFC 2NN8A 1J1TA 1FV3A 5EWSA 1YI7A 5HCAA 3ZYPA 3AP6A 5T52A 1VAVA 2D6LX 4UW5A 2NP0A 1X50A 3VKLA 5DUVA 3WDUA 3HN1A 3RRDA 2CL2A 3O0XA 4GWNA 4ZXKA 1AJOA 2LALA 2ZMLA 2AR6A 1SCRA 1IOAA 4Y22B 1QNWA 2R0FA 3POWA 1W6QB 3CNAA 3SLIA 1FNYA 3M3OA 1AX2A 1O4ZA 3ZYRA 3FLRA 3RS6A 3ASIA 2NM1A 3ZXEA 4YW3A 2ZGSA 5KXBA 2ARBA 2BQPA 2P34A 2YV8A 3FBYA 3KM5A 3UJQA 4PF5A 2DWRA 1VALA 4FP3A 3MW2A 1CJPA 2AREA 3V0BB 3T2TA 4LBOA 3VKOA 1Z0HA 1MZ6A 5CBLA 3VUOA 1IS4A 1S0FA 3LCPA 1F5FA 4UW4A 4DRRA 1BXHA 1UL9A 1S0BA 1NLSA 2UU8A
chains in the Genus database with same CATH superfamily
1AR81 2PLV1 2ZGKA 2FCVA 4QDQA 3UKTA 5C71A 4AVVA 5DPNA 4QGLA 1L7QA 2K46A 1CD3G 5FZDA 4PDWA 4H55A 4YM2A 1QKQA 4Q4X2 3OSDA 4YPJA 1PM7A 1R081 4AHXA 2VVDA 5KR7A 1O8PA 2D6KA 3UK9A 1PO12 2W87A 1GQGA 1PK6B 1H8TB 5A7WA 3GDBA 1SACA 4XDPA 3PURA 1EPWA 4S2HA 5EZWA 4DQAA 2XXZA 1ZA4A 4TTGA 3V0AA 1K5MA 3OBRA 5C3OA 4UF0B 3KQRA 1PMHX 4IDZA 2HEYF 5EV7A 3RMYA 2AH2A 2H6BA 1F31A 1V9U1 3PNAA 4QPGA 3AJZA 5GZDA 5FP3A 3R05A 4CP9A 4E8CA 1APNA 3JXSA 3ZYHA 2IWGB 1A8DA 2O8OA 5FAXA 5J1XA 4FXKB 2BNNA 2Y6FA 2DUOA 5LK5A 3TN93 1ODNA 2LM3A 5KHHA 3VD7A 4Q0UA 4H7LA 4KMQA 4CXYA 2JE9A 3WR0A 2WS91 3J8F2 3FHAA 2DCJA 3NNFA 5JXIA 1TMF2 1G9CA 4IERA 3CDZB 1AXYA 5ISLA 2JD4A 4JGYB 4Y5TA 2WZPP 4BIFA 4WM7C 4ES8A 3M1HA 5BXXA 1AYN3 4XBQA 5KC6A 2IVJA 4K1YA 1JYIA 1A6CA 1YYNA 4UOJA 5ANQA 4NPLA 1EAH1 3SCHA 4KG8A 1RMU3 5A80A 2RM22 5I0UA 3D4KA 2ZABA 1HXS1 2VZSA 4FPHA 1W8UA 3NMBA 4BQYA 1JZ7A 5FZ7A 4Q0SA 4ARYA 2ZX1A 4M0HA 1VB4A 3UGFA 4BLJA 3PUQA 2A75A 1ASJ2 4HVOA 2B46X 3J4UH 2R072 1HRV3 1UY0A 1ZA7A 3FFZA 1REDA 4RR3A 3M8LA 3B7MA 4CU9A 1WMFA 1S2KA 2NMNA 3MBWA 4ATFA 4BK4A 4A42A 3WLUA 5C7GA 1X82A 1MS9A 3AYEA 1URXA 4NOTA 2JD9A 2P6CA 1FYUA 4JHZA 3KD4A 4Y22A 2J42A 4IE4A 5GZCA 1B35C 5FQ0B 1UOJA 3OCPA 1BKZA 3WW4A 1GBGA 1OUXA 4TLFA 4ZZ8A 3B69A 4LTAA 4N7UA 1PZ9A 3OBTA 4BHPA 2XONA 4XCAA 4NRQA 1VBD2 1VMHA 4MOAA 3VBOB 5BNOB 1OXCA 3H7JA 1NY72 5SV8A 1HDKA 3KSCA 3QD6A 4OUMA 3T2OA 5AVAA 3VBHB 1ULCA 4HMZA 2XJQA 3U1XA 1KJRA 1VBB1 2W95A 4KWUA 3WF4A 1CQ9A 4AEJA 1G9DA 3V0BA 1SEFA 2PAEA 3DYMA 4H14A 1G6NA 1FMD1 4EZHA 3ZPOA 3WQ0A 4HPKA 3WNLA 3HPNA 1VB2A 2ETEA 4Y4YA 3T30A 2RR11 3TBDA 1MS5A 1D4M2 2MEV3 4FCAA 4Y26A 4B7EA 2CDPA 2VAUA 2XWJB 3TYJA 1ZRDA 1VRH2 2R7EB 3NSTA 2R6QA 3LE0A 4K20A 3M70A 4C0BA 1RUJ2 2EALA 2D97A 3H8XA 1FOD1 3N9NA 5IFPA 3MLKA 2LTNA 1SLCA 2PHTA 2XLAA 2BP6A 4Q0QA 1NE6A 4Y1YA 1BEV1 1UW8A 3L9JT 5CU1A 3UGGA 4DPNA 1DHKB 4XBLA 2WWJA 5K9YA 1PGSA 4HVRA 2ZGQA 3HD8B 2ENRA 3H1MA 2FHRA 2D98A 4FPKA 1GSLA 4OHVA 2RMU1 4K8FA 4BXSV 4QGMA 1HRI1 2E51A 2ZBJA 4L11A 4XTMA 2A73B 2YU1A 5CEHA 2FDHA 4KI5M 5AC93 1ZM1A 1HQLA 1YUDA 2QDNA 4O65A 4BH9A 4YM3A 2VZQA 4JTNA 1YC61 4OQ8A 1Y9MA 1LHWA 1NX9A 2HWD3 2QNKA 2XLFA 5KWRA 3WW3A 1YI9A 3T1LA 2CWMA 1UY2A 3M2MA 5GZEA 3IPVB 1Q56A 4MVTA 1C1FA 1WLCA 2TBVA 4AFAA 5JZGB 5F32A 2GP5A 3AZXA 5ACA3 1Q8QA 3MV01 4BU2A 3WXPA 1NCRB 1Z78A 3AYCA 1W9FA 3LEIA 1DYPA 5HXMA 3D82A 2RDNA 1UZYA 1FT9A 3KCYA 4OHWA 1MS4A 1XBFA 3PVBB 5L7OB 3IB3A 2RS11 5FYVA 1PGL2 4COUA 4BM8A 1YLLA 3K77A 2QQKA 1O91A 2F4PA 2TNFA 5A7PA 3TEWA 4FPLA 5CFCB 5ABJC 2Q0AA 2OQ7A 3CJIC 4AGVA 1W9WA 5LK7B 1OLQA 5CYYA 1JXNA 3DXUA 2OT7A 3MYXA 2WT1A 2Q1ZB 2FMDA 3USUA 2GC2A 4LHSA 4K8RB 2XJPA 4DY3A 2B45X 5FMDA 2VCCA 2ZJCA 4AYUA 2VMEA 4CVUA 1W2OA 1ODMA 1UNBA 5LB6A 1Z7S2 1Y9GA 5HI0A 2Y26A 4Y4RA 2AZ5A 3INAA 1RUH3 1W05A 2GDFA 1NE4A 1PO22 4P5YA 4JKMA 3HBKA 2P1BA 1SCSA 4ZU5A 3FN9A 3I59B 4HK9A 3AC0A 3HMYA 4XEZA 3ACGA 5FXVA 1G9FA 1S1AA 3KHBA 3MIGA 1AUYA 1DGRA 1YEWA 3VD3A 1C8M3 3K3OA 2R1BA 4WZFA 3M7AA 5B4NA 4AGGA 2RE9A 2FDKA 2R49A 2VR4A 4AF9A 1DQ6A 2HH9A 2HWE3 3T0AA 5J7MA 4Z8BA 3ZSLA 1ST8A 4XF0A 1V6IA 2BNOA 4NWVA 3T4VA 3O5SA 4CDWC 5FXZA 3U07A 4OVEA 2YYOA 3OUHA 3VD5A 4BE3A 1PVC3 3VDDB 4NIHA 4QXHA 5FY5A 1JYNA 4Q4X1 4M3CE 2WLQA 1VBC2 2YC4A 1RGSA 5FKBA 5C9AA 5EXOA 1PO11 1I1EA 1UMIA 4OLLA 5I8YA 5FZLA 3QACA 3U0ZA 4YGDA 4LK6A 4FO9A 2KXLA 4YFZA 4UAPA 3O7OA 3GZAA 3AJYA 2CNAA 1QJX2 2W2IA 2X10A 2AEYA 2EIGA 3IM0A 4XF9A 2YU2A 3RZKA 4A7YA 4R9AA 2Z79A 1E5HA 2ORZA 2YMZA 3RYPA 1PM4A 2A6VA 2VTXA 2VMGA 2WSUA 4AE2A 1YO8A 1MQTB 4LXLA 3AL5A 4KH9A 2ZS6B 2DYCA 3RWNA 3LDRA 2BVVA 1UKRA 2DURA 4MHRA 4BQWA 5JIUA 2XKPA 2P3YA 3ABZA 1OQDA 3NJXA 1HX6A 3VDBA 3OEBA 2RS32 5FZBA 3SCGA 3M3QA 3N7LA 1NA1B 1QGLA 3J8F1 1O4YA 2WAAA 2TUNA 1TMF1 1SLAA 2G9ZA 4QQLA 5IJRA 4DEQA 4GMP0 5F5AA 1DLCA 5KC5A 1NXMA 2X8KA 4GB32 4OMDA 1IZ3A 4P9WA 4YNIA 1RUF3 4HKWA 5FUPA 3S7IA 3LA3A 5K4LA 3UT0A 4A7ZA 3H9AA 2FZ2A 4YW6A 1OHFA 2Y6LA 2W91A 5HCBA 2JKBA 2EAKA 4HG6B 3JBG3 3LAGA 2FZ1A 5IT6A 3AMMA 1XYNA 1ZZBA 1EUTA 2VW2A 2RM21 4IV1C 1C4RA 3VKNA 3ZSEA 1H9PA 3ME2A 2E6VA 1W6MA 4HKOA 4M3CF 1OF3A 5DG2A 2GNBA 2VTXJ 1VAKA 2WNVB 3OPWA 4YVWA 5FWJA 1ASJ1 3E1F1 2R071 2C1FA 4RQPB 1F5JA 5EYYA 1H30A 2WNUC 1VE0A 4FPEA 2PA7A 4RA0A 3OJBA 4Y20B 3RVHA 5IAVA 3BPZA 2HEWF 5FY9A 2IXKA 3M3CA 4MV2A 5DZEA 4Q8LA 2JIJA 1UOGA 5FLHA 3RYRA 1DU3D 3USSA 4XZPA 4W6XA 1VBD1 4MGZE 4XW3A 3RZJA 4O9GA 3CKHA 4FTBA 3GZEA 4F7ZA 1NY71 1WA4A 3P3NA 1RHI3 1GZWA 1S2EA 3O14A 3NWKA 3J9SA 5FZ9A 4DXSA 4C0HA 3BTXA 2R16A 2WZEA 4OI2A 2QQWA 1BK0A 3FHIB 1XE7A 3GJAA 5C4WC 2P37A 2ZHMA 4LORA 3E97A 2WRAA 2GC3A 5DZGA 1G7YA 5IUQA 4FPOB 4NHLA 4PIXA 2PQSA 4FPYA 4NHXA 3LFMA 5T5PA 2OQ6A 5D2AA 3WG1A 1D4M1 3ZYIB 2FMYA 2XJSA 1MS0A 1X8EA 1AR72 1IGOA 2XUMA 1GOGA 4BA6A 5CG8A 3AZZA 2BU9A 4XFCA 4SBVA 3AFGA 3NVCA 4FSJA 4IV3A 1VRH1 5E8AA 1EYBA 2P5BA 3LIHA 1ND2B 1RUJ1 2E9QA 4LQRA 4YM1A 2E63A 3RZLA 4BZ4A 4HVQA 1TNFA 3GCXA 2ZHNA 1GZ9A 4I30A 1TNRA 1UIJA 5A32A 1YIFA 1HV1A 4CCEA 4IE6A 3ZXDA 3DXTA 1C28A 1QH6A 5IVYA 1ND3A 3K51A 2PHFA 5SV5A 4XDQA 4LLFA 3VBSC 3T0BA 2W5FA 4XUOA 4CDXC 4AQSA 3WQ1A 5DDJ2 2XHNA 5C5UA 3WDVA 5DAWA 5KHJA 2WT0A 2QCSB 1U5IA 1POV0 1AX0A 2ZACA 4FFGA 2QUOA 4EYUA 2WQ4A 5FPBA 1YRZA 5C8WA 2ZEZA 1XE0A 1GOHA 3T2QA 4YZ1A 3B01A 2IXHA 2YBKA 3OBZA 3WHUA 3V65A 5A6QA 4ZS2A 1X36A 5K0UA 2WT2A 1UAIA 2W1WA 2WR9A 1G9AA 1LULA 1WW7A 2JWPA 1AVBA 3DL3A 4A44A 2HWC3 1MR5A 3AXDA 2BWAA 1IS3A 3I2DA 3EMRA 5FZ3A 5CADA 2DUPA 2XG3A 3PUIA 3K46A 4PDWB 3VLBB 4CXXA 4D7YA 3W59A 3PVOA 2DVDA 1ZBE2 1LOEA 3ZXAC 3DUIA 3KWVA 3WT3A 3ZFEA 4MGKE 5A7WB 4IEYA 1PGL1 2W92A 4DS0A 1OKQA 3V0AB 2WFPA 4HT1T 3QBQA 2B9VA 1K5MB 3ZKYA 1ZZ8A 1GNZA 1S0JA 2CWSA 4GMP3 1YQ5A 4CSWA 3Q8AA 3NJYA 4L99A 5EJ1B 1LTEA 4QPGB 4DUVA 4BQ4A 3IN9A 3POJA 5F2WA 4CP9B 4DRVA 1WKYA 3WY6A 2FDGA 4PI0A 3PIGA 4Q4Y2 3GGLA 1PX4A 3H8UA 4AFDA 3ZO0B 3SKJE 4GH4A 3SITA 4GKXA 3SH4A 2WO1A 1LHUA 1Z7S1 2QQMA 2RJ2A 1AYM2 1WGPA 3D0SA 3I97A 2Q8CA 2WBKA 2WLPA 5FPUA 4UFHA 3M3IA 5I0RA 1PO21 5D8AA 2DFBA 1S0IA 2DCTA 1ZZ9A 3URFA 3NAPC 5K7PA 1PIV2 4CEYA 1W3VA 1DF0A 2EIEA 3BN6A 2NLRA 2OX0A 4Q0PA 3APBA 4XFAA 3ZFGC 4RYDA 4LO8A 4QX5A 1NCRA 3MHZA 4PHZA 4NRMA 1QHDA 4WM8A 3UL2A 1XNTA 1RVF3 3W9AA 1GANA 2VUJA 3AZWA 2RVAA 4K21A 5H9QA 2J1AA 3IZOA 4M00A 5L19A 1V00A 3WSOA 1YQ6A 4CA9A 1RJ8A 4NMIA 3VKFC 4LNVA 4PJYA 3TEZA 2CGNA 1YI7A 2XR4A 3KGLA 3KVBA 3AP6A 1I5ZA 5FK7A 1VBC1 4RR3B 4NN0A 4QPIA 3NO8A 1L7LA 2C6SA 2JIGA 4NIGA 1UU5A 2RJKA 1H0BA 1Q3EA 3A7QA 3JB4C 2CL2A 1BCXA 1WCUA 3CLPA 3U37A 3EYPA 3E5UA 1SCRA 2HBTA 1IOAA 4Y22B 5CVRA 4Q4V2 1QNWA 3J7NA 1QJX1 3VHRA 1CWPA 3SLIA 4RS5A 1AX2A 4MG2A 5LEKA 1BK1A 1ALYA 3HT2A 3MF9A 5D21A 3DN7A 4QXCA 5FOJB 2BQPA 2P34A 3FBYA 2ZOEB 3KM5A 3UJQA 3WF1A 2ORXA 4PF5A 4Y33A 1AR83 2DWRA 4P00B 1H1MA 2EAAA 2PLV3 5CKQA 3VDAA 4I3PA 2QQPA 2AREA 3HWJA 3NJVA 2F4LA 3V0BB 4INDA 4LBOA 3PU3A 5LA1A 2I07B 4N43C 2RS31 1R083 3KV9A 1S0FA 2WO7A 3LCPA 3OGSA 1F5FA 1CAUA 4AFCA 4HPKB 1BXHA 1UL9A 2VQTA 3D3AA 1U12A 1TZOA 2B9UA 4QAWA 1F15A 2WC2A 4GB31 5BYNA 1RUE2 1RUI2 4QX8A 3LDBA 3UESA 1KFUL 3ORJA 2Y38A 4Y1UA 1LOFC 2PAMA 4K7JA 4YLZA 5BNNC 1POV3 2UY9A 5A6YA 5KXDA 5L9BA 4CDQC 2VL4A 3ZVXA 4HOOA 1KD7A 2OKXA 1EP0A 2W1SA 2VMFA 4FOYA 4OHXA 2EF6A 3BIWE 5E89A 5T3NA 2GSYA 3FHQA 3OGRA 2X53S 4TWTA 2DTWA 3EBRA 1UXZA 3IT8A 4ZY9A 5KHIA 3VBRA 1SZBA 2DU1A 2XWBB 4LE3A 3ZX7A 3FLTA 1JZ8A 2WNOA 1LU2A 4D94A 2QQNA 1MQTA 5J36A 4YRDA 5A3LA 1GP5A 3PVNA 3KV4A 5I91A 4A2UA 1NXD1 2Y6KA 4LKDA 4LT5A 4CPBD 5FLJA 2YZ4A 2OZJA 3U78A 1W04A 2G9FA 4YYOA 4AI0A 1GNYA 5JOXA 1KDKA 3LOBA 5M0TA 2OA2A 4E2SA 4FBFA 5H9RA 1EAH3 4ATEA 4EWEA 4RL7A 1W6NA 3HAGA 4AI1A 3AXEA 1RB8G 2WYFA 1HXS3 3BU7A 1E5RA 2C26A 5GLUA 2Y60A 4XHXA 1GV9A 1JYWA 3BTAA 4GA9A 1W03A 3NL1A 4BQXA 3K4AA 2JDKA 3O0VA 5FLIA 4XIKA 1EV12 1PMJX 1W8WA 3FC0A 5JDBA 1SLTA 1UX7A 1ZYBA 2CAVA 3OGVA 3HT1A 2J22A 5DXDA 1IQAA 3WW2A 1AR71 3ETQA 3O1RA 2WSVA 4OUEA 4N90A 2V09A 2ZKLA 3A0KA 2Q1FA 4LKFA 5BPXA 3O1SA 5E88A 1LNSA 5DAVA 5JCTA 1RUD2 1R1A2 4NAOA 5LZ6A 4LITA 3USUB 2X5IC 5T5JA 1UZ0A 4LBQB 1JYXA 1FAYA 3N9PA 1VBB3 2DVFA 2P17A 3C7OA 3DKWA 1VBE1 3H3ZA 2VNGA 4P9JA 4XQ4A 2QKDA 2CSGA 1FMD3 2YC2A 4N9IA 5FZHA 2BEOA 2V73A 1JOPA 3ZR6A 3AVRA 2HLEA 5DDJ1 3I2OA 5L9VA 1N1SA 4HONA 1VBA2 2RR13 1N47A 3GCWA 3LEMA 3MLLA 4JRAA 5I0TA 1US2A 3OBAA 2X09A 5FYSA 4NR1A 5CFDC 5FP8A 2VPVA 4ZXEA 3I3MA 3W5MA 5HCFA 4QMAA 1ZRIA 4HN0A 1XU2A 4XF1A 3ALQA 3LEGA 3TRSB 4D7SA 1AXKA 4P08A 4ARXA 3ZFFA 1AXZA 1HIXA 5F3GA 2LRPA 3EB7A 4Z1VA 1BEV3 2XVKA 5C8CA 5I8TA 1J84A 2D3PA 5FZIA 4F8AA 4UFLA 1PGW2 2QQLA 4QHOA 1ZBE1 1REFA 4EE2A 5C9AB 4JDMA 5FREA 4LR4A 2C9KA 4AI8A 5EJ3A 1OA4A 2BOIA 4YZ5A 1HRI3 3RWKX 1PX3A 1RUG3 1GP6A 4YWAA 1UXXX 2W39A 3QOPA 1UMZA 5F1RA 1ENSA 4AEKA 5FY0A 4CUAA 4FTEA 4FFHA 1JYVA 3WQ7A 1ZX5A 1SBEA 1GMMA 1R64A 2E32A 2EXHA 4NIDA 4MXWA 3MGUA 3CEWA 2D6MA 1XB9A 1H1AA 2W94A 4Q4Y1 4C8DA 2RDSA 1W9YA 5LATA 3LIGA 2XJRA 5DUWA 5JSOA 2VM9A 4PCRA 4ZONA 1AYM1 3UYJA 2FDIA 1COV2 5LY2A 2HWF2 1GZCA 4N53C 1S0GA 4QX2A 4FTSA 2Q8EA 4B4QA 1X7NA 4L8QA 4E9KA 5KXEA 1IPSA 1QF3A 4TSVA 1UYXA 1PIV1 3ACIA 3SC7X 3I2IA 3CZUA 3B9CA 5DUXA 4AEDC 1DZRA 2OIIA 3B94A 4CZSA 1KITA 1WLWA 2R32A 5DN2A 1V6OA 5IFTA 1HB1A 4XHBA 3DYPA 4LA2A 4QX0A 2EIBA 2ATFA 3ACLA 1XNBA 1LGCA 4YGCA 4AQTA 1T6GC 4I2OA 3N4MA 4YVSC 2R043 1W6MB 2XBO3 4B1MA 5DAPA 2P3JA 2QFEA 5FRAA 2PYTA 4YVWB 2JDNA 2ARXA 3HNYM 4AVBA 2XVLA 4IEPA 5F39A 4FXGB 2YFZA 1SLBA 4K6BA 1NCQC 5IW0A 1EUUA 1QXPA 3ZPYA 3O1OA 1SMVA 2V4AA 4Q4V1 1RMU2 5F9TA 1JU3A 5BNPA 2WO3A 4CDUC 4ES9A 1WBFA 2WABA 1NT0A 4HSJA 4E27A 2VBBA 2A6XA 1Y4WA 1XYOA 1YQ2A 2Y0IA 2OW4A 4NIIA 3VGIA 3IWZA 3MW3A 1W3XA 2ZAAA 4YSFA 1OLME 1OOPC 4AGRA 4PQ9A 3ZYJB 5AVPA 1GZWB 2WFF2 2H0BA 2YBPA 2VTFA 5EHDA 3NNGA 2D3RA 4Q4X3 3FUOA 4JGZA 2AYHA 1KFXL 1XPWA 5GZFA 5HV4A 5FYBA 1UMHA 2VUAA 5FZ6A 3WVJA 1OC1A 1GFF2 3CJXA 4BCUA 3AM2A 2VE1A 4OCTA 1RUE1 4AVAA 3ZXKA 1RUI1 5BY5A 3ILRA 2Y34A 5LBBA 1YFWA 3VBFA 1OBNA 3OY8A 4IV3B 2D40A 1WBLA 1K12A 4JDNA 2VVEA 1PNGA 1HB2A 4XFHA 1TQ5A 5FIXA 5F8PA 3UKVA 3I2FA 2ZEXA 4CEWC 3IKWA 3ST7A 5EJZB 5A32B 2YGMA 4EN7B 1RITA 5KHKA 1ND3B 2JG9C 5JVVA 4E4ZA 2GNMA 2MEV2 1TME3 2VZOA 2NZ9A 4AEMA 1O6UA 2WZR2 4YFWA 4OI4A 1UU6A 4L92A 4XVHA 2PHUA 3SNMA 3J8F3 3WG4A 2AUYA 1CPMA 3MI8A 1TMF3 4U36A 3VHNA 3DECA 5HBAA 2VBPA 3SH5A 2Z42A 3E6CC 4KBBA 3R0RA 1W9SA 5JMOA 4P9XA 2H6CA 3G7DA 5GM0A 5LA9A 1HV0A 1OLRA 3VZKA 3J7MA 3ZLIA 1DGWX 4IEWA 5K0UB 1WLDA 1Q5OA 4BYYA 5CAZA 2RM23 2JG8A 1O3TA 4LMFA 2BRTA 1JI6A 1XQNA 4EQVA 1YJKA 4LBQD 4OHZA 4QQOA 5J96B 1AL0G 1DG6A 2UY8A 1OFSA 2EXIA 3DPRA 1J58A 4PLNA 4TN7A 5C33A 1XNCA 4A7KA 2R073 5AC92 3VB9A 1DBNA 3VBUC 3PMSA 3ZFEB 1EV11 5HPOA 2ZMNA 2YC0A 5JWPA 4QM9A 1AL23 2HWD2 3CO2A 1K45A 4HSLA 3ZN5A 4ORFA 4XF4A 4Q0VA 2RDQA 2YROA 3MLJA 1MS8A 4NE9A 3KT1A 2A6YA 1UOBA 3B3QE 4YZ3A 2JKXA 2VZUA 5G05L 1SFNA 4UI9L 1RUD1 1R1A1 1VBD3 3POGA 4NPRA 2W46A 5JSPA 4YW1A 1JN2P 1PK6C 4XCBA 1H8TC 2F6BA 4GH4B 4IXLA 2OPKA 1CZSA 3I2KA 4KL1A 2C5DA 1CAWA 2IZWA 4XJ8A 4DIQA 5D8AB 1E5IA 1ZRRA 5FPXA 2Y6GA 2MNGA 3J26N 3MIEA 4K3UA 3V64A 5I93A 1YFUA 2VMCA 1VBA1 3ELNA 3KB5A 3PVEA 3RPQA 3T4HB 3NJZA 4B7KA 4CEYB 4IGQA 3PUSA 4CCKA 3A22A 1F4HA 5A1LA 2Q1MA 4J25A 4MH0E 4XDOA 3FMGA 2XQRA 1OF4A 2IXCA 1VRH3 5FP4A 3KF3A 4WM8B 1RUJ3 4YGBA 1N1YA 3GBGA 3WOGA 3ZM8A 2VNVA 3SH3A 2XQXA 3WDWA 4Z2WA 4MGTA 1OKOA 5FY7A 1RUH2 4EJRA 5J3UA 4HZFA 4PT6A 3I2JA 4EN6B 2GMEA 2ARAA 4XAAA 2GMPA 3V56A 1LB2A 3DV8A 4JGYC 3E5QA 3I7DA 4W6WA 4RGKA 1W39A 1LOBA 1PGW1 1C8M2 4QPIB 4HBNA 2ZGTA 2PMWB 3K48A 4TLGA 4QQHA 3ES4A 4XFBA 2BW8A 4LBQA 2HWE2 4V1PA 4IEXA 4JZRA 1AR92 3LEKA 2Q5TA 1RINA 1VP6A 3JQXA 5CZKA 5JXHA 1JYTA 4RS5B 3BOWA 3G6JB 3VKMA 2UWAA 4OMCA 5DAXA 4CUGA 4EWAA 2BV4A 2DVBA 4ZPIA 2Q30A 4XJ9A 4QKBA 1ULFA 5JIAA 2UWCA 2ZGNA 3HQRA 2IFRA 5KXCA 1SDDB 4FOVA 3GZUC 2O14A 2D3SA 1V6KA 2ZMKA 5F6KA 3SKVA 1COV1 1N3OA 2HWF1 1XNAA 2AGSA 1CAUB 2ZHKA 5EFUA 5FZCA 4XXPA 2R063 4NJ4A 1BVVA 3NNLA 1MPXA 3VBOC 3D6EA 5BNOC 5EIYB 3GBWA 5T5OA 3OD4A 3VBHC 3RSJA 3BUCA 1H9WA 5AFEA 3B5LB 2DV9A 1H2LA 2DBIA 2G9GA 4XC9A 3WNMA 4OZOA 5FR3A 2ZGRA 1F8VA 2VXRA 4JVAA 1JOJA 3JQWA 2JB8A 3TEYA 5CKMA 4XFIA 1GWMA 3LA2A 3LKJA 1BBT2 2VY0A 5F2SA 5FK8A 4O9EA 3WDXA 3AMPA 2ADEA 1WA6X 1B35A 2BYVE 2QQIA 1ENRA 3VBRB 1YXWA 2EICA 5I0SA 4NHYA 4J1XA 2DUQA 1U0AA 2HYXA 2Y6JA 1PO23 1ZVFA 2ZX0A 4LUKA 1QOSA 1EY2A 1MEC2 1QH7A 3AMQA 3RZZA 5J48A 4QKFA 4M01A 4DXZA 1R092 3SXWA 3TNQA 1OA3A 3NW4A 4EZ4A 1GWKA 2ET1A 4QDRA 4XFFA 1RMU1 4O7XA 4PIZA 3ZXLA 3UKNA 5FY1A 4CU6A 1O7FA 3MDPA 4OYUA 3N3HA 4R9DA 1OMIA 1W6NB 2LROA 4LHLA 1S0DA 2VU9A 1U5ZA 4RD7A 2WFF1 1RYYA 3LA7A 4WVWA 5FFOC 4L2NA 4I0BA 1W2NA 3TNPB 3ZDVA 1ENXA 3HNBM 1UU4A 3KQ4B 3AKTA 4XJZA 1VBC3 1QJFA 1RXFA 2JJ6A 2KA3A 3N7KA 4F83A 4RN5A 4IETA 3WEZA 3CQOA 2JICA 3OTFA 4OQ9A 3KS7A 5LA0A 4PBOA 3THTA 1YQ8A 3BGAA 3ZDSA 5EWSA 5HCAA 1RHI2 2XGXA 5JZGC 1ULOA 1MZEA 3ZXGA 1NCRC 1RL3A 3RRDA 4L9BA 5DMYA 4GWNA 2J7MA 1RUC3 2NQYA 1OT5A 3WNOA 2LALA 2BGOA 5L7OC 2AR6A 2XPJA 2YBSA 3OGJA 2IXJA 1HN1A 4RGAA 2R0FA 3T09A 1NQJA 5C6CA 3CNAA 2MEV1 1QJZA 5CFCC 3FLRA 2WZR1 3POFA 5FZEA 3KLSA 4AXOA 4WBBA 3AL6A 3ASIA 1L7RA 4YW3A 1MZFA 4HFSA 1UY3A 2YV8A 2YPJA 3BCWA 4X8NA 4NROA 4BQ2A 5FZ4A 1ZRFA 4FP3A 2Y0OA 4RHV3 1CJPA 5FPZA 4LIUA 3HQXA 1Z0HA 3VZJA 1FPN3 5CBLA 2WN3A 3LPFA 4JQRA 4D6RA 5FYTA 1S0BA 3EXUA 3ZFFB 3AVSA 2D5HA 5A3PA 4AR2A 2IFWA 5I8SA 1AR62 5FYMA 3N9QA 4YARA 1W6OA 1IPKA 4QXBA 5F3EA 1QEXA 3ZYGA 5C8CB 4UFKA 1DGWA 2ZX4A 5ABJA 2W1UA 1D4VB 4DFSA 1LOAA 1CX1A 3CJIA 5AC91 4AI2A 1ZZ7A 4AHZA 4LULA 3ENRA 3N9LA 5I0DA 2PELA 3K2OA 4XIOA 3KV6A 2IXLA 2HWD1 1VBE2 3N7JA 5A33A 1CX4A 1Q8PA 3JUUA 4COZA 3VDDC 2BZDA 2V5DA 3PTYA 4C1WA 3ZKUA 5A1FA 3AX4A 3LSEA 3VN4A 4O61A 1D2SA 1MVEA 4MXWB 2CAUA 2PAKA 2XOMA 1N1TA 3Q8EA 2F17A 3IDAA 4DXTA 1JU4A 4XQDA 4MGSA 5F5IA 4OULA 5A7SA 1HQWA 4LA3A 2I74A 3HOBA 1JYCA 5A3MA 4IQPA 1DGLA 1QOOA 3BB6A 1OH3A 4P5HA 1Y3TA 5A70A 1MQTC 1O3SA 1SBFA 1B09A 2BFUS 4Y1XA 1H2NA 4CDWA 2VMHA 5F5QA 2VZ1A 2D6OX 4ET7A 2JDPA 5FZFA 4XABA 2YHJA 2VW1A 4V2VA 1NA1C 2WWUA 2RS52 4BXFA 1RUH1 3QH6A 3UNPA 1CIWA 3GZTB 4EROA 2YGLA 1XNDA 3AKQA 1OFNA 1G86A 3RDIA 1ULGA 1IPJA 2TEPA 4P9YA 2DCZA 4KU7A 3WDTA 3BU0A 1CVNA 3H7YA 1C8M1 1N3PA 2QQJA 3JU9A 3FWEA 5CA6A 1AZDA 4YG0A 2HWE1 1RVF2 4IESA 4HN1A 3SISA 1AR91 3H3UA 3MZHA 3RZHA 1Y43B 2J1TA 1W6QA 5BNPB 4LOSA 2WNVC 2G4IA 3IDEA 1LHVA 1HW5A 1CESA 1QJY2 3NV2A 2JENA 3KV5A 4IGPA 1H6XA 1QXRA 1WCKA 4QXKA 4RQPC 1N1VA 2D93A 1VIWB 4Q27A 1CONA 4JKKA 4LO6B 2A1XA 2KR2A 3AKSA 5DG1A 5ANNA 5GLWA 4GWMA 1I9RA 4FI9A 2EVXA 3ILFA 3CHXA 4XILA 1QQP2 2WA4A 3WX5A 2J1RA 2W47A 4Q4W2 3DF0A 1CAVA 2HWB2 4JGZB 1ACCA 1ZBE3 3JD73 2VJXA 2JDUA 4D0QA 3L2YA 4OHYA 5FYZA 5IHRA 2QE3A 2CV6A 2VMDA 1K5JA 3AYDA 2QJVA 3BI3A 5GLVA 2AACA 4IV1A 3WNNA 3HEIA 4QU1A 4BMBA 1UQXA 1W0OA 3VBFB 5IVCA 4GKYA 3OY8B 2OYZA 5APAA 5FOBB 4AI9A 3POEA 3VDCA 3WUCA 4TYSA 5FYCA 3AKPA 4GWIA 4D8MA 3POIA 4IEVA 3W20A 4FPCA 3H3LA 2WNUA 2AENA 3NNMA 1BBT1 2UWBA 1V6MA 1DQ2A 3X29B 1WMEA 2O1QA 5FYIA 1AYM3 2DCKA 4E2QA 3S57A 3WQBA 2A5ZA 1ND2C 1W06A 1YIPA 1ZZ6A 1MEC1 2VOWA 4IEUA 5L9RA 2CY6A 4AVTA 4MGQA 3CBNA 1PIV3 1R091 2YG0A 1OD3A 1QIQA 3NV1A 4R4ZA 1TG7A 3MO4A 4KBZA 1PHMA 1S4CA 1GP4A 1W9TA 1W8HA 4OZXA 4RGGA 5FZOA 5LBFA 1BQPA 2LUWA 4IEQA 2QZ3A 5F5CA 3WF0A 3WP4A 4QX7A 4R52A 5A6ZA 1JODA 2KD7A 2YB7A 5C4WA 2BOJA 1JUHA 1DQ0A 3I8TA 1W90A 1J1LA 2RJLA 2B7YA 5FDBA 5LRSA 2E53A 3AP5A 1YWKA 2JG8B 2J1UA 2PHXA 2ZGUA 3GBFA 3M3EA 1O5LA 4W8JA 1UWWA 1VAMA 3OD0A 4A6OA 1V9U3 4QU2A 4UXAA 1ZBA2 1I3HA 3DPRB 5A3OA 4U2AA 4M4RA 1LR5A 1BMV2 3ETPA 1H8VA 1QDOA 1QJU2 2D7FA 1LHNA 2GN3A 4XTPA 4QB6A 4UBGA 2B39A 2BTVC 3POBA 1KJLA 2ZTNA 1BJQA 1A8MA 4LBMA 1CAXA 5DQ0A 1RHI1 4PDWC 4ZS3A 3T0DA 2WS93 4N8MA 3VBSA 2ZGLA 3J7HA 2OUHA 3T08A 1XYPA 1LHOA 4CDXA 1UYYA 5HV0A 3IAPA 4I01A 2X29A 3A21A 4UWDA 2ERFA 4JX0A 3NV4A 5H9PA 2C0ZA 3I3EA 4H2AA 2D5FA 1K5MC 2JECA 1D0HA 1CAWB 1LRHA 2D44A 4I3GA 5LBEA 2GZWA 1M4WA 4DXRA 2ID4A 4QPGC 4GAZA 4R9CA 1UYPA 1BZWA 1W8NA 3OOXA 1T6BX 3GF6A 4NAMA 4DNYA 3I49A 5IK7A 2VW0A 2XB6C 4UFIA 3L2HA 1P8JA 5FBJA 3OGGA 1W8TA 4CU7A 1S2BA 3DGTA 1RUE3 3H50A 2Y8KA 1J3QA 2PHRA 3EO6A 4MYEA 2OPWA 4MGYE 3VV1A 2P2KA 1GQHA 1REEA 1HLCA 2VBDA 2CU5A 2NMOA 2H0VA 4FQ4A 4JV4A 1OI6A 3B93A 5EQUA 4A3XA 1LESA 4S2DA 1FI2A 1OPMA 1FNZA 1AR61 4P9LA 2NPIA 3SQOA 3R4DB 3Q8FA 3IIAA 4M3CA 1US3A 2I2SA 3MPBA 4UW6A 2JE7A 3LF7A 4XAEA 5F7UA 4DUXA 3VZOA 2JXAA 2FDFA 1ZNPA 4PIYA 5LA2A 5F37A 3GYDA 3I54A 2GMMA 1STMA 3WD5A 4HK8A 1QNYA 1KQRA 4DO0A 2ZCWA 1CR7A 1W8ZA 2ZZQA 3QH7A 5JR7B 3WP3A 2AC1A 4YG6A 3O1MA 4XMAA 4Q29A 1LAJA 2FDJA 1IKQA 1VRBA 2SBAA 1DZQA 5IYYA 1CZTA 2GP3A 3O1TA 2WO2A 3AMHA 4WZCA 2QQOA 3VBFC 4RR3C 1LGBA 1JS9A 2G19A 3B02A 3IMNA 4XJWA 4GIQA 3NAPA 5LRRA 3S7EA 4NO4A 5CNAA 3T1MA 4QHBA 4CYDA 5JLVA 1ENQA 1AJKA 1AF9A 1KEXA 5FXWA 2JDHA 4WM7B 1TEIA 1J83A 1RUG2 2GN7A 5F3CA 2A3WA 1FOD3 1LOCA 2N7GA 4WVMA 1YNAA 3I3BA 2ADDA 4EN9B 1EV13 2JDMA 3NKTA 4QQPA 3MV11 3A0NA 1E57A 1J59A 4NHKA 5E6HA 2YUEA 4FFIA 4J6GA 1QOTA 2CGOA 3NQHA 3BPSA 5A7QA 2RMU3 2GU9A 4QD2A 4RFT0 3H0OA 4BDVB 1RUD3 2RS51 1R1A3 4QB2A 5DAQA 3TAYA 5FPAA 3ZN4A 1VPHA 4QKDA 5GLZA 2OXBA 4YZ2A 5JI9A 5JOWA 1B35B 2YDEA 1UYZA 2A3XA 2WN2A 3VZMA 5L36A 3K4ZA 5JXJA 5HXVA 4M0NA 4AL9A 2C4XA 3CF6E 3DPRC 5LASA 3AZVA 3O1UA 1HB3A 1W2UA 3D0JA 1QMJA 1RVF1 4W65A 2VC9A 5T54A 1VBA3 4H7MA 3WV6A 4CCJA 3S0MA 2VMIA 1X8MA 2DF7A 3GM8A 4A6SA 1UN1A 2WYSA 2ZZJA 2R042 3KCCA 2DVAA 3U11A 4Y1VA 5FP9A 1NQDA 3OPTA 4N43A 4Y3OA 2XBO2 2CDOA 2PXJA 4A3ZA 1HKDA 3DKQA 5IWFA 3SCFA 1H6YA 1QJY1 2EXKA 2RS13 3KZ4C 4IE5A 5JSRA 3ZN6A 3JZVA 1IG0A 1WCDJ 1LJ7A 2C9AA 4I0AA 5FZAA 2VQ0A 4COYA 4PLOA 3TN92 2DVGA 1WD3A 1H2KA 1QQP1 1UY1A 2DCYA 4Q4W1 2HWB1 3VL9A 5JR2A 1LOFA 5BNNA 3BKZA 1OQ1A 4UFJA 5A3NA 3WUDA 4TZDA 4MSVA 4CDQA 2FQPA 5FP7A 3O0WA 3OPZA 5CG9A 3ZSKA 4LBNA 1NLRA 1DGRN 3F95A 3MIBA 3I2GA 4MHUA 1WD4A 4XMIA 4YW5A 5JOZA 4OFGA 3H1WA 1RTVA 2R30A 4BPZA 2FD8A 2WQZC 3PLQA 3GHMA 1AYN2 4BJ0A 4BK5A 2BGCA 2YY1A 3R4SA 2BERA 5FZGA 1SPPA 4GXLA 1A78A 2GH2A 1QY4A 4LHNA 4JQTA 3OUJA 3B00A 3CL1A 3GHNA 1C5IA 3MFCA 2WQ8A 1XRUA 3IDCB 4FPJA 1COV3 3THPA 1UF2C 2HWF3 1XOYA 2C24A 2XJVA 3EHKA 1Q8SA 2WDBA 3OB8A 1S55A 2ZPXA 1HRV2 3BVCA 2JB4A 3RZGA 4QQ2A 1DYKA 2E33A 4E2GA 1POV1 3GALA 2OZ6A 4LOTA 1F9KA 5FWEA 3TB0A 2YPDA 4F3JA 1C8NA 4KNCA 2KM2A 3FL7A 3HIFA 3O12A 4MX3A 5FKCA 4ZU4A 3I3DA 1YQCA 1W0NA 4BQ3A 5BNQA 2PFWA 1PO13 1BVP1 5IAXA 1TME2 4ASMB 1MACA 2VCBA 4BMEA 4Y24A 3ZIXA 4G9SB 4G4FA 1W6OB 3MF6A 2W52A 5FPLA 1T2XA 1GNHA 2ZGMA 3ILNA 2XVGA 1ZBA1 2VCMA 1M06G 5ABJB 1K42A 1OUSA 1BMV1 3CJIB 1OSGA 1TE1B 2Z69A 4OI0A 5FXXA 4XJAA 5FTTC 4LE4A 1QJU1 2GNDA 2X5IA 1CGPA 1AHSA 1CPNA 4CRQA 4G3YC 4NWWA 2ZGPA 4Y5Z0 4I09A 1OH4A 5A33B 4IW3A 1ULEA 4XPVA 2VG9A 4GJZA 4COVA 2B5HA 4XJUA 3BYWA 5C9AC 3FUQA 1FATA 2FCUA 5EP9A 4YW2A 3BOPA 4AI3A 2QBXA 2XL7A 1O3QA 1RIRA 2WFF3 3WG3A 1K3IA 2VUCA 3NV3A 1AL22 1NKGA 3ZOIA 3WCSA 5CFDA 2D6NA 4DEVA 1WCQA 4AVSA 3HBZA 4N9HA 3ZYBA 4OUSA 2VZPA 1PZ8A 3PDQA 2WIIB 3Q9OA 3HN3A 2OUJA 4Q26A 4NHMA 4CDWB 1C5HA 4BLIA 2WINB 1DQ5A 4R9BA 1ASJ3 2A7AA 3W5NA 4EWDA 1UO9A 3JCIA 5A6XA 1C1LA 4GULA 2E7TA 3FJSA 2QQVA 1OURA 3AKRA 2Y64A 1ZREA 4TXWA 2E31A 5FY4A 4P9IA 2NN8A 1J1TA 5FYYA 1GOFA 1VJ2A 3ZYPA 4ONUA 3K3NA 5T52A 1QJEA 2WZR3 3T3YA 3WW1A 5ACA2 4QB1A 5J37A 1VAVA 2D6LX 1HQNA 2K2SA 5FMCA 2NP0A 3VKLA 3WDUA 3HN1A 4AAXA 2VNOA 3O0XA 4IE7A 3NKGA 4XZUG 4ZXKA 1AJOA 4RSUA 1GZTA 3IDBB 1ZZCA 3T2PA 1J3PA 3POWA 1W6QB 1Y9QA 3M3OA 2VULA 1H2MA 1JMUB 1O4ZA 3OF1A 4HLTA 4N53A 1DYOA 3U10A 4DOUA 1W2TA 4YVWC 3KHCA 4QT6A 1DZTA 5IVBA 5FMOL 4Z92B 2P6HA 2ZGSA 5FZ0A 2ARBA 5FO8B 3IAQA 1D4M3 3MUY1 4EV0A 4AEDA 4QWNA 5C5TA 4IUGA 1VALA 3MW2A 3SEPA 1TVGA 1RUG1 5LBCA 1QXJA 3T2TA 3VKOA 3LPGA 4BB3A 1CAVB 1D0GA 1MZ6A 5FJKA 4ASLA 1NZCA 3IIIA 3H42B 4UW4A 3VHOA 4DRRA 5FJHA 1NLSA 2UU8A 2ILMA 4IV1B 4XUTA 4YVSA 1MS1A 4PI2A 4E4HA 1KGYA 5FYUA 2GALA 5JUVA 3P3PA 2WJSA 3BIEA 5EPAA 1H4HA 2NYYA 5IVFA 1JOBA 1UOFA 2JEMA 4QM8A 4NIAA 2EXJA 3S5QA 3BTZA 3WNPA 2JE8A 2WNUB 1UKGA 3OYWA 4QPYA 5DABA 3WCRA 1JH5A 1NCQA 4XUNA 1O5UA 2R062 3D5OA 4DINB 3ZXJA 3K4DA 3RI9A 2EIDA 4NPMA 4BISA 2VZ3A 3AYAA 2SLIA 2ZXQA 1PVC2 1XU1A 5GLTA 3ZMNA 3C7GA 2UURA 2WA3A 3MEPA 4IV3C 4CDUA 1A3KA 5H9SA 1Q8VA 1OOPA 1CN1A 2VUDA 5LEJA 2MHFA 4WM7A 3O1PA 2DTYA 4GD4A 3WF3A 3OEAA 4XUPA 5FZOB 2J1EA 4CUBA 5C3QA 2R041 1ND3C 4MGIE 2XBO1 5F6LB 5C4WB 4K9SA 1W6PA 1IHMA 2PHLA 5A3WA 4BWOA 2G1MA 1JZ4A 3M4FA 1YCIA 1NUKA 1I6XA 2ZX2A 3ZR5A 1UD1A 4CCOA 3ITQA 4KGGA 3TN91 2BVBA 3KVAA 3WG2A 3FX3A 1QWRA 2QVSB 3TWIA 5FMOS 1X9PA 1LEMA 3U75A 3TEXA 3U4SA 3THDA 1E5SA 1O59A 2RG4A 3N35A 4Q8KA 4YW4A 3W21A 2BWCA 3P6BA 4AQ6A 4CEWA 5K0UC 1JHNA 1WMDA 2P4EA 1AR93 3LQCA 4XYXA 1X9TA 1Z7S3 5CISA 5LCWL 5JOYA 2HBUA 2BJSA 1G8WA 1CAXB 1RUF2 2JG9A 2PHWA 1IS6A 1BLZA 2YFUA 1AYN1 3BALA 1LENA 5GJ6A 1GU3A 3VBSB 4CDXB 4Y1ZA 5D1IA 3EQEA 4A41A 3JBG2 3ZFEC 1ONAA 3K75B 5A3TA 5FO9B 4D3WA 4FQZA 1YFYA 1SFPA 5FO7B 4QHZA 2B8MA 3KT4A 3WZ1A 4HXCA 3ON7A 1L3JA 1NAEA 3THCA 2BDRA 2W08A 5T55A 1GR3A 4AOCA 3Q8BA 1HRV1 3C7FA 4C91A 2E7AA 2P3KA 4Q1RA 4CCCA 3U4XA 1PZ7A 3IBMA 4YGEA 2ZEWA 1RUC2 4GH4C 2VZTA 2BGPA 4AAPA 3RZMA 4ZKTB 1S0CA 3AZYA 3CZJA 1SDWA 4YG3A 3WINE 4GJYA 5D8AC 1TME1 4MUVA 3VBUA 4D6SA 1RJ7A 1MVQA 4XUQA 1V6JA 4W4ZA 4FAGA 2UYAA 1OPOA 4XF3A 3U14A 1BBT3 1LOGA 4ZU7A 1QJX3 4CEYC 5JXGA 2XHKA 5A3UA 3ECQA 4M3CB 1HJGA 1O3RA 3GXUA 5GKAC 3RQ0A 2E7QA 1XC6A 3GJBA 4RHV2 5T50A 1X33A 2HJIA 3H1YA 1WCSA 4WM8C 5ERLA 1FXZA 3N36A 3UETA 1MEC3 4LUMA 1FPN2 3C7HA 3LDKA 4LKSA 4NRPA 1R093 5C3PA 1PK6A 1H8TA 2BFUL 2Z4FA 4NUBA 1H1IA 2DU0A 2RS33 3Q8CA 5B2GB 5FUIA 2UYBA 4UF0A 1C57A 2WAOA 4LJHA 1OA2A 4QPIC 2WKKA 5C70A 3UV9A 2VOVA 3KCXA 1DIWA 3QCWA 4W6YA 2ZAHA 3NAPB 4GB33 4IGOA 1Q8OA 4SLIA 1XJAA 4LKEA 2DBNA 4UT5A 5CKNA 3LSDA 4E8DA 1NG0A 4LBKA 5J09A 2IC1A 3ZFGB 1JZ3A 1AL21 1LECA 1UCXA 1WW5A 4RS5C 4XACA 3GNEA 4WVMB 2QZ2A 4B8EA 4KQ7A 1LGNA 3E6BA 2WNEA 4D6QA 4Q1PA 1NLQA 1XSQA 2XJTA 4X6QB 5JAXA 5FCCA 2XH6A 3N9OA 3ZIWA 1IKPA 1WW6A 4JHTA 3FZ3A 1BHGA 1UIKA 3PJYA 4JGYA 3W58A 4DY5A 4B3NA 2VECA 2ZHLA 4HETA 1OD5A 4WV8A 1OVSA 2Z5WA 5B4XA 3LGRA 1U5XA 2I45A 3R4UA 4KG0A 4CE8A 1H4GA 4X6RB 5LY1A 1SFYA 2VZRA 4MADA 5EYXA 2QQUA 4IEZA 2X05A 2QTWB 4D7TA 1HB4A 2HWC2 1KS4A 2W3JA 4IE0A 4NVPA 4EN8B 1DDLA 4UFMA 3WF2A 2CGPA 2CTVA 2ARCA 2VZVA 3A23A 4CTEA 3VD9A 5ACA1 4ISQA 2JDZA 3RG0A 3D8CA 4XOGA 4LBLA 1XNKA 1KXGA 2JDYA 3KGZA 3PJQA 2RHPA 4GZ9A 2VH9A 3E6DA 3PTRB 3NRUA 2VXJA 2A6ZA 4Z07A 3PIJA 3I4IA 5FQ0A 1CZVA 4N43B 5L73A 3VBRC 2B4KA 3DYOA 3I2HA 3RJ2X 4BOWA 1OLMA 3PUAA 4GWJA 4PF1A 4C1XA 4FP2A 4UBHA 3FFQA 4D69A 3ES1A 1KRIA 4V2WA 3UGHA 4BQ5A 3ZN6B 4FOQA 1AR63 3C3VA 1R1ZA 3VBOA 1AR73 3WHTA 1JUIA 1IG3A 5BNOA 2Q8DA 4I02A 3VBHA 3CIHA 1V70A 3P5BA 5JPMB 4B29A 3MICA 5BNNB 4AZZA 4KU8A 3WP5A 3AFKA 4CDQB 2W68A 3JB8A 4DMIA 4XFGA 1FX5A 4ZHNA 4LLOA 3CMGA 3MW4A 1LKNA 4XXAA 1VBE3 3TOJA 5F3IA 4CP1A 3ZSJA 3N9MA 5IVEA 1RUOA 3FE5A 4XQWA 4K40A 4PBPA 2OS2A 5DDJ3 4A4AA 2DFCA 1HJFA 4FT8A 1SPPB 4YM0A 2MPFA 4CCNA 3JD72 4MO3M 1JTZX 4Q2FA 1J3RA 2R061 5T5LA 4YW7A 1OQEA 2XJUA 5E1RA 4KGQA 1W99A 1F4AA 1W2AX 4JC1A 4FAHA 2R0HA 1PVC1 3J7LA 1YFXA 4CP2A 2K0GA 2ZEYA 3C7EA 4CUCA 5CB7A 1WUVA 3O1VA 4HANA 1KS5A 1MS3A 2Q4SA 3OUIA 1SHWB 1GWLA 3KMHA 2GNTA 1V6NA 2D6PA 4GQ7A 4LBJA 1KDMA 2BUKA 4MXVA 4R4XA 3ZYFA 4P9GA 1DQ4A 2A70A 1OVPA 4FVVA 2QDRA 4ITCA 5K8SA 2RS53 5IK4A 2WWSA 3F2ZA 3VHPA 3H8OA 3LZZA 5FBZA 3AMNA 5BUVA 2EA7A 3PL0A 4A45A 1AR82 1JBCA 2V5YA 2PLV2 3PHMA 4BQ1A 4AHWA 3AP7A 1AX1A 1GQPA 4JDOA 4K1ZA 4AG4A 4B4PA 3AP4A 3P1IA 3IPVA 4FPFA 4AQ2A 1EPZA 3WNKA 5JZGA 5J98B 4CCLA 1RXGA 2BBAA 5DZFA 1VMJA 5A7NA 1R082 3S6PA 4Q4Y3 1DQ1A 1I5PA 3C8XA 4L0PA 5A7OA 4DUWA 3PUHA 2X5IB 2V4VA 2A3YA 3ZFFC 5L7OA 5FUNA 1IS5A 1DLLA 2PHDA 5GZGA 4COWA 4UYBA 2Z2SB 1RUF1 3LB9A 5KBFA 3HVDA 5C8CC 2VQUA 3HR9A 5CFCA 1V9U2 2GAUA 1WLTA 1QJY3 4CXWA 5JMCA 4YZ4A 5HCHA 1RUNA 3R6SA 2O0OA 3JBG1 3MFAA 2BNMA 2VOXA 3DCQA 5FMBA 4C90A 3KT7A 4FOWA 3E5XA 1A34A 1QQP3 4AW7A 5CFDB 4Q4W3 3FBMA 1VMFA 2HWB3 1PVXA 3HNMA 1VLNA 2YXSA 3ZMOA 2D43A 3C2UA 5FV3A 3ZXFA 4CCDA 3SEEA 2LS6A 1W28A 1N3QA 2WS92 4GALA 4LK7A 4XBNA 1XXNA 3I59A 1G9BA 3PMEA 3VZLA 2BBVA 2Y33A 1GUIA 4H3WA 1O8SA 4CU8A 1RUC1 2CHHA 2PTMA 2VO5A 3A4UA 2PN5A 1UPSA 3RNSA 4ZZ5A 1LU1A 4E4DX 1Y7BA 1S0EA 3SMHA 4PLMA 1EAH2 2XL9A 3RJRA 2VCAA 4Q4V3 4AHYA 5A1AA 2VVFA 5LWBA 4JAAA 3S30A 4JCKA 2HYKA 4QDSA 4AFBA 1HXS2 1UPIA 1JW6A 2OVUA 3WNXA 1YHFA 5C3SA 3VDDA 5IK5A 4KWLA 4RHV1 1SLLA 3AK0A 1C3HA 3MPPG 4UW3A 5IVVA 5LW9A 1RC6A 3ATGA 2VNRA 1FPN1 1SG3A 1ULPA 2CYFA 3WDYA 4FFFA 1NOVA 2K9ZA 4XURA 1UZZA 3HJRA 3IMMA 4S2GA 2GC0A 2ET7A 2ZKNA 1WW4A 2ZX3A 4AFMA 2V72A 1JZ2A 2XMLA 4N53B 5IK8A 4URAA 3MIDA 1UZWA 1F35A 5GALA 3RI8A 4P14A 4B1LA 1F2NA 2ZGOA 4AK3A 1ULDA 1UY4A 2XLGA 2ZA9A 2LW8A 3AB0A 1UX6A 4W50A 1FV2A 4M4PA 1LEDA 3RYKA 4META 4AEDB 3LD8A 4ISRA 3OG2A 1RUI3 4B4RA 1GLHA 4HKLA 2HEVF 4KWKA 1BYHA 1QDCA 2IVIB 4CP0A 3B9IA 1VBB2 1ZBA3 5FZ8A 3NNJA 1UZVA 4HL0A 5BNPC 2AEZA 2R1DA 2RV9A 4LHKA 3KF5A 4CCMA 1XE8A 1CJDA 1JHJA 1DP0A 1FMD2 1W8OA 1NA1A 2E26A 4QKNA 4AWDA 1QJU3 5C3RA 4FPGA 3UJOA 4QX3A 3FLPA 4YVSB 2A6WA 2RR12 2XKOA 1WZXA 4KWJA 3RGBA 1JZ5A 1ZRCA 3DEMA 5FPVA 1WWYA 4JGZC 5G04L 1IQDC 1FOD2 3QLQA 1V6LA 1SLIA 3OYWB 2VOTA 5FZ1A 1NCQB 3POYA 1SQ4A 3MIFA 3N7MA 4IEOA 2FBEA 5FZKA 1GYKA 2HWC1 1CIYA 3LFIA 5FYHA 1BEV2 1GICA 1YJLA 2VQAA 2XUEA 4QX1A 4XETA 3VL8A 5JPNB 2BPA2 4X8PA 2W1QA 1LCLA 1U5YA 4CDUB 2WNVA 2ES3A 3LWCA 3POSA 5DUUA 3HQUA 2RMU2 4RQPA 4WVZA 4URTA 3S5AA 1OOPB 2Y6HA 4OI1A 2DDUA 1JZ6A 2GC1A 1HRI2 4LO7A 1SBDA 4QGNA 4Y20A 2B42B 3ROUA 3ZFGA 4DB5A 1D2QA 3CU7A 3AP9A 4XE9A 4LO5B 4Z82A 4GMP1 3ACFA 3BODA 4RFRB 1D7PM 1GKBA 4JRLA 5FZMA 1W6PB 4DZGA 4E4SA 2IXIA 1PMIA 2VD7A 2FCTA 5AFBA 5IATA 1DFQA 2P3IA 1LODA 2HKXA 4J1WA 2A71A 3ACHA 3VD4A 1QU0A 3H8RA 3BTYA 3MIHA 4LEJA 3MUZ1 1W0PA 4IL7A 3RMXA 1POQA 2IUWA 4WVVA 4N7IA 4S2FA 4CEWB 4LO4B 4CPBA 1DCSA 5TSWA 5KHGA 2RS12 1MZ5A 2JG8C 2Q8OA 3ZSMA 2RDRA 3LOIA 2L9LA 2J1VA 2JG9B 1XSRA 1FV3A 1WMXA 2WZ8A 4BIOA 4EN0A 5IVJA 2PQQA 4R8HA 4P02B 1ND2A 1X50A 3I3QA 3PU8A 4UW5A 5DUVA 1W8FA 3VZNA 4ASKA 3JD71 2JDAA 4MLOA 5E16A 2ZMLA 4MZUA 4L97A 4AVCA 2GH8A 2JX9A 5JI7A 1O4TA 4LIVA 4QPWA 2WL1A 1FNYA 5BV6A 3ZYRA 3SHRA 5FY8A 2W0XA 4Q5OA 3RS6A 1NZIA 2NM1A 3EJKA 3ZXEA 5KXBA 1NYWA 4I0WB 1VR3A 2VOKA 3RFRA 3WP6A 2WUHA 4JKLA 2O8QA 1Q43A 4Y5SA 2VGDA 2XDVA 5CIRA 4Z2AA 1IS4A 1HN0A 1PNFA 3VUOA 3VBUB 1V0AA 4PQQA 4JTOA 2J1SA 4LPLA 2W9XA
chains in the Genus database with same CATH topology
1AR81 2PLV1 2ZGKA 3UKTA 4AVVA 4QGLA 1CD3G 4Z8BA 4PDWA 4H55A 4YM2A 1QKQA 4Q4X2 4AHXA 1PM7A 1R081 2VVDA 2D6KA 3UK9A 1PO12 1GQGA 1PK6B 1H8TB 1SACA 1EPWA 4S2HA 5EZWA 4DQAA 3V0AA 1ZA4A 1K5MA 3OBRA 3KQRA 5EV7A 3RMYA 2HEYF 2AH2A 2H6BA 1F31A 1V9U1 3PNAA 4QPGA 3AJZA 5GZDA 3R05A 1APNA 2IWGB 1A8DA 2O8OA 5FAXA 4FXKB 2BNNA 2DUOA 5LK5A 3TN93 2LM3A 5KHHA 4Q0UA 4H7LA 2JE9A 3WR0A 2WS91 3J8F2 2DCJA 1TMF2 1G9CA 4IERA 1AXYA 2JD4A 4JGYB 2WZPP 4BIFA 4WM7C 4ES8A 3M1HA 5BXXA 1AYN3 4XBQA 5KC6A 1JYIA 4K1YA 1A6CA 1YYNA 1EAH1 3SCHA 4KG8A 1RMU3 2RM22 5I0UA 3D4KA 2ZABA 1HXS1 4FPHA 4Q0SA 2ZX1A 4M0HA 1VB4A 4BLJA 2A75A 1ASJ2 4HVOA 2B46X 3J4UH 2R072 1HRV3 3FFZA 4RR3A 1REDA 3M8LA 3B7MA 1WMFA 1S2KA 2NMNA 4ATFA 3WLUA 1X82A 1MS9A 3AYEA 1URXA 4NOTA 1FYUA 3KD4A 4Y22A 5GZCA 1B35C 5FQ0B 3OCPA 1BKZA 3WW4A 1GBGA 4TLFA 3B69A 4LTAA 4N7UA 1PZ9A 3OBTA 4BHPA 1VBD2 3VBOB 5BNOB 3H7JA 5SV8A 1NY72 1HDKA 3KSCA 3QD6A 4OUMA 3VBHB 5AVAA 1ULCA 4HMZA 2XJQA 1KJRA 1VBB1 4AEJA 1G9DA 3V0BA 1CQ9A 1SEFA 2PAEA 4H14A 1G6NA 1FMD1 3WQ0A 4HPKA 1VB2A 2ETEA 4Y4YA 2RR11 3TBDA 1MS5A 1D4M2 2MEV3 4FCAA 4Y26A 4B7EA 2XWJB 3TYJA 1ZRDA 1VRH2 4K20A 3NSTA 2R6QA 1ZRFA 3M70A 4C0BA 1RUJ2 2EALA 2D97A 1FOD1 3MLKA 2LTNA 1SLCA 2PHTA 2XLAA 4Q0QA 1NE6A 4Y1YA 1BEV1 1UW8A 3L9JT 5CU1A 4DPNA 1DHKB 4XBLA 5K9YA 1PGSA 4HVRA 2ZGQA 3HD8B 2ENRA 3H1MA 2FHRA 2D98A 4FPKA 1GSLA 4OHVA 2RMU1 4K8FA 4QGMA 1HRI1 2E51A 2ZBJA 4L11A 4XTMA 2A73B 5AC93 1ZM1A 1HQLA 1YUDA 2QDNA 4BH9A 4YM3A 4JTNA 1LHWA 2HWD3 2QNKA 2XLFA 5KWRA 3WW3A 1YI9A 3T1LA 2CWMA 3M2MA 5GZEA 3IPVB 1Q56A 4MVTA 1C1FA 1WLCA 2TBVA 4AFAA 5JZGB 3AZXA 5ACA3 1Q8QA 3WXPA 1NCRB 1Z78A 3AYCA 1DYPA 3D82A 1UZYA 1FT9A 3KCYA 4OHWA 1MS4A 3PVBB 5L7OB 1PGL2 2RS11 4COUA 4BM8A 1YLLA 1O91A 2F4PA 2TNFA 4FPLA 5CFCB 5ABJC 2Q0AA 3CJIC 4AGVA 5LK7B 1OLQA 1JXNA 3MYXA 2WT1A 2Q1ZB 2FMDA 3USUA 2GC2A 2XJPA 4DY3A 2B45X 2ZJCA 4AYUA 1Z7S2 5HI0A 2Y26A 2AZ5A 3INAA 1RUH3 2GDFA 1NE4A 1PO22 1SCSA 4ZU5A 3I59B 4HK9A 3HMYA 4XEZA 1G9FA 1S1AA 3MIGA 1AUYA 1DGRA 1C8M3 2R1BA 4WZFA 3M7AA 4AGGA 2RE9A 2R49A 4AF9A 1DQ6A 2HWE3 5J7MA 3ZSLA 4XF0A 1V6IA 2BNOA 4NWVA 3O5SA 4CDWC 3U07A 4OVEA 2YYOA 4BE3A 1PVC3 3VDDB 4Q4X1 4M3CE 2WLQA 1VBC2 1RGSA 5C9AA 5EXOA 1PO11 1I1EA 4OLLA 5I8YA 3U0ZA 3QACA 4YGDA 4FO9A 2KXLA 4YFZA 3O7OA 3GZAA 3AJYA 1QJX2 2CNAA 3IM0A 4XF9A 2EIGA 4A7YA 4R9AA 2Z79A 2YMZA 3RYPA 2A6VA 2WSUA 2VMGA 4AE2A 1YO8A 1MQTB 4KH9A 2ZS6B 2DYCA 3RWNA 2BVVA 1UKRA 2DURA 5JIUA 2XKPA 1OQDA 1HX6A 2RS32 3SCGA 3M3QA 3N7LA 1NA1B 1QGLA 3J8F1 1O4YA 2TUNA 1TMF1 1SLAA 4QQLA 5KC5A 4GMP0 1NXMA 2X8KA 4GB32 4P9WA 1IZ3A 4YNIA 1RUF3 4HKWA 3S7IA 3LA3A 4A7ZA 3H9AA 1OHFA 5HCBA 2JKBA 2EAKA 3JBG3 3LAGA 2FZ1A 5IT6A 3AMMA 1XYNA 1ZZBA 2VW2A 2RM21 4IV1C 1C4RA 3VKNA 3ZSEA 1H9PA 3ME2A 2E6VA 1W6MA 4HKOA 4M3CF 5DG2A 2GNBA 1VAKA 2WNVB 4YVWA 1ASJ1 2R071 2C1FA 4RQPB 1F5JA 5EYYA 1H30A 2WNUC 4FPEA 2PA7A 4RA0A 3OJBA 4Y20B 3BPZA 2HEWF 2IXKA 3M3CA 4MV2A 5DZEA 4Q8LA 5FLHA 3RYRA 1DU3D 3USSA 4XZPA 4W6XA 1VBD1 4MGZE 4XW3A 4O9GA 4FTBA 4F7ZA 1NY71 1WA4A 3P3NA 1RHI3 1GZWA 3O14A 3NWKA 3J9SA 4C0HA 2R16A 4OI2A 3FHIB 5C4WC 1XE7A 2P37A 2ZHMA 3E97A 2GC3A 5DZGA 1G7YA 5IUQA 4FPOB 4NHLA 4PIXA 4FPYA 5T5PA 3WG1A 3ZYIB 1D4M1 2XUMA 2XJSA 2FMYA 1MS0A 1AR72 1IGOA 1X8EA 4BA6A 5CG8A 3AZZA 4XFCA 4SBVA 3AFGA 3NVCA 4FSJA 4IV3A 1VRH1 5E8AA 1EYBA 1ND2B 1RUJ1 2E9QA 4YM1A 2E63A 4BZ4A 4HVQA 1TNFA 2ZHNA 1GZ9A 4I30A 1TNRA 1UIJA 5A32A 1YIFA 1HV1A 3ZXDA 1C28A 1QH6A 1ND3A 3K51A 2PHFA 5SV5A 4XDQA 4LLFA 3VBSC 4CDXC 4AQSA 3WQ1A 5DDJ2 3WDVA 5KHJA 2WT0A 2QCSB 1U5IA 1POV0 1AX0A 2ZACA 2QUOA 2WQ4A 1YRZA 5C8WA 4YZ1A 3B01A 2IXHA 3WHUA 3V65A 1X36A 5K0UA 2WT2A 1UAIA 1G9AA 1LULA 1WW7A 1AVBA 3DL3A 2HWC3 1MR5A 3AXDA 2BWAA 1IS3A 3I2DA 5CADA 2DUPA 2XG3A 4PDWB 4D7YA 3VLBB 3W59A 3PVOA 2DVDA 1ZBE2 1LOEA 3ZXAC 3DUIA 3WT3A 3ZFEA 4MGKE 4IEYA 1PGL1 4DS0A 1OKQA 3V0AB 2WFPA 4HT1T 3QBQA 1K5MB 1ZZ8A 1GNZA 1S0JA 2CWSA 4GMP3 4L99A 1LTEA 4QPGB 3IN9A 4DRVA 3WY6A 4Q4Y2 3H8UA 4AFDA 3ZO0B 4GH4A 3SITA 4GKXA 3SH4A 1LHUA 1Z7S1 1AYM2 1WGPA 3D0SA 5I0RA 2WLPA 3M3IA 1PO21 5D8AA 2DFBA 1S0IA 2DCTA 1ZZ9A 3URFA 3NAPC 5K7PA 1PIV2 4CEYA 1DF0A 2NLRA 4Q0PA 3APBA 4XFAA 3ZFGC 4LO8A 4QX5A 1NCRA 1QHDA 4WM8A 3UL2A 1RVF3 3W9AA 1GANA 2VUJA 3AZWA 5H9QA 4K21A 5L19A 4M00A 1V00A 1RJ8A 3VKFC 4LNVA 4PJYA 2CGNA 1YI7A 3KGLA 3AP6A 1I5ZA 1VBC1 4RR3B 4NN0A 4QPIA 3NO8A 1UU5A 2RJKA 1H0BA 1Q3EA 3JB4C 2CL2A 1BCXA 3CLPA 3E5UA 1SCRA 1IOAA 4Y22B 5CVRA 4Q4V2 1QNWA 3VHRA 1QJX1 3SLIA 4RS5A 1AX2A 5LEKA 1BK1A 1ALYA 3HT2A 3MF9A 3DN7A 5FOJB 2BQPA 2P34A 3FBYA 2ZOEB 3KM5A 3UJQA 4PF5A 1AR83 2DWRA 1H1MA 2EAAA 2PLV3 4I3PA 2QQPA 2AREA 3HWJA 3V0BB 4INDA 4LBOA 2I07B 4N43C 2RS31 1R083 1S0FA 3LCPA 1F5FA 1CAUA 4HPKB 1BXHA 1UL9A 1U12A 2B9UA 2WC2A 4GB31 5BYNA 1RUE2 1RUI2 1KFUL 2Y38A 4Y1UA 1LOFC 2PAMA 4K7JA 4YLZA 5BNNC 1POV3 2UY9A 5KXDA 4CDQC 3ZVXA 1KD7A 1EP0A 4FOYA 4OHXA 2EF6A 3BIWE 5E89A 5T3NA 2GSYA 4TWTA 2X53S 2DTWA 3EBRA 3IT8A 5KHIA 3VBRA 4LE3A 2DU1A 2XWBB 3ZX7A 3FLTA 1LU2A 4D94A 1MQTA 5J36A 4YRDA 5A3LA 3PVNA 5I91A 4A2UA 1NXD1 4LT5A 5FLJA 2YZ4A 2OZJA 2G9FA 4YYOA 4AI0A 5JOXA 1KDKA 3LOBA 2OA2A 4E2SA 4FBFA 5H9RA 1EAH3 4ATEA 4EWEA 4RL7A 1W6NA 3HAGA 4AI1A 3AXEA 1RB8G 1HXS3 3BU7A 5GLUA 4XHXA 1GV9A 3BTAA 4GA9A 3NL1A 3O0VA 5FLIA 4XIKA 1EV12 3FC0A 5JDBA 1SLTA 1ZYBA 2CAVA 3HT1A 5DXDA 1IQAA 3WW2A 1AR71 3ETQA 2WSVA 4N90A 2V09A 2ZKLA 3A0KA 5BPXA 5E88A 5JCTA 1RUD2 1R1A2 3USUB 2X5IC 5T5JA 4LBQB 1FAYA 1VBB3 2DVFA 2P17A 3DKWA 1VBE1 3H3ZA 2VNGA 4P9JA 4XQ4A 2QKDA 1FMD3 4N9IA 2BEOA 2V73A 5DDJ1 1N1SA 1VBA2 2RR13 1N47A 3MLLA 4JRAA 5I0TA 4NR1A 5CFDC 2VPVA 5HCFA 4QMAA 4HN0A 1XU2A 4XF1A 3ALQA 3TRSB 4D7SA 1AXKA 3ZFFA 1AXZA 1HIXA 4Z1VA 1BEV3 2XVKA 5C8CA 5I8TA 4F8AA 2D3PA 1PGW2 1ZBE1 1REFA 5C9AB 4JDMA 5FREA 4LR4A 4AI8A 5EJ3A 1OA4A 4YZ5A 1HRI3 1RUG3 2W39A 3QOPA 1UMZA 5F1RA 1ENSA 4AEKA 4FTEA 3WQ7A 1ZX5A 1SBEA 2EXHA 4MXWA 3MGUA 3CEWA 2D6MA 4Q4Y1 1H1AA 2XJRA 5DUWA 5JSOA 4PCRA 1AYM1 1COV2 2HWF2 1GZCA 4N53C 1S0GA 4FTSA 4B4QA 1X7NA 4L8QA 4E9KA 5KXEA 1QF3A 4TSVA 1PIV1 4CZSA 4AEDC 3B9CA 5DUXA 1DZRA 2OIIA 3B94A 1KITA 1WLWA 2R32A 1V6OA 4XHBA 4LA2A 2ATFA 3ACLA 1XNBA 1LGCA 4YGCA 4AQTA 1T6GC 4I2OA 3N4MA 4YVSC 2R043 1W6MB 2XBO3 2P3JA 2QFEA 5FRAA 2PYTA 4YVWB 2ARXA 4AVBA 2XVLA 4IEPA 4FXGB 1SLBA 4K6BA 1NCQC 1QXPA 3ZPYA 1SMVA 4Q4V1 1RMU2 5F9TA 5BNPA 4CDUC 4ES9A 1WBFA 4HSJA 4E27A 2A6XA 3VGIA 1XYOA 2Y0IA 2OW4A 3IWZA 3MW3A 2ZAAA 4YSFA 1OOPC 4AGRA 4PQ9A 3ZYJB 5AVPA 1GZWB 2WFF2 2H0BA 2D3RA 4Q4X3 3FUOA 4JGZA 2AYHA 1KFXL 5GZFA 2VUAA 3WVJA 1GFF2 3CJXA 4BCUA 3AM2A 1RUE1 4AVAA 3ZXKA 1RUI1 5BY5A 3ILRA 1YFWA 3VBFA 3OY8A 4IV3B 2D40A 1WBLA 4JDNA 2VVEA 1PNGA 4XFHA 1TQ5A 3UKVA 4CEWC 3IKWA 3ST7A 4EN7B 5A32B 2YGMA 1RITA 5KHKA 1ND3B 2JG9C 5JVVA 4E4ZA 2GNMA 2MEV2 1TME3 2NZ9A 4AEMA 2WZR2 4YFWA 4OI4A 1UU6A 4L92A 2PHUA 3SNMA 3J8F3 3WG4A 2AUYA 1CPMA 3MI8A 1TMF3 4U36A 3VHNA 5HBAA 3SH5A 2Z42A 3E6CC 4KBBA 3R0RA 4P9XA 2H6CA 3G7DA 5GM0A 3VZKA 1HV0A 1OLRA 1DGWX 4IEWA 5K0UB 1WLDA 1Q5OA 4BYYA 5CAZA 2RM23 2JG8A 1O3TA 1XQNA 1YJKA 4LBQD 4OHZA 4QQOA 5J96B 1AL0G 1DG6A 2UY8A 1OFSA 2EXIA 3DPRA 1J58A 4PLNA 5C33A 1XNCA 4A7KA 2R073 5AC92 1DBNA 3VBUC 3PMSA 3ZFEB 1EV11 2ZMNA 2YC0A 5JWPA 4QM9A 1AL23 2HWD2 3CO2A 4HSLA 3ZN5A 4ORFA 4XF4A 4Q0VA 2YROA 3MLJA 1MS8A 3KT1A 2A6YA 3B3QE 4YZ3A 1SFNA 1RUD1 1R1A1 1VBD3 4NPRA 5JSPA 4YW1A 1JN2P 1PK6C 1H8TC 2F6BA 4GH4B 4IXLA 2OPKA 4KL1A 2C5DA 1CAWA 2IZWA 4XJ8A 5D8AB 1ZRRA 5FPXA 2MNGA 3J26N 3MIEA 4K3UA 3V64A 5I93A 1YFUA 3PVEA 1VBA1 3ELNA 3KB5A 3RPQA 4B7KA 4CEYB 3NJZA 2Q1MA 4MH0E 3FMGA 2IXCA 1VRH3 4WM8B 1RUJ3 4YGBA 1N1YA 3GBGA 3WOGA 3SH3A 3WDWA 4Z2WA 1RUH2 4EJRA 5J3UA 4HZFA 4EN6B 2GMEA 3V56A 1LB2A 2GMPA 3DV8A 4JGYC 3E5QA 3I7DA 4W6WA 1W39A 1LOBA 1PGW1 1C8M2 4QPIB 4HBNA 2ZGTA 3K48A 4QQHA 3ES4A 4XFBA 2BW8A 4LBQA 2HWE2 4V1PA 4IEXA 1AR92