5KYKA

Covalent gtp-competitive inhibitors of kras g12c: guanosine bisphosphonate analogs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
168
structure length
159
Chain Sequence
b'GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDDSYRKQVVIDGETCLLDILDTAGQERDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Covalent Guanosine Mimetic Inhibitors of G12C KRAS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5kykA00
1MKYA 4PAMA 1QHIA 1IJEA 2DFTA 2JJ2D 1XD2B 4CDGA 5AUQA 4GL2A 4B2IA 1GM5A 3AF1A 3C15C 5EJEA 1W7AA 3NXSA 1X8KA 2ZR7A 3QXSA 1YR9A 1TNDA 2R6CA 3A36A 4GFDA 4A8JC 1U9IC 4QHYA 1MO3A 3VKHA 3R20A 1UM8A 1NMZA 1XZPA 3VAAA 4LC1A 1QZXA 2RGEA 4NYJR 3VHLB 4TYQA 1OIWA 4URYR 2ZREA 1N6NA 3IO3A 5AUOB 1HUQA 4QNMA 2WWYA 5BN3A 2QQEA 2V6JA 5LD2C 2N46A 1G16A 1E0AA 2YZ2A 4JL6A 4XD7D 3V4FA 1N5JA 4MYHA 4EQ6B 5JI3E 2V6IA 2GJAA 4PC1A 4MUBA 4UNNA 1MO5A 1OH7A 2ATXA 1KO8A 4U00A 1NP6A 2ZRLA 5H68A 3H84A 5CJ2A 4WXRA 4Q1DA 4UNQA 4WAUA 2YWEA 4F4CA 4L9WA 2XNSA 3U60B 2EFCB 3CX6A 1JEEA 4WBSA 4HAXA 4IKEA 4MKFA 3T5DA 3OFNA 5JHGB 4GDFA 1SZPA 3LLUA 1BMFD 3RC8A 2GVZC 2Y8EA 3CW2A 2W2XA 2C95A 4Q1BA 4B75A 1QHNA 2CHGA 4WZ6A 4YMSA 1EXMA 1E2PA 5DIFA 3RLFA 1AKEA 1TU3A 1JR3D 2IA5A 1QVAA 2B92A 4AC9A 2GF0A 4LHXA 1KI7A 2G3YA 4DUGD 4RD4A 2NZ8A 1S9DA 2ZRAA 1PV4A 2PZGA 4BWYA 5JMTA 2PCJA 3IIMA 4M4SA 3R7WA 1YJ5A 3ADCA 2NO9A 2IYYA 2VP6A 1Z3IX 1RIFA 4URZR 2CCJA 2W6JA 3VTKA 3GP8A 5J4KA 1VYTA 3K9HA 1WP9A 1PUJA 3AVPA 3E5HA 3VNUA 4XSHA 1YRAA 5FL7A 2D7CA 1YZQA 2QTFA 5HZHA 4JT4A 3PEYA 2Q3HA 3FFBA 1T6NA 5TVKA 4AURA 1S2MA 3CRW1 3OE7A 4KBGA 2O0KA 2JLYA 3LY5A 1A7JA 2GBLA 1T8TA 1S0UA 4M9SA 3LBNA 3SZRA 1E2QA 1ZBDA 4LHWA 1E79D 3B13B 3VNVA 1DG1G 2J0UA 1RYFA 2RKOA 3D6TB 1E0KA 3S1AA 4DSOA 1KO5A 2KJQA 1OH6A 1FMLA 3MWLA 5HKKD 2FPMA 4AIIA 5FPSA 1II8A 2OBLA 4KITB 2H16A 2WPDD 1L7VC 3QPUA 1KO7A 3SE0A 3EPJA 1U81A 2PL3A 1E2JA 3NH9A 3HDTA 3AF3A 2XITA 3HPRA 1E1QD 4BZPA 1YR8A 2R6DA 1N6PA 2ZS7A 2QI9C 4RD6A 5SZKB 4Q48A 2Q9BA 1RJ9A 2Q0HA 2SHKA 5KDLA 4EJSC 3GLIA 5AUPB 3KUDA 2AWNA 4M1MA 4B32A 4KFRA 4X8OA 4L16A 3GJ8A 3ZVNA 3D7MA 1M6NA 2NO0A 2XJ4A 3A58B 1G5RA 4OJKA 1JALA 1QDEA 3R7WB 3UXMA 1IY1A 3OZXA 1DELA 1TPZA 5H8WA 3NBYC 1KO4A 3CBQA 2OM2A 5AJWA 4PANA 1HA3A 1RE0A 3U4QA 1E2HA 2VF7A 5EXSA 5JWOA 2QN6A 3TMKA 2GNOA 3B1ZA 2W6ID 1GP2A 2QAGC 4HDOB 3LW7A 3AKCA 121PA 3CR7A 3BIFA 4I99A 1QHYA 3O47A 1YHNA 4NONA 1PLLA 2BBOA 2TMKA 4BRWA 4II7A 3ZD7A 2ERYA 4OQMA 4D0GA 5F98A 3OF5A 3W34A 5EP1A 4OQXA 4NCJA 3B6EA 3OIUA 4BZXA 2OCAA 4B74A 1AM4D 1KMHA 4AWXA 2AXNA 2BBSA 3S1AB 4M1OA 2QT0A 5J4VA 3TUJC 3LO5A 1IXRC 1II8B 2Q3MA 1AKYA 3ZS8A 4DT1A 4Z1MD 3LW8A 4FMBB 5FPYA 4XWAA 1SVSA 3FFAA 3ASZA 3GLFB 3ZVLA 2GEUA 4UNSA 3DDCA 3EWSA 4MRNA 4DSNA 1RJ9B 3WXMA 1Y3AA 2J46A 1OXSC 5DSZA 5J40A 3L43A 4DEXA 1KI6A 3CF6R 2WM9B 1WA5A 4IXMA 2QE7D 1MRNA 5H70A 1G4UR 421PA 3PUZA 3CF2A 1WBBA 1DAEA 1R10A 4JVSB 3ADDA 1JECA 1QRAA 4NBSA 1XPUA 2R6FA 3SC3A 1FQKA 4GNKA 1RFLA 3AVOA 3AF2A 5A5GA 2G6BA 4P4TA 2QMOA 2FH5B 4NPHA 2VP5A 1KMQA 1GFIA 3U4QB 2BDTA 1XEXB 3KJHA 4TQUS 2GDJA 3F3YA 2OBNA 4IDNA 1S8FA 4IXNA 3GEIA 2MSDB 2OLKA 1E9SA 3QPWA 4RJLA 4TLCA 5EZ6B 3U3MA 2O8DA 2BMEA 2D2FA 5EZ5A 1UJ2A 4DIEA 4TN1A 821PA 4LBZA 4B3CA 1I2MA 4NCHA 2ZS8A 1QHGA 2B7CA 1XTQA 2OAP1 3ZZ0A 1CTQA 3REFA 2ZSFA 2C9YA 4LBVA 3UMFA 1JJVA 3M0EA 4FCTA 4IEEA 4US0R 1O87A 3U3KA 3KXKA 1G20E 4W5JA 1TQ6A 4TL7A 4O2RA 4IFBA 4M9XA 1QHHA 2JASA 5HE8A 4H1UA 1HE1C 1T3SA 3AVUA 1FUKA 3VKWA 3L0PA 2HYDA 4PAOA 2ANBA 2C78A 1TU4A 2FU5C 3K0FA 3K1JA 4BPBA 4Q66C 1MRSA 3L8ZA 1DG3A 1UDWA 3O8BA 2J45A 2CVFA 2NO7A 3T61A 1J2JA 1S3GA 1U8ZA 2HF8A 3PEUA 5D3MB 4NU0A 2HLDD 4JLVA 4RD0A 4ZI2A 3M4YA 3P4XA 3PCRB 3QBTA 1Z6GA 2F9LA 2ZAMA 4ACBA 2XSZD 5CIQA 4E22A 2JCSA 1IN4A 1KI6B 1Q44A 2C9OA 4Q01A 2EWWA 1XD8A 4ZDIA 3HYTA 4M8NE 1ZUHA 4QJ3A 1G41A 4HUTA 3QY0A 2CL7X 4W9MC 1JI0A 221PA 2GKSA 1R4AA 1G3IA 4ASUD 5CLQA 2ZROA 4P0TA 5EXTA 4ACAA 1BH2A 1M8PA 5IDVA 2C96A 3KJGA 2VH5R 3PQCA 3KXIA 2PCLA 5CK5A 5KU1A 3SJBA 3W3ZB 2YYZA 4KFUA 2EFGA 1HE8B 5JRZA 1K8RA 2GJKA 2YC4C 4MA4A 2ZI4A 1N0VC 3KB1A 3WYAA 3SR0A 3I32A 2RGNC 2IC5A 3EA0A 3UIEA 2CNWD 4F92B 1PZNA 5GJWC 3PUWA 3THWA 4UQOA 3K0AA 4PXAA 5IRCD 3I3SR 1J8YF 3BWDD 4LHVA 3CB4A 3BB3A 2WJIA 4JL8A 1G3RA 5CK4A 5DH9A 3LWNA 3GJ3A 2IUUA 4OHVA 3SHFA 4QBGB 5FTJA 3WYGA 2HXYA 5JBQA 3C4JA 2WAYA 3BD9A 1D5CA 1GL6A 1XWIA 1GRNA 4HB2A 3W6NA 1P6XA 4D2IA 1Z83A 1QHHB 4MUAA 4Q4JA 2O8CA 3BS4A 1KI9A 3FHTA 2WWFA 2FA9A 5DI3A 1SVKA 2QA5A 2V7QA 4O3MA 2O8FA 2V54A 1M34E 3HJNA 3ADBA 3LXRA 1ANKA 4UJ5A 3U44A 2WSSD 1W4CA 3TGPA 5DN6A 2MMGA 3OAAA 1XTSA 1GZSA 3NHAA 3TAHA 1EFRA 3TSWA 4PC3A 2QP4A 2FN4A 1KSFX 1UBEA 1W49A 1ZM2A 2BKUA 1N6IA 1OXVA 3MCAA 3TUZC 1ZM9A 4N1AA 4V03A 3CR8A 3L2OB 4A2QA 1CEEA 2VL7A 1XCPA 3Q5DA 4A8JA 2RMKA 1NJGA 1U9IA 2JLUA 2BJVA 2P65A 2Q9CA 1I2DA 4BRUA 2EQBA 1EFCA 1GOTA 1H8EA 4XTCS 2OE2A 2E87A 4HYYA 2A78A 2EFHB 2IBMA 4QGGA 3EZ9A 4WOPA 1LVGA 4BFSA 5L3QA 4S2EA 3T34A 1OKKD 4GOJA 2D3WA 3SS8A 4BLOA 621PA 3FDIA 2AK2A 3THWB 4ABYA 3K0AB 4GP6A 4TMKA 2C99A 1ELOA 3LH5A 5IK2A 2CXXA 4XIGS 2XTMA 2VYFA 5EE0A 2CK3A 2KBFA 1SXJD 2CEAA 3EZ6A 1Z08A 3U3JA 1ZYUA 4NCIA 2PT5A 3U61B 3GJ7A 1OIVA 2I4IA 2AL7A 4XH9B 1TQDA 1XXHA 4Q4JB 2O8CB 2NO6A 5BN4A 2ZRFA 2A5DA 2ORIA 2ZYUX 5JS7A 2FE4A 3JVUA 5DI3B 2D2EA 1ZUIA 2W83A 2YNMA 5GVSA 2WTUA 5JRJA 2MMCA 4DLRA 2P5TB 3NIBA 4DKXA 5FR2A 2ZI9A 3EC1A 1DAFA 1TADA 5DLQC 1VG8A 3B1YA 4KFTA 3ZYCA 5KOYA 1JAHA 4DCVA 4PHFA 1SHKA 3FB4A 2R6AA 3A8TA 1PJRA 5AJYA 1KHTA 3NBXX 4R7ZA 2EU8A 5KSOA 3THXA 5EE3A 4BLSA 1WF3A 2FGJA 3T35A 4Q21A 4A8JB 5G3YA 3TJZA 1AS2A 1AJEA 1KI1A 4BFXA 1FTSA 1ZD8A 2WZQA 1Q57A 3KFXA 3OEHA 4KAXA 4A92A 4DHEA 1XXHE 4PQFA 1E9AA 3I8SA 1E2NA 1LS6A 3T5GA 5LD2B 3U7GA 2W00A 3PITA 3IEVA 2J0VA 2IW3A 1G7RA 4US1R 1ESNA 4BFUA 5L3QB 4B3GA 2F3RA 1M7GA 2CE2X 3DVLA 3QNUA 4PSKA 1GWNA 4EFLA 2CLCX 1UAAA 3X1WA 2A3RA 5JZVA 1TL7C 3L8YA 1FL9A 3MLEA 3W5JA 1VHLA 1X1SA 4I1OA 5C2JB 3AVTA 2ZEJA 1RRPA 1E9DA 2GK6A 2QT1A 4MGZR 3W6OA 4IVRA 1HURA 1XMVA 1CBUA 2JLZA 1Z5ZA 3CF0A 4A0GA 1YR6A 3ZJYA 1AZTA 2GZDA 4A82A 1NF3A 1XXHB 1CR4A 4BECA 4WVFA 4JLMA 2X2FA 2GTPA 2OXRA 2W0SA 2JLWA 3FKSD 3EZFA 1BYIA 3BFXA 5FUYA 3EARA 5KSZA 3DO6A 1E1RD 2ZRGA 4JVNA 2A5YB 3RANA 1WMSA 4GMXA 1E9EA 3THOA 1G3QA 3R8FA 4EJSA 1OHHA 4AKHA 1XEFA 3SJZA 3Q9LA 4IW3B 3PV0A 4LJ6A 2C8VA 1KO1A 1NLFA 2WHXA 3HPQA 3A1VA 3ZIAD 3OHMA 1JPNA 4D4MA 2VSOA 4DCNA 4YONB 4TYPA 5JCPA 3X2SA 4YXWA 2LCFA 4IVPA 1OFHA 1ZM4A 3MD0A 2HXSA 4I1VA 1KJWA 1SVIA 4NYMR 3QSYA 3VR3A 3SJAA 1S9HA 1W0KD 1YZUA 3BB1A 1NJFA 4LBWA 2CBZA 4D4LA 2ZI6A 4HAYA 2FZ4A 2QAGA 3JVVA 5CIWA 1KDTA 1DAHA 3UG7A 3QVUA 4V0LA 2XXAA 1F6BA 1G8YA 3F8TA 3AKDA 1G9XA 5FTNA 3GJ4A 1XFAA 1E2FA 2GZHA 3R8CA 1EX6A 2VO1A 2PBRA 2JJ2A 5DHFA 2H17A 1SGWA 2ODWA 4LYAA 2CDNA 1NVVR 4H1VA 1E3MA 3I73A 4CEIA 1M2OB 1ZD1A 1FW6A 2EW1A 1Z0KA 2A30A 4Q7KA 3K09C 2ZQ5A 4POAA 3WRYC 5CB8A 1N5LA 1SKQA 1Z0IA 1IAQA 3JZAA 1NG1A 4WXPA 4NMMA 2YJTD 5IT5A 2ATVA 5JJLA 5B2ZA 5F9HA 3HYRA 4IOKA 1KKLA 4B44A 4RD2A 1AS0A 1P2UA 3WBKA 1U0HC 1S4QA 1W4AA 4MH0R 1G5TA 4XD7A 2ONKA 3IPYA 4X8HA 1XPOA 2IF0A 1Q0UA 1HTWA 1TUIA 1DADA 3PR1A 2V1XA 1E69A 2ZJOA 3Q5EA 5CITA 3B78A 2W0MA 4QGAA 4DLZA 1SXJC 2KI5A 2ZUBA 4U7DA 2WJGA 5BW8A 4NDZA 3NEYA 2F1IA 3NH6A 3CZPA 3CONA 3OIWA 3I1FA 1VCNA 5AJXA 3GCGA 4KJZA 1A5TA 4QBHA 5E7MA 4E07A 4YMVA 2OCYC 3RS7A 4R2IA 4IDOA 1M1YE 1X3SA 3PFIA 3LLMA 3TVTA 3P27A 2QAGB 1OB2A 3F0TA 1FX0B 2XXAB 3VX4A 1G4AE 1B0UA 1BMFA 1GDDA 3ZLJA 2XX3A 4G1UC 2JLVA 4Q4HB 3MGCA 4TYWA 3QG1A 3K9LA 4TTRA 4MGKR 1Z0FA 3OESA 4MRSA 5AR1A 2XZOA 3NHBA 3NDPA 1Q1EA 5B30A 3BRWD 4QHSA 1NBMD 5L3SA 4LJYA 1LS1A 4QHTA 1ZU4A 3GJXC 1Q3HA 5P21A 5HPYB 3AVXA 4DUGA 3NEJA 2JAQA 1T0HB 3P26A 4C0KA 2CL0X 1WRBA 2ZITA 3U3OA 4CEIB 4BFVA 2WKRA 3SOPA 2IYSA 4LUCA 4CGZA 1C9KA 4I1SA 3VU9B 2GJ8A 2F6RA 3CX8A 4IDQA 2OCPA 1LF5A 5CM9C 3DM5A 4JLPA 2J9RA 4OHZA 3KZ1E 1OE0A 3CKLA 4JVLA 4RCYA 1ZW6A 3T1VA 3GD7A 5A0FA 5E7IA 4TSFD 3B1VA 5KTYA 3IBGA 3AF4A 3MMPA 1KK1A 4LZZA 3SBEA 4ZKEA 4TLDA 4B35A 2HDNB 5JSZA 1Z06A 4PC6A 4Q9IA 5FTMA 2F3TA 4HLUC 3RS0A 1JR3E 2RH5A 2GETA 3DMDA 2YC2C 1ZIOA 3R9WA 1E79A 2IL1A 3SYNA 4A1FA 1F2TA 3VR4A 3AVYA 1NI3A 2R6GA 4HLDA 2RGNA 2WMOB 4TMWA 4E5UA 2ZSAA 3ND9A 2EFEB 5HKKA 4NKRA 3QVVA 1E9RA 1EX7A 2BIFA 1IXZA 2ZRKA 3TAUA 3KQNA 1P9NA 2WPDA 5G40A 3SQXA 4BFWA 1W5TA 2GILA 1K5DA 1R0XA 4IOLA 4AKEA 3ONWA 4JLBA 5AJZA 5D3QA 1AN0A 1JXOA 1OFIA 2FPLA 4MGYR 2F1HA 1E1QA 2ZE7A 3TH5A 1KIMA 3GLHA 5L3SB 1W48A 2QTHA 2ZRNA 5EUMA 3U6BA 1Z0JA 1OFUX 1DE0A 3RYTC 4CYMA 2YOFA 5EXPA 1XCMA 2PT7A 1VG1A 1PLJA 5DGXA 2NO1A 2OBMA 4PZZA 1UKZA 1Q1ZA 2IXGA 3NWJA 2AK3A 4F7WA 4R98A 5JJKA 1LB1B 2XOKD 4XSGA 4QXAA 4EPXA 4HDCA 1VG0B 1YR7A 1MABB 4DDWA 5JJIA 2Q6TA 2ZE5A 1JNYA 1NL3A 3QF4A 2ZJBA 1TF5A 1ZC4A 4PAQA 4YMWA 4P33A 3NG1A 2VEDA 5FBLB 1W0JD 2X19A 2QM8A 2ZI5A 3IQWA 4U02A 4KSBA 3LX5A 2J7KA 1DTSA 1VIAA 5JSZB 4TT3D 4P3YA 2OUKA 3GLHE 2WIBA 5EE1A 1OSNA 2G0TA 2ZAOA 4J0QA 3CRRA 2OILA 1ZNXA 1F2TB 4G5GA 3RRNA 2QTVB 4OBEA 3KQLA 1DARA 3AGPA 4M1YA 4Q9HA 4YDSA 1VPLA 2F43A 2QRZA 4G5OA 4LY6A 3KX2A 4YQFA 2V3CC 4Q00A 1N25A 1L4YA 4UJ3A 1A4RA 3OEEA 1D8TA 1VCMA 1U99A 1IN7A 4QKQA 2JIZD 2Z83A 5ELXA 2ZSDA 4LOAA 4FXPA 1KKMA 1KSJA 1W5SA 3GLHB 3A4NA 4DVGA 3QKSA 4YMUA 5TARA 4FMDB 4KODA 3SDZA 4DC9A 1PVOA 3HU3A 4B48A 2JLXA 2QE7A 4TMXA 1Y63A 3PUXA 1V43A 3RS2A 1XTKA 1K5GA 4JZKA 3VR6A 5C18A 4KBFA 2ZPTX 2H7VA 521PA 1Q12A 2FSHA 4Q4AA 4RFSA 4JS0A 2P0EA 4LWZA 2ZVPX 4S35A 2GCNA 3GLFA 1GTVA 2G83A 3BH0A 2QBYA 4TZ6A 3QF4B 3DPUA 4B33A 5H1YA 4C0AC 4IDPA 1GNRA 2Z43A 5FPHA 1L8QA 3BGWA 2NIPA 4C30A 4BUJA 3X1DA 5FL3A 3THYA 1G6HA 3KQKA 3B8HA 1E2DA 1GUAA 1WXQA 4BZQA 4TL9A 4G3XA 3T15A 3PEWA 4RZ2A 4HZUB 2J7PA 4BE7B 3RRZA 4DCSA 1QG4A 4JYBA 1J70A 1OV4A 1XEXA 1DO0A 4LJ8A 3Q85A 2HF9A 1XZQA 1QG2A 5GVRA 2F43B 1GRQA 5AWFC 3BC1A 3NDBB 5TB5A 3OFND 4PQRA 2PLFA 2ZU6A 2IX3A 1EWQA 3GLFE 3LV8A 4B47A 2MSCB 3RDPA 4GRAA 2QG6A 1W4RA 4ZPXA 4PZYA 4RKFA 2REBA 1IOZA 1X86B 2B21A 2AXPA 3MAAC 4N0DA 1Q3TA 3QKSB 3TVDA 3RHFA 2XSZA 5DI9A 3EPHA 4XTRA 4ZO4A 3WP1B 4ESHA 5B57C 1NKTA 2ZRHA 1CR2A 4MKGA 2GA8A 2DY1A 4Q4AB 4RFSB 4A2WA 1NMYA 1MH1A 1CRPA 4AI6A 2IYLD 1EWRA 1I4DD 2C2HA 2RHDA 3W90A 3OIVA 1KDPA 3LX8A 4O2LA 5D3MA 2QBYB 4OI1A 2PZFA 5K8IA 3EIQA 2IXFA 2W6JD 1CR1A 2GK7A 2QPAA 2W2TA 1BYUA 4A0FA 3EW9A 4QJ4A 2GCPA 3THYB 3H2YA 4CRWB 3IPXA 2CHVA 1RRCA 2NTYC 1R5OA 5LBIA 2XB4A 4QGFA 4AYXA 3MUFA 1HT2E 4FI3C 4RFVA 3QEOA 2QGZA 2BEKA 5CLLA 3FKQA 4BEBA 4GPTA 1KOFA 1N0UA 1Z07A 5F9FA 1P5ZB 3QEJA 1HT1E 1RC8A 5IF9A 4A6XA 5BQ5A 4BFZA 1WDTA 3EAQA 3WMGA 2OT3B 4KYUA 3AF0A 4Z8XA 3FYHA 2YV5A 3QBVA 1N3BA 1UKEA 1CLUA 1P61B 3DOFA 4AYWA 2WSSA 2FFBA 2KB0A 4Q19A 4WZAE 1E2KA 2H8KA 2BMFA 2JLSA 1IY2A 2J1LA 2GJ9A 1GKIA 4RY2A 1V5WA 4P32A 3DOEA 1T9HA 2WWIA 3C5CA 2R65A 5FPTA 3UG6A 1VDZA 3LVQE 1OW3B 4R2HA 3VR1A 4KYIB 2CMKA 3VX3A 1QVRA 3LQRA 4TYNA 1N5KA 2ZS9A 4LRWA 1NNEA 3U7HB 4NP6A 5J4HA 2RGBA 2P2LA 1G18A 1H8HD 3K09A 2BCJQ 2WBLC 2VHTA 1KI8A 1RRFA 1S3SA 1UADA 4HEJA 5FI1B 2ECKA 4D81A 4HAVA 4CZ2A 4RD1A 4UNRA 3L0OA 1T8UA 4O0MA 1NN0A 3L82B 2W58A 4W5HA 3T1OA 2JJ1D 3LAWA 4EPYA 3QENA 1E9CA 4BASA 4PO9A 2C77A 1OT3A 1E9BA 1AS3A 1GG2A 2EFDB 4HI0E 1IN8A 3CZQA 3Q7PA 3JZMA 1SXJA 1E2EA 2J0SA 5E4FA 3X1YA 2XAUA 4MYCA 5FR1A 1KDOA 4BFTA 3AVVA 1JR6A 1YU9A 3GJ6A 5C46F 2FDCA 3B60A 4Q18A 2WOJA 2OCBA 5CYOA 2ZRBA 1E2IA 4HB3A 4CEJB 2OLJA 3SEAA 5HCNA 4RD3A 3K8YA 1HV8A 3ZZTA 4R9UC 3QKRA 3CPEA 1F60A 4GI7A 2HEIA 2IXEA 4HLQB 3W9YA 3FMPB 4OHXA 3GFTA 4C0HA 4C0JA 3AB3A 1XP8A 2CCKA 4N3NA 3KL4A 5KDDA 4AKGA 2AFIE 1N6HA 2QY9A 4TL8A 3EG5A 4CF7A 4AKIA 3CNLA 2OFXA 2VF8A 3PVSA 1UF9A 2J87A 1SXJE 1KK0A 2HJGA 3C41J 4YDHB 4CEHA 5JWRA 1R5BA 1P2SA 3KKPA 1Z63A 2IUTA 3W8RA 3WYFA 4IVQA 1KK3A 2DR3A 2PH1A 3G0HA 2IYVA 4LJ7A 4D4JA 5GJCA 2FG5A 2WWGA 3KKMA 3IDQA 2FZLA 4B6FA 1KY3A 4ESVA 1KJYA 3GFOA 3LDAA 4MQBA 1AA9A 4DBLC 1EFHA 3ECCA 5EP2A 2DFKB 3KFVA 2QMHA 3EWAA 3SFZA 4C4PA 1ODFA 5JECA 4OHWA 3IO5A 2IS2A 2A7QA 4JKYA 2J41A 1OXXK 3SBDA 1SXJB 4LJAA 2A5JA 3DL0A 4HLUA 3QKTA 1R0ZA 2VSXA 1XMIA 2ZJZA 1AGPA 4JJKA 3RRYA 1YZTA 4Z51A 4C3ZA 2P6UA 1ZM3A 3CPHA 3KTAA 1CF4A 4JLDA 1DVRA 3SYLA 5KNCA 4HUQA 1M74A 5JWHA 4HSEA 5JEDA 4URVR 3QKRB 5BYKA 1XTRA 4G5QA 2REXB 2VP2A 4PO1A 4F38A 1E1RA 4KVGA 3RRMA 4DSUA 4K81B 2V4ZA 2KSQA 4LHZA 2Z0MA 1Z6AA 3CNNA 4V0MA 2D7DA 3IGFA 4Q1EA 1LV7A 5M04A 1WQ1R 2H92A 3PUYA 3WHKA 5FOTA 2GZAA 2EYUA 1R0YA 2IYWA 4JIMA 1G8GA 4TQAA 2QNRA 3P20A 3F5FA 1N6KA 2A5GA 2WJJA 4CEHB 3RS5A 4RZXA 4G5SA 1SHZA 2WJHA 4DLXA 4D25A 3MWYW 1G64A 5KYKA 3AM1A 4ZDKA 3UPUA 3GMTA 1VKJA 1W0KA 3KQUA 4A6PA 4JYCA 2CVHA 5GADl 2BV3A 4MGIR 1A2BA 1DBSA 4URXR 2BVNA 4D26A 2ZJ8A 3VR2A 1QHSA 4OL0A 4XWKA 5JHHB 4LPKA 2P6NA 2JGNA 4HB0A 1ZP6A 4K46A 4NYIQ 2JA1A 3CUEF 3BFKA 3UMSA 4V0ME 3V00A 5HE9A 1P2TA 4DJTA 5CYPA 2G77B 4HZIA 2FMXA 2ZR9A 1N2CE 1NVUQ 4PHHA 1Z6XA 2BJWA 4ERNA 2YKGA 1G3UA 1CR0A 2E1RA 2R8RA 3KTAB 2C9CA 1NG9A 3EPLA 4Q9LA 4HUQB 3VFDA 1W44A 4JBYA 2UZ3A 2WAXA 2ZYWX 2L0XA 1A82A 3Q3JB 4AD8A 2FV8A 4M22A 3RNLA 1N6RA 2AKYA 4EKDA 1LF0A 2WV9A 2GWHA 1E94E 1MV5A 1EFRD 4TLBA 5KDOA 5G3ZA 1UDXA 3SHWA 4HB4A 2VSFA 3TQFA 2DBYA 3KJEA 2Q21A 4PTLA 5L3RA 3FE2A 1CS4C 1KZGB 4C0BA 4A9AA 3KXLA 1XX6A 2XNDA 1X1RA 2VRWA 1VCIA 3L0IB 4EAQA 1LW7A 3TK1A 4PR0A 4ZKDA 4ARZA 1OH8A 1H8ED 1CP2A 1US8B 4UXHA 3PG5A 5FOUA 3AEZA 1KNXA 3FGNA 4BFYA 3FPAA 4ILEA 2W2VA 4NH0A 3EASA 4RVCA 4OHYA 3ZGXA 2GRJA 2Q3FA 2QMEA 1SULA 4PQYA 1DS6A 2FSGA 2PLRA 2RGGA 3A1WA 4AK9A 1XPRA 1W2GA 4YLGA 1T3HA 1RRGA 2V55B 1KNQA 2JDID 4PPFA 3ZS9A 3UANA 4B2LA 2CK3D 3Q72A 1COWA 4I1UA 2G9NA 1G3MA 1ZD9A 1NBMA 1KAGA 4LV8B 5CB6A 4WIAA 2R2AA 2CE7A 1G7SA 4M1KA 2J59A 4ZCLA 3BE4A 3P1JA 1E32A 4EPTA 5TMPA 5FOWA 3RVBA 1WE2A 4JBXA 5LDDC 1F48A 1UBFA 2OZEA 1FX0A 2VP9A 4JVMA 3B85A 4C2TA 4GMDA 4LC0A 5J5CA 2KBEA 4F91B 4F4JA 5FUXA 4Q4HA 3K70D 1AQYA 4XOIA 3LRPA 4GT1A 1CJKC 4V0OA 1KGDA 1VYVA 1ZINA 4WA7A 4IFEA 3C8UA 1XCGB 1ONBA 4DLTA 4TSFA 5HR5A 1NMXA 2ERXA 4FMDF 1NLZA 3KB2A 2R62A 1SVMA 3LVRE 3KQHA 3W5IA 3QPVA 1JXMA 2F9MA 3AP3A 3LQQA 1I4TD 2H1LA 2ZIAA 2BM1A 4OK6A 4ARZB 4ZCMA 1NBME 3VU9A 3LNCA 1YKSA 4OKSA 1N5IA 2GXQA 4NZYA 3GPLA 1CXZA 4QG7A 1VG9B 5B64A 2WKPA 2REOA 5J4YA 5CDFA 3HR8A 5EE5B 1XTJA 1PLKA 3Q7QA 4B3DA 1ETUA 2ODNA 3DZDA 2ASEA 2VQSA 2WOOA 3BXZA 1X6VA 1G21E 2LKCA 3SN6A 4A0HA 4B34A 2FGKA 3O8CA 1OFTA 1LY1A 2BBWA 1Z22A 3FTQA 4BGDA 1VHTA 3C5HA 1XJQA 4OJQA 1FP6A 2PMKA 2WWHA 4Y0AA 4N0EA 1A2KC 1NLYA 4D0LB 3J81k 2D74A 3MJRA 4DLYA 3AH8A 1ZAKA 2P3SA 1RW4A 4B2PA 3H0KA 4Q9KA 4JL5A 1Z6TA 4MRVA 3FMIA 1UKVY 4PSVA 1BS1A 3C7KA 1U94A 2HJVA 3N70A 3NC0C 4PX9A 4EIWA 1J8MF 4ZI3A 4Q47A 2Z4SA 4HDQB 2QP9X 4MITA 4E03A 5CDFE 3LA6A 3VHXA 1JR3A 3TLXA 1KZ7B 1VIYA 2ZE6A 2XZPA 3SQWA 4FN5A 2FJUA 1W0JA 1JQLB 3AVQA 1FP7A 2OG2A 4UXJA 4E09A 1JPJA 1N6OA 4JLNA 4PPQA 2GESA 1W36D 2HYIC 3QOFA 5FUWA 2ORWA 1G7TA 1GRRA 2IYZA 3DKVA 4TT3A 2HV8A 1JEDA 1P7CA 3T12A 4Q4LA 3CH4B 5L8VA 2VHCA 2ZRMA 1R8QA 1KTVA 4D6PA 5BN5A 4Q7LA 2QL6A 1MABA 4W7SA 1ZJ6A 1DAMA 3WHLA 3BERA 1KSGA 4RKEA 1G8PA 1TEXA 3BK7A 3QJYA 5TV2A 5FI0B 4DSTA 2AD5A 3W8NA 2FEMA 3ZD6A 3A4LA 4YC7A 3GLGA 4IOMA 4FCVA 2XGJA 2ZYTX 4FWIB 2HT6A 2QP3A 2A9KA 1U2RA 3PEVA 2O8EB 4C0QC 1Q21A 3RAPR 3CRMA 4PO8A 3CO5A 3AP1A 4R71A 4UKDA 1IN6A 3B7GA 3U2QA 3TR5A 1XEWX 3CIOA 4TMTA 2NG1A 3EC2A 4Q5IA 2ANCA 4HAZA 1E99A 2CHQA 3QIAA 1SVLA 4PHGA 1T5LA 3QF7A 1T4GA 2ZXUA 4JLOA 3CRVA 2GCOA 2ZR0A 3A1TA 4DCTA 2IS6A 4BEJA 2BMJA 4KU4A 2DHRA 4TMZA 4IDHA 1F3OA 1U0JA 4AY2A 1KYIA 4PHTA 1FNMA 4RZ3A 1D2NA 4Q7JB 4EPVA 4Q7MB 1R0WA 2DYKA 1TF7A 1O3YA 2X2EA 1FMJA 2B6HA 1R2QA 4EDHA 3A1SA 3LXXA 5SZJA 1P75A 2IWHA 5JCZA 1P60A 5JFGA 1P72A 1XB2A 3K53A 2VP4A 3GLGE 1BIFA 2IYXA 3CM0A 3RC3A 4FWTA 1S96A 3TIFA 4DDVA 1MR3F 4KFSA 4LV6A 1L4UA 1FNNA 3K0CC 1F5NA 3FMFA 4WW0A 1JBKA 3ZDQA 4XJXA 1XD9A 1H65A 2I1QA 4NCNA 5CJPA 3ZVRA 3VR5A 3VMFA 3IBYA 1BOFA 3HP1A 3BAFA 2WKQA 2BC9A 2IEZA 5EP4A 4TLEA 2VHUA 1IM2A 3D8BA 2PZEA 3UWOA 4M1SA 1EG7A 1AK2A 2W6IA 1P3JA 2RHMA 3ICQB 2IYQA 1DEKA 2RGXA 3GLGB 3BFVA 4M9QA 2ZJAA 3U7FB 4TMVA 3K70C 4BLQA 2AFHE 2QAJA 4OI0A 4HZUA 4DIDA 4GP7A 5KUTA 3R9IA 4QFMA 4NHOA 4RCZA 4DCUA 4PC2A 3EZ2A 5EUQB 4DLUA 4AG6A 4X8MA 4ZDWA 3TSOA 4KO8A 5LPNA 3KDSE 2D62A 1HYQA 2GCOB 2HCJB 3M1IA 2ORVA 4QM6A 1E96A 3H4MA 1RKBA 2PJRA 3ND8A 5FBQB 4Z1MA 3IQXA 5LB2A 5AUNB 2RGDA 2ZE8A 2F1RA 3RWOA 2UVQA 1W2HA 1YQTA 2VLIA 2X8AA 1D9ZA 2OXCA 4NYJQ 2JLQA 4XVQA 5KSYA 1Z6YA 1ZNWA 3IILA 2AHOA 1YE8A 1N6LA 3ETLA 1UKYA 2XZLA 1VYUA 1Z0DA 2ZI3A 2N42A 4TWZA 4OQFA 2JEOA 2VIIA 1TEVA 2JJ8A 3WY9A 5E3HA 2ODBA 3IHLA 1W46A 1TQ2A 5TDHA 2IHYA 3W6PA 2ZRDA 2WWXA 2ZUDA 1G19A 1AGRA 4LCBA 4EFNA 3RS4A 4ZV4A 1F2UA 3WP0A 4B3BA 2BOVA 1TX4B 4KSCA 4RZUA 5HCIA 1GILA 3AP2A 3G82C 5FUVA 4DXAA 3C14C 1PUIA 3BOSA 5HTKA 3WNDA 1II0A 4LJ5A 2ZYVX 1M7BA 1EFUA 2BM0A 3GEHA 3Q8XB 1RYHA 1LNZA 2FEOA 3RSLA 2HT1A 4LV5B 3I62A 4V0NA 3TSZA 3UMRA 1ZVQA 4LPSA 3N5CA 3KKNA 2RGAA 3WMFA 4K8OA 2YWHA 3UATA 2BWJA 1IXSB 5SZHB 3UKDA 1Z2AA 4L15A 4URWR 2G88A 1IONA 3AKYA 4LHYA 5EE9A 3TKLA 3QI2A 3LBHA 1KI3A 3SFVA 5ANRB 1JJ7A 1Z29A 2C04A 1W36C 3ADKA 3IKJA 2OFOA 4P4SA 1H8HA 1T91A 1W1WA 3EA5A 3BB4A 4MYUA 2B8WA 4ZCIA 3O8DA 3V9PA 4OK5A 2RGCA 4JT2A 4I81A 1GAJA 1NVWQ 2ZANA 1NN3A 4H9GA 4PPGA 2QORA 5DNYB 2HLDA 4GBMA 3LD9A 1Z28A 2GXUA 1B23P 3B1WA 3DZ8A 4IRUB 4CIDA 4QBIA 4NTZA 1CIPA 2FPKA 2FWRA 3RABA 2CLSA 1XNJA 3B5JA 1OYYA 2CLDX 1G6OA 2JJ1A 1HQYE 4Z54A 1OXUA 1TAGA 4DDTA 2ZJ2A 1OB5A 5E7JA 4ASUA 2DPXA 3AGQA 3KKQA 1P73A 3B1XA 4M0LA 2Z6VA 2XEXA 3GJ5A 2WIAA 1XJCA 1F2UB 1E98A 3GLIE 4C2UA 3LBIA 4W5WA 3VKGA 1LFDB 2ZU0C 1SKYE 4NCKA 1OPXA 1ZCBA 4IHQA 5FPKA 2J0UB 1T0JB 4CT5A 2CNWA 1G17A 1YRBA 2QROA 1NIPA 4FCWA 5FL7D 3WNCA 5HZKA 4ZDJA 4TYYA 3AUYA 3FWYA 4JMPA 4US2R 2OSBA 4FW9A 4A15A 4QBFA 3OE7D 2WVJA 4L4UA 4KLZA 2XTNA 2QU8A 3OEED 4JKIA 2H5EA 4V0KA 721PA 3QE0A 3DMNA 3V4RA 5FBWB 1IQPA 1NY5A 3B9QA 3MWJA 1XEWY 1AQUA 4X8LA 3GLIB 2PX0A 4JLAA 1E6CA 2KE5A 2UKDA 3AUXA 4L9SA 2OO7A 1ZRHA 2YINC 4M53A 2ZM5A 1SKYB 1CKEA 4CEJA 1Q20A 1VECA 2VTKA 4P4UA 4P4SB 2IS4A 2QRNA 1Q22A 2XTZA 4NL4H 2R44A 1GNPA 1ZC3A 3H86A 1XDBA 1SQ5A 4ON9A 1X8JA 3NTUA 5IHPA 5EXXA 1R7RA 2ZRIA 4QRHA 4GOXA 3PUVA 1T3LA 3EXAA 2ZRPA 8OHMA 3CWZA 1IHUA 2PEZA 2OAQ1 1CJUC 4QJ5A 2GEDA 2IT1A 5K8LA 3CH5A 4JLKA 3R9XA 5KNBA 2J7PD 2VA8A 4C0LA 4DB2A 1OIXA 5F2EA 4IEIA 2O5VA 1P9WA 1KMHB 5KNDA 2P6RA 3A6PC 3TW8B 3T1TA 4UNPA 2GVDC 3TW4A 1OKKA 4OQNA 4OK3A 3ZQJA 1D9XA 1C1YA 5FFMA 4DRZA 2PEYA 4Q9JA 4DT1B 1CRQA 1DPFA 5BYJA 5JS8A 4U5XA 2QENA 1EK0A 1D6JA 2FFAA 2J5XA 3K9NA 2FSFA 2DFLA 5KPDA 4P31A 3ZZUA 2YOGA 1J90A 2QUZA 5L3VA 1J99A 2GXSA 1ZUNB 3AKEA 3CPJB 3QG5A 2IK8A 4TLAA 3DHWC 1E0JA 4B73A 3FMOB 3A4MA 4M1TA 4A2PA 2P67A 3MSXA 3WMEA 3REGA 1IY0A 3EIHA 2O0HA 4DLWA 1BKDR 2DCUA 2NOAA 4CW7A 2F55A 1D2MA 1AIPA 1G8HA 1JAIA 4M1WA 3TUIC 4DLVA 1NN1A 2CJWA 3MG9A 4MKHA 4AG5A 3FHCB 4RSGA 4EFMA 1UEJA 4LI0A 5C4MA 1RPZA 1E2GA 4PPNA 1KDRA 3BH6A 1GL7A 3D31A 3D3QA 3A37A 4DEYA 4A0RA 2DWPA 1E4VA 4PFSA 2O8DB 4IOJA 2ZRCA 5FBVB 4LJ9A 4L5BA 1UFQA 3W3AA 1KAOA 4G0NA 4TZ0A 4MYTA 2GF9A 1OYWA 5BWMA 4CT4B 2ZI7A 2NPIA 5G41A 2IEYA 2VPPA 5JI2E 2QPOA 3TE6A 3QUSA 3RS3A 4GZMA 5J47A 1S1MA 2YWFA 4LDJA 5FOXA 2XJ9A 2QEQA 1NKSA 1GKYA 1KSHA 2KWIA 2WMNB 2RAPA 2PX3A 1ESMA 1R6BX 1MT0A 1ZIPA 1IJFA 3KUCA 3E2IA 1XTIA 3AV0B 3K0FB 5AJVB 1CJMA 2X1VA 3C16C 4YMTA 1E4YA 4NYIR 5C4GB 2G0NA 2J0QA 2WJVA 1MOZA 1IBRA 3FHOA 1E9FA 1Z0AA 2RB4A 4MRPA 4A4DA 4NE2A 4JSYA 1E2LA 2PJZA 3I4LA 4LJ4A 4PZLA 4M2LA 3N2IA 4BQSA 2EWVA 4TTQA 2OESA 1KK2A 2C5LA 5FH9A 4ITRC 2ZSBA 1FPMA 1E2MA 5DHAA 4F4IA 4XWOA 4QGHA 3QXCA 1P62B 3FKSA 3N2EA 4O25A 4ZIRA 4MDEA 1M7HA 2Z5FA 5KPJA 5KO2A 1FUUA 3DM9B 3UK6A 2IS1A 3SYKA 4KCGA 1GITA 1DOAA 2ZUCA 4LX0A 2O8BA 3FVQA 1OJLA 3UWKA 2FFHA 2WICA 2ZETA 2CJWB 2V9PA 3DEFA 4G5RA 1ZCAA 3B2EA 4URUR 1BO6A 3IUYA 4WZBE 4MKIA 2VBCA 5TY0A 4B76A 5EP3A 3PJRA 5LB4A 3ZIAA 2MSEB 5GJBA 1EFTA 3K0CA 3B82A 1A1VA 3B9PA 2JDIA 4QL3A 1EGAA 1NSFA 1OF1A 3TQCA 3CRQA 1GKUB 2O52A 3I72A 2ZJYA 3M6AA 3GFPA 4Q1CA 2GBLC 2GEVA 1GL9B 3X1XA 1K6MA 1US8A 1R8SA 4FMCF 4QM7A 2A5FA 4Y0VA 2LWIA 1OLOA 1RZ3A 2OEPA 3ICEA 1WCV1 4HATA 5F3WB 1VTKA 2WJYA 2ZJ5A 2FFQA 3NVAA 1VCOA 5FTLA 1P9RA 1NSTA 1FQJA 1NY6A 4GSYA 4HAUA 2O8FB 1UBGA 2FF7A 3U44B 1HQCA 1SVWA 4KXFB 4TTPA 1C4OA 1RVDA 4QOSA 2IYUA 4QNRA 1DAKA 3U3RA 3FOZA 2IWRA 1U90A 2N1BA 1Q1BA 2BBTA 3SU8A 3I61A 4GZLA 1AZSC 3EX7C 5A4JA 4KVAA 4PC7A 1ZM7A 4Q1AA 4HLCA 5K8UA 3E1SA 4TQ9A 1MO4A 1IN5A 4M21A 2IYTA 4DWJA 4G01B 4FINA 1WB9A 2G1KA 4ZIRB 1Z47A 2F1JA 4Q1FA 5C1BA 4C7OA 3CLVA 2V7QD 4MRRA 1JB1A 3EIEA 2FX3A 4LSGA 1TQ4A 2QSZA 2AD1A 3TNFA 2O8BB 2CCGA 3SI7A 1GNQA 3I8XA 5FOSA 5DN6D 2E9SA 1G5PA 3OAAD 3QXXA 1SVOA 2G1JA 4OYHA 4Q03A 2QPTA 1W4BA 3EZ7A 4FIDA 4KV9A 3ZVMA 1ZNZA 4JSTA 2JATA 2B8TA 3L0SA 1NIJA 4OI2A 1ZU5A 3GJ0A 1XBTA 2GJSA 2QM7A 1NRJB 1G7CA 1KJZA 2BMDA 2IF2A 2FSIA 2C98A 3NBZC 5FOVA 4D4KA 2RCNA 2LKDA 1N0WA 1NVXQ 2H18A 2B7BA 1CJTC 1XU4A 4TL6A 5GJVC 2QSYA 4Q02A 2DWQA 1DAGA 2AN9A 3OIYA 2FOLA 2NQ2C 4LYFA 2GAAA 5EQTA 3PXGA 4D0NA 3CX7A 5DISB 1G291 5IK2D 3K9GA 2Q9AA 3K70B 4BLTA 1HEIA 1D2EA 3IHWA 3KJIA 4L8GA 2CL6X 3TR0A 4KI0A 3HU2A 2FNAA 1II9A 2VHJA 2QZ4A 1DAIA 4DB4A 2GAOA 3CWQA 4F93B 3THXB 3TBKA 2JLRA 1ZMXA 2PMDA 2V8OA 3PENA 5KHOC 4Z8YA 5DYIA 3WNBA 4C7OB 4DLSA 4LYJA 1E0SA 4C0SA 2UZIR 3MRSA 2YWGA 1FZQA 2BCGY 4LBYA 2YOHA 3NBFA 4AYTA 3A1UA 3VQTA 3QQ5A 3ZQ6A 5J4LA 1NN5A 1I4LD 1G8FA 3BJIC 2ONJA 3O8RA 5BXQC 3E70C 1XMSA 1U8AA 4LYHA 1Z2CA 5G53C 4B71A 1EESA 2BHRA 3U7EB 1X8LA 2BKEA 4BLRA 3H1TA 1HH4A 1TUEA 5FTKA 2V1UA 5DYGA 1P2VA 3PIRA 3SJCA 1WBDA 1UPTA 3ASYA 2QMUA 2X77A 3AQ4A 1KI4A 2AWOA 4JJZA 5B58C 2I3BA 3OEHD 1DO2A 1TF2A 5DE3A 1GIAA 5JEEA 2GHIA 2YVUA 5FBRB 3EPKA 4FD2A 2J3EA 1GSIA 6Q21A 2BEJA 2AKAB 2WSMA 4JBWA 3MWKA 1QF9A 3I92A 3WRXC 3BH7A 3X1ZA 2XB2A 2DB3A 5JLJA 1TTTA 4KHZA 1MO6A 2VP0A 2DFNA 3DKPA 4B43A 2GXAA 1CU1A 3IIKA 2O8EA 4D80A 2AR7A 5AK0A 1QHXA 2ZSEA 3CNOA 1YZGA 2IHBA 1Q1QA 1GVNB 4LK2A 2AX4A 4XVRA 1QBKC 1KY2A 4EJSB 4OQLA 1KI2A 1LTQA 1UBCA 1XD2A 3KKOA 1FFHA 1W36B 5CM8B 2R9VA 2ZTSA 4LGMA 2EVWX 2VHQA 3QKUA 2QGNA 3K0SA 4DZZA 2XNDD 1U98A 2D06A 3QXHA 1ZNYA 5UKDA 1S1CA 2XOKA 4EUNA 4XVUA 2HCBA 3T06B 2NZJA 2QQ0A 4NYMQ 3BORA 1XMJA 2F7SA 2WWWA 3HU1A 4HAWA 1XF9A 3I5XA 3K0EA 4DDUA 1Z8FA 2D4HA 3NKVA 3HR7A 1TMKA 3RWMB 1CJVC 4IJMA 2NPFA 3ZH9B 1OHHD 2ZVQX 1YVDA 2IYRA 4M9ZA 1HY3A 5KSPA 1YZLA 5TXGA 4B3FX 4EQ6A 1T5IA 2OHFA 4QC2A 1G1MA 3U5ZB 1L2TA 3P4YA 2A2ZA 4C9BA 1J7KA 1YZNA 2DWOA 4CVNA 4YXWD 3IIJA 4OI4A 3IEUA 4PSAA 2HUPA 4V02A 4D82A 4A36A 1UEIA 4FMCB 5K8TA 1COWD 3MJHA 3GEEA 2IUSA 3BBPA 3GQBA 1VMAA 5E95A 3SNHA 1FTNA 3QXJA 2EYQA 2NGRA 2ODEA 2Z4RA 1R5NA 2K5UA 1XJ0A 5SZIA 3RSOA 4MDFA 2NMVA 4UXIA 4GOKA 1NVVQ 1FOEB 2OFWA 2C03A 3T1QA 2P5SA 2H57A 2O0JA 1OH5A 1JQJC 2YHSA 3TRFA 1W47A 4B6EA 4KLNA 1CULC 3HWSA 3P32A 3NC1C 4I4LA 3WBJA 4B3XA 1U8YA 3LFUA 4EPRA 1P4SA 3MFYA 3I5YA 1U0LA 2JIZA 3AVWA 4BLPA 1OXTA 2ZRJA 2I1VB 1YZKA 4JLJA 5DO9A 2OV2A 3G5UA 4EPWA 3U6KA 1XRJA
chains in the Genus database with same CATH superfamily
4PZPA 1GZ6A 4PAMA 1DLIA 1P4AA 1IJEA 1F6DA 3PIDA 4F8JA 5AUQA 1O94C 5LYYA 4G4JA 5ICFA 3M6XA 2NVWA 4HTFB 5SY4A 5EJEA 3P19A 4L8LA 4ONEA 1W7AA 2ZR7A 2XYPA 1YR9A 3AERB 3QEMA 3QXSA 5F2NA 3OT1B 2R0QC 1MO3A 3VKHA 1QGDA 3R20A 4RMIA 3D3KA 1SXQA 5A2GA 5HSGA 2J3JA 4JROA 1BRMA 2RGEA 3FNQA 5KYUA 3FPJA 4RTRA 4QULA 3T99A 4C87A 3OKPA 2ZREA 3X0DA 1RPNA 3PKIA 5BN3A 2DT8A 2QQEA 4AY3A 2W22A 3CRZA 2IPMA 5KOIA 3CG0A 3B38A 5E1DA 3ZU5A 1G16A 2WF5A 2RCYA 4EQ6B 1OVMA 3D6HA 4XD7D 1N5JA 5E3IA 1JWLA 2V6IA 4UNNA 1QFYA 4EECA 5REQA 3E05A 3VSCA 1XZ8A 1OH7A 3DFFA 3WO0A 1L1EA 1KO8A 4JMLA 1XVAA 3RYIA 3H3JA 3DMYA 3TSCA 4D43A 3H84A 2W2KA 1DKLA 4NLLA 4R5HA 4UM5A 3SYMA 1AURA 4F5EA 3KT6A 1WZNA 3DZFA 5I3CA 2YWEA 2HQSA 2Y2VA 5EHNA 1A2OA 3HXOA 3AFHA 4GP9A 3TD6A 3IDSA 2ZZNA 4IKEA 1E3JA 1OX6A 5D6NA 5JNTA 4I6JA 1DKQA 1FYWA 4R16A 4AMGA 3LLUA 5AESA 3OE4A 3GLKA 1BMFD 3NKLA 3NIGB 1HFEL 2C00A 3IKMB 1J8FA 1W581 4JI4B 4AZTA 2ZULA 4B75A 1T8WA 2OORC 5AI9A 3TLGB 3ILVA 3S2UA 5ED4A 1Y9AA 3GRUA 1TKBA 3OX2A 3E0QA 1L8XA 2C5FA 3KYIB 3VUFA 1JR3D 5KJ6A 2VPIA 1QVAA 4JCOA 1L7XA 1ZQ9A 2C2YA 1Z4MA 2IEGA 1C81A 2EAUA 1C2TA 1GAWA 2LNDA 1X7ZB 5B3JA 4AXBA 3G9XA 1PV4A 3NHWA 3ABZA 1CZHA 4BE9A 2HCTA 4KSYA 4R9VA 3BSSA 4RH1A 5IANA 3UT0A 1QNFA 3WIDA 1IDN1 2VP6A 5DTMA 1Z3IX 4AUKA 5IAOA 1NBHA 3CCCA 1YE5A 2TSYB 1L3IA 4MIOA 4AQDA 5I9NA 1NGSA 5TMBA 4BNZA 3DV9A 2WU4A 4XSHA 1EK2A 4GSKA 1YZQA 1KYQA 1JJBA 1ZX1A 2JANA 2WINI 2BFEA 3KD2A 1YS2X 4E6EA 2QJFA 4FM9A 4QX6A 5D51S 3EC7A 3JYOA 2XMGA 1S2MA 4KBGA 2O0KA 1XYVA 3LHFA 1CZKA 3QU7A 5L7YA 4MLZA 5EN4A 1KP2A 1VE5A 2OVBA 3RSGA 5JAHA 3OA2A 4LF4B 2PU7A 3HVHA 5CT9A 2ZYSA 4U39A 4YJGA 3VNRA 3DTYA 3KEGA 4IIJB 1M2FA 4BDSA 2WTXA 2PQMA 3QLEA 1DG1G 2B8EA 1QIFA 2BLLA 2J6BA 2RKOA 4O4LB 1RXCA 5EKTA 3D6TB 2VDJA 2NSLA 3FSJX 1KO5A 2KJQA 5DHPA 1FMLA 4B4VA 1CW2B 2BMVA 1Y4SA 2FEXA 2QVGA 1LPSA 3I4FA 2E4ZA 4HNHA 4AIIA 2WPDD 3DZKA 2Q1WA 1RVV1 4PYMA 1U2ZA 3SE0A 2YUIA 1U81A 2PL3A 4QPZA 1W73A 4EP1A 3OHSX 3ZH2A 3EA4A 2Y3IA 3EY9A 3U37A 1ICEA 3HPRA 4FSHA 1DRUA 2Q5EA 3JATB 1N6PA 3M3HA 2IZ1A 1LV8A 2PSJA 2Z95A 4CUJA 1XROA 2MOKA 5MN6A 2SHKA 5IKMA 5AUPB 1Q6YA 3DDOA 4X8OA 3Q87B 1T2NA 4JYPA 2HRCA 1O03A 4JUBA 5DU2A 4M1ZA 2M9MA 2NO0A 2XB6A 5K0NA 2NM0A 5IM4A 2VUSA 1G5RA 3I9FA 4OJKA 1R66A 2VWQA 1JALA 1G98A 2WTBA 3A6GA 1QDEA 4KDFA 1GRVA 3IQFA 3PX2A 3WKBA 2HLNA 2GEKA 1NBAA 4BDTA 4O1HA 2A6PA 3L5KA 1DELA 5FRDA 1HT0A 7GPBA 2G5CA 2Y0CA 4LRSB 3CBQA 1HA3A 3O95A 1E6KA 1RE0A 3U4QA 1PVDA 4K6GA 5EXSA 4MWCA 2BI7A 3PGMA 4WTOA 2DM6A 5K7SA 2GNOA 5LXTA 1UPBA 3G5TA 5JY6A 3EUWA 3LGAA 4GC5A 3UK7A 5AKXA 1GP2A 3NTVA 1JGTA 1QANA 5KVCA 2V59A 2ZIXB 3AKCA 1FMCA 3PE3A 1E60A 1IE3A 3BIFA 3NNDA 4I99A 5AJHA 4B82A 5CXXA 1PLLA 2BBOA 2TMKA 3IE0A 4BRWA 4BEVA 4F6LA 4II7A 3I2YX 1SH7A 4Q1VA 3UO8B 4UM9B 4LZLA 3TKYA 3WL4A 1WOYA 3B6EA 3MUNA 3O83A 2MSNA 1ZISA 2OCAA 1BTOA 5H5JA 1KMHA 3WI7A 3ILHA 1A5SB 4AWXA 2AXNA 1U2PA 4NENB 3LP6A 4ND6A 1MOQA 2QT0A 3S1AB 3TNYA 4HYQA 3O2JA 3D8RA 4AL4A 5J4VA 1ECBA 1D1SA 1II8B 4ZEOA 2Q3MA 1IQUA 3MM4A 1KVQA 1UKAA 3AB8A 4ZEWA 3M34A 1IYZA 3KKLA 4PF1A 2PBZA 5ALZA 5CDYA 1QO0D 4L85A 5LM3A 2C2MA 3ASZA 2PY6A 3VPCA 4BOYA 1YU6A 3BVPA 4MUJA 2FUG6 4UNSA 1IVSA 3EWSA 2ZIZA 3L6CA 2GAIA 5A3JA 4KQJA 3UVEA 4FN4A 1OXSC 1QRRA 1NHWA 3L43A 4FYVA 4RZQA 1XGKA 2BZGA 4F3RA 3W8FA 2WM9B 4IXMA 1G4UR 4W8HA 3TCKA 4S1VA 421PA 3CF2A 1R10A 1TIPA 4BO3A 3ROKA 1QRAA 1MXFA 4OGFA 3UAOA 3SC3A 3VKVA 5LIPA 3AVOA 5A5GA 3AF2A 1YI8A 4W5RA 1M2VB 5DWVA 5JATA 4GIBA 4GVPA 4RTQA 2FH5B 4NPHA 4U8HA 4D4GA 1E3IA 2VP5A 4YT2A 3H4IA 1H3NA 3OZVA 2COUA 1Z12A 2OCIA 3R3VA 4EL0A 3SK0A 2X86A 2HOQA 3W2HA 3I9V1 5ITZA 5ALUA 1E1KA 2Q5FA 4IXNA 3MWDA 4TLCA 1VJGA 2FG6C 2O8DA 7REQA 2G17A 4MVJH 2D2FA 2DR0A 4OQZA 1UJ2A 5JAUA 5LL6P 1A5AB 2R7LA 1QPZA 1F7UA 1WW3A 1OUMA 4LBZA 4NCHA 4OHPA 5K20A 2H1WA 4HHEA 1QHGA 5ES3A 2VZEA 2B7CA 2QUJA 1BHO1 3ZZ0A 4RL6A 2EKZA 5SYNA 3T6KA 4LBVA 3TQRA 2O8VA 4G84A 3UMFA 4YV7A 2OBYA 2UAGA 4J90A 4US0R 1KEWA 3R77A 1G20E 1C0PA 4Q3EA 5AH0A 4NECA 1MQAA 5ILQA 5D84A 1HNWB 1FUKA 1LBIA 2P4HX 3VKWA 2VS1A 1S01A 4PAOA 5DLPA 1EU1A 3Q2OA 2FU5C 3K0FA 5B7PA 1ZZEA 4PX5A 2P2CA 3RTGA 4Q66C 3IOMA 1UDWA 4YT4A 3O8BA 3HKBB 3L8MA 4RF2A 3OQOA 2NO7A 3T61A 3OZFA 3QUCA 3PEUA 1RE1A 1U8ZA 1GXSB 5D3MB 5BQXA 4KBYA 2HLDD 4RU1A 4RD0A 4J2TA 2OZLA 3GVCA 4UOZA 3P4XA 3WKAA 3O90A 4HGQA 2F9LA 3NT4A 3NJ4A 2ZAMA 4ACBA 5CIQA 1HDEA 1Q44A 2QTNA 4Q01A 1TA9A 2EWWA 3V8QA 4CFYA 1OGIA 3HYTA 1CS0A 3EUFA 1G20B 1T35A 1ZK2A 3QY0A 1I80A 3SX2A 4AMUA 1K2VN 4D74A 2GKSA 3STTA 1ZGAA 3W7BA 5FYQA 1G3IA 1O8CA 1XQXA 5EXTA 4RVDA 4AJ1A 1BH2A 1E5QA 5DBEX 3A4VA 3KJGA 3PQCA 1SKMA 1YQXA 2D0IA 5CK5A 2ZXFA 3TW0A 1X1BA 3W3ZB 3I0NA 4H1WA 2JIMA 3UT5A 4DMGA 5I8PA 4EB3A 2EFGA 2GI4A 4XQCA 1L4HA 5JRZA 2G0AA 4P81A 4MA4A 4MR8A 2BGUA 1K7FB 3I32A 2YHIA 2B4AA 3UIEA 3ZTWA 2CNWD 2LDXA 3BMOA 2H07A 3HL4A 1AKMA 2VJMB 4PAWA 4CNBA 5FI5A 4LZWA 5IJAA 4C7VA 4Y67A 3GFBA 4PXAA 5KEIA 3CUTA 2HKIA 1AUXA 4B0OA 1MAVA 4NQZA 4JI2B 3GD5A 1G3RA 2AUNA 3AMVA 4E6PA 4IZHA 5KTTA 2AKEA 3GJ3A 4RTOA 1Z16A 5EPOA 2HXYA 3SHOA 3T7IA 3NHPA 4PTYA 5K6AA 1UZAA 2F3UA 3W6NA 1IWOA 2GLTA 4EEXA 4BMZA 3FHTA 1KI9A 1G5HA 1R4MB 4EK9A 4DV6B 2Q5CA 4MW5A 1SVKA 2O8FA 2ACKA 5E6SB 4OAOA 5CFNA 4XYGA 4YCLA 3L3BA 4KB5A 3FHJA 3IQIX 4HBGA 4UJ5A 4C03A 3TGPA 5CB0A 1JQBA 2IKSA 5JXGA 1GZSA 2I78A 3HYNA 4UZEA 3ZW8A 4HR7A 4W99A 2VWGA 3TSWA 2R1TA 2QP4A 1C7ZA 3VNSA 3GWZA 3H9JA 3N05A 2BKUA 1QHEA 3HA5A 4BNDB 1OAOC 3GH1A 4KYVA 4QD3A 3TUZC 1H5QA 1NUAA 2QK4A 4YQZA 4KWCA 1T4BA 1YBMA 3BXFA 4BV2A 4LIPD 2YJNA 2VL7A 2WIDA 3Q5DA 2IDKA 3TIVA 4C3VA 2RMKA 3DSRA 2JLUA 2JGDA 1GSOA 2XCSB 1FIUA 2QTLA 4DYHA 2WUGA 3R23A 3GDFA 5HBRA 2EQBA 1B41A 3EDRA 4XVUA 3TOSA 4EENA 2OE2A 4HC4A 4HYYA 2PS1A 2QN1A 3OLQA 1AKNA 4G4GA 5AKEA 3TIXB 4W9RA 1ZUWA 3MFQA 5CA0F 2P1RA 5K4GA 3QVJA 3EZ9A 2F1KA 2DKOA 1TMGE 1B7GO 4RQAA 4FR2A 3V4VB 3ZXYA 4UUAA 4X1YB 1B1AA 3T34A 3PD0A 1P1RA 2D3WA 3SS8A 3L8HA 1P0IA 3K0AB 2B3TA 4TMKA 2C99A 3BEOA 1VMDA 3DEAA 3Q7IA 3QTBA 5CNJA 5IK2A 3WGHA 5CFOA 5IC4A 3JU3A 4HZGA 3KR2A 2DX7A 5EJ8A 1SXJD 4FZRA 1FFSA 1O2DA 1V2GA 4NBKA 4EABA 3ZXIA 4P8RA 4QTZA 1G2QA 2ZJ3A 1ZRSA 2PT5A 4O2BF 3U61B 1DHTA 1U3CA 3FNEA 4ZAZA 3WLMA 1Q91A 5JS8A 4XA8A 4AB1A 5BN4A 3LP8A 2ORIA 3OZAA 3WDKA 5DI3B 2D2EA 1ZUIA 2W83A 4PIPA 4XKJA 2WW8A 4MK4A 5EFZA 4CM1A 2OV4A 2JAUA 4DLRA 4F9EA 5B3KA 3ND5A 1DAFA 3E6AA 4X1KA 2H5JA 3RC2A 3TXYA 3ESRA 5DRTA 4DCVA 2Y1XA 4DJEC 5HXAA 1AO0A 1SXIA 2NU9B 4CQJA 5TT1A 1OWNA 1DDOA 4XZ3A 3OTGA 3DCYA 1I1OA 1KHTA 1VIMA 2FW7A 2SKDA 2EU8A 4R7ZA 4AMYA 5EE3A 2XPCA 1JT2A 1XU7A 3LLVA 3T35A 2XUFA 4KIGA 4Q21A 1RI2A 2HCRA 3GGSA 2PZJA 1AS2A 3O03A 2JZNA 1QRUA 2VDQB 5GP1A 5B53A 4ZHQA 4AS1A 1P0CA 3OEHA 4XPZA 3FBTA 1QP8A 1XR3A 3FYDA 4LRTB 4PQFA 1MGOA 5AKYA 3I8SA 3F5QA 1ZFNA 4P3XA 1M66A 3T5GA 2UU9B 3IEVA 2PLAA 5COAA 1GQYA 4US1R 3GVPA 2OGWA 3V7YA 1AVTA 5EE0A 2F3RA 5EGSA 4BFUA 4YRJA 1QC5B 3ONDA 2AW3A 3DVLA 2B1IA 2JFWA 1GWNA 2FPGB 3PGA1 1NKVA 1ORRA 1TL7C 1JHZA 3MLEA 1FDTA 4IJWA 4JXZA 1X1SA 5DCUA 3AVTA 1TW2A 4JH0A 2XXBA 2ZEJA 4QOIA 3GPCA 1HETA 1QH9A 2AYXA 2QT1A 3ZDEA 1Z2OX 4OYRA 3UM9A 4AJIA 3CF0A 3C6BA 2PUFA 2HMTA 2GZDA 3LYLA 1NF3A 3TOZA 1L7EA 3QUQA 1PR4A 1N2CB 3OCXA 4G67A 4IF4A 4CMKA 1KFBB 1GZ4A 2V3WA 2JLWA 1JH8A 3N0TA 3CZAA 1F12A 2O3JA 4TWBA 2X8JA 1GT6A 2OK7A 4YHBA 2WDPA 3RRFA 3PQEA 1CJBA 4Q3LA 5H9VA 3DEYX 3DYBA 2VYND 3O75A 3QVSA 4NZMA 1QGUB 3RANA 2NTVA 2AQ8A 2D00A 2Q2WA 4Z9AA 4GMXA 1E9EA 4PXSA 2BGNA 2F90A 1FU4A 3OX3A 1IVNA 4IW3B 4I4TA 2WHXA 3M1LA 4GW3A 1G0NA 2C4TA 4R84A 1LSJA 5I9SA 2GHTA 2WA2A 3OHMA 3I9KA 2R00A 4KKXB 4WUTA 5K3DA 1A9OA 4D4MA 5JDIA 5JZMA 5B4UA 5JCPA 2BE7A 4DWVA 1MX1A 1BRTA 2H4HA 3ZQKA 4A27A 4EM6A 4YXWA 3EHEA 5LYJF 2FWMX 3PQDA 5ITVA 2Y1WA 3AOGA 3C5VA 4ZA2A 3WKEA 5IJWA 2W2LA 4PWYA 1U7HA 5FHRA 2WVHA 3RI3A 3A7DA 4FOSA 5K3AA 3PC6A 1YZUA 1DKMA 1I3CA 1PFVA 2YY7A 1YIOA 4GQBA 1NJSA 4G85A 3CR3C 2FZ4A 2QAGA 2JB9A 3GZTB 1JHYA 1U1FA 3I6IA 4WMLA 4X6XA 1LK0A 3GB9A 2GYVA 1F6BA 4YV2A 1G8YA 3AKDA 3S27A 1IB0A 2KPOA 3AY0A 3G1TA 2VNIA 1G6Q1 4DUPA 2OY0A 1BFUA 3N75A 4YPVA 1RWQA 2HY7A 3FGPA 4LYYA 3LQ1A 3R8CA 2ES4A 3R44A 3OOEA 3TOXA 3HE3A 5F1KA 1KEVA 2PZKA 4L76A 4M0UA 4CR6A 3LQ4A 3VI4B 2IRWA 1HYGA 1Y9EA 1SUDA 2H06A 3PQ4A 5GY7A 5HYVA 4DQXA 1CUSA 1M1YA 3BD8A 5CX1B 1ZD1A 4U7HA 1RHQA 1BOOA 3QE2A 1UDCA 3ZE6A 1Z0KA 1EFDN 2A30A 3N07A 1JIKA 1WDLA 3N59A 2WHEA 3WRYC 5KTPA 1N5LA 3ZU6A 1JHAA 4FGJA 1GTRA 3VDRA 3PWSA 1J2UA 3GCWA 5F9HA 3FVVA 3R0ZA 3WRWA 1WUKS 2L69A 3LT5A 2G08A 2FVYA 4B44A 4LJSA 1JDNA 2ETXA 3IERA 3M9XA 2ODPA 4MH0R 4RENA 5TGZA 1G5TA 1MA0A 2VTVA 3HBMA 4EYOA 4CLXA 5A7GA 4B3RB 3JQ7B 3GZNB 3A2LA 1XPOA 1OFVA 4BQPA 2VOJA 3MGAA 4ZI7F 1QJCA 1Q0UA 1HTWA 3EZXA 4KQEA 3F3SA 3LTEA 1E69A 4FQ8A 4P1ZA 3BKXA 3Q5EA 4KLCA 3B78A 5CA0B 1TM1E 5BW8A 3HJCA 4FBMA 3DULA 2Y6VA 2A9QA 4TKLA 1EUDB 4X93A 1VCNA 3ER8A 4KTVE 1R8YA 1DX9A 2CLOB 4KJZA 2OCYC 4LZJA 1ZH2A 4R2IA 4IDOA 5DGDA 3ROQA 1CZLA 2AG6A 1XTUA 3F1LA 3HHPA 4TRJA 5KYXA 5F7JA 1ZK4A 3TVTA 3P27A 3OEYA 5FWDA 4RTMA 1G55A 1UINA 3ESZA 5FXMA 1FX0B 1RWBA 1VXOA 3JASA 3HEMA 1B0UA 4MAAA 3FWZA 4KNWA 5FLYA 3VRHA 1XRMA 3D6AA 2EP7A 3QG1A 1JG4A 3C3YA 3COJA 2FN9A 2XCOA 2I03A 3Q98A 4QOGA 3L6EA 3URMA 4D9CA 3P71T 2ZBGA 4O2BB 5AR1A 4DMFA 3BCHA 3RTCA 3STWA 5LWQA 1OLSB 1QE5A 3DAGA 4BXOB 2E4XA 4OHRA 4QHSA 1AV7A 2NXJA 2XMBA 4WNIA 5L3SA 1ISPA 3DBHA 4M87A 1B2LA 4QHTA 1Z2PX 1PN3A 1Q3HA 1ZU4A 1C3LA 2NLOA 3GJXC 1UC4B 1DQRA 2VUTA 3GN2A 3NEJA 3NRBA 1BXZA 4CKBB 4C0KA 5TEVA 5LJIA 2CL0X 1WRBA 3PR2B 2QJTA 4BKUA 4GO1A 4XRRA 2OV6A 1KRWA 2GBFA 1TC2A 2QTMA 1C9KA 3PNVA 5F51A 2H4XA 4Q6BA 5CVVA 3T3GA 2F6RA 3F6BX 1TRKA 2OCPA 1LF5A 2O5CA 3DM5A 2QIOA 3DR3A 3JQ9A 2FX5A 4IG9A 4PAGA 5ECWA 3ZHQA 3KZ1E 3PJGA 4UBLA 3CKLA 4KXYA 4ZGGA 1ZW6A 4J3JA 3H2IA 3T1VA 4KGZA 5A0FA 3R74A 2WSBA 3T4PA 3GUZA 3B1VA 2Q9UA 4P5PA 5KTYA 1D07A 1XK6A 3BZWA 1B8OA 1FQOA 1GNVA 2JIRA 3IBGA 3OETA 4K03A 4QYSA 4XSVA 4LYEA 3SOZA 1XTBA 2FK8A 3MMPA 5JJBA 1E62A 7ADHA 4ZKEA 5HS4A 1QM5A 2UZ0A 1KKUA 2QLMA 3WLFA 2H65A 2IE0A 2I7DA 3X1JA 1FA9A 2F00A 3CMCO 1SG6A 2JZCA 3PTLA 1JR3E 1QZZA 1APBA 2GETA 2VKQA 3DW3X 4ETNA 1NR5A 3R9WA 3JRXA 1DTWB 1IHXA 5I9BA 1V0JA 1P91A 4A1FA 1F2TA 3EXFB 3I42A 5LZ5A 2R6GA 1YJCA 2RGNA 4E5UA 2EFEB 4INJA 1N8SA 4NKRA 4IFTA 2VRBA 4YUAA 1E9RA 2BIFA 4V1CA 2ZRKA 3KQNA 1P9NA 4UARA 3K1TA 2GILA 1K5DA 1R0XA 3HZOA 3ONWA 2JCYA 1O5IA 3REQB 5ICMA 3C7TA 5D3QA 1JXOA 2A1IA 2PWPA 1FW8A 2FPLA 2V6GA 3QOXA 4EEZA 2FW0A 1CUVA 1PR9A 2FCAA 2WKSA 4F2GA 3OVMA 2BP7A 1E9VA 1Y9ZA 2HA7A 3GLHA 2BDEA 3GPDG 3MIIA 3DXFA 2Y0BA 1OFUX 1VL0A 2IZZA 1Z39A 1XZJA 3D8UA 3N3AC 2CNLA 1B8PA 4D46A 5EXPA 5BY2A 3EIFA 4RDXA 3HY3A 1WQ4A 2YRXA 1PLJA 3WA7A 5E6RA 1NMSA 3CKMA 3U4IA 2IXGA 3DWGA 4CHGA 1N0IA 2QR2A 3IP8A 4F7WA 5CA1A 4ZICA 5JJKA 4BU1A 3FYTA 4TKVB 2XOKD 4IX9A 2O2HA 1T2UA 3IULA 3K1AB 4DHWA 4H2DA 1PGPA 3NYQA 4COKA 1CF9A 2BFMA 3L8GA 3QF4A 2O2ZA 5HKLA 1D6MA 1A97A 4YJ3A 4LGCA 4P33A 3TLZA 3W5BA 3TI7A 4JSRA 1QQ5A 2E4VA 4D5EA 1ND5A 2AJLI 3QPAA 3U3XA 5LQKA 5JH7A 3OU7A 2EZUA 1FLNA 2J7KA 5LYJB 4LCJA 4ND8B 5F1YA 5JPDA 4YCMA 2I9KA 3ZY2A 4M86A 3L40A 1L7BA 2A67A 2OUKA 3NGXA 3U4HA 3K31A 5LIRA 2ZAOA 2Z08A 3KALA 4J0QA 3WLQA 1GUFA 3MYRA 3I1JA 3WB0A 5LPNA 1N9GB 2WUDA 1DEXA 5AOCA 1WHSB 4N7RA 2I6QA 3ES9A 3KQLA 4ZWNA 4M1YA 1F2VA 1YZHA 4YDSA 2HMWA 3N2KB 5I7RA 4G5OA 4LY6A 3UAVA 3KX2A 4L7VA 4TXLA 4Q00A 5DOVA 4C2BA 3O31A 5BMOA 4DL9A 2DPMA 1PFYA 2IE8A 3FH0A 4F8EA 3DF7A 1QB7A 4HKTA 1A4RA 4EG1A 3OEEA 3MB5A 2NVUA 4M8SA 2QRUA 3G8YA 1IN7A 2PNFA 2QZJA 3I9MA 4B4KA 4BNIA 3DPIA 4E5DA 1N2XA 5BUZA 5KTMA 2C7RA 1W6UA 1PG0A 3ETJA 3IX7A 4YMUA 2WU3A 4FMDB 2HHCA 2B2NA 1W5EA 4B48A 3M4XA 1ST3A 1GLVA 4HS9A 4DJJA 4FX5A 2QE7A 1NW6A 1MJNA 1Y63A 2G82A 3PUXA 4G65A 1QE3A 4BQQA 4Q6WA 3RS2A 3R76A 5K05A 4XIJA 4E11A 521PA 1Q12A 3EMVA 2P0EA 2ZVPX 3F47A 4S35A 4G81A 3HJGA 4I7EA 1GTVA 2QBYA 3EF1A 2CXPA 4W82A 3TQOA 2R5WA 4J49A 4YA6A 2HNAA 4MULA 4GWKA 4ZOAA 4C0AC 4ZN6A 1OWOA 4ZVTA 5K2MA 5GINE 1JJAA 4EAAA 3P9PA 3K5PA 2M2IA 3HHEA 2IV2X 1MC4A 3D0RA 5FL3A 1ZH4A 3THYA 4F2HA 1I24A 3GGGA 1P77A 3RB8A 4IM7A 4C14A 4BZQA 4TL9A 4G3XA 5IZCC 1E8DA 1ECJA 4JA2A 1ZLYA 2PKCA 5IT0A 3PEWA 1Q0HA 1DMSA 4WOKA 1I8TA 1LKZA 1OWLA 1Y8AA 3MJCA 4DCSA 4DJFC 1C0EA 4O3MA 1DJMA 1J70A 1JA9A 2GFIA 3A1EA 3A9RA 4I3GA 4UHCA 5ALEA 3ROEA 3CUUA 4LJ8A 4X97A 2HF9A 3NBKA 5D00A 2AOWA 4HQRA 4DSAA 2FUCA 1TZ2A 4IUDS 3JWIA 1KXJA 2PLFA 1E6UA 3OMWA 1K08A 2VOEA 3LGXA 4IH1A 4PQRA 3FCOA 4R0NA 3GLFE 2XVAA 4B47A 4KLAA 3RDPA 5ALHA 5ALDA 4YASA 4ZPXA 1BFKA 3CLTC 1XT6A 1Z13A 1PRYA 4DMCA 1LJUA 1IOZA 2P75A 3P0HA 5JD6A 2B21A 5HF9A 4CPDA 1L4EA 1MN6A 4E7PA 1Q3TA 3UHAA 2IIBA 3RS8A 5B12A 1ZMBA 2RHBA 2EF0A 2NZ2A 4DF3A 4Q34A 5DI9A 3ZWAA 4MP8A 5E8RA 2K87A 3WP1B 4O4HA 5BSTA 4CDRA 1ZR2A 5TS3A 1DWQA 2ZRHA 1L4GA 3VO9A 4Y2HA 2GA8A 4A2WA 4KRXA 4DDUA 4BP9A 1GV0A 5BURA 1PWZA 3HJRA 3SX4A 2B0CA 3BK1A 3W90A 4EGJA 3RYCB 1DJLA 2LW7A 3I0MA 1KYTA 3LX8A 1HBJA 4MPPA 1FE8A 3HUUA 2J4CA 4OMFG 3RIXA 3TEJA 3TRDA 4YO7A 4B4WA 7YASA 5MDHA 1MZPA 2NP6A 2XBLA 2ZB3A 2X6RA 1W35A 2Z04A 3LKZA 2QPAA 1IHPA 1BYUA 4B09A 2IU6A 3E7WA 3EW9A 3OM9A 4UCQA 3ESQA 1UXKA 2HSJA 2QYHA 4R2XA 3H2YA 4Y0NA 4CRWB 3QW2A 4L07A 1RRCA 2TS1A 3LVFO 1VSUA 1BHSA 5HF5A 2FPPB 3LCUA 1NRWA 2CKDA 4HG2A 4QGFA 4RMHA 5EAIA 2FMKA 3UPDA 4AJNA 2L19A 1HT2E 4AYXA 3Q5GA 3QEOA 1XDZA 2WB2A 4CTNA 3FRHA 1JFLA 2B36A 4RX1A 2JAWA 1PGNA 5E6UB 5LDGA 3AJRA 3HA3A 1ATZA 1TCBA 1WDTA 4GR4A 1UT5A 5IF9A 1U3DA 4RBNA 3EAQA 2J6IA 2OKCA 3STUA 4PRYA 3H11A 4PYNA 5EVJA 5NLLA 4X66B 3ZBTA 3ZXXA 2OT3B 4C6TB 1W30A 2CJXA 1GKLA 2Y27A 3AHCA 4FU0A 3L41A 4H08A 4J4HA 2EX0A 3CT6A 4QTTB 4AYWA 1KARA 2FMIA 1H69A 4MARA 1DSSG 3ADPA 4E33A 1OZ0A 1RHMA 5GPBA 1DUSA 3JQBC 4UVEA 3JZDA 3WR5A 3AI2A 4MMYB 1EUCB 5DX1A 5DM70 1HORA 4IQ8A 4E2WA 1N0HA 4NXNB 3I76A 2OO5A 3Q6NA 1OZHA 2VXBA 1FMFA 2B5VA 4YGYA 2BFFB 3DFMA 4KUGA 3LVQE 4YECA 5JALA 3DBRB 4OM8A 2Q1TA 4FT4A 1BWQA 2CMKA 4MS3B 3VX3A 2ZS9A 1NNEA 1BXGB 3U7HB 2ZUTA 1O97D 5TQ2B 2P2LA 1V5EA 3OQIB 3T7RA 3F1KA 2LD4A 1GSAA 5AVYA 1BEEA 1RRFA 1T2CA 5DWDA 2FRDA 4D81A 1BHQ1 1JQ3A 1Y8CA 4RD1A 4BMCA 2JL1A 1NN0A 5EWJB 4YCJA 1L5NA 1GA6A 3R7SA 1VGRA 5KYGA 3T1OA 1AXEA 4G5HA 3ROGA 3VC3A 1WHTB 2JJ1D 2YWRA 3EGCA 3IOBA 4HQ6A 2B2CA 5KVVA 1KPHA 4E2ZA 5KQSA 2C77A 3VNQA 3LUDA 4HI0E 1PT7A 3CZQA 3TDMA 1KQOA 4P3KA 5JDCC 3WX0A 1G59A 4OFZA 2VVTA 5K0JA 3R3JA 4UBJA 1Q1GA 2XAUA 2HREA 4OLJA 4C20A 4CM4A 4MYCA 3Q1KA 2COKA 3I1IA 3AVVA 3N2GA 2A92A 3HC7A 5C46F 5IUKC 2MYTA 2NNWB 4HNRA 3GA7A 5CYOA 4ZMSA 4HB3A 4QFCA 4ZAYA 2OLJA 3SEAA 1O4WA 3TNJA 4KQ6A 1QQ6A 5HUHA 4IMRA 1EAYA 3AESB 4D3SA 3ET4A 3H8VA 5TR9A 1HV8A 4IAOA 4QELA 2CXSA 3QKRA 2DLNA 1F60A 1N75A 1UUFA 2PMEA 2HEIA 4HLQB 3RBAA 3W9YA 3MHTA 1CC1S 1LX6A 3KL4A 1ZS9A 1W87A 2BEVB 1C3XA 3HY6A 1GQOA 3I01M 3PP8A 1FZTA 4AKGA 2EJUA 3GL9A 2M32A 1DUIA 1QB8A 3BXHA 2GYUA 2PD3A 4MA5A 4PN3A 4K0KB 4X3CA 2VF8A 3LYAA 3PVSA 2J87A 3QVTA 1SXJE 1NZDA 4ML3A 1KK0A 2HJGA 3N28A 4QWWA 3OKFA 1QIJA 4YDHB 4CEHA 2YHUA 2YIDA 1OZFA 3LXUX 2RG7A 1A7AA 2QTCA 1P2SA 1RAFA 2B7LA 2X1LA 3KKPA 2C0QA 4F1WA 4QOFA 4LNHA 1E6MA 3KZXA 1YRLA 2PH1A 3NEPX 3G0HA 1K6JA 4PLCA 2OYRA 1JXAA 3BCUA 3ANYB 2FZLA 3PEFA 3UMMA 1T6ZA 2GZRA 3FF4A 5CXUA 1QHFA 1KY3A 3PFGA 3GFOA 3LDAA 9LDTA 1JWAB 3D7RA 1P7WA 3FPLA 5EMKA 4K6CA 4MQBA 4X91A 3W5HA 3KFVA 3E7XA 5JD3A 2O0MA 3B1JA 1GGKA 3LUPA 5CAEA 5JECA 3RFCA 2A7QA 3ANSA 1AD2A 5B1HA 1YOVA 1GD1O 1OXXK 3IB6A 1SXJB 5H4HA 3SPXA 4MJXA 3FSEA 5E38A 3QKTA 4GUAA 4UBKA 2XCQA 4M0PA 3EAFA 5THQA 5CW1A 5A02A 3FNBA 4AXXA 4F4UA 3RRYA 1YZTA 4Z51A 1V37A 3G0DA 1ZVJA 1WXEA 2XMSA 4WESA 5DHRA 2X0EA 3COYA 3IUQA 1OTHA 2I76A 4UE2A 4YAJA 3SYLA 3RU3A 4OL9A 4XFJA 3P9ZA 4JKOA 1M73E 5FOQA 2OLEA 4G5QA 5BYKA 2REXB 1D04A 3KQQA 1UOPA 1R9JA 3A10A 1E1RA 4RA9B 5I7WA 5BSKA 2DXIA 1Q7GA 4IR7A 4K81B 3G2PA 4LHZA 3P2JA 1L5HB 2IXAA 2Z0MA 5AHWA 5C7YA 1XAHA 4P58A 5EC8A 1QH1A 2C58A 2E4AA 2JIPA 4KUEA 3IGFA 4GI3A 2XE8A 5KVAA 4PPYA 2D7DA 1TGVA 1UJMA 1U0RA 1TZCA 3G2IA 5KSWB 5EJMA 3T3EA 4BNUA 4GLJA 3EIUA 3FPHA 2PKWA 3G2OA 3I5UA 4J0HA 4RXTA 3FFXA 5EJ5A 4ZVOA 3P20A 1TT5A 2GASA 2WJJA 1I0ZA 1KP9A 3QPCA 4RV5A 4F3YA 3SKVA 3R5XA 5HDQA 3VBCA 3R6DA 1LC3A 1ORHA 3D3WB 3HDHA 3MJSA 5KYKA 2WT4A 2VEOA 3L79A 3F4BA 3FYSA 3V46A 4BX3A 1QRSA 5GADl 2DUNA 5EMHA 3SAJA 4OHMA 3NASA 2DOKA 5LNK1 3UJNA 4URXR 2VJCA 1LLUA 3BCRA 3VR2A 3SC6A 1QHSA 3TLMA 1MVNA 1U0NA 2FWNA 4QUAA 3C70A 3U1TA 2ZSIA 5AIAA 4MEJA 2RGRA 2FLWA 4QT0A 3CUEF 3BFKA 2NXCA 3V00A 4YFVA 1SK9A 3DLBA 5HE9A 3JR3A 2CL5A 1GN9A 4I14A 4CDNA 4DJTA 2EV9A 2OZPA 3NONA 4ER7A 4JI5B 3T1NA 4FYWA 2GUGA 4ERNA 5HHTA 3ODPA 1CR0A 1Y0BA 1PT9A 1VL8A 3SHVA 4EFKA 4F72A 4H7HA 1UQUA 1KR5A 3KTAB 4ZRDA 4X0EA 2G70A 1SB9A 1Z4PX 2HSEA 1KE2A 1Z2EA 5FUBA 1MH9A 4Q9LA 3WLHA 4HUQB 2RGWA 3PUJA 2WAXA 4IJKA 4JBYA 5KNLA 1NXOA 3SEZA 1YGPA 2WUFA 1P3Y1 4EKDA 1HQKA 1U28C 1NFRA 3SR3A 2PVCA 2G1PA 1MV5A 4C7XA 4RETA 1RLIA 4FJ2A 1U6IA 3UZUA 4PX3A 4RDHA 5G3ZA 1FCJA 1CZRA 4JYAB 2V5AA 2VSFA 2DBYA 2F67A 2ZDGA 5IJXA 3WB2A 5K0EA 1J97A 4C06A 5L3RA 1IHYA 4LGVA 4UBMA 1CS4C 5T3UA 1SCUB 3EG9B 4C0BA 4A9AA 1GYPA 5ICSA 2XNDA 4J16C 1X1RA 4D8VA 2P41A 3L0IB 3VSEA 4EAQA 3VSAA 1LW7A 4OX9Y 3PHCA 4RCVA 4K9LA 3TK1A 3UXHA 1ZK3A 2RH9B 1A96A 4G8BA 4MQ5A 1S7CA 2HJRA 3QHPA 5T64A 2C42A 3L0DA 5F2KA 4ZYWA 2DU8A 3HP7A 1RM3A 3DE4X 3B1KA 3PG5A 4RIHA 3R7BA 1YVUA 2B0JA 3K7EA 4R51A 1ISRA 2PX8A 4HTAA 5H3HA 2Q7XA 2X7HA 3FMVA 1JG6A 4R9NA 3T95A 2W2VA 4UTOA 4OHYA 2O05A 1PNVA 3ZGXA 2N0SA 4PSCA 2QMEA 3DMFA 3C1AA 4MGEA 2BR5A 2PLRA 3RJ9A 4AK9A 2RGGA 3H04A 3TZ6A 1XALA 3PXBA 4KQHA 5KMGB 1U80A 5JUWA 3DUFB 2BSQA 1JTVA 1RRGA 2JDID 3ZS9A 5G0WA 3PUIA 4QTXA 1GPLA 4B2LA 3Q72A 1TVMA 2WYIA 6PFKA 1NXTA 1RZRD 3RD5A 2Q5LA 5CX4A 2ECQA 3UFXA 1ZD9A 1NBMA 4LV8B 1LTKA 1Y33E 3W2GA 1GZDA 2PFSA 2VZ8A 4ZCLA 1Z5OA 3DP7A 1MGPA 2WFLA 3WMXA 4BO7A 3EY4A 3O5AA 1VM6A 4L4ZA 3D6JA 4TTTS 5KVQA 3TM5A 1MIOB 3LQFA 5CBPB 4E31A 5IP5A 3DMGA 4NMWA 4MTLA 2EJWA 1QX4A 1TJYA 2QAIA 2ZJ6A 4HNSA 2ZB4A 2ZUSA 4UREA 4EO4A