5KYKA

Covalent gtp-competitive inhibitors of kras g12c: guanosine bisphosphonate analogs
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
168
structure length
159
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDDSYRKQVVIDGETCLLDILDTAGQERDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title Covalent Guanosine Mimetic Inhibitors of G12C KRAS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 44
structure length 159
sequence length 168
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5kykA00
2YWEA 2Z6VA 3RC3A 1H8HD 1XEWY 4KSCA 5IK2D 1JR3E 4OHWA 3SYKA 1XP8A 3FHCB 1WA5A 1XX6A 4XJXA 3TRFA 1Q22A 5CLLA 3LQRA 4JL8A 5JMTA 4EFLA 2AFIE 2Z0MA 4ZI2A 2QTFA 2J0VA 5FH9A 1P6XA 1G3UA 3QQ5A 4CZ2A 3X1YA 2MMGA 1J99A 2QRZA 1T91A 4R2IA 1PZNA 1ZC3A 2AXNA 2FV8A 3CM0A 4H9GA 5F9HA 3FKQA 2ZRAA 4B73A 1OXTA 4LYJA 1W36B 1KSFX 2YNMA 4JYCA 4R7ZA 4PC7A 4AY2A 2ZYTX 2HEIA 2P2LA 3NKVA 1IN8A 1D5CA 2QROA 2ORVA 2ZRLA 3KJGA 4JT2A 1GUAA 4HLUC 4PR0A 4MYCA 3IPYA 4PHGA 3KKNA 4Y0AA 1MOZA 2NO6A 3A6PC 2P3SA 3P4YA 2YJTD 4JVSB 4NCKA 4DXAA 3KZ1E 2Q9BA 4ITRC 3LBHA 4TLEA 5AUPB 1AGPA 3AF1A 3TVTA 1TTTA 1G3RA 2CL0X 1SVSA 1Z5ZA 2NIPA 3B6EA 3HYTA 2WJGA 3QENA 3DKPA 3B1XA 3MMPA 1ZYUA 3ZIAA 1U90A 1T0JB 1H8HA 4LC0A 4U5XA 3QG1A 1GAJA 4TYNA 1NVVQ 5GJCA 3IUYA 1W48A 3SHFA 2GWHA 2IS1A 3C5CA 4MKIA 1OJLA 1VCNA 3SBDA 1NBMA 2PEYA 3L43A 4MITA 4URUR 3KB1A 3MFYA 1A2KC 1VECA 2MSCB 3EAQA 4LJ5A 5KNDA 4JLMA 4FD2A 3VMFA 3KKQA 3NBYC 3EWSA 3T5DA 1G4UR 3LBIA 3W8RA 4JVLA 3CIOA 5FBWB 4IXNA 1AQUA 3IO3A 3Q85A 2JJ2A 4PC1A 2OFWA 2CMKA 2GVDC 5KTYA 1S9HA 1QHGA 2WV9A 2CDNA 2J0UA 4DDVA 2DYKA 4E09A 4GI7A 3WRYC 2ZYUX 2MMCA 2VHCA 4GT1A 1EFRA 1R10A 2BM0A 3ADCA 2XSZD 4JJKA 3DHWC 4YXWD 2VHUA 2JCSA 2WPDD 2J0UB 4B33A 2WSMA 4Q7LA 5KSOA 3PUWA 2B8TA 1YR6A 3CH5A 3FPAA 5CIQA 1ETUA 2PH1A 1HE8B 2FZ4A 1AKEA 1VDZA 2RGGA 1UEJA 4UNSA 3QBTA 5B57C 1QHHA 2GAAA 3SHWA 3VR6A 4QM6A 421PA 4DUGD 1JAIA 1R5OA 1GSIA 1OYYA 1M8PA 4ESHA 1S96A 2XX3A 3EIQA 1N5IA 4RY2A 1JBKA 3GLIE 4WXPA 1Z0IA 1ZNXA 1GRNA 1QHXA 1E2IA 3T61A 2DR3A 3CPHA 1OW3B 2QPTA 3KUDA 4ABYA 1QHHB 5D3MA 1IJEA 4IRUB 1VG1A 2QSYA 4W7SA 3RRZA 4P4TA 4AURA 4B3DA 3V4RA 4OQMA 2EQBA 4LGMA 1U2RA 2VHTA 3QIAA 3C41J 3TR5A 1OIXA 1OV4A 2IYVA 4GL2A 2W6JA 4LWZA 2ZIAA 4HYYA 1XTIA 4W5HA 2CHGA 2ZVQX 5LBIA 5D3MB 1R8SA 2VSOA 5G3YA 3B1VA 4U02A 4LBVA 3TSOA 2GXSA 4HATA 3AGPA 3OIWA 1G5RA 4B71A 1VG8A 2KWIA 5KUTA 2JLYA 3ZD6A 2QG6A 1EX7A 5HE9A 4TQAA 1Z2AA 3AKDA 1BMFD 4EPXA 2YWHA 5FBVB 4PO8A 2FSGA 1X8LA 4M9XA 1CXZA 3GJXC 5AUNB 4I1SA 4QJ3A 2AKAB 1KK2A 1DAIA 4Z54A 4BPBA 1UPTA 3QPWA 4JLDA 2LWIA 4HZUA 1U8AA 1OH7A 1N2CE 1JXMA 4H1UA 2H7VA 2VA8A 5DE3A 4LBYA 4RFVA 4CEIA 2WSSD 1T3SA 2ZJAA 4EPVA 2QSZA 4FINA 4Y0VA 4KVGA 1J7KA 5JJKA 5CDFA 4C0KA 4BZPA 4HZUB 1Z47A 2P6UA 5FL7A 3VNVA 1ZJ6A 1Z0KA 1U8ZA 2OAQ1 4CEIB 3I3SR 4NDZA 3GLGA 2FSHA 4G1UC 1IN4A 1FL9A 1I2MA 1A1VA 2ZU0C 2VTKA 4PAQA 4Z51A 2GXUA 3ADBA 4YMUA 2P0EA 3FKSD 1Q3TA 1NI3A 5FI0B 3B7GA 3VX4A 1ZD1A 1VYTA 2REOA 5G40A 5JCZA 4A0FA 1CTQA 2FE4A 3WY9A 2QGZA 1XD2A 5A5GA 4Q4AA 3I61A 5ELXA 4POAA 3GLGB 4X8MA 2C77A 3DMNA 5C46F 2J41A 4AKEA 2QEQA 4KO8A 3VAAA 3I4LA 5LB2A 4ZIRB 3OIVA 4A9AA 4WZ6A 2WJVA 4NHOA 5H70A 5K8TA 4PSAA 3QUSA 2XGJA 2R6CA 3D3QA 4Q4LA 2ONKA 1XD2B 4HB4A 3ZZ0A 3I8SA 4RKFA 4US2R 5J4HA 4B6EA 1W7AA 2VSFA 4QNRA 4LY6A 1Z2CA 221PA 4M8NE 3SJCA 5HKKA 1YHNA 3OIUA 1RYHA 3BGWA 5F9FA 3QPUA 3ND8A 1X1RA 1HH4A 4BFVA 2ZR9A 5HZKA 5D3QA 1R0XA 4EFNA 4H1VA 4HUQA 4MDFA 1EESA 5JLJA 1HQCA 1N6OA 3ND9A 2IX3A 2V3CC 2NMVA 4EFMA 4KXFB 3RNLA 3LA6A 2KBEA 5JBQA 5HTKA 2G6BA 4A2QA 5HPYB 2WIAA 1X8JA 1Y63A 4RFSA 5B2ZA 4DLXA 1KSHA 1N6LA 2FG5A 2D7CA 1R2QA 3QXHA 4TTQA 4TT3A 1N3BA 5HCIA 4R2HA 3CB4A 5TV2A 2JLXA 3T15A 3H4MA 1AGRA 4BRUA 1Q1ZA 2JGNA 4TMZA 1J70A 2P5TB 1ZIOA 3KQHA 2IEZA 4ACAA 3X2SA 1DG1G 2UVQA 4RFSB 1KAOA 4A2PA 4Q9KA 3KQUA 1WP9A 2EWWA 2ZJBA 4M21A 1COWA 3ZS9A 3EPJA 3BK7A 5HZHA 2JJ8A 4I4LA 2PBRA 5JEDA 2P6NA 2YOHA 3C14C 4TTPA 2GHIA 1EFHA 3LX5A 1D6JA 3BERA 5FOVA 5H68A 4CDGA 1GKYA 2Z5FA 4KFSA 2PLRA 3PG5A 2YOFA 2IS6A 1A5TA 5CITA 2P5SA 1W0KD 4US1R 2WWYA 1G20E 1A82A 1QHSA 5E7JA 3W3AA 3NH6A 4KJZA 4K46A 1MRSA 2XB4A 4OBEA 2FJUA 1VHTA 3FHTA 4II7A 3B9PA 5JRJA 1VG0B 1Z0AA 3CX7A 1JR3D 5JS8A 2QBYA 1W36C 5LD2B 5JZVA 4MGYR 5CM9C 2IYZA 1DEKA 1VHLA 3NIBA 4HAZA 5TXGA 3QF7A 621PA 3NH9A 3W5JA 3WHKA 5JJIA 1R0YA 5IT5A 2RGNC 4UXIA 2B8WA 2UZ3A 3K09A 1CRQA 3LW8A 2BMEA 1HQYE 3TNFA 4TL6A 3O8DA 3L0SA 3LQQA 1ZM2A 1L2TA 2ZITA 3OHMA 3TJZA 3C8UA 1XTKA 3VR5A 4DLYA 3SOPA 2V55B 5JHGB 5KDOA 1Q1BA 1TNDA 3IIMA 1A2BA 521PA 3A4MA 3KFXA 3K0CC 2SHKA 1I2DA 3B1WA 5CYOA 2ZYWX 1S4QA 4C3ZA 3SU8A 4Q4JA 1OFTA 1QG2A 1E1QA 4XSHA 2RGCA 4GP6A 5E4FA 1UKYA 1OIWA 1CBUA 4G3XA 1CRPA 5C1BA 4LBZA 3ZVLA 1Q21A 2W2VA 5UKDA 4AD8A 4DCUA 5DI3A 4BFWA 2Q3HA 2ZJ8A 3RS0A 4B3FX 2H1LA 4DKXA 2BMDA 4JVMA 4GNKA 2B7BA 2IA5A 5E95A 1NVVR 4ZO4A 5A0FA 2ZS8A 3E70C 2UKDA 3IIJA 4FMBB 4EJSA 1E79D 4F4JA 3M1IA 4ASUA 2QNRA 4Q7KA 2GTPA 5DI3B 4IOKA 2RCNA 3BFKA 4OI0A 4TMTA 2AL7A 4RD3A 5HE8A 1TF2A 4BZXA 3GEHA 4P32A 4PQYA 4OHYA 4A6PA 5AUOB 4EJSB 2VEDA 3I8XA 1E2FA 1G19A 1WRBA 3FFAA 2R9VA 2F1IA 5EJEA 1OKKA 4JLKA 1F60A 2CE2X 1R4AA 1U0LA 4X8OA 5ANRB 4NU0A 2KB0A 4OK3A 3PITA 2B7CA 4LHZA 3LXXA 3IQWA 2OSBA 2ZRNA 3SE0A 1UKZA 1E2MA 5BN5A 4A1FA 5GADl 4N0EA 1KKLA 3GD7A 1E98A 4LRWA 3P4XA 4TL7A 2EFHB 1G8HA 2ODWA 2I1QA 4D4JA 5JJLA 1FUUA 3M0EA 1OYWA 2BHRA 3U7GA 1KZ7B 3EX7C 3EIHA 2BM1A 1XBTA 4NZYA 1KY2A 3K0FA 1LTQA 2QM8A 4LYAA 3Q7PA 3AM1A 4Q47A 4XD7D 5LB4A 4TSFD 2G83A 4TMKA 2IYQA 4V0LA 3KXKA 1BYIA 3ZYCA 2Q9CA 5FPYA 3WMEA 4MGIR 1TUIA 3JVVA 1KSJA 2ZUCA 4MYHA 3K0EA 2ZEJA 1LVGA 3B60A 3U2QA 1NJGA 4M1WA 3TBKA 2Q6TA 4LYHA 2A5DA 4LC1A 4UNNA 4F38A 1T9HA 3UXMA 3R8CA 1AQYA 3PEYA 1YQTA 2HV8A 4HI0E 4TLAA 1M6NA 4E22A 3HPQA 2DBYA 1E9AA 3AKYA 2UZIR 1XU4A 4IDPA 4OI2A 1WBBA 4NBSA 1N0UA 4DSUA 3O8RA 2QQEA 1KI8A 4ZI3A 3WYFA 3G82C 5L3RA 3RC8A 4R71A 4F7WA 1Z06A 1FQKA 5EXXA 4F4IA 2NO1A 3OE7D 4UQOA 3SI7A 3KB2A 4PX9A 1MO6A 2CVFA 3HR7A 3RABA 1HV8A 3HDTA 3BB1A 3TUJC 1OXSC 4PHHA 4FMCB 5BN3A 4HDOB 3HPRA 4ERNA 1DTSA 2OAP1 2QAGA 4E07A 3EXAA 3RRMA 2OESA 1BYUA 2JLRA 5BQ5A 1K8RA 4G01B 4MH0R 1YZLA 1EFUA 4FMDB 1UJ2A 2VF7A 1G3IA 1PLJA 3GLIA 1ZVQA 1Z6XA 1CF4A 2GA8A 1EX6A 4KI0A 4D80A 4DB4A 2QT1A 4ILEA 2QAGB 2BMFA 5K8LA 2O8EB 1TL7C 5BN4A 2O8CA 2ANBA 3NVAA 1FFHA 4HLQB 4KLZA 4HLCA 4NMMA 2DFKB 1AKYA 5AJWA 1BOFA 5FI1B 3T1TA 3PUVA 1PV4A 3GLIB 4CF7A 2J7PD 1W0JD 1G8PA 3R9WA 4KSBA 1MKYA 1KZGB 1GILA 3VR3A 2PJRA 3RVBA 2O8CB 1GOTA 3VR1A 3W9YA 2IT1A 4BLOA 4RD2A 5IDVA 4GPTA 3L8ZA 1LV7A 2Z83A 3D31A 2DY1A 3EZ2A 4C9BA 5FR2A 1Q1EA 3O47A 2OEPA 5CJPA 4BASA 2JLZA 2X77A 3GMTA 4YMVA 3AVQA 3CLVA 2A5YB 1G3MA 3EPHA 2JDIA 1AZTA 1G21E 3BBPA 4B3GA 1JECA 2OCPA 2RHDA 2V7QA 2AWNA 2GESA 2ZRCA 4PO9A 3BB4A 1P2SA 2W0MA 4DZZA 721PA 4Q1CA 1Z0FA 4B32A 1OFHA 1XCGB 2QRNA 1HA3A 2V4ZA 1FZQA 2K5UA 2MSEB 2C9CA 2PZFA 3AKCA 3HJNA 3DO6A 1ESNA 3SFVA 3MJHA 1HUQA 3HYRA 2YVUA 2WKRA 2JEOA 2X2EA 3GJ5A 4U00A 3CRW1 4PO1A 2CL7X 2VP4A 1N6NA 4ZCMA 1W36D 2VHJA 2WTUA 2BDTA 5C4MA 3E1SA 1WMSA 2REBA 4X8LA 5CK5A 3ZVMA 1D9XA 2XEXA 4CVNA 4EPTA 3EC2A 4JJZA 4LX0A 2IYYA 4TMVA 1AK2A 3Q72A 1JAHA 2FMXA 1NMYA 1ZW6A 2DHRA 2ZRBA 3K0AA 4O0MA 2W6IA 1E9BA 4C4PA 3VKGA 4RJLA 3RYTC 1YVDA 5EP4A 1U81A 2EWVA 4QM7A 4WW0A 4P4UA 2VP6A 1NIPA 4M1MA 3DOEA 3ZZTA 2WWIA 4Q18A 3SS8A 2ZETA 1ZNWA 3AH8A 2ZREA 3K0AB 5TY0A 5FUYA 1MO3A 3JZAA 2ASEA 2QQ0A 3LRPA 1FNNA 1UAAA 2CHVA 4UNRA 4TMWA 5LD2C 4RCZA 4IVQA 2IYXA 2EVWX 2J59A 4JVNA 4L5BA 2B21A 2YHSA 2XITA 4TMXA 3R7WA 2H92A 1E3MA 2DPXA 1PLLA 4ZCIA 3SYLA 1NY5A 4X8HA 3RS3A 1Z0JA 3ZIAD 3KDSE 1SHKA 4FCVA 4JLVA 2YV5A 2CJWA 1OPXA 1XB2A 1G8YA 3BXZA 1VCOA 3VQTA 4BFUA 1VKJA 3GLFA 1S8FA 1B23P 2QN6A 3R7WB 1CJVC 2EFCB 3QEJA 1OLOA 1E2DA 3N70A 1U9IC 3PXGA 5BW8A 1NBMD 1PUIA 2IF2A 3FGNA 1SXJA 4N1AA 4GBMA 2G0NA 3K09C 2CLSA 3KKPA 2BEKA 2HCBA 2CJWB 4RD4A 5EUMA 1LS6A 1P60A 3GLFB 1ZNZA 1KI2A 3AVPA 4KLNA 5FBLB 4BLQA 3M4YA 5H1YA 1JNYA 2CVHA 2WKQA 1G18A 1O87A 1RFLA 4QGGA 3WYAA 1PJRA 2JLUA 2JJ2D 2GZDA 3AUXA 1DAHA 2FWRA 3OF5A 4K8OA 3HR8A 1LS1A 2DFLA 3QXXA 3T1QA 2A30A 4JYBA 4OHVA 4IDQA 2QZ4A 1RRPA 2R44A 4DCTA 1MABA 4C2TA 1EFRD 5EE9A 4DWJA 1QVAA 4G5RA 1G5PA 1NN0A 3TAUA 3TMKA 2OCAA 2W00A 4YQFA 1ZD9A 4HLDA 1Z3IX 2ZYVX 2C95A 1NMZA 2QAJA 3SJAA 2GJ9A 1M2OB 1MABB 5TARA 1D2EA 1CJKC 1SKQA 2R8RA 5DYIA 1ZD8A 2GEUA 2YZ2A 1F2UA 1TU3A 3A58B 3IHWA 4KYUA 1II0A 4NH0A 3QI2A 2FFAA 4G5QA 2VP2A 1KDOA 1G7TA 1ODFA 3W5IA 4GOJA 4PHFA 4DDTA 5FOUA 3DZDA 5FR1A 3UWOA 4DIDA 2FEOA 4I99A 1W1WA 4PANA 4RKEA 1I4DD 2GETA 5KOYA 4Z8XA 1G7RA 1MRNA 4HAXA 1KNQA 2GRJA 1F2UB 3I5XA 1DE0A 4FXPA 3CF2A 1Q1QA 5AJVB 3QVVA 4CEHA 3TUZC 2ZUDA 3GCGA 2FDCA 2ZJYA 4O3MA 4PHTA 1E0KA 3NBZC 5DN6A 1KYIA 4V0NA 2W6JD 2ZSEA 4D0GA 2WKPA 3IBYA 1AS2A 1W46A 2CXXA 1OSNA 3O8BA 3EZ6A 4LPKA 1E69A 1S1MA 2ZJZA 3N5CA 4PAOA 4AWXA 3IEUA 3I73A 1ZNYA 3A8TA 3RS2A 1IN5A 3X1XA 4EKDA 4CEHB 4Q19A 2ANCA 2D3WA 1FOEB 2IXGA 2NO9A 3PEVA 4LHYA 4NPHA 4Q01A 5KPJA 2O8BA 1KNXA 4XVQA 1NG1A 1NVUQ 1GVNB 3ICEA 2GZAA 1P9RA 1Z28A 2AD5A 3OEHA 2F1JA 2FSFA 2YC2C 4P31A 1KI1A 2IUUA 2AR7A 1R7RA 1SVWA 4WOPA 2R62A 1E2JA 3MRSA 4RD0A 4CT5A 2NPIA 1W4BA 2FGKA 1HEIA 1DBSA 3FMPB 4JIMA 2JLVA 4DBLC 1TUEA 4S2EA 2O8BB 1E1RA 2QP9X 1VYUA 3CNNA 4NCJA 3RS5A 2C9YA 4KAXA 3UKDA 1YJ5A 4JBYA 1NY6A 4Q7JB 1NN1A 5DNYB 3WNBA 2IYWA 2YWFA 3EARA 1U94A 1XMSA 1DPFA 1XDBA 5FL7D 2CCKA 2I1VB 3AF3A 3ZS8A 4A15A 2BKEA 3RAPR 3KJIA 3FE2A 1FNMA 4Q00A 4QRHA 5JWOA 4ESVA 1T8TA 4PZZA 1KMQA 4Q02A 4M53A 4HSEA 4QNMA 4TWZA 2JIZA 4UJ5A 4MRRA 4BLSA 2ZUBA 1V5WA 1VYVA 2IXFA 2BJWA 3AUYA 1GWNA 3L0PA 2HF8A 4V03A 821PA 1IN7A 2NQ2C 3U7FB 3GJ6A 2WOJA 2P65A 1RRGA 2OFOA 3A1VA 1RVDA 5HR5A 3C7KA 2C96A 4BZQA 5SZKB 2X19A 1FQJA 5CYPA 3QF4A 1W2HA 3VHLB 3SQWA 1CJUC 3NTUA 2X2FA 4Q1DA 4B3XA 1CEEA 1R0WA 1AIPA 1N25A 2Y8EA 2WJHA 3CRQA 5JWRA 2QAGC 2L0XA 5HKKD 2FEMA 1NN3A 2VP0A 2ZI5A 3SQXA 2AXPA 4UXHA 3REGA 1TMKA 1DS6A 1QBKC 3I72A 1CIPA 2IS2A 3ZVRA 3ZVNA 2C2HA 3CRVA 3QXCA 1MH1A 1S1CA 3K9LA 1G6OA 3PEUA 1DAKA 3RANA 1H8EA 1Q3HA 2JAQA 1IXSB 3K1JA 1G41A 1U8YA 5H8WA 1T6NA 3BJIC 3DL0A 1PUJA 2PCJA 3CNLA 3U44A 4LOAA 2C8VA 3A1TA 3TE6A 5G53C 3UPUA 1F3OA 2ZE8A 1YZTA 2GCOA 2PX0A 4C30A 2FFQA 2R2AA 4M9QA 2PT7A 2HYIC 3AKEA 2F9MA 1Q20A 3ZQ6A 4TT3D 1NLYA 1IY0A 4JKIA 4HB0A 4OHZA 4TYQA 4A4DA 4AYWA 1LY1A 1E4VA 2ZS9A 3U44B 2GJSA 2GZHA 3AQ4A 3L8YA 3LLMA 3PVSA 5F2EA 1XCPA 3NBFA 1G7CA 4URWR 2GCOB 1K6MA 3W6NA 1UBCA 1MT0A 2XNDA 1COWD 4LJ9A 4LJAA 3T5GA 3W6PA 3NHBA 3L0IB 1TADA 4YMTA 2IWHA 3MWYW 3QY0A 3QNUA 3EZ9A 1Z07A 2F3TA 2GCNA 3LV8A 4Q4AB 4XTRA 1SULA 2Q3FA 5FOWA 4A0HA 5IRCD 1HY3A 1NLZA 3UMSA 3THXA 3RRNA 4EIWA 2IUTA 3IHLA 3FHOA 2Q9AA 3B9QA 3E5HA 2OHFA 1HT2E 2I4IA 2EFGA 4LV8B 4QHYA 5JECA 2GK6A 1FMLA 2AHOA 3MJRA 3U3MA 4WZBE 5GJWC 1N0VC 4LHVA 1CULC 2AX4A 3SR0A 1C9KA 4QFMA 3UG6A 3PEWA 4JLPA 1ZAKA 1G9XA 2A78A 3H0KA 4F92B 1KI7A 1AA9A 2NG1A 2GBLC 1V43A 3WYGA 3KX2A 2BCJQ 2QT0A 3GLFE 1P9WA 3EW9A 5FTNA 3RWMB 2C03A 2JJ1A 2PX3A 4EQ6A 3TQCA 3H84A 1OB5A 3AEZA 2V54A 4M1KA 4OK6A 4D2IA 2QU8A 1G7SA 1XJQA 2RHMA 4LZZA 4OQXA 1SXJE 5IF9A 1M1YE 4PPFA 2J3EA 3CWZA 4HUQB 3SYNA 4TYYA 1XMVA 2WJIA 1AS3A 3I1FA 1OHHA 3LO5A 2QMOA 3VKWA 1X8KA 2C98A 1VG9B 3I32A 4B43A 3BFXA 5DH9A 1U99A 3GJ4A 3B5JA 4EQ6B 4AYXA 2C5LA 4IVRA 1E9SA 1ZU4A 3THOA 3MAAC 1Z63A 2BKUA 4DSTA 2WJYA 2ZVPX 1Z6YA 1RC8A 1JR6A 1R6BX 4HDQB 1ZUNB 2D2EA 4L9SA 4BEJA 1UDWA 2HT6A 4LHWA 4MYUA 3TLXA 4B34A 4RZ3A 3VTKA 4B2LA 4A8JA 1XTSA 4D25A 3WP1B 1E1QD 4DIEA 1E32A 3LAWA 2FGJA 5JEEA 2IW3A 2IYTA 5FUVA 4D6PA 3PENA 2ZANA 1ZC4A 3GJ7A 4A8JB 1TEVA 1SVKA 1WE2A 3U7HB 2GVZC 1KTVA 1UKVY 2ODNA 3GFPA 2CNWA 5J4KA 3B1YA 4Q5IA 4M2LA 2CL6X 4AG5A 2O5VA 3W34A 4ASUD 2RAPA 4KV9A 3E2IA 4N0DA 5SZHB 5E3HA 1EWRA 1E2PA 1P72A 3P32A 2ZJ5A 3GJ8A 2F43A 3CRMA 4F91B 4Z8YA 1M74A 4ZDKA 1RPZA 1BO6A 2OCBA 4UKDA 4B75A 3GEIA 2QBYB 2OZEA 2VYFA 2BBWA 3SBEA 4YDHB 1OKKD 4CYMA 3BB3A 1A4RA 4JBXA 4XWOA 3FMOB 2RGXA 3TR0A 2F43B 1FTSA 5JS7A 5KO2A 2NOAA 1RZ3A 3TH5A 1Q0UA 3OESA 3K9HA 4ARZA 2QE7D 3DM9B 3GLHE 3KQLA 2ZRIA 4WXRA 4Q7MB 3EG5A 2OBMA 2EYUA 2VPPA 4DCSA 3QKSA 2WWXA 1Y3AA 2RGBA 5DI9A 4BLPA 3W90A 4LDJA 3ZH9B 3AB3A 4O2RA 3U3KA 3DPUA 3PUXA 1ZU5A 2IUSA 1Z6GA 4M22A 2V1XA 5KNBA 1NVXQ 3LH5A 5E7MA 4Q4JB 4WZAE 2WIBA 3RRYA 2RGAA 3QKSB 5AJXA 4M1YA 4HLUA 2IYUA 4RD1A 4M4SA 2P6RA 1NL3A 5FOSA 4U7DA 4TZ6A 3LNCA 3RSOA 5CJ2A 3EIEA 4FIDA 4BGDA 1IXZA 2J1LA 2XTNA 3ZJYA 5JHHB 1R5BA 4GOXA 3HU1A 3K53A 4QKQA 2X8AA 2WWFA 4A0RA 1RKBA 4B3BA 1OH5A 3ECCA 5DIFA 4ZV4A 1JXOA 2EU8A 4KU4A 2XTZA 2EFEB 2PZEA 3R20A 3BC1A 4MQBA 2CLCX 2FH5B 2ZRJA 3HU3A 4DT1A 4KFUA 4L16A 1KJZA 2WAYA 4EDHA 4URXR 1KO1A 4DLVA 2E87A 2Q21A 3QXJA 1AM4D 1P9NA 2QE7A 4QHTA 2V8OA 3CPEA 1E2LA 3NEJA 4P0TA 2NPFA 3W8NA 4JL6A 1N5JA 1EFCA 4OI4A 3EA5A 1KJWA 4MA4A 4P33A 4DT1B 4C7OA 4GSYA 3AP2A 4Q1EA 2D4HA 2O0JA 3D8BA 1FP6A 3ADKA 4K81B 4MGZR 1T4GA 4XH9B 3SNHA 4TL9A 2LKDA 3GJ3A 1B0UA 4ZDWA 4DDWA 1CJTC 5F3WB 2F7SA 2HXYA 3DKVA 2GXQA 4JZKA 4AKGA 4D26A 1SZPA 4OYHA 4D4KA 2PL3A 2ATXA 2R6AA 4I1UA 4NYJQ 4C7OB 3I5YA 1SQ5A 2W2TA 4MGKR 1DG3A 3UMRA 3A1UA 4D82A 1QRAA 4FCWA 2QP3A 1GL9B 3B13B 4L8GA 5EUQB 2ZRMA 1OB2A 2NTYC 2ZSAA 1MR3F 3KKOA 3W6OA 1LNZA 1RRFA 1ZIPA 4CT4B 3K0FB 5CK4A 3U61B 4NYIQ 1BIFA 2F55A 2WMOB 4MRPA 3SZRA 2ZTSA 5GJVC 2N42A 3LVRE 3R9XA 1DAEA 1KDPA 5EXPA 4FMCF 3WMFA 2J7KA 5EXTA 1KKMA 4DCVA 1JB1A 1ZUHA 2QORA 3BH6A 5DHAA 2C99A 3G0HA 4JSYA 1QHNA 4FWIB 3ETLA 5DISB 2FA9A 1NG9A 2QMEA 3D7MA 2WICA 1E0AA 2IBMA 1KI3A 4V0OA 3F3YA 2J46A 3GJ0A 1WXQA 3H2YA 1OXXK 3T34A 4PAMA 2W2XA 2ZS7A 1SHZA 1DOAA 1ZRHA 4DSOA 2IYSA 1TPZA 2KI5A 2BBSA 2JLQA 2JDID 2XB2A 1FX0A 5C18A 4AC9A 1XJ0A 3VX3A 1IONA 2V7QD 4DDUA 4WIAA 2GNOA 2RGEA 4BRWA 4PTLA 5FTMA 4MKFA 4IOMA 1KOFA 4DLWA 2IYRA 1E99A 5BYJA 4B35A 3Q9LA 3RS7A 4B6FA 3L82B 2G1JA 4A92A 2OLKA 1FX0B 3OFNA 1E94E 4C2UA 1IAQA 4GFDA 3C4JA 5KYKA 2GAOA 2CHQA 2R6FA 2HYDA 1DVRA 4DLRA 3CONA 1G4AE 3UIEA 1NKSA 4LBWA 1SVLA 2D2FA 1QHIA 4TLBA 3X1ZA 2OO7A 1E9RA 3BIFA 1KO4A 2PLFA 4W5JA 3NC0C 2AK2A 2FU5C 4GMXA 1N5LA 2ZI9A 5GVRA 2H5EA 5EQTA 5EP1A 1F5NA 3VR4A 1R5NA 3CR7A 1NF3A 3ZLJA 2J0QA 3ZZUA 4BEBA 4B2IA 3QKUA 2JA1A 4LV6A 2IS4A 1AJEA 2H57A 3THYA 4L9WA 3AF0A 4JLOA 2W6ID 4Z1MA 2G1KA 2ZAMA 1YRAA 1YZKA 3ZDQA 5K8UA 2G0TA 3PCRB 4RCYA 1GKUB 1W4AA 5BYKA 3ASYA 1GG2A 1E4YA 3EPKA 5L8VA 3CO5A 1IM2A 3CPJB 3MSXA 3THYB 4XWAA 5FUXA 2XXAA 3AVVA 3A4NA 2R65A 1S9DA 2VRWA 1ELOA 2B92A 3B2EA 2B6HA 5FPHA 4B47A 2QI9C 4DB2A 2BJVA 1Z0DA 4LYFA 1IY2A 3CKLA 4RZUA 2IHYA 1G64A 4NYMQ 3RDPA 5EP2A 5KDDA 2XXAB 2GF9A 4NCIA 2EW1A 3TSWA 1CKEA 1G8GA 4EUNA 2OE2A 1EG7A 1CR0A 1UM8A 2TMKA 2F1HA 4PSVA 1QHYA 1ZINA 2F9LA 1ANKA 1TX4B 2FPLA 4URYR 3RHFA 3KJHA 2OG2A 1CR1A 2VIIA 1XPUA 1XZQA 1E2EA 5DYGA 1SXJD 2Z4RA 1BH2A 2OXCA 2PEZA 3EPLA 1CP2A 2GXAA 2R6DA 1IN6A 3EC1A 3BS4A 1DADA 4Q03A 3WNDA 2OILA 2DB3A 4PPGA 3FFBA 2GILA 1E6CA 2ZI7A 1JJVA 2DWPA 2F1RA 1PVOA 4EAQA 3KTAA 4M0LA 1VPLA 3CR8A 3A36A 3WRXC 2OLJA 4PSKA 2V6IA 5TDHA 1T8UA 3BE4A 2BIFA 1EXMA 3FTQA 4NE2A 4B3CA 2HT1A 4P4SA 3NXSA 1KI4A 2WWHA 1K5GA 3PIRA 4LJ7A 3DOFA 3VU9A 1EGAA 3OZXA 2LCFA 4TQ9A 3KTAB 1RIFA 5JI2E 3S1AA 4E03A 1M7BA 1VIAA 5FOXA 3T1OA 3V4FA 1UFQA 2ODBA 2VP5A 1P3JA 4P4SB 4M1SA 4LJ4A 2RKOA 2CE7A 4LPSA 3PUYA 4OK5A 4PXAA 5EE3A 3QKTA 3VU9B 2ECKA 2VSXA 2BWJA 4OQLA 4PC6A 2J45A 3CH4B 4YMSA 4Q1BA 4EPYA 1JJ7A 4MRNA 4ZDJA 3S1AB 5J47A 2JATA 1OF1A 4BUJA 1XFAA 2ZQ5A 1W44A 1NIJA 4V0MA 1T3LA 4M9SA 5A4JA 1KI6A 3OAAA 4KFRA 4LJ6A 4OJQA 2QMHA 2IL1A 4IFBA 2HXSA 4BQSA 1XZPA 1TEXA 1ZMXA 4NCNA 1RRCA 2CEAA 1W4RA 5JRZA 3K70D 4HAUA 2NGRA 4CW7A 3AVWA 1YR9A 5J4LA 4JKYA 1GITA 3EWAA 5E7IA 4MUBA 5KU1A 2ZRGA 4IFEA 4G5OA 4GRAA 2QM7A 1KI6B 5DN6D 1DELA 4KYIB 1SXJB 3K8YA 1KO8A 3PQCA 2ZU6A 1S3SA 2LKCA 1MO4A 5IHPA 2JLSA 4QJ5A 4BFSA 2C9OA 1BS1A 3NBXX 4N3NA 4FI3C 4DLSA 3U6BA 3GPLA 1NVWQ 3V00A 4C0SA 1KO7A 2RGNA 2H8KA 3TVDA 3NG1A 3SEAA 4Q9LA 1W4CA 1P75A 1XMJA 3KKMA 3U7EB 5LDDC 3OEHD 1XWIA 5JWHA 5CIWA 1J2JA 3IIKA 5KSZA 1HYQA 3AVTA 3BH0A 3CZQA 3U3RA 4LV5B 5FBRB 2R6GA 4G5SA 5FPSA 3K0CA 3P26A 2A5JA 3WP0A 3QXSA 4EJSC 1M34E 1IQPA 1E1RD 3LVQE 2CK3A 3NDPA 4OL0A 4IDOA 3IO5A 2QPAA 1PLKA 2ERXA 1SVMA 3EZ7A 1YKSA 2A5FA 2ZJ2A 1E9CA 1KSGA 3VKHA 2IXEA 4QGHA 1DO0A 2FPKA 4Q9HA 1EWQA 4AIIA 4I1OA 3B82A 2IYLD 2OCYC 2CLDX 4JL5A 2YWGA 1D2MA 3AVXA 1X3SA 1WBDA 3GFTA 2FFHA 4Q4HA 1IOZA 4DLZA 5KSYA 3CBQA 2ERYA 3ZQJA 2JIZD 5IK2A 1G16A 4MRSA 4EPWA 1KDRA 2V1UA 4P3YA 1N6PA 3Q8XB 3J81k 3K70B 1YZQA 1AZSC 1L8QA 3A1SA 2EYQA 4DEXA 1FMJA 1GZSA 3GLHA 3GQBA 4Q4HB 3AV0B 2G77B 4QG7A 1KY3A 4LJYA 4XTCS 4A2WA 3VFDA 2BVNA 4B2PA 4ACBA 4PC2A 2JLWA 1ZM9A 1US8A 5GVSA 3ZGXA 1R0ZA 3H1TA 3KQKA 1H65A 2FFBA 2ZRPA 2ZE7A 2ZI3A 3OIYA 4NYJR 5BWMA 2QPOA 4JMPA 3GLHB 3LD9A 3WHLA 3QVUA 3UATA 5FBQB 1KGDA 1TQ6A 3C16C 5KPDA 2ZR7A 5EE0A 1CU1A 1GFIA 4TZ0A 4OI1A 2QP4A 1US8B 3CNOA 2XZPA 1P4SA 3GFOA 4HUTA 2DWOA 4CGZA 2YC4C 5B64A 3FDIA 1P2TA 2IK8A 4NYIR 1LB1B 4BWYA 1XTQA 1H8ED 1E9EA 3LW7A 1M7HA 2Q0HA 4GOKA 4W5WA 5SZJA 1KK3A 2HUPA 4ZKEA 2FZLA 1E2KA 4Q21A 3N2IA 1KAGA 2PMKA 4L4UA 2ZAOA 3BWDD 3T35A 3PUZA 1E2NA 1W47A 2FSIA 3KL4A 3MGCA 2CBZA 2VLIA 1WQ1R 3GP8A 8OHMA 1N6KA 1XEXA 2ZI4A 1DARA 2A2ZA 4IKEA 2RMKA 1U0JA 4PFSA 3TKLA 3BD9A 1G8FA 2PZGA 3U6KA 2XNDD 2GJAA 1JEDA 1UKEA 4GMDA 4L15A 3DZ8A 5EZ6B 121PA 3CF0A 1E96A 1XEXB 3DEFA 4DC9A 2ZROA 4D0LB 4MKGA 3U5ZB 1S0UA 3TUIC 2FX3A 1E0JA 1S2MA 1TQDA 2ORWA 1TU4A 1VTKA 1GIAA 5JFGA 1P73A 2NO7A 1VMAA 3FMIA 4JLJA 4OJKA 4J0QA 3CX8A 3IKJA 2HJVA 1TF7A 2WVJA 3QF4B 2G9NA 3QG5A 2C78A 2A9KA 1O3YA 5DO9A 1YZUA 2AN9A 2XSZA 3N2EA 4MDEA 3NWJA 4YXWA 3AGQA 2ZI6A 2WHXA 2WPDA 2AD1A 1JPNA 1L4YA 1YRBA 2QUZA 4PZYA 1T5IA 3Q5EA 4BLRA 2JJ1D 4HAVA 4GZLA 1SKYE 1FUKA 4W9MC 1T3HA 3TK1A 2P67A 5EZ5A 2WWWA 4HDCA 1CR2A 5K8IA 3F0TA 2EFDB 4DUGA 2W0SA 1OHHD 1ZBDA 5TMPA 3VNUA 3ASZA 1NP6A 3KUCA 4TL8A 1RW4A 2GKSA 4R98A 1U0HC 1XD8A 3NHAA 5FTKA 4QGAA 4WBSA 1N6IA 4C0AC 4DRZA 4DCNA 1Z22A 4QBGB 3B85A 2BOVA 4B48A 5AJZA 4RSGA 3THWA 3RWOA 5AUQA 1Z8FA 1KDTA 4LCBA 4ZIRA 4OKSA 4AYTA 1Z83A 4TLDA 1F48A 3X1DA 1IY1A 1WCV1 2H18A 2HLDD 1XTRA 1XTJA 4C0QC 3UG7A 4ZPXA 2AFHE 3TW8B 2J0SA 1NJFA 2HF9A 4NYMR 1A7JA 2BCGY 4RD6A 3THWB 1DAGA 2OBLA 4DSNA 5BXQC 5EP3A 3U4QA 1XNJA 1XXHE 1XPOA 3R9IA 5C4GB 3THXB 4MYTA 4C0HA 2ZM5A 2OUKA 2VP9A 1KMHA 3LY5A 1OIVA 3QE0A 4NL4H 4Q48A 3SDZA 1BMFA 2CNWD 4YDSA 4AG6A 2PJZA 4HB2A 1ZCBA 5JCPA 4A36A 3EASA 3TIFA 4UNPA 1OFUX 3DMDA 3B1ZA 2GK7A 3BAFA 3P20A 3UMFA 1GL6A 2D62A 2ZRDA 4V0ME 4D0NA 3LBNA 3X1WA 3DDCA 3U4QB 2E1RA 1U98A 3W3ZB 2GDJA 3DVLA 1KMHB 4XVUA 4WAUA 2ONJA 4G0NA 2WSSA 5EE1A 3KQNA 5GJBA 4TTRA 1P5ZB 2REXB 2XJ9A 2WZQA 1P2UA 1IBRA 4XSGA 1G1MA 2ZRKA 4O2LA 1GKIA 3HWSA 4BFTA 3KFVA 2OM2A 4KBFA 2H17A 1G291 4LI0A 4AI6A 1QVRA 1E2GA 1II8A 4MKHA 2GCPA 1E9FA 3BORA 3T1VA 1XEWX 4XVRA 5G3ZA 1UF9A 5FL3A 2FPMA 3FKSA 4CIDA 1VCIA 4QOSA 4YMWA 2JASA 4C0BA 1YE8A 4AKHA 2HLDA 4V02A 2BBTA 1QG4A 2BMJA 1UADA 4TQUS 2W83A 1NN5A 2DCUA 1CJMA 1TQ2A 3LDAA 1II8B 1SVIA 3NC1C 4URZR 1M7GA 4TLCA 2D7DA 5TB5A 1R8QA 5M04A 1EFTA 4TYWA 4JT4A 5L3VA 2V6JA 1N6HA 1TF5A 2HJGA 4ZDIA 1GNQA 4RVCA 2FNAA 3IGFA 4DHEA 1GL7A 5DLQC 1CLUA 1F6BA 6Q21A 3LFUA 2I3BA 3CW2A 4M1TA 1P61B 2J5XA 4DJTA 1SXJC 4KODA 2BEJA 2V9PA 2A7QA 2OT3B 4TYPA 1D9ZA 1LFDB 4BFZA 1IHUA 2QA5A 3ONWA 4Q1FA 3CRRA 1UDXA 2XAUA 3LLUA 3MCAA 5J4YA 1W5TA 3K9NA 4GDFA 1HTWA 2DFTA 1N0WA 3UANA 3B8HA 4UXJA 4A0GA 4C0JA 2KBFA 1G3QA 1VIYA 3I62A 3GEEA 4GP7A 2N46A 5KHOC 5JSZA 2D74A 1J90A 3H86A 3HP1A 2W58A 4PPNA 1QF9A 4R9UC 1G17A 2YOGA 4YLGA 3IPXA 1NBME 4IW3B 1U9IA 3JZMA 3AVYA 4BLTA 5J40A 3VHXA 4KFTA 3NDBB 1LF0A 4IEIA 3EA0A 3DM5A 5JSZB 1TQ4A 2O0KA 3CX6A 4DLTA 3UK6A 4XOIA 4D81A 4ARZB 4OQFA 1BKDR 3FYHA 1QZXA 2YKGA 1J8YF 1JQJC 4WA7A 4QXAA 2WJJA 1Q57A 5CB6A 1QDEA 1RJ9A 4HZIA 1GP2A 1ZM4A 1NSTA 2RH5A 2PT5A 2DFNA 4IOJA 4V0KA 2WWGA 2ZSBA 1VCMA 4TN1A 1S3GA 4BE7B 4A82A 4KHZA 2HCJB 4LSGA 5AJYA 2X1VA 3KJEA 2GEDA 3EZFA 1W0KA 1UBFA 3A4LA 2PMDA 4MRVA 2IWRA 3UWKA 3ICQB 3K70C 1RJ9B 4HB3A 4PZLA 3C5HA 3LWNA 3SN6A 4NP6A 1OE0A 3AF2A 1SVOA 2QL6A 4E5UA 2C04A 1F2TA 1XF9A 5DHFA 1IJFA 1ESMA 1JR3A 2GEVA 5DSZA 1GRRA 4YONB 1TAGA 3MD0A 5J4VA 2XZLA 2ZSFA 3PJRA 2GJKA 3MLEA 3IBGA 1Z6AA 1EK0A 3ZD7A 3AVUA 3A1WA 4KCGA 4HAYA 1F2TB 4IJMA 2FN4A 2XOKD 4HAWA 2J9RA 4KITB 2YYZA 3IQXA 4JLBA 3I92A 1LW7A 4DEYA 4F93B 1MO5A 1OH6A 1DAMA 2Z4SA 5LPNA 1E0SA 3SJBA 1UEIA 3D6TB 3Q5DA 3PR1A 3SFZA 1ZP6A 4NKRA 5CB8A 1E2QA 2BBOA 5L3SA 1Z6TA 4JLAA 2O8DA 1HE1C 4D4LA 5FTLA 2Z43A 3TAHA 4BFXA 1Z29A 2ZRHA 2CCJA 2HDNB 1KIMA 3AVOA 3LXRA 4URVR 3NEYA 4IVPA 4B44A 5AK0A 1OXUA 3T12A 3QBVA 3WXMA 3V9PA 4QGFA 4DLUA 5F98A 1WF3A 2F3RA 3OFND 4XIGS 2VBCA 5L3SB 2O8DB 5FFMA 1FTNA 3BH7A 4D4MA 1GNRA 1T5LA 5B30A 1Z08A 3FMFA 2KJQA 2ZRFA 2DWQA 2ORIA 1SGWA 3PFIA 3QEOA 1J8MF 1JQLB 3RS4A 2QTVB 3QSYA 1NSFA 1FP7A 1E79A 4QBHA 4NTZA 4JLNA 1KI9A 4FMDF 2ZXUA 5CDFE 2WMNB 3KXIA 5TVKA 4Z1MD 4ZCLA 2BV3A 3TSZA 3MWKA 4JS0A 1ZUIA 2XOKA 1OH8A 1G5TA 3L0OA 3GLGE 3MUFA 2GF0A 4IDHA 4HEJA 1NRJB 3P27A 4FN5A 5FOTA 2ZE5A 2KE5A 4IEEA 1WDTA 2G88A 5SZIA 4KVAA 3WMGA 1E9DA 1GNPA 4UJ3A 3B78A 4PQFA 1XD9A 3SC3A 2BC9A 1C4OA 1D2NA 3QOFA 5B58C 3BFVA 1I4TD 3FWYA 3OEED 5L3QA 1JALA 1XJCA 3TGPA 1ZM3A 3U60B 3IEVA 5EE5B 1RE0A 2OBNA 2Q3MA 1X1SA 1D8TA 3REFA 3BRWD 3K0SA 4IDNA 2OXRA 1XEFA 1P7CA 2FF7A 3TW4A 5JI3E 2D06A 3O8CA 2O8FA 4QC2A 1IXRC 4KBGA 1WB9A 1ZM7A 3BOSA 5L3QB 4ON9A 4PPQA 1HURA 3Q7QA 1XPRA 4BECA 3MWLA 5DGXA 2WM9B 2VHQA 4Q9IA 4Q1AA 1JEEA 3P1JA 2XJ4A 1ONBA 2QGNA 4C0LA 2O8EA 4G5GA 2O8FB 5KNCA 2YINC 2WOOA 1OFIA 2ZR0A 4XD7A 1GDDA 1W5SA 2VH5R 4TSFA 2E9SA 4RZXA 1N5KA 4F4CA 1AN0A 4Q66C 4NCHA 2N1BA 4BFYA 3FOZA 4B74A 1AS0A 4QL3A 3QPVA 4QBFA 1YR8A 5KSPA 2IF0A 2RGDA 1W2GA 4UNQA 3FB4A 1L7VC 1XCMA 4FWTA 4B76A 1OXVA 2NZ8A 2WBLC 4I81A 3CUEF 2VO1A 4QJ4A 1X86B 3F5FA 2G3YA 2IEYA 4QBIA 5FPKA 3OEEA 1G6HA 2WAXA 1JPJA 1Q44A 3QKRA 3CZPA 1FW6A 5AR1A 4CEJA 5J5CA 4DVGA 3TQFA 3Q3JB 1KJYA 3CWQA 3A37A 4O25A 1YZNA 3K9GA 1FPMA 2XTMA 1P2VA 2IC5A 2A5GA 5EXSA 3AP3A 5C2JB 1T0HB 4LHXA 2ZPTX 4YC7A 3U3OA 2QENA 4OHXA 1Q12A 1GRQA 1I4LD 3C15C 3QKRB 1KHTA 3OE7A 4FW9A 2O52A 2ZE6A 4FCTA 3SJZA 2XZOA 3FVQA 4CEJB 3L2OB 4Q9JA 4LUCA 3WBJA 4LJ8A 1DAFA 2VL7A 3AP1A 2ZSDA 1NNEA 3OAAD 1DO2A 1X6VA 4M1OA 1GM5A 2AWOA 3LX8A 5FTJA 3T06B 1ZCAA 1N6RA 1KK0A 1MV5A 4CRWB 3WBKA 1UBEA 5P21A 1HT1E 1OT3A 3R8FA 2OV2A 1SKYB 4PQRA 1NLFA 2VQSA 2XNSA 4QHSA 3HU2A 1NMXA 2GBLA 2PCLA 4US0R 2ZJOA 2AKYA 4AK9A 5FPTA 1NKTA 3IDQA 1C1YA 3U3JA 4A8JC 2ODEA 2NO0A 4EPRA 4ZKDA 4S35A 3RSLA 2ATVA 4WVFA 1KO5A 1CR4A 3M6AA 4NONA 3CF6R 2J7PA 4PC3A 1GTVA 1W0JA 5G41A 5CM8B 2GJ8A 3G5UA 3VR2A 1E2HA 1W49A 4XWKA 1K5DA 2MSDB 2CCGA 3AF4A 4M9ZA 4IXMA 2H16A 3F8TA 5KDLA 1XXHA 1KK1A 3PV0A 5AWFC 2VF8A 4AKIA 2J87A 2QTHA 3QJYA 1CS4C 2QMUA 3KXLA 1YU9A 2A3RA 2FOLA 3JVUA 4IOLA 2F6RA 4I1VA 4LK2A 1YR7A 2KSQA 2CK3D 2QY9A 4A6XA 3ADDA 2OFXA 2AK3A 1II9A 1XMIA 4MUAA 3MWJA 2O0HA 1RYFA 1LF5A 4JBWA 5CLQA 5FUWA 1P62B 3WNCA 1XXHB 2NZJA 4IHQA 4OQNA 1XRJA 3RLFA 4GZMA 2RB4A 4JSTA 1L4UA 3IILA 2IHBA 5HCNA 3MG9A 1JI0A 4RZ2A 1YZGA 1UBGA
chains in the Genus database with same CATH superfamily
2YWEA 2PUBA 2NN3C 1U02A 3F47A 4CE6A 1VMEA 1NWCA 1XEWY 3QU5A 5IK2D 4YCAA 4TKLA 5H02A 4F85A 1XP8A 2EV9A 4FE7A 1DNPA 1OWMA 4J1SA 3WLHA 1XX6A 1K88A 1HG0A 1DIRA 4GLBA 1Q22A 3TRFA 4HX5A 1NPDA 3A7EA 3IAUA 1ARZA 4H16A 4JL8A 4KNWA 5IM5A 2ZUEA 1SCIA 3V8VA 2JFVA 2Z0MA 2BTOA 2QTFA 3CLRC 1DC8A 3R0QA 2Q6IA 5K3SA 2DLNA 5B4TA 4NE7A 5FH9A 3X1YA 3FUCA 5JNLA 3H7AA 3MW8A 4ENRA 1ISRA 1QVZA 3MWEA 3RV4A 4OGGA 3B5IA 3JYPA 3O4GA 4AROA 2Q0SA 2WIDA 3W5CA 4BLVA 2I1WA 4JYCA 5K51A 4PC7A 3UUGA 2PS9A 4ZI3A 1F0YA 4FMPA 3NKVA 3VOSA 1IN8A 2QROA 5D84A 4HXEB 2QF7A 3CH6A 4JT2A 3Q41A 3MWEB 1GUAA 1STOA 5EGSA 4PR0A 2HA7A 2VK4A 3IPYA 3Q3EA 4O2BF 4PHGA 1BMDA 1GQYA 4I2NA 4OP3A 4CF3A 5K9ZA 2PUGA 1R9NA 4RK0A 3A6PC 4LRXA 3HRHA 5CP8A 4JVSB 4NCKA 3WDMA 2G36A 2JZOA 2WVGA 1OAAA 1UT8A 5D5QA 4BO3A 4FDTA 2YXPX 3KZ1E 2BZ1A 3GT3A 4ITRC 3ZJ4A 1JHOA 1HYBA 5F77A 4TLEA 7ABPA 4UUAA 1WNTA 5LNK1 3AF1A 5LA6A 3TVTA 1KFEB 2QV0A 2WUGA 2NIPA 3O2JA 4FK8A 2O7RA 1JAXA 2LIVA 3H5NA 3B1XA 3MCZA 3MMPA 3NPMA 3OE4A 4U8HA 4D8YA 1U90A 1T0JB 3ZNNA 4F4UA 1W1UA 5K45A 1W0CA 5B3AA 1WKBA 3QG1A 1G59A 4PN7A 5JZMA 2VHWA 1NE2A 2WYHA 3IUYA 1W48A 5GJCA 1XNRB 2GERA 2K7FA 3UM9A 5LMUB 1PR1A 3I4CA 5B6IA 4B7XA 2XHZA 5LA6B 3NYRA 5EVCA 5CNKA 3L43A 4BNMA 4BX2A 2ET6A 4KX3A 1X14A 3KB1A 5J9FA 3KV3O 1A2KC 5F7JA 5KYNA 4QU8A 5DYTA 4FD2A 4YO8A 1J39A 3KKQA 4I9UA 3EWSA 2O2CA 4O8ZA 1G4UR 3BYZA 2PVSA 1EGVB 1EXWA 5I9LA 1XRLA 4IXNA 1KYYA 4GE0A 1A76A 3QLJA 4Q3EA 3V1UA 4RDXA 5LNK6 1ILWA 2OFWA 4PC1A 3V1YA 1S9HA 3L93A 4EBFA 4MW9A 1UKAA 1Z33A 2VRCD 4ARBA 5IN5A 5KNCH 2E2WA 5AIAA 2UYYA 4DDVA 4ZO7A 1C0PA 1WO8A 3GRUA 5LCXA 1EP1B 4GI7A 1TEZA 3WRYC 2C4WA 1QOZA 1KVRA 3BD7A 2RG1A 4KXVA 2VN8A 1QGED 1UZNA 2MMCA 3A3YA 5IJZA 4X65B 5JV5A 2UU9B 1AZLA 3DD1A 4BHTA 2H2DA 1MAVA 4JJKA 1NLUA 1DWQA 2A1TS 3STUA 1T5TA 3BEDA 1QOPB 3LSTA 3OPYA 1B0ZA 1WXIA 3LX6A 3IVRA 2ALJA 4Q7LA 1DGQA 1R3DA 5DEIA 4XIYA 5CIQA 4OHUA 3ONNA 4JMLA 1TRHA 4E5PA 4CM8B 3R77A 3BD8A 4PSCA 3KAJA 3PQDA 2IE8A 4WESA 1M54A 3UOAB 3SMVA 4CMGA 2OHJA 3OPYB 2HIMA 4NNJA 3T41A 3OOYA 1EX1A 3PFKA 2W2PA 4MW1A 3EIQA 3HCNA 3LLSA 3QLVC 4NOMA 4DRXA 4AMGA 1C1XA 4RY2A 4J03A 1T0UA 1FZTA 1ZNXA 2AA3A 1A77A 4LE2A 1UK9A 3PX3A 3U4IA 3AHJA 1ZGHA 4ZA2A 2VNIA 1OW3B 1QG6A 2QPTA 2X1LA 1KBOA 2WSLA 3KUKA 4M0FA 4WESB 5EIWA 1IJEA 1U2TA 4HXGA 1SBYA 5J43A 2NU6A 5PGMA 1C8VB 4B3DA 1SC1A 3B6KA 3QVSA 1ECGA 5EIOA 3LPAA 4NECA 2E4UA 5FADA 4HG2A 1TA9A 1U2RA 3BA1A 3C41J 4AJ1A 3D02A 4DRXB 2IYVA 1C1XB 4AJIA 2EL9A 2P3QA 4RULA 3FDJA 1G6KA 3BF7A 4WNIA 2C2MA 3H1AA 3SIRA 4A0QA 2DU8A 1O54A 2ZVQX 4EMBA 4G25A 4BO0A 3WB2A 2NU6B 5JJCA 2HJWA 3TSOA 4HATA 4E33A 3QVJA 1K86A 4C43A 4ND6A 2O3RA 5DGCA 4XARA 2YV1A 3CEJA 3NRCA 5JZSA 1C9NA 4KNYA 2P91A 3NHJA 1Z2AA 3AKDA 2YHBA 1F0KA 4PO8A 4RVDA 4I1SA 4EG1A 2AKAB 1YDFA 4UU8A 4YUWA 3FPCA 4JLDA 2GEBA 2LWIA 2B69A 1U8AA 3OFSA 3RKUA 3GN1A 2H7VA 1QIJA 4DMCA 1AUPA 2Y9PB 3I12A 4GPIB 2O3JA 4RFVA 5EJ9A 1N1EA 1YL5A 2WSSD 2YY5A 2W2KA 1Q16A 2BFEB 2QSZA 3ABSB 1XL0A 4XR9A 4FX5A 4KVGA 3QLUC 5ALMA 3VUFA 3R6WA 4K9DA 3L1VA 3TB4A 3FUVA 2J6IA 3BGOS 5FL7A 5A4AA 4QASA 1Z0KA 4EG4A 2ABWA 1K66A 1Y6QA 2OAQ1 3D4PA 1RPAA 4K86A 2GX6A 2P79A 4HN9A 5C31A 4B84A 3L40A 4G1UC 5FWYA 2W2KB 2XQFA 2GTHA 2X5OA 1LX7A 1MX1A 3CKYA 2O14A 1I6WA 2ZU0C 4K9MA 1NXTA 2YS6A 5TQJA 2P0EA 3PYMA 1K3FA 1Q3TA 3GGPA 1H3FA 3B7GA 3WQBA 4BMSA 1J2RA 1VYTA 1KH1A 4NXMB 3CY6A 3CLUD 2QGZA 3EXG1 1ZY2A 1ZK0A 3H2ZA 1UMBA 2X5JO 3NIDB 4ZT4A 5FWYB 1T5DX 3NYQA 2DQZA 4HY3A 4FE4A 5KS2A 2J08A 1X9GA 1GEEA 2ODQA 4IHKA 4KO8A 2YWJA 4AKEA 3UICA 3DTVA 3I4LA 3GMIA 4PSAA 3QUSA 1JDJA 4Y6OA 2P9GA 4YRRA 5DDIP 1WVMA 3HZRA 1QR2A 2WSYB 1GZVA 3EUWA 2RGWA 3SYMA 7AT1A 2DUNA 4B6EA 4BMCA 1W7AA 3GFGA 1OI3A 1V7PC 1FUEA 2HC9A 4LY6A 1Z2CA 1RAEA 3B7WA 1ZKMA 3M8KA 3DTVB 4M8NE 4YREA 5KYTA 5A5DA 3IR5A 3I2IA 4DR1B 1OVGA 3A05A 5DTRA 3ZW7A 1VLVA 1O0BA 3MLBA 2GZ3A 3ND8A 4GLLA 5BO5A 1B8PA 3S81A 3UMMA 2VEOA 2EEPA 2W2LD 4BJ3A 1YA4A 1WXXA 4ZVNA 3MRTA 3T3GA 3RVSA 1V71A 1UDRA 1R0XA 4PE5B 1W85A 4HGRA 2AOUA 4HUQA 1P45A 4L0CA 1G6Q1 1JQBA 3EXFA 1X92A 3ND9A 4BN0A 4F84A 2AG1A 1IRIA 3HSKA 3SEZA 3WWYA 4XX0A 2X0EA 1YACA 3L7MA 4TV8F 5CEEA 5K05A 1G2OA 1L4HA 5F51A 1T10A 1X1AA 3D1JA 3W4KA 5JBQA 5HTKA 4NAVA 4PCAA 5EKTA 4QRDA 3ZGOA 2WIAA 4A2QA 4YXFA 1Y63A 1W85B 4HVCA 3PIDA 1KSHA 2AOUB 4QTXA 4RLQA 3EXFB 5CVCA 3M1YA 4PO3X 1XZIA 2PH7A 1FNDA 3PGMA 4R2HA 3CB4A 3TL6A 4P86A 4XX0B 3EISA 5TV2A 2VZEA 3T15A 2ZB7A 3K5IA 4ZMSA 2ZSUA 1VDMA 3BL8A 4YTEA 4YHBA 4A2CA 5DGIA 1ZK3A 1KR5A 3KQHA 5NULA 1ODSA 2CUZA 4FP9A 4LS3A 5E6UA 4E08A 4R7TA 4Q9KA 1WP9A 1HQDA 2IE0A 2ZJBA 1GQQA 5AXAA 3FJYA 3WNZA 1BDBA 3BK7A 3CNHA 4EM6A 5HZHA 3FSGA 1RYNA 4ZREA 5THXA 1RU3A 2R87A 3E9CA 2GHIA 1EFHA 3CF4G 2Q5HA 4LRSB 4TTPA 4P7JA 4DREA 3TCKA 1P1JA 1PJ3A 3ZWQA 1UC5B 2AI2A 2QQGA 3T99A 2HLPA 1XC7A 2YOFA 1LTKA 3GHYA 1AKQA 1OUMA 5E6UB 1QB8A 3VVLA 4US1R 3AW9A 4NMWA 4PPYA 5KVQA 1T0IA 2IYOA 5E7JA 1SKUA 3NH6A 4KJZA 4H0NA 1L6IA 5I4BA 4K46A 1A8SA 1XDDA 3CCCA 3EDMA 3VSEA 3ZHBA 1FJGB 4YP7A 2GM4A 4EHBA 1VHTA 1KDYA 1NX9A 1BFDA 4II7A 2B5VA 1VG0B 2GCEA 3CX7A 3TRHA 3LUAA 2D5BA 5JS8A 2PSEA 4KZKA 1KQGA 2W90A 1F3LA 1RWVA 1PHRA 1NVFA 2BGMA 5CM9C 4HAZA 4JUFA 5TXGA 1H0RA 1I51A 1NP3A 5K0LA 3NH9A 3W5JA 1TFUA 5IAAA 2VAWA 1R0YA 4D4GA 3EZGA 2Y2UA 1VRVA 1QV6A 4LXTA 2PGXA 1GYPA 1OYOA 3K09A 2BMEA 2D2XA 4Z53A 3L0SA 3LQQA 1KJQA 3RFXA 4JOQA 2OQRA 3TJZA 1XTKA 4KQHA 5JHGB 5KDOA 3R74A 3WV4A 3ND6A 5KWEA 3L8MA 3TB6A 4R1SA 4C5CA 1A2BA 4QOIA 4ZAGA 3UAVA 5KC9A 5EI5A 4DCMA 4RTQA 2WY2D 3PGLA 1A9OA 1QWSA 1O6ZA 4Q12A 2JCXA 1BEUB 2SHKA 5DBOA 3WXBA 4YBRA 5BUZA 4OXIA 1EWTA 2G8NA 5CYOA 5DSXA 1QPBA 4XGIA 2XIJA 4C3ZA 3F9IA 3IPAA 1JAYA 1GV0A 1LC3A 4QATA 4XSHA 4OLBA 5E4FA 5JE8A 3L4BA 1EH5A 4ZO8A 4GL4A 4G63A 4B87A 4DM4A 5C1BA 3RUEA 3ZVLA 4O4JA 1Q21A 5UKDA 4DCUA 1LDNA 5JFTA 1ZGJA 2ZJ8A 3A1DA 4GHWA 3RS0A 3ZWWA 4DKXA 1DJPA 3WADA 1Y8CA 2VRNA 1AX9A 5GMOA 2NVBA 1QO0D 5TPZD 4CFSA 3IUEA 3ROMA 4OSOA 5DTJA 1KS9A 4C05A 1Q1AA 2VQFB 4Q34A 1M2GA 4O1MA 4EJSA 1OWOA 1E79D 2FN9A 4O4JB 4F4JA 2QD3A 4DNPA 3UJAA 1WXFA 4Q7KA 5LC1A 1HFKA 4BYMA 4OIFA 4RQUA 2P2YA 1N4AA 2AFIA 2KHZA 1LD3A 1BJRE 1VSVA 4F9GA 2O1WA 3T1YB 4PG4A 1GA4A 4RZIA 4AUKA 4EGQA 5ILOA 1VIVA 2YFHA 2ZYAA 4XRGA 3IBFA 4DILA 4X7BA 5MN6A 1RAFA 3GEHA 1OILA 3ADOA 3HXLA 4XXHA 4N0PA 3U3XA 4A6PA 4EJSB 1BHO1 2YHAA 3VVMA 1E2FA 3PC8C 3O75A 1XZKA 5BP7A 4RTKA 2AFIB 2R00C 4JLKA 4MW2A 4E5KA 3CN7A 4LXQA 4GOOD 6AT1A 4CWAA 4NU0A 5JNRA 3U4GA 5HX7A 3C4QA 4MINA 5JAMA 1W75A 2R5NA 1TO2E 4RADA 2AXEA 1JDUA 1DX9A 2ZTVA 2ZW9A 5GIOE 3AOEC 5E8JA 1LU9A 1R00A 3BIOA 1PTKA 1UKZA 2GSWA 4K2HA 3VGJA 2A7XA 3NRBA 4ZODA 4BS9A 3DFKA 4X6UA 1TO6A 4Z5XA 5GADl 5JXGA 1KKLA 4FNGA 2I6XA 4FLMA 1NQTA 3P4XA 5BSKA 2EFHB 3L4EA 2ODWA 3QKIA 1MOSA 4JBGA 2HLHA 5LOVF 3M0EA 1V1RA 5HQJA 1OYWA 3Q88A 4FQ8A 2QAIA 4KQFA 3ROKA 3U48A 4BKOA 3EX7C 3JYNA 4KQ2A 3GRPA 4U6NA 1J0AA 1JKJA 1XQWA 1TYDE 2I33A 1MAUA 2GO7A 2VPWA 2W8ZA 1BKSB 3KLPX 4NZYA 1F20A 4UTZA 2PX4A 3K0FA 3WGGA 2QX6A 4X7PA 4GGMX 1W9HA 3Q7PA 1F4PA 3ZWXA 4M49A 1XTVA 1JI3A 2IYQA 1V1RB 2ILVA 4MMXB 2IY7A 3ZYCA 4G1VA 3ELDA 1IJBA 2Y1KA 4OFXA 1JKJB 1SC4A 3D6VA 1GQ2A 4MGIR 3JVVA 1QNFA 4MYHA 4TVBA 2ZEJA 1LVGA 2RH4A 3RUPA 1GPH1 3I6MA 4FZ5A 4EZIA 1N2EA 3MSCA 1TCUA 4HUJA 2OMEA 2C83A 1GCIA 4LYHA 4L5CA 4M1WA 3A31A 4LC1A 1A5BB 4P98A 4R2KA 1DC4A 1L5KA 3UXMA 2HNBA 4A0SA 3IP7A 1LZKA 1A27A 3P7MA 5ENDA 2C8LA 5JCJA 4TLAA 3DL4A 3V7UA 2DBYA 3H9EO 2Y76A 5EKXA 1FSSA 4XGKA 3AUSA 2LD4A 3Q0EA 3N0WA 2IPMA 2R85A 2A9PA 3PQ7A 4KP7A 2WA1A 3K2IA 4NBSA 1ZXLA 2BY4A 4IS2A 1XK7A 3KYDA 5EKDA 2TRSB 2OHIA 4GKVA 4HFMA 4IUBS 4JJIA 2COKA 4FYIA 3GQVA 2EHJA 5L3RA 5K3FA 3WYFA 1UWVA 3DPSA 1UFKA 1TMYA 3KELA 2I2XB 4CKWA 5MFZA 3RC8A 4K1LA 1K6JA 1VE7A 2YYSA 1NMQA 1F06A 3KB2A 2QVCA 2CVFA 3HR7A 1HV8A 1KVQA 4KO3S 1F51E 5IAGA 3TUJC 4FMCB 4KTVE 3KYDB 3HPRA 4RF3A 2OAP1 1T13A 2JZCA 2QAGA 1W8IA 4RY8A 1HF3A 5FDFA 5K3FB 4CKWB 3AESA 3TQQA 3RRMA 2KS6A 4XIFA 2JLRA 4EZEA 1K5HA 1YZLA 2D1SA 1D2CA 2Q3DA 4LSZA 3TQTA 1GPJA 2DHQA 3CNBA 2QTCA 3L7CA 3AL3A 4OKIA 5JY6A 1OD6A 1PR2A 2DOKA 2BUAA 4R0NA 2F8MA 3CVYA 1ZVQA 2GA8A 4AF6A 4BVEA 3WWEA 5AP9A 2Q1YA 4ILEA 2JCYA 4KWHA 2QAGB 3AUAA 2G1PA 3AM3A 4G0UA 1TL7C 3L01A 4AF8A 2PL1A 3AESB 3GIDA 2IYNA 2OHGA 1AV7A 1T9AA 1ZVVA 5K09A 1JU9A 2Q5OA 3OCCA 1B6GA 2IXTA 5FI1B 1GAQA 4BE4A 2M9MA 4OB8A 1YK0A 4XW2A 4ZRDA 1PV4A 1DQPA 1UXGA 3DMTA 2NM0A 4EI9A 4LFBB 1U3GA 1UZLA 1EM6A 1YHYA 4HFRA 2X0FA 2WFMA 3DR3A 3EGCA 4V3CA 4X1KA 3BTOA 2HWUA 2IZ5A 3VR1A 3VR3A 1WM1A 3WLFA 1U0GA 4GEKA 5IDVA 5KJCA 2DY1A 3NBUA 1F7VA 2EJCA 2OEPA 4JODA 2I67A 4Y18A 5D6NA 1AQJA 3IDOA 2DH5A 4FYMA 5CTAA 3GMTA 3CLVA 1NVMB 2A5YB 1R0BA 3P19A 3LUFA 3EPHA 3PFCA 4GX5A 3KSMA 4X1KB 4A91A 4B3GA 1AZTA 1Y34E 3UHOA 2PUHA 4BNHA 2AWNA 1X39A 4RHYA 4JYZA 2ZCUA 3ADPA 5HA5A 3BB4A 4QUBA 5F1YA 1BD3A 3R7NA 4YFYA 1MVLA 1DBQA 3UB2A 1XCGB 4OX9Y 3EQZA 1ORHA 3ITDA 1XDZA 1GDTA 3RROA 3HJNA 2C9CA 3SM9A 1V8OA 2IU3A 1UJ4A 1R6VA 3OH8A 1WSAA 4HN2A 2IXAA 4TZKA 4W6ZA 3HYRA 5GTDA 2WKRA 4PM4A 3Q10A 1FFBA 4RPCA 4UQPA 3LCMA 2RG7A 2R751 4OQDA 2CC2A 4S1NA 5EZSA 4LDRA 4PO1A 2QRVA 2C54A 2GFHA 1N6NA 2FWBA 2RH9B 1W36D 3QV2A 5SYAA 1A5AB 5DNWA 2DRIA 4GR4A 4WKPA 1WNFA 3E1SA 2REBA 4MIEA 2C59A 1D9XA 3C7AA 5BMOA 2L69A 2RKBA 1UXIA 1XA4A 1WABA 1OU0A 1XKXA 3DV9A 5JIBA 4LX0A 5ICCA 1N32B 2NTVA 3UFBA 2FMXA 4EA7A 2QRVB 1TJ5A 4IIGA 1CY6A 4O0MA 1AMUA 4JYMA 4KDEA 3VKGA 4K6OA 3RYTC 2IV7A 4DSAA 5EP4A 4U0JA 4LGCA 1VSUA 2EWVA 3ZEIA 5D01A 1K68A 2CFSA 1V8ZA 3ONEA 4P4UA 1J20A 4M1MA 1O77A 1NQUA 3FNEA 5T8KA 3SS8A 4P08A 2Z98A 2JG3A 3ZDBA 1XN1A 1TVKA 1ZONA 3A4YA 2QX8A 3ZY6A 3OM9A 4Y3UA 3K4HA 1T5BA 4ARSA 2J4CA 2QQ0A 3VJRA 2CW5A 1PJAA 4ZU6X 4ZK2A 4UNRA 1RACA 5J2UF 5LD2C 1U2GC 2IYXA 4JVNA 4WERA 4E2WA 3SPXA 1FSFA 1XMXA 2IUFA 1AKRA 2A0XA 2XITA 2DPXA 1PLLA 3A28A 2AB0A 1CUHA 2R97A 3L6BA 1TVKB 3LT4A 2ZBPA 5I6DA 2HK7A 4X8HA 1CZNA 5ALPA 3PEFA 3RS3A 2C4UA 4C7XA 4HWSA 2C2GA 4JLVA 2BSAA 3TD2A 5CG1A 1GCUA 1G8YA 1TIPA 1P7PA 2FF5A 3M6UA 4M7OA 5CB4A 1S8FA 3C6MA 3CV3A 3IOEA 4H60A 4A5SA 2FK8A 1B23P 1D6MA 3D0KA 3WISA 4BKRA 4BMVA 1OLOA 3CQ9A 1YB7A 3PXGA 1NBMD 3FGNA 3O0DA 4IZHA 3E35A 1SEVA 1FC0A 2WPNA 1T35A 5DYYA 1O97D 5KNDD 2C1XA 4H6VA 2BEKA 3PQ6A 3AONB 1PL8A 1WCWA 2GN4A 3KTDA 3MGAA 2XMPA 3RD5A 1LI4A 5CB4B 3OQNA 1PEYA 2D5IA 4KLNA 2DPHA 3M4YA 3OZ7A 4KK3A 1K27A 3V33A 2CVHA 2WKQA 2ECOA 2PL9A 2YXDA 4QGGA 4IP0A 4YGYA 2OLEA 3D3KA 3H2JA 1DAOA 3P2MA 3PJGA 3PPXA 5TF0A 3TLYA 4FGKA 2GZDA 4BEVA 3AUXA 1LDEA 4Q4DA 2FWRA 1T1EA 4K8OA 2VWPA 1LS1A 2D1RA 4TV9A 2DFLA 4X63A 5IJWA 4OHVA 5C5CA 4FZRA 1RRPA 1M2OA 3ROGA 4FC7A 1I8TA 2D2IA 2PUJA 4JNKA 1D2RA 1ZR4A 2B3TA 2PSHA 3IA7A 3P0RA 4Q37A 1P3Y1 3EDYA 3LTEA 4TWIA 1NN0A 2W00A 4KPFC 5D85A 2ZYVX 1WMDA 3JVDA 4NX2A 4NFHA 1ZGZA 4KXMA 1D1PA 3ENNA 1M2OB 4XDGA 2FMHA 5TARA 2YXNA 2R8RA 2XUPA 4QPZA 4Y6RA 1QYCA 1FP2A 1F2UA 2OP0A 1K7SN 4NH0A 3QI2A 3EE6A 2Z1NA 1FDIA 2VP2A 2H54A 1G7TA 1TPYA 1X0VA 3F6YA 3H3FA 3SIWA 3HA5A 3IV9A 1RRVA 3HEAA 4FFVA 1NVEA 4DDTA 1ZHOA 3R3SA 2GN9A 4EYEA 2W6CX 3ZWDA 4I99A 4QFDA 3KJQA 5H80A 4DIDA 4RKEA 1C3JA 2I6FA 4Z2AA 3H7IA 3HXQA 1CHDA 2QTGA 4Z8XA 1Q1NA 1LV8A 5I7UA 1F2UB 4NXNB 3O84A 2HRRA 1YQWA 4UUMA 3RF6A 5M7EA 1Z2DA 3K72B 4OFZA 3V4SA 4BO9A 5KTMA 4CEHA 2N1MA 4OOFA 5E2AA 3KZOA 2B9EA 3RRJA 2ZJYA 1I7DA 1YMUA 1E0KA 2I9PA 1GSHA 2PZLA 3PC4A 4OHRA 2W6JD 1FNBA 1KAEA 5DN6A 3R3JA 2WKPA 3IBYA 5E6RA 3KZNA 3WYDA 4D0GA 1W46A 5JPCA 3G5AA 4D3FA 4XFJA 1P8JA 2G9ZA 4LPKA 4RWEA 2ZJZA 4PAOA 2BR3A 3MOSA 2WDZA 1T8WA 2P0AA 4GE3A 4HGNA 5CH5A 3RLIA 2XCTB 1ZOSA 4X20A 3RS2A 4CEHB 3OPVA 3T3OA 3ODPA 2IXGA 1FOEB 3OZUA 3D0RA 4FDVA 9ATCA 2P2GA 5KEIA 4R05A 4Y7DA 1F1JA 3HUTA 2HBZA 1OGJA 4XVQA 1NVUQ 1RXUA 2WWTA 1GVNB 3L7OA 4WN3A 3W8FA 2W42A 1QIFA 2RJ3A 5AW9A 3LX4A 2FSFA 4RJKA 4F2HA 1U0BB 4P31A 3RFFA 5BRAA 4IY1A 1YU6A 2C58A 1GLVA 5G0TA 3ZCVA 2AR7A 4K05A 1TZCA 3PUJA 1E2JA 2YBEA 4KUEA 3GGSA 2OTCA 1W4BA 1Z35A 4L85A 1ST3A 3NEPX 5ALUA 2JLVA 3ZI4A 3WWOA 2C4MA 3CNNA 2FI1A 2J5BA 5FB3A 1IH8A 1FQOA 2PRKA 4HX2A 1LPPA 2BLLA 2Q4TA 2AI1A 2FSVA 1U1DA 3F6PA 1Y80A 3LHKA 4JBYA 2ZBEA 4ZQBA 4MXDA 3WNBA 3HVRA 2QMZA 3ZDRA 5EHZA 1EA5A 3R0XA 3WFZA 3RK1A 2PBLA 3AG5A 4JQCA 4AP5A 4RNDB 1MD9A 1XDBA 4EYKA 4QRIA 3F7TA 4XPZA 4NEGA 3AF3A 3ZS8A 4A15A 1C29B 1QJ4A 2ZSJA 1O95D 3KJIA 1BGWA 1CRLA 3PKJA 4KRGA 4S0XA 1DHRA 3RAPR 4XM0A 1T8TA 4MWSA 3IJ5A 3KE9A 3COYA 4M53A 5B3KA 1M10A 2ERCA 2HGZA 2XOXA 4U2KA 4UJ5A 3ZTYA 4BLSA 4YAJA 4DV0B 3R0JA 2ZTUA 2ONCA 3ZU6A 1V5WA 2O3UA 4AF7A 2CD7A 2EIHA 3UAGA 4AY3A 4ROSA 1V2GA 2VJDA 1QANA 4KUGA 2HHLA 1UIMA 5L51A 3CJQA 4NZOA 1HWYA 1RI2A 3DQPA 3RRXA 3PICA 4IGFA 4J4HA 3W9UA 1JKMA 2B30A 2PKEA 3SZ3A 4Z4EA 3KSBC 4LF8B 3D0OA 1RT9A 2ZB3A 1RVDA 2QLLA 3O93A 3A4IA 3FCYA 2PWBA 5D5HA 5DASA 2WVHA 2I0FA 2VHZA 2X19A 4ZK6A 1AGNA 1BA3A 3QF4A 4ENQA 5SY9A 2PXXA 2R84A 3ESYA 3JYHA 2X2FA 3NBQA 4Q1DA 4XD2A 3I9V1 3I28A 4FKZA 4ALNA 3FX2A 2VP0A 1U6IA 1Q84A 2E4YA 3VPXA 5JXJA 3JXEA 4TM7A 4R3WA 4UXHA 4BB5A 5TEVA 4PNEA 1WZCA 3IUNA 3B52X 2DGDA 3BDVA 4WLVA 4HXYA 1CIPA 1I3NA 4AQDA 3ZVNA 5IT9A 4HDMA 4QPPA 3QXCA 3I9OA 5KQLA 4IGAA 5CXUA 1SK9A 3GMSA 3ANNA 4M98A 4E31A 1N2SA 1E3JA 1RI5A 4YQZA 1KWGA 1H8EA 4AP9A 3TZCA 2LVBA 2IYFA 1I6MA 1PD0A 3HA3A 1ZI6A 4RPJA 3AB7A 1GGVA 3BJIC 1XL1A 2R1VA 3DL0A 2CNNA 2PXHA 3WBKA 3U37A 5GZ1A 4HDMB 1K98A 3H2KA 1U8XX 1TYAE 2PX0A 1MJGM 3IP5A 3EMVA 1H2XA 3DP7A 3CNEA 3OJLA 4EHHA 4YAEA 3A3OA 1IY0A 3I9V6 3M6VA 4ENVA 2XVZA 4WL0A 4A4DA 1RWNA 4ZCTA 1ECLA 1E4VA 2R1VB 3DEZA 5J23A 4JI0B 4HZGA 2P4EA 3Q6NA 4HBZA 3MHPA 5K8JB 4OBBA 1VC2A 4KIFA 5HBRA 4RTOA 1L5NA 2EZUA 3UUEA 3B2QA 3WWDA 4I4TB 3WLTA 4LJAA 3USES 1DCKA 2IWHA 4Q4AB 3SS9X 3F73A 3LV8A 1Z07A 4C89A 1RWKA 1X1TA 3OZWA 2CJFA 1NFRA 2BMVA 2QSJA 1EYZA 5FOWA 1HY3A 4G9GA 3ZDFA 3ZHRA 4DPLA 5IRCD 2JANA 2IHJA 2O59A 2IUTA 2R7AA 1DI0A 2QW0X 3HS3A 2ZBUA 4MLZA 2EOAA 2Q99A 3E0XA 4CQLA 3E5HA 1GSOA 2OHFA 1Z7GA 4JDUA 3BFPA 1KPIA 4R40A 1MPTA 4YROA 5NLLA 1PZGA 3TX2A 3VPGA 1MEEA 5LQJA 4ZI7A 3NTQA 1X9IA 2C0CA 1CY1A 2QQFA 2AHOA 3GVXA 4GX0A 3U3MA 3GBVA 4XQ0A 4LHVA 2AX4A 3GA7A 5IVDA 1U2EA 3D4BA 1ZAKA 3GNSA 4YR9A 1GPNA 4XVHA 1TQHA 1NW8A 2NG1A 2EW8A 3L8DA 3NBAA 3QELA 5CMLA 5AVZA 3ZTWA 1U63A 4KR6A 2BM8A 4CQLB 2QT0A 2KPOA 2XEDA 4YWJA 1CQIA 3RWMB 4WBNA 3GLFE 4DMGA 5IZCA 4QXMA 3TQCA 4ZI7B 5LXTA 2V54A 3HHPA 3Q12A 3UAXA 4D2IA 3HI4A 2WFAA 2PNJA 1JV2B 3RV3A 1OI7A 2H29A 2ZZMA 1ZUNA 1VKHA 2PJUA 5K6RA 5JTUA 4M8SA 4B43A 1OHHA 2OK7A 3ANLA 3QELB 1X8KA 1S3IA 3TSCA 4A10A 5H4GA 5DH9A 1U99A 1Y0BA 3GJ4A 2PRZA 4AYXA 4WBNB 3S2IA 1E9SA 2Z8YA 5FLEX 1V26A 3L4SO 3EVDA 1R0SA 1RHUA 3G13A 1KARA 1P4JA 5EMLA 4PGFA 4DSTA 4UHBA 4DW8A 2DY0A 2ZVPX 4FGJA 4G1BA 5IT0A 1JR6A 3ZWAA 4HO1X 4CLHA 5JDCA 4AJPA 1JMVA 2WM3A 1ZUNB 2W22A 3PGKA 2QWXA 3R40A 4MVJF 3B3JA 4Z4CA 1U3DA 3ES9A 3IEMA 1N33B 4IJVA 2BFNA 3HC7A 4MYUA 2PKCA 5CVJA 3H3XA 3QZUA 4D25A 1DZIA 1POXA 2IU6A 3ZKWA 4IHJA 2R7NA 2PV7A 1E1QD 5DRYA 3GD5A 1Y82A 4IG9A 2XUIA 2Q1WA 1LQTA 1Z88A 2BFDA 2QV7A 4TWAA 1MB3A 2I22A 1HM5A 4HLNA 5FUVA 1WW3A 2ZANA 1E64A 3KLNA 2GD0A 2VT6A 1T29A 1TEVA 4Y6LA 1EQUA 1I9CA 1SVKA 1YZ3A 4TKUB 3U7HB 5ALOA 4KWIA 2ODNA 3GFPA 2JVIA 2OB2A 3I1IA 4IRMA 4IHJB 2NSLA 4UBOA 5FI3A 3UMBA 4AJJA 1CDEA 3AL2A 3W77A 3V8RA 2C0PA 3DOIA 3V46A 4F86A 4Q4CA 2BFDB 3JATA 3BTSA 4ASUD 4RK1A 3A6GA 4KV9A 3KOOA 2XMZA 3ZWYA 3E2IA 3HXTA 2IOFK 4F5WA 4WKBA 3GUVA 2ZJ5A 3P32A 4JKOA 2OOKA 3CRMA 4RH1A 4UUBA 4F91B 3KWFA 3DW1X 4W5NA 2C57A 4UKDA 1H2AS 1PF7E 3QVLA 5B1HA 4DM3A 3WLQA 2OZEA 2WFLA 3JATB 4LVOA 4WXYB 3UMCA 5KTKA 3FAKA 1NZJA 3IMEA 3F71A 3ZWNA 2HMYB 4YDHB 4CYMA 1NX6A 1X7WA 1GLGA 3BB3A 4PYRA 1A4RA 1J2UA 2WJPA 4M88A 5KI6A 4YAWA 4C5BA 1RP7A 3DWEX 3KUUA 1FTSA 5JS7A 1SB9A 1RZ3A 4MULA 3K9HA 4PBRA 4ARZA 3N2NA 1T1RA 3CLKA 3DLTA 2E48A 2WFLB 3JWGA 3G7NA 3BL5A 4KYTA 3FMGA 4WXRA 1R66A 1BZYA 1TQ8A 1W30A 2OBMA 1Z4JA 3JPWA 1X7WB 4DCSA 3QKSA 3EZXA 4IRXA 5DI9A 1I10A 3E22A 3H17A 4M0CA 4MIKA 3ZH9B 3U3KA 3DPUA 4DEVA 4ZT7A 4CUKA 3FPFA 4H3KB 1X0XA 4MRAA 1GGNA 4WKOA 3RT9A 5KNBA 1T9CA 3G0BA 3LH5A 3IB6A 4YACA 5IJ9A 5LIPA 1KZ4A 4PLVA 1RBZA 4Q4JB 5DCWA 4G0MA 3RRYA 1ENZA 2C1EA 1KXZA 3PYXA 3QKSB 5KSWB 1IUOA 4G84A 1DT5A 1SCDA 1UWKA 4DIBA 4E6PA 3DZBA 5MFPA 3D8UA 1SBZA 2AS0A 3E22B 4H7HA 4II2A 3UT5A 1O9HA 1MUUA 2VF5X 3DTYA 3HJGA 3K9BA 4ICIA 2QN7A 4GOMD 1H2ZA 4Y6GB 4P0PB 2IVZA 3H5AA 4UVDA 3T5BA 5IJ9B 2PKQO 1AO0A 3DB2A 4A0RA 1RKBA 1OH5A 3FBTA 3VJMA 4ZV4A 2AG8A 1XHFA 2YQZA 2SECE 1DQNA 3ZCUA 2Z8XA 3UT5B 1O6BA 3AHCA 5F35A 4UQLA 1NC1A 2HRBA 4UCWA 3R20A 2OBYA 4RSMA 1LI7A 4CV1A 1P6UA 1Z2NX 4U0KA 3HU3A 2R4UA 1T8YA 4TTAA 3L1HA 3DHEA 2OM6A 4OAOA 4DMRA 3C3EA 1FYDA 1KO1A 1AVTA 1EWYA 2H63A 3AFGA 4ZT5A 1FRQA 4P0TA 4L5IA 4LE1A 2DFVA 2R8OA 2XT9A 2B1JA 3WTCA 1EFCA 1PCXA 2H2FA 1KJWA 3FWHA 4MA4A 3DWIA 4QIHA 5AOAA 4EA9A 4C7OA 4Q1EA 3AP2A 1IZZA 4BXOA 3UK0A 2IIQA 2Y71A 4C08A 3UC5A 3S1SA 2FN7A 2QN2A 1FP6A 3GVIA 1HZZA 1XEAA 3IPRA 3LJKA 4MGZR 1T4GA 3I9KA 3LKZA 3RFVA 2LKDA 3SNHA 4X92A 3GJ3A 3VO2A 1DXQA 2G9UA 1D4OA 2H1IA 2GXQA 3PFNA 3DAOA 1VFPA 5J5VA 1BOOA 4KG7A 5J2TF 1FRZA 3L46A 1SZPA 1MORA 3DVQX 1RKUA 4KIWA 1QKKA 2ATXA 3OLWA 3Q40A 4HDSA 4LZPA 5HW0A 4AECA 1SQ5A 2W2TA 4BXOB 1C4WA 4C7OB 3OCYA 3KWJA 5YASA 2HRQA 2AUNA 1ZFNA 3FB1A 4MUGA 1QZZA 3AF5A 1RM0A 3Q3CA 4PS1A 1E3EA 5EHQA 2OCDA 3UNXA 1RJEA 3PHJA 4O3FA 4EFKA 2F59A 2VCHA 2X7XA 3W6OA 3SGLA 5AVJA 1ZIPA 4WUVA 3F90A 2QJWA 4HDSB 1AF4A 4CT4B 1YHZA 5CK4A 3U61B 2JL1A 4IDFA 1YB1A 2PS0A 4CR6A 1XRNA 3DV2A 2GYUA 4QDUA 5GJVC 4KR9A 2QRKA 2N42A 3NI2A 1UKCA 4PRKA 5EXPA 4TXNA 2DTXA 2J7KA 4LCJA 4P92A 8AT1A 4J0HA 2HPZA 5CH3A 5A3RA 4RTLA 4JSYA 3D4OA 4KPUA 2C29D 2R8BA 4IV0A 4WWHA 4DMLA 1RBYA 2WICA 4Z3DA 4JY7A 4BQIA 1IG3A 2RHLA 3L0DA 1PNTA 2DETA 4H7FA 3JQEA 5I3ZA 1Q3KA 3EVCA 1TD1A 2JBAA 1OXXK 2MIIA 2CUKA 3BG5A 3L84A 2ZS7A 2YJGA 4KPUB 1VE5A 1TPZA 2BBSA 3RYFA 1FX0A 2JFOA 3P0EA 4AC9A 2UUAB 2V7QD 4INJA 4BRWA 3MJTA 1MEJA 3IAEA 5DNAA 2JBAB 2WUDA 1GPMA 3KO8A 2V58A 3KSUA 4NBWA 2JARA 3O5AA 2HY7A 3V3KA 1OTYA 3TPCA 5IKE<