5KZCB

Crystal structure of an hiv-1 gp120 engineered outer domain with a man9 glycan at position n276, in complex with broadly neutralizing antibody vrc01
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
221
structure length
214
Chain Sequence
QVQLVQSGGQMKKPGESMRISCRASGYEFIDCTLNWIRLAPGKRPEWMGWLKPRGGAVNYARPLQGRVTMTRDVYSDTAFLELRSLTVDDTAVYFCTRGKNCDYNWDFEHWGRGTPVIVSSPSTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Minimally Mutated HIV-1 Broadly Neutralizing Antibodies to Guide Reductionist Vaccine Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VRC01 Fab heavy chain
total genus 33
structure length 214
sequence length 221
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2016-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kzcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kzcB01
2R8SL 1AP2B 1H3TA 1U2HA 3QEUB 4NWUH 4XXDB 3NMEA 4Z5RA 4JO3H 5D71H 4HDIB 4K7FB 2EICA 4JY5L 4ELKB 1G7JB 2Y06L 1XIWC 4R6UA 1PSKL 1BZ9A 4NOBA 3DJ9A 3IFPA 2CJUL 3GRWL 2B0SL 3OKDA 4P46B 1BQHA 3FO2B 4QHUB 4X4ME 3I02A 4HPYL 1XCTB 2HFEA 3BZ4A 3PDOA 5HYSA 3BHBB 5GS1B 3EZJB 4U1SA 3HR5A 4ZAKD 2YD4A 1WZMA 1BZQK 5FUOL 1HINH 2VKWA 2CUMA 2GFBA 4M1GH 5IT2L 5C8JB 3HR6A 1NCWL 4NO2A 3NIDE 1LO4H 1A1OA 4G9FA 2R2BA 5K93A 4WCYH 1DDHB 3DX7B 1FZKA 2Z31B 3WHXA 4Z8FL 1T03H 4AT6B 4K7FA 4L4VA 4O58H 1NMBL 5CP3H 4ZUVA 5M94B 5EPMA 3PWNA 3ULUH 3LVEA 1AD0B 2VLKD 1GGBH 5GGRB 1LP9E 2VO5A 4MJIA 1RUKH 3B6SB 1AO7D 4RMQA 4LHQB 5LCVH 2JIXB 2PTTB 4ZUVB 1FAIH 2VAAA 3S8WA 3P0YH 3QHFH 5B8CA 4PRPD 3VG0H 3WFCH 4UNVA 1TETH 3VFTA 2KZWA 3GSXA 5ENWA 5EC2A 5DT1L 4WWKA 2R2BB 2CIIA 3OKEA 5TE7H 4WCYL 3RWCB 1JGDB 2G75A 1EEZB 3FFDB 4G5ZH 3QCUL 4HAFA 1Q0YH 4NUJB 3VXUB 5CEZD 2MWCA 2ATKB 5EBWA 3FB8A 1ACZA 4L3EB 1FZJB 2ICEB 2B1HH 1XGTB 3D39D 2BFVH 4O51A 3UTSA 4KVNH 1U93A 4DVRH 4Y4FD 3V6ZA 4ZYKA 1DN2A 4LRNH 2FEDC 2QQLL 4PG9A 2LFGA 3NH7H 3OJMB 1VACA 5F7DA 5ECJE 3H7BA 3KYMB 5TF1L 1MCCA 5CSZA 1I9JL 2WLYA 3FB6A 4X99A 3D3VA 4PJCF 3S3SA 1NC2A 4U6HA 4AIZB 5JQ6H 3PWPB 1UJ3B 4NYLB 3O6ML 3VH8A 2EIDA 4PGJA 3SKMA 2ZUTA 4TNWF 4GRWB 1I7TB 4NQCA 1MFDH 3ULUF 5EWIL 1SBBA 4PJXA 4Q6IB 3HA0A 4S1DD 4TULH 4QHMA 1WGOA 2O5ZL 1VGKB 2ZUSA 2OQJB 4WTZA 1E28A 1RUKL 4OAWB 4BKLA 4ONGL 1UZ6F 4YDKH 3VE0A 1C08B 2CDEA 2BERA 4JZNB 1EK3A 4KK9C 5CJ8A 3TM6A 1RFDH 2KL6A 2BJML 2HT3D 3ZL4L 3CVIL 3NN8B 5HYQA 2Y36H 5BV7L 5I17A 3O4LB 5B4MC 2Y6SC 4MQTB 4WGVB 5DS8A 2JK5A 3VFPA 35C8H 5DO2C 1S5IH 3KLHC 5D7IB 4HC1L 1NFIA 5JA8B 1AI1H 2ICES 1Q9KA 5EA0L 3WN5A 4JFOB 4UDUB 2I60H 3LN9A 5F93C 4QXUH 1Z6JT 3HZMA 1NSNH 2NY0D 4FXKB 5A3IC 5HVWA 5I8CB 2K7PA 2HJKA 3CDGA 1TVBA 2FL5B 1TCRA 3GMRB 2P47B 1U58B 2I07A 3ULUE 3WL9A 4JFFD 1ZLSL 3QDJA 4OFYD 1MVUA 3IJSB 4RCAA 4E0RB 2EH7L 3U2SA 5DYOB 3RTQC 3CZFA 1YJDH 1G9NL 2MPAL 5I1EH 2YD9A 3GHEH 5KSAB 4XZUA 1FC1A 1JRHI 2R1YA 1T1WA 3BP6B 1SM3L 3PL6D 1NCBH 4OF0A 3WHXB 3VFNB 2YWZA 4WWKC 1MI5E 4HV8A 4PRPA 3EOBA 3QA3B 1JNLL 1Q9OA 4N5ED 1R5WB 4FFYH 3HI6H 2OZ4H 1O7SA 3O8XB 4Y19E 3O2WL 3VFUA 4GKOA 4NC1C 4L3EE 4PP1D 5E8EB 3LOWA 1TZIA 1A2YA 4OT1L 4Y88A 4YGVA 4RRPG 4U6TA 3STZB 4YPJA 1X5AA 1AD9A 2WP3T 4V1DD 1YZZA 3EKCA 1CFTA 3IDNA 5TH2A 5GS2D 1JPFB 3PWUB 3ARDD 5CBAA 2C3GA 4M4RA 1ZA3A 5DUML 5TPWL 5DFTA 5A2KH 4OLEA 1JFQH 4WENB 1HNGA 2J4WH 43CAA 2XWJB 4J8RA 3JV6A 3JSSA 2XA8L 4FG6C 1H3VA 4G6AC 4GKNA 5ID1A 5JHLH 3T0XA 1LO0H 4N8PA 2AJVH 3MPCA 1EAJA 3WUWA 1X5ZA 4XVSL 3LD8C 5E5UB 4O9HL 4QYOA 5CILL 4KZDH 1I7ZA 5LAXB 3IDUA 2ZUQC 3UJIH 1EVTC 4ZNCD 1KIQB 4ODWA 5CZXD 3TIEB 2QQKL 4HZLB 3WLBB 3PQYE 4WTZG 5JXEC 3P40A 5CBAB 4X6CA 4WFHE 4L8BB 5DD5H 2WINA 3TN0C 1PEZA 3TBTB 3ILQD 4WV1B 4GMSL 3QSKB 2CMRL 4YUEH 2JB6A 4AY0A 1J0HA 2LVCA 5FB8A 2AP2A 1Q94A 1DBMH 3OAZH 3ZSSA 4MMXC 2VL4A 4GT7A 5I73B 4JFPB 5TF0A 4XWGH 4UQ3B 4MA3A 4XVJH 4P2RE 1P4IH 2VSDA 3QEGL 5E24E 1G6RL 3VXTB 5DD6B 3ULVE 5KG9A 2MKWA 2GTWB 1YNLH 2DF3A 1UWGH 1XF4A 1SYVB 1N64L 2FJHB 3WIHL 3SE3C 3IYLW 3KXFB 1F00I 3BXNB 5HYJE 3QPQC 2EDKA 3RAJL 1I3UA 2GTZB 4I2XE 4EI6A 1CFNB 5F6HI 4ZG1A 3ARBB 2R9HD 3JVGA 5I9QB 1NC4D 3CMGA 4U3HA 3VWJA 3ZMRA 2ARJQ 4A2MA 1CL7H 3PXHA 1YYMH 5CD5D 3QR2A 3MV9D 5TFSH 5JDJA 3Q6FB 5IP4A 3HC0B 1DBML 4KK6D 5CZVH 2EXWC 4ODSL 2OCFD 5EBMA 2BY2A 1WBXB 3VGFA 1MH5B 2UZIH 5E0QA 4B5EA 5C86A 4Y19B 1BVKB 2IPKA 3MMEB 3MV8A 3M07A 2V7NA 4GMTL 1ZHNA 3V0VB 3LIZH 2A83A 2AKRB 4HPOL 1BLNA 4M48H 3CLFH 1HE7A 2VXUH 1Y6MR 3BGFB 3L3IB 1P69B 1I4FB 1AC0A 2QLVB 1KCUL 3DSFL 1QLRB 4YHIB 1FBIL 1AGEB 4PRNA 2HT4D 2IQAB 4IS6B 4Y4FA 3VMNA 2E9BA 3QDJD 1W0VA 5HTSA 3DV4B 3L3OA 2Z31C 5DQ9A 2ADFH 5F9DC 3JV0A 2YSSB 2C9AA 2VQTA 4PJ5A 1F8TL 2EC9T 4OV5A 3FTGA 2G2RA 5IESH 1V3KA 4XMPH 1CFBA 5BV7C 3GMQA 5D1QC 4EUPG 4PJCA 1JYVA 4GAJL 3LKPB 4KZEH 3EO1A 4OTXH 1K2DA 2XPGB 5E2UL 1HHJA 2SEBA 1FFOA 2UVEA 1A7NH 1YEDB 3T3ME 1NBVL 5T1LA 3LZFH 3UXFA 1L0XA 3WUWG 5FGRA 1UFUA 2WIMA 1JHTB 5GGSA 4D0BB 1SYSB 2VDQH 3QULA 3ZKXC 1EX0A 1LEGB 4N8VA 3NFSL 1H5BA 5F7UA 4PB0H 3GI9L 5I1IL 4JANA 2RQ8A 4HXAL 2X40A 3OPZL 4P9HC 2ID5A 5MEQA 3JUYA 3CPLA 1D9KC 4PJDA 4N68A 4H8WL 3QP3A 2B4CL 4GRWF 4X80L 5GZOC 2R56L 1OTTD 4YHZL 5I2IA 2HKHL 3MCKA 1CZ8L 3MLXH 5F6IC 1HIMH 2R0WL 1WZ1L 2ED7A 3MUHL 5DK0A 1JNHB 4WHTA 2EYSA 5FKAA 1T1XB 2FB4H 1BWWA 3G08B 5GJSL 2I5YH 2YEZA 4GS7C 4CMHC 3U4BL 3RVVC 3KXFE 4JQIL 3D2UA 4K3DL 4YFDB 3QIUA 1VKXB 2BX5A 5I66A 1IC4L 1TZHA 4YHYC 1ZLWH 3RWFA 3AREC 4PJFA 5CUSH 4F58H 3QDMD 4LRIA 2X89A 5CIPH 3MROA 4OLYH 5ESVB 2AI0H 4D0DB 4RGMC 5F72S 3LH2H 2AQ2A 5DTFA 3DTXB 5SX4H 3EFDH 4J12A 3CDYA 3L7FB 1T0PB 2YD5A 3TBWB 5HI4C 2UWEA 1PDKA 3TT1L 3AUVA 4JFQA 4HUUB 4I8DA 3B2UC 4WHTB 5F70A 4G6KH 4K7PY 2J8HA 4D8PB 5AYUL 1TZGL 1N6QH 2X5PA 5DQDH 4HUWB 1KXVC 4M1CD 5MI0C 4Q0XL 3D1MC 5HYSB 4IOIB 1F4XH 3HR5B 2HVKB 3A6BH 5TE4H 1YC8A 4PRID 1T0MB 5FOBB 5HYQB 5J0BA 1DVFD 1VSCA 1U9KA 2QSQA 3MRHB 3Q5OA 4RFNC 5I1HH 5DS8B 4YNYA 3HRZB 1JZ5A 5HD8C 1YEHL 3QHZH 4UDTB 5IHBA 1NAKL 5I6XC 1I75A 3V52L 3HC3H 2Z4QA 4KRMB 5HVHC 2YUZA 5D1QA 3K1KC 2AXJA 2R29H 1OD7A 1F4XL 4DZ8B 1PQZB 4JHWL 3HC4H 5LGJB 3BIKB 4LCWD 4XI5C 3D0VB 3I6KB 2GAZA 1VGKA 2D7MA 5JW4R 1Z0NA 3DMMD 3ULSB 2V5TA 1QG3A 2Z91A 4U1NA 2DQHL 2OXGA 4L3ED 3BD4A 3LEVL 2H2SD 4U6YB 3QXVA 2XTJE 4TTDC 5EUKB 1QFHA 4U31A 3BJLA 1UZ8A 3BE1L 3VFVA 3MV8E 1ADQH 1Q0YL 1YEEH 2APBA 4AJ0A 5B38G 4G7VL 4KV5E 1VEPA 4KMLB 3BZEA 1WBYB 2JCCA 1NCUA 3QCTL 4N8VG 4GAFB 5T3ZL 2XZQL 4N90E 4CADA 3VG0L 3FFDA 4O9HH 4ODHH 5CILH 4PJ5D 1PZUB 2VITA 4N1EA 4X7FC 3K2UL 4HZAA 2ICEA 1S78D 4ZO7A 3MLZH 3HPLA 2W0LA 3VXUE 1S7VA 4HEPG 1NGWA 4TPRL 5K9OA 4YGVB 2B2XL 1F6AB 1HHHA 2AK1H 4Z7UF 3KYKH 1M6OB 3WDIA 4X9GA 3P4OB 2W9DH 4ETQA 3GO1L 5DXWA 1QRKA 4P2OB 5L7XL 3AREA 5MEQB 1S9WB 5C9JB 1UKTA 3IDIA 4M61A 4HS3B 1EHNA 1HHHB 4I0PA 4EIGB 2OK0L 3GEWB 1S9VB 2PKDA 3DVFA 3L5HA 3K4DA 4NZTH 1JE6A 2UZYB 4FFZH 5IMMB 3WXVH 1NGZA 4PBWD 3FAWA 5IFHH 4B53A 3KXFA 4G6JL 3DYOA 1CGTA 4YHLH 5FO8A 4Z7QF 2EYTB 4GRMA 1XGUA 1NMCC 3RRQA 1PD6A 1P5VA 1A6WL 2IJ0C 3U82B 2X9XA 2P8MA 3HUJA 1C1EL 2CH8A 4MGXA 1IARB 3BSZL 3RL2B 1Q0XH 2WAHA 5HHPB 5IFAL 4JQVC 3L7EB 3SGKA 4JKPH 4EOWL 1RZJC 1YEFH 3ULVD 4JY4B 3SDAA 2NMSA 3ULVL 1FFNB 5EU6E 2K7QA 4WFFD 1K3ZA 5BV7B 3RVWD 3OX8B 1XR9B 3B3IB 3MA9L 3O3DA 5D93B 1WVZA 5MENE 4JREC 4TNWK 5EU5A 4R4NC 1FORH 4C58B 5D1QD 3F7YB 3I6GB 1YA5A 1MELA 2EDXA 3VDBA 2OQJA 4S0TD 5EOCH 1W0WB 4DGYL 4TOYH 4XNYH 1WQVT 3VD3A 3P4NA 1N5YH 3MUGB 3UTTA 1J88A 1WFOA 1MOEA 4PV9B 3SE4A 5I19H 1MCWW 4KKCD 2GSGB 3X12B 1F90L 4IRZH 3MOAL 1T4KA 4P3CL 3ILPB 1LDPL 3PHOB 2DQJL 4HUXA 1AJ7H 2EDHA 3FOLB 3VRJB 4EI5A 3NGBC 5T33H 2YEZB 5DZOA 1U8JA 1KACB 1PYWB 3RKPA 2NY6D 3H0TA 1A47A 4XCNB 5T3XE 4J6RL 2VR9A 4BZ1H 3STZA 4ZUUA 3AS1A 4QTIL 4G8GD 4P2OD 3ILPA 2VDRL 3ZKMC 4NNXB 5CP7B 1H3XA 5JIHA 4QNPE 1G9MC 3KR3H 1LEKB 1YNLL 2ADIB 5D1XA 1IEAB 1VADB 4KTEH 1MCOL 2LQRA 3C6LA 1AGCA 3V5DB 3HRPA 1V7ML 3CH1A 4IRJA 1NCBL 3MA7B 2VDNH 5D7KE 4I0PC 3OKLA 3TN0B 4JPVH 3OXSA 1FSKC 1K4CB 2E7HA 4Z7OE 4Y5VB 1WZKA 5ALBH 4PJ8B 4PREB 1H3PL 5FF6B 3PV6B 4DQOH 1BIIB 2JE8A 5DMYA 3VGEA 1MCNA 5GS3A 3MJ7B 4J7RA 1IM3A 3EW3B 5D5MF 3HI1A 4ODBD 5I1HL 3BT2H 3NACL 5TDNA 5EORL 1I8LC 1FDLL 3MLYH 3RGVB 3EUUA 1A6VL 1F2QA 1YPZB 1AGBA 1DBJH 3QG6A 2XKNB 1HWGB 1LQSR 1T0NA 2X1PA 3A0OA 2X10A 3WKNA 3HG1E 2Z4QB 1P4LB 4BFEA 4F7MB 5IBUG 5I1DB 2PTUA 2XA8H 4YR6B 2R2CA 3SDAC 4OV6F 5SWSB 4HWZB 1S7TB 1YMME 4JM2C 4LLUB 3VXPB 1U8LB 3QO1A 5C0FA 1WEJH 3INUH 1QRNB 1OT1A 4JFHE 4XPBL 4WFEE 5K9JH 4HF5L 4ZFOB 4PR5A 2I9TA 3X14B 5C7XH 4UTAL 3Q6FA 2W9EL 4QHMB 3S6CA 3MOQA 5BO1H 2LTQB 2FO4A 2P8MB 2Q8BH 3C6SB 4GQ9L 3AU1B 3HZYB 4LHJB 2E9WA 5IT2H 2E8YA 1ZT4A 2YD1A 3TCLA 3U4BH 3OXRA 5EBLA 4MX7B 2BNQE 4RGND 4JKPL 3V5HA 1BD2D 4TSAL 3SE4C 4EOWH 1IKNA 3I9GL 4PYHA 5L0QC 4FQXD 3JV4A 4D3CL 1T89C 1S3KL 2WMPA 1INQA 2EECA 5FCSH 5I1EL 4OJFH 3QQ4A 4OCWH 4OTXL 5T1MA 1DQML 3NAAL 5HYSG 1MH5A 3UC0L 1KEML 5DRXB 1U3HA 4LPUA 1F8TH 4X7EC 3PDGA 5FKAB 3FMGL 2WINB 4WUUE 1JGDA 3ARTA 4CDGC 5E9DB 4UT7L 1BM3H 5KJRH 1MSPA 1P4BL 2CIIB 4WI3A 3IRPX 5IVZB 8FABA 4XX1E 1WWWX 4P5MB 4P4KD 3EBAA 3D85D 4OLXL 2CLVA 2ICWB 1MJ8H 3F8UB 4GBXD 4JCMA 4J3VA 5HDBF 3PHOA 1NLDH 3WS3A 3ZKND 4IRJC 1BF2A 5IMKB 5D70H 4JO1H 3MJ9H 2W9LA 4MNGE 3QUXB 4W4OC 3KPRB 1I3GH 1VPOL 1MHPH 1FFOB 3SDDC 2EO9A 3TZVD 1EA9C 1O0VA 4RISL 2X4UB 2DWDB 4XNMB 1MJ8L 1HH9A 4JRYB 4PLKD 3BIAX 3MO1A 4L9LB 4AT6A 1UYWL 4HKXA 3R1GL 2DI8A 1ZV5A 3IDXH 5J6GB 1VDGA 4LCUA 3MV8B 4FZ8H 1IMHC 4Y89A 3HG1B 1OSPH 4GG8B 1F3DH 1Z0MA 2GCYA 3L3HA 4P9HH 3SDCB 1QLFA 4HGWA 1TJHL 4KI5F 4KTYA 2PW2B 2NY1D 3O6MH 3PP3K 4M7ZB 3H3BC 4OZGF 3HPJB 3BQUC 3F7QA 2JB5H 1DQMH 3O6LL 3BAEL 1OGAE 4N8CL 1NCNA 3WHE0 3ARVA 2J2ZA 1YNTB 2UUDK 3VFOA 2HMID 4YDVA 1OAKL 1PZ5A 3ZDZF 1Q9OB 4U1IB 1J0YA 4KU1A 2NYYC 4P48A 3QUKB 3RWGA 3WLWC 3O6LH 3KHOA 3PGFH 2FZ3B 5MERB 4JY5H 3H9HA 5KSAD 5I66B 3PHQB 4N0CC 1UCBL 3EDDA 5IG7B 2YN3A 2VDOL 2C7UA 4NBXB 5DVMA 2NY2B 2ZJSH 4LHUB 1G1YA 4NNPH 1EVUA 2FX7H 3HLAA 3FRUB 3ZT7A 2ICWI 4TVPL 1P6AB 1WC7A 2XIDA 2DMBA 3WFCL 2R23B 3FQWB 3INUL 3D39A 4MCYB 5J4MA 2NY7H 4RWYL 2ZUYA 4FXKA 3L1OH 3UTSE 5D2NA 1OT2A 5TE4L 1ZK9A 4M1DH 1U8JB 2W38A 1G84A 5FYLE 3GDBA 3R8QA 3TC9A 3TN0D 1EO8H 1U3HC 4JZJB 3U6RA 1L7TH 2CDGA 4WEBL 3DROA 3T2NH 3HE6C 2HAZA 3VWKA 1E4WL 4PV9A 4WV1C 4O58L 1PKOA 5LVEA 5JORB 1IT9H 4NKDB 5JHDD 4HQQL 3HZVA 3TT1H 5EO0A 1NFKA 4I5BA 1E4KA 2NPLX 2FECI 2IAMC 3MRHA 3BN9D 5FFLA 5E94B 3WFHA 5KVGL 3DIFB 1IGIL 2J6EL 3NN8A 5MEND 3GFUA 3UZQA 3ZDXF 5JW4M 4Z7NF 4Y19D 4EEEA 4OZHE 5GS1C 2VXTH 4LCWA 4W4OA 4Z7QE 2WQRA 5C0BA 5IV2B 4KUCF 3VFGL 3O6FD 5L9DL 4LSRH 3B2VH 4R97C 5C70A 3QIBD 4WIQA 2A38A 5ACZB 5TH2B 1F4HA 1TPXC 3REWB 3SJVB 1DL7L 3LQZB 4OSUH 4UOJA 4QXTA 1KJ3H 1DE4B 1KCVL 1ROWA 5HYJD 4L8DA 3F7VA 4QY8A 5FK9A 3HCVA 3U9PH 4NO3B 5FA4B 4XBGB 2IGFL 3JV6B 1SMOA 4LASL 1MI5B 3ARGC 5F71A 4HWUA 3H7LA 4F7MA 2J6EA 1EHXA 5K9OB 1WAAF 4F8QA 4MXQC 1RMFL 4P9MH 3PV7A 2I26N 2P45B 1NCAH 1B9ZA 4YE4L 3LKOA 5I8KL 4QY8B 4FS0A 3RGVA 1TZGH 1DQDL 2DJUA 4PGDA 4GXUM 3GKWL 3O9WD 4NM4H 5DSCA 4HK3N 5JPMA 4GBXA 4NZTL 3BGFC 3ZTJG 4OGYH 1UACL 4LCUB 1QLEL 5EU7C 4RFEB 4PJBF 1MREL 4G42B 4DGYH 5F3HB 2J6EH 1A5FH 2XFXB 2VNCA 3K8MA 3NCYP 3MBED 1A6ZB 2DQUH 4Y4KA 4S2SA 3IFOB 1GPOH 3DVGB 5IMOB 4MAYC 1BHGA 1CFSA 2BJMH 3CVHA 4KH2A 3V6OE 1PG7H 3DUUB 3GJEB 2BCKA 2GTZA 2F5BL 4EUPB 2NCMA 1IC7H 5C2BL 43C9B 4OLZL 3GK8H 3N85L 2OTWA 1FE8L 3EYFA 1AO7A 4L3EA 4DCQA 2YPVL 3DVGA 1YY9C 5IMOA 1JF1B 3ROLB 2J5LB 3JWDC 4M8QB 4WNQA 2IBGA 2N7BA 3RDTC 4HWNA 3H9SA 5HDQL 2R0KL 3RVXC 1BD2A 4JN1L 1HSAB 5D9SA 4U05A 4ZOEA 2NTFA 3SN6N 3OGOE 4WWKD 2V9TA 5SWZE 4R90H 1KPUB 4F15C 3C60D 5J06A 1I1AC 1UXWA 2DL2A 2QR0B 3TJHC 4NQDD 4MJ6A 5D5MA 4YHNB 3K46A 5CGMA 1ES0B 4PJEB 2ZJSL 3GSVB 5INCB 2IAMA 1ZEAL 3WSQL 3JUZA 1BBDH 3MYJB 3OJVC 3ES6A 1RZJH 3RUGB 4M62L 2VITB 1BVLA 2AKRA 5IJKC 4NN7C 3KAAA 4WU7A 4K94C 4K71C 3F7YA 5JO5A 4AL8L 4R4FH 4WUUD 1L0YA 4LIQL 2XKSA 3SKNA 3TIDB 1FNAA 1A6AA 5HHMD 1V05A 4XRCB 5CGYD 5HDOA 1QSED 4CNIB 2MCPH 3DBXB 5JNYB 4QGTA 4XVJL 3O9WB 3C6SA 1INDL 1U8PA 4HAGA 1DEEB 3GMQB 1XGYL 5CEZH 3MXVH 1F02I 2ADFL 1WIOA 3R06B 4IBLT 4EVNB 3K1DA 1A6UL 4C56B 4KK5D 5CLWA 2LE9A 4LK4A 4ZOCA 3E6FA 3IKCB 3CFCL 1KN2H 5E2TL 5JIPA 3OAUL 3BKYL 4HWZA 1CFQB 1CD9B 1Z9SA 5C0JB 2OP4H 1S78C 2D0HA 1A9EB 1JGUL 5E70A 3GI8L 2R0KH 4OZFH 2VLLA 3NIFE 1DVFC 4XWOD 3L3DA 3MGTA 5D1XB 1JUFA 3IDXL 4QCIA 3IDMB 4J23A 1CLOL 3O2DL 4R0LC 5MENA 3G9AB 1XGYH 3QHTC 5CEZL 5AWNH 3UDWA 2WIIA 1JYXA 3ARXA 5HI3C 2KPNA 4POUB 5DUMH 5TPWH 1X5KA 3P4MB 1FJ1A 5ANME 4Z7OF 4K9EC 4OBRA 4PJCE 2NY4D 3VXRA 1WC7B 4R4FL 5EU3A 1M05B 4E41E 1WBZA 1TTGA 3FOMA 4O2EB 4BSVA 1QQDA 4P57A 3A6CL 2VIRB 5KSVA 3O45A 2AEPH 3MLSH 1X4YA 3B8YA 2B39A 3D5OF 4P5TA 3WUWB 1TMCB 3MROB 1AIFA 2OZ4A 3T0EE 1XFPA 4DVBA 3KPOA 3FO2A 5CJQH 3SQOL 2CDFA 4UT7H 1DLFL 4LLUA 3KPMA 4OF6A 1CLCA 3UBXB 1U8LA 2F53E 1I1AA 4G3YH 1KENH 5IJVB 1YMMD 4W6WB 5DHVB 4J8RB 5LGHL 4OD2A 3DLQR 4JPWL 4PJHB 4X4ZA 3ZYZA 3ALXA 1QSFA 3MRDB 4XCNA 1EERB 4LLYB 4JRXB 3VRIB 1KIRA 5KOMC 4OCRH 4ZS7L 4G8GE 1SY6H 5JW3L 3CH8A 5ACZA 3GBML 3W5MA 1MFCH 4JDZA 3CFJA 1BOGB 4S1RL 2B8OT 1J05A 1LVEA 2W65A 1D7FA 2VLJE 4Q2ZA 3C5ZC 5FM5M 3UJIL 2IANE 3C2AH 5EZLA 1LP9F 2ZKHL 4UB0L 5C0BB 5IV2A 4XC3H 4WU5B 1SBSH 3J7HA 3T0DA 1CGVA 5FK9B 4UIMA 5HY9B 5E9DD 2FO4B 3QEUA 4NRYB 4XHQA 3HAEH 4OM1H 2EDRA 1RULL 4X6DA 1ZA6B 3WNMA 4NHCH 2R0LL 3L5XH 3EDFA 4Y16A 5IHUH 4NZRL 4YHPB 2YD7A 4UTAH 2GW5A 2I5YL 4EI6B 4LPXA 5I1AA 4LPYA 3NIDF 4G8GA 5IB2B 4UNUA 1BVLB 1KTDA 2HYMA 2NY6C 4KKNA 3BZDA 1HXYA 2A0LC 1YECH 3PWUA 1MLBB 3ARPA 1I7UB 3W82A 3RIAF 1IM9A 3MBXH 4DGIL 1FC2D 4XCFL 1WJ3A 5D2NB 3OKNB 4BSJA 5EO1A 1QZ1A 3HB3D 2IH3B 4MS8D 3MOBL 3S37X 5E2WH 5HYIA 5EUKA 1C5BH 2AK4B 2VDKH 1AXTL 8FABB 2RCSH 1J1PH 2O5ZH 4GW4B 4KPHL 4X98B 3KPSD 4M7LH 3N50A 3MRIA 4R0LA 2E7BA 4N0UA 3UTTE 4OGAC 4J2XA 3TT3L 4K9EH 2OJEA 2VDOH 5GS0C 1HK6A 1NGPL 4EJ1C 3WIHH 1KCSL 1WF5A 1EMTL 1HQRB 3IFLH 4OKDA 3D25A 4X98A 5E8DH 1C5BL 4RSVA 1ZANL 1JZ3A 4CN4A 2R4RL 2PR4L 3KPRE 3AREB 3SO5A 4NQEE 3THMH 2DJSA 3Q5TA 5EU5B 5CJ5A 2WLZA 4JHAL 5EU4B 5KVMC 3MCLH 4NO5B 3U36B 2FCBA 1QOKA 3FT3B 1ZS8B 5KVDL 1E6JL 4PBXA 1A7RH 5IW3A 4APQA 5T3ZE 5BCAA 1I9EA 1KJ2L 2L4OA 3O3BB 4WW2C 3W2DL 2P5EB 4KI5C 4WO4A 4F7CA 3QPXL 1V3LA 4RMVA 4D9RE 4U7SA 3N0PB 3MV7A 4K3DH 2G5BA 3MNVB 3HE7D 1QP1A 4LOUC 5H8DA 3U7AA 4NN5B 5EZIH 5IIEA 4M1DL 3HUJB 2NX5B 3I2CH 4U1IA 3UAJD 2VZVA 1HHKA 3MOAH 5DJAB 4DWHA 2QTEA 5CKAA 1NCDH 3U46B 3AXLB 2L7JA 4J3TA 3VGDA 1FFPB 3T4YA 3AC0A 1NC2D 5CJOH 5JW4N 4YHZH 2R2HB 5D7IF 3X3GH 2XQYK 2XG5A 1DBAL 4NSKA 5INDA 3PIQB 1AGBB 1XR9A 1X3DA 3PL6A 4PJEF 4Y16C 4JFDD 3WXWL 5JXEA 3BP7B 3VH8B 1BVZA 2NZ9C 2BY3A 5BRZD 4NP4L 5KW9L 3WKMH 3TP4A 2AEQH 1PEWA 1BLNB 2H9GB 2PXYC 1LE9A 2R69H 2V9QA 3ZDZE 4JR9H 5GZND 4NT6A 3ZE2E 3K8LA 4QOKD 5AZ2H 4LCYB 1KBGH 1ZHBA 3MRBB 3MACL 1R3LA 3OKMA 4HWEL 5EO9A 1II4E 4JG1L 4ALAH 3VXSB 1AR1C 1LO5A 4OZIE 1G6RB 2UVFA 3JTTB 5HHME 2BOCA 1NBZB 2X4QB 4WGWB 3SE3A 2AXGA 4IRJD 1FBIH 2ZNXA 4U1GB 1ETZA 4KPHH 1UEMA 2AJYH 4DKFL 4BSVB 4N5EC 3NA4A 5I74B 3TBVA 2WIIB 4PJ5E 3UYPA 2IALB 5T5NF 2QQNH 3EZ8A 3LS5L 4LNVA 1R5VB 4YX2H 2CRZA 3DETC 4OQTL 3P30H 5J11C 1XGPB 3RZCB 3EOTH 5IWLA 4QCIB 3OAYK 3TO2A 3GNMH 5A2LH 4ZUWB 4MCZA 1IAII 1KEGH 1QRNA 1IAKA 3SKJL 3DRTB 1MFNA 1A7QL 3CFDB 4XPFH 5JMRA 1CG9B 3GMNA 1I9RL 3LPWA 3AAZB 4KROB 1NGQH 1PKQA 4DW2H 3QQ9C 1VEMA 4HK3J 1MHEA 2YD6A 3OSKA 1AP2A 5D72H 1FZOA 5AEAA 5KAQG 3O6KH 3OKYA 2YBRA 4C56E 2EDLA 2NY1C 4UDTA 1NAMA 4WW2A 4OZHA 2AABL 2W65B 1IC7L 3TA3B 3QIBB 5C8JA 3QG6B 3W9DA 3JXAA 3H6JA 4FFWD 4EUPH 4I18B 3JTSB 5ESAB 1K85A 3BKJL 1GPOL 4ODTL 5HJ3A 4H26A 4LDLB 5FHAH 3CNKA 3S4SG 1HYSC 1BEYH 4JDZB 2VE6B 3R8BB 5GJSH 4NO5A 4O02H 5IVXF 5EH1A 1R3JB 4BSWB 4RBPH 3X13B 1K8DA 3KJ6L 3WIFA 1MFBH 1T0NB 2FR4A 3CK0L 4EXKA 1ITBB 3RVWC 3DX6B 2Y9RT 3MQIA 3VXSD 5DD0L 3I84A 2VDMH 1HI6A 2IFFL 2CLRB 2JJWA 4KKBD 4IOSD 1DP0A 2DDQL 1MCBA 3HC0A 5KN5A 2DJ4A 1MCOH 4K2UH 4ZXBB 3J8F7 4CN1A 3H9SE 3VJ6B 1CR9H 5IEHB 4HF5H 1F11B 3FQXB 2EYRB 5TDOA 4E41D 1B0RB 4WUUB 5F97E 5F7FA 1S9VA 3S35X 5E9DE 2D03L 1S5IL 4NKOA 5CZXC 4MVBD 1BD2B 1M6OA 4PGBB 5GHWH 4HT1H 4RGOL 4LHUD 2GITB 3HE6B 2OJEB 1F11A 4GRLD 3TLRA 3HAEB 5FHBH 3T09A 3VXRD 3L6FB 2DWEB 4FQ1H 3G6DH 5AYUH 2FHBA 3LPFA 4YEFA 3HN3A 1GC1C 3DXAA 3A67L 3O4LE 3G5XB 4KK6C 1K5NA 2AK4A 2HFTA 5AG8A 4P3WA 4AMKH 5SWQB 5CZKA 5I16A 2ARWA 2PETA 2VLJD 3HLAB 3ZE0E 1R3IL 1QACA 3OKNA 1ED3A 1FVDA 2AGJH 4NCC1 1X5HA 4U1JA 2KKQA 1CGYA 4MB3A 5GISH 3QI9A 5KSAC 3JZ7A 1KB5L 3WNOA 4QRSB 2BVPB 5GRVL 4FQ2H 3KDMB 1E4WH 1UJTA 1DEEA 4PGDB 3LEXB 4PUBH 1G0YR 1UVQA 4Y1AE 2A6KA 1FO0A 4PR5B 2I9TB 2DMKA 3P11H 5J1AB 3P73A 1OF2A 1ZA6A 2DQIL 1AD9B 1RY7B 4YPGB 1HOCA 4HUVB 4PLOB 3ARYA 3NCFB 4LGSB 3ZE0F 3UPCA 2AEWA 3BGMB 1JZ6A 1EZVY 4JZOA 1X6NA 3D69A 3B3IA 2CJUH 3L3IA 3QPQD 2HVJB 4Z7UE 1SVCP 4BUGA 4JFDB 1XGQA 4J3OC 2G5BB 3MNVA 4AL8H 1ORQA 4LFHD 3MMEA 3QIWC 3BGMA 3TFKC 4KRLB 3K74B 4IHOB 1AJ7L 2R2EA 3VDAA 1UXWB 4U0RC 2X42A 4XAWL 3O3BA 1HKLL 5F8RC 2VDQL 1HILB 2IAMB 4JM2B 4KRPC 1HSAA 3VFMA 3ARFB 1PG7W 2VLMD 5FUCE 3U7WL 1CDYA 4GRMB 4AYFA 1ZVYA 2JB5L 3QXAA 1RUML 1TJGL 2VXUL 4H20L 5CINL 2WWKO 1KB5H 3L95A 1RIHH 1J10A 5E8PA 4HQQH 2XZCH 3D25B 3E6HB 4ZOAA 4KRNA 3VXOA 4KJQD 4V1DB 3VRLE 2HWZL 5BVPL 5JDSB 3RDTB 3BP5B 3OMZA 2PXYD 3B2UD 4H1LG 2AJXL 4DOHB 2E6QA 1VADA 4WI5A 1GIGL 3NZ8B 1KJVA 5BZWB 1MCPL 4NHUA 2QHRL 1ZGLM 2A73B 2VLLB 1YQVL 3BUYA 3IDNB 3I50H 2VLKB 1M7XA 1JNNL 5FHBL 1VB9A 3SBWC 4N9OB 2RIKA 3EOYG 2APXA 5IQ9A 4RMRA 1R3KA 1BQSA 1B4JL 4K3JH 3TZVA 1KFAH 5GZOD 5I1CL 3I02B 4ZXBA 4F9LC 3FRPA 2X41A 5IBTH 5EOCJ 3FQXA 4XMKL 3D3VE 3VFNA 3DUHA 1C16B 4X7DC 3DVNB 3D0LA 2OTWB 3P4NB 4R26H 1QSVA 1OGAA 4PS4H 2FEEL 2GJ6A 3TA3D 3KPSA 2VDLH 2XQYG 4MLIA 4IOFD 4XI5D 1I7ZB 3S37H 1IAOB 3OQ3B 1RMFH 1LGVA 2DTSA 1HYRC 1C12B 2FH6A 3EO9H 4OLWH 4PJGF 5J3HD 3MRQB 32C2B 5D7KD 4R2GB 3MV01 1YEHH 3QUKA 4GAJH 3UC0H 1JNNH 4JG0L 4KJWC 2EDTA 3O2VH 3HZYA 1E4XL 4TVPD 1SM3H 4P46C 1OOAA 5KZCB 5B39A 1ZGLP 4PP2B 4NFBA 4HUWA 1B88A 3L5WA 2DYPB 12E8L 3QEQB 3V5KA 3SGKC 2VOTA 3VXQA 2QHLA 3LRSA 4IS6A 1N26A 4J4PD 4QHUA 4Y4FB 2VDKL 3PGCA 1UA6H 4NFCA 4QF1B 1BGXH 4FP8L 4K8RD 4OZ4A 1LP9B 4HHAB 2CMRH 3AMLA 5IROA 1F3JA 5C0CA 1QFWH 1MI5A 3HNVH 1EV2E 2F54A 5IJVA 2GK0B 4OD2B 1D3CA 3MBXL 1QPPA 1B6UA 5F3BA 2P24B 4PGEB 1DE4A 5IFJA 4PJ8A 1ORSB 3CJJA 4HG4J 1AIFB 4JZJA 3QPXH 4IMKA 4KAQL 5I74C 1WEJL 4OIIH 5IB3A 3VGBA 3QO0A 3QXDA 5GJTL 1D6VH 4UT9H 4X4YA 1CK0H 5F7NC 4E5XA 5D96B 3MJ9A 1C8PA 1B6DA 2DLEA 3MRNA 5HHXH 1A21A 4FQIL 1CFVL 2XFXA 1RULH 5DLMH 3TH4T 4V2BA 1MF2H 2JKXA 2NY2C 3CU1A 3SDYH 3MCKB 3W39B 3LSOA 1HCVA 1A6VH 5IGXL 1PLGL 4LVHC 4Z7NE 4NWUL 1G9MH 1JWSB 1NC4B 4U1LB 4F3FB 1AD0A 5T3XH 1N59B 4Q9QL 4DKDC 4H25B 4MA1C 1QFWI 2FGWH 2XQBL 2CKNA 3BJ91 3A6BL 2YKLL 3KYNB 1CICD 2VDML 2HFFB 5D2LE 1PAMA 3O4LA 5F1OB 4WHDA 3GSNH 1RHFA 1IGMH 4XAKD 3HI5L 5ITBL 3EAKA 2BSED 5GRUH 1J8HE 1VFAB 2VR5A 3G6JA 4ORZC 3BRGC 3UJJH 3SCMB 5HGAB 1K2DB 3RKDD 1UJ3C 4KXZH 2W9EH 3TO4C 4HIHB 4K7PL 2A73A 1J9CT 3R4DA 4YBQC 4KDVA 4U3CA 2MOVA 4MA8H 2W91A 4XPTL 1JHTA 5GGSB 1I9RH 1JN6B 1OARL 2ZCKH 2E6PA 1I7TA 1KFAL 2PYED 3SKNB 3TIDA 1A6AB 4EDXA 3BRDA 5C0RH 2SEBB 2VLRB 3BEVB 5DWUL 5BS0A 1FVEB 3JWDH 4TSCL 4WHYH 2AK4E 5AWNL 4P99A 3VFOB 3B9AA 4P5TD 2MHAB 3MGOB 2NY5C 3RL1A 4YNYB 2RR3A 1T21A 5FKPB 1Z3GH 1A7QH 5BVJA 4H26B 4J1UB 4TULL 3EO1B 4JM2A 4XVUD 2XKUA 5LBSL 1FIGL 2VIRA 1KNOB 4K23L 3P9LB 3ARGB 3NCBB 4OAWA 4Y5XA 1RK0A 2Y25A 4BKLB 1QFWL 3QIUD 1TZIB 1AKJA 4BJLA 2FJGA 3TGXA 3KVQA 4OLXH 4FQXB 1INEL 1I9JH 3ESUF 4QWWD 5A16A 1MNUL 4M5YL 4LLQA 5J13B 3D39B 3DOSA 4X4MA 3OKOA 4LMQI 1QBAA 4Y2OA 1IL1B 5FUOH 4QHKJ 1OAQH 1J86A 1MFDL 3MR9A 2DIBA 5KN5B 1TQBB 1IKNC 3CXDL 4ZUTB 1QHOA 1EBPA 1TNMA 5JXAH 3HNSH 2P5EE 3DXAD 1MWAA 3X3FL 2HTKD 4N9GA 2AK4D 2EZ0C 1UWXK 4NQDA 1XZ0B 2F53B 2X4RA 1U3YA 4QTHB 1VHPA 4IRSB 1MF2L 1B90A 4TUJB 3T8XA 1NGYB 2XTLA 4MD5B 5C09B 2IH3A 3RY4A 2G9HA 1W72B 3NABL 1IJ9A 1IGJA 3F58L 3K3QA 3R1GH 4FQXA 4KKCC 2BNRA 2VDPL 3GMLA 1XF3B 1INEH 1NBYB 1QO3B 2XICA 5DEFA 3S96B 2AV1B 3WO4B 5E4IA 1WV7T 2CPCA 3IDGB 2I9LA 1LD9B 1ZEAH 5IQ9B 4PJDF 5KS9A 1Q9LB 3TESA 4IDLA 5I1AB 4F7PA 3K2MC 5LBSH 2EDNA 4JANB 1J8HB 2H26B 5L7XH 1UWEH 1NQBA 1NGXA 1OAUH 1OGTA 4HGKC 2ILLA 5GXBB 2DL9A 1LE9B 2ZUWA 1CD8A 5IHZA 5F9AC 3SE8H 3MRCB 2GYSA 4G43B 1LE5A 1JGLH 1MCQA 4M7JL 2FX9H 4ONHA 3W9EB 4W68A 4L8DB 4ZD3H 1GIGH 2VZOA 4HDIA 2B5IC 2EYTA 3SDCC 3P9MA 5CJXA 4ORGB 1X5GA 1JPTL 4TQEL 3CSYA 4R2GC 1ZS8A 5KS9F 2Y23A 5FDWB 3V5KB 1CVRA 3FMGH 5J12B 1EZVX 2WSKA 1JFQL 4LSTL 4Z7WE 3C5JA 1I9IH 1JBJA 3HZKA 5EZLB 2GK2A 2YUWA 2NY5H 2PYEE 3OWEA 1WZLA 4YGAB 5IKCA 3QDGD 1UWGL 5HHMB 3L3JA 1H0DB 1F4AA 4HUMB 3QUML 1X44A 1MFEH 3BUTA 4PY8I 3IU3A 1Q9WB 3X3FH 3UPRA 1P9MA 32C2A 3L3KA 2C1PB 2EDOA 2DKSA 2R69L 1S7UA 5E94A 3WFHB 5IVXB 1QEWA 3DIFA 1UADC 1BBJB 1KLGA 1BQHG 1ED3B 1FZMA 1WCQA 4H0GA 1A7PH 4MD0A 5IEKB 2G5RA 4YE4H 3RVUD 1BVKA 3DUUA 3MLWH 3V0WL 3RX7A 4QGYA 2F74B 3MLRH 3DPBA 4L4VD 4H0IA 1TVHA 1PLGH 3VXUA 3IDJB 3VXNB 5IMLB 5D4QA 4H5SB 2X4TB 1ZLVH 1ZT4B 4OKVA 2EDWA 1EO7A 1HQ4A 4YBHA 2AK1L 4PJGE 3VMPA 1MWAH 1JWMB 2RBLA 2Q7YA 4HIXL 4NKIH 3O2DA 4KQ3H 5D2NC 3O3EA 1R0AH 4OKVB 1JK8A 2P49B 1KV3A 5KSBA 5GRXG 4RGNC 3IGAA 2L0DA 5E1AB 4FQXC 3OKOB 3VWKC 3BD3A 1S5HA 4MA3B 4NRYA 1MJJA 5E6ID 4BM7A 3V6FA 3DX6A 1NH6A 3ARFC 2PW1A 5E5MB 1QNZH 2GI7A 1MRFH 3KPRD 5FM5O 3FONB 4YZFF 1H8NA 1H5BB 1RFDL 4HFWB 1AR1D 1F4WH 3VFMB 3W39A 2ZUQB 3E2HC 4JFXA 4OCMC 4Z77B 4F7CB 3OAUH 1L4IA 1YC7A 2BC4B 1N8ZB 3MRKA 2IMNA 1KN2L 1FPTH 2M2DA 4JRWA 3CPLB 4UILL 4DTGH 3MRRA 2C3WA 3AROA 3HMWL 3MV11 2O5YH 4CGTA 1IC5L 4P2QD 2XG4A 4OZGB 2GUOB 2BY0A 2P1YA 4ISVA 1FLTX 2XZAH 2NW3B 3C60B 1MRDL 4G80B 5DGRA 4HIJA 3V4PL 1HH9B 4BK4A 1FH5L 5GIRB 4XP9H 5DVNA 4LIQH 4BH8B 3L5IA 5TE6L 1YEDA 2JJTC 2NW3A 2PO6C 1OP5K 2DD8H 2DM2A 4CW1A 3RWFB 1NGXB 1YEKH 3IDYB 1CXKA 2A6JB 3VXRB 2AJ3B 1XGPA 3RZCA 3T0EC 4LQ1A 4HWBL 3H7BB 4MA1B 4OZGA 1AGEA 2FX9L 25C8L 4X6EA 4ORGA 1HEZB 5BXFB 5HVGB 4JFFA 4N0FB 1NBVH 5A2JH 2CIKB 3PABB 4NCC2 5BRZE 3WNKA 1CLYL 1IQWL 2F53D 4NJ9L 5EU4A 2QL1A 3GI8H 3T65B 4DUVA 4HV8B 3I50L 4PRPB 5MP6H 1U92A 4X6BA 4NNXA 4XX1G 5CP7A 3X12A 1RUQL 3W11D 4YPGA 3PHQA 2F53A 1UZ6E 1H8SA 3MA9H 2VXVL 2BMKA 5FM8A 5J6HB 3IFNL 1L7TL 4Z9KB 2ZUVA 1DR9A 5F6HJ 3RHWK 2EDDA 3NVQA 4JCLA 4XNUH 5B8CC 1KLGB 4FXLA 3T0BA 1MIML 4R4BA 1AQDA 1XMWA 12E8H 4M5ZH 1HIML 5GS0L 3ROOA 4L29B 5GGTL 1RUQH 1TJGH 2VLJA 5LQBH 5J56B 5FGBA 5HY9A 3MC0A 2V5YA 4ACPA 1NCWH 2XYCA 4WEMB 4LCIH 5EZJA 4LSSH 4QRQA 2F74A 1IQWH 4NJ9H 3SQBA 4FA8A 3WN5B 1NBQA 4LSQL 1JHLL 1RZFH 3WYRA 3H9ZA 4U1MA 1HI6B 2HLFD 4UT6H 4Z18A 3VI4E 1OWWA 1ZT1A 5F3BB 3LKOB 1F13A 2YBRB 3M17A 1P1ZA 4X6DF 4DGVH 1HXMA 3NGBB 3VXSE 4HK0A 5DJ0B 4I9WE 3CFBA 5E1HB 4J1UA 3VWJD 2HJFA 5F7YC 2F54B 1OQOA 1OGTB 5D7JA 3VGGA 4M9PA 1UC6A 3HRZA 4KZEL 4L9LC 1ZWIA 4HLZH 3U4AA 4KHXL 4BUHA 3QHFL 5JHDB 3BN9C 2DWDA 5F1KC 4CJ1A 1A7BA 1JN6A 1OAZL 1S3KH 3VXRE 3GGWB 4QHNA 4Q0XH 1UWXH 4OGXH 1HXYB 2XV6B 1YPZF 3BYTA 2VXQL 5HHQB 4MNQE 1FL5B 1H15B 5DD1L 1MNUH 1BZ7A 4KJQC 3BQUB 1HSBA 1HDMB 4DCQB 4G43A 4DTGL 4ELKA 1G9NC 2O61A 2E7LC 4WJ5B 3MLUL 1I3RB 4Z8FH 2O5XL 1JF6A 4BQ6A 4OI9A 5IMMA 3BW9B 3P9MB 1S7WB 4CL7A 5C09E 2G60L 4OCSH 4ELMA 2Y7QB 3QRFM 1I3GL 1VPOH 4YHYB 5CSGA 5D7IE 3MREB 2DQEH 5ID0A 1MFAH 2GJ6B 2IPTL 4JFZH 2APWA 4U2ZA 4I3RH 5L2KD 2AVGA 3M1BB 5JOFB 4CADB 1ES0A 5FYLD 2EYSB 4FZEL 4HS8H 4CU8A 4I2XA 4I4WA 3S98A 1NBYA 1QO3A 3KLHD 3DURB 2AV1A 3F62A 3L5JA 4PRPE 1CIUA 3QIWD 2AJYL 4DEPB 4DKFH 3TFKD 4DKEH 1JGEA 1FAKT 5DHYB 3OGCB 2RGSA 5ICXB 4YXLH 3RY6C 3EYVB 1BF8A 3RTQA 3SY0A 5HXMA 3C2AL 3FO9A 3IGAB 4F57H 1MWAB 3MFGB 4UOW0 4PJGA 3CLEL 1MQ8A 3HTLX 1JWUA 1OM3H 5ID0B 15C8L 4YAQA 4JR9L 1Q1JL 4S2SB 2QADB 2CUHA 1A7PL 2WUBH 5SWQA 1L9NA 3CDCA 2R4RH 5L9DH 1U92B 2AQ1A 5HD8D 1MCDA 1TCMA 1TFHA 3HMWH 3L9RA 3Q1SL 1X4ZA 3OR6A 4K8RC 2VUYA 1OAYL 5A16B 2HP4A 3HFML 5KVGH 3B9KA 5CIPB 2O93L 1KTRL 3E8UH 4S11A 1HOCB 5D6DA 2JCCE 1Z9LA 3RVTD 2A6KB 1HWHB 4X4XA 4E42B 2J88H 4PG2A 1DQQA 5LKNA 3B9KB 4F80A 1ORQB 2H32H 2ITCA 3V4UH 3FFCA 2ZNWA 4G6FD 4JFDA 4PGCB 1S7QA 4BFIA 2V2XB 3S35L 2F15A 2BNRE 4WY7L 3CGTA 3REWA 4YH6A 5TQ2L 3D69B 2NY7L 1D6VL 3ULUD 4V1DE 1YN6A 3FKUS 3P77B 3PP4L 3R0MA 2NY4C 4K07A 4HXBL 1RHHA 3CH1B 4IRJB 4PY7B 3VFSB 4OIBA 3UYRH 4D9LL 4Z76A 1CR9L 3WFDL 4NQXA 3RWIA 4WEBH 3LS4H 5A2IH 4P59H 5JIIA 5KSVB 2E7LA 1AHWA 2OL3B 3P30L 1A7OH 1IAMA 1OGAB 2DLGA 1HHIA 3DBXA 5JNYA 2MMXA 5IBLD 1QFUL 3DX9B 5F7MC 1MJ7L 5GSVA 1GYAA 4M6NH 4QRSA 4XB7A 3G5YA 4JVWA 5IIEB 3FOLA 1C12A 4CKVX 5JOPE 1IAIL 1UQSA 5JPMB 1FRGL 5FGSA 1JNJA 1CDCA 2D7QA 4ZFFB 3MODH 4X6FB 3MRDA 4PLJD 4F8TA 3CK0H 5CGYC 1Q9LA 2CDGB 4JY6A 3E2HB 3OAZK 1W72L 3BUYB 4NDMB 3JVGC 4TYUA 3VXOB 1IAKB 1QSZA 3BW9A 3WV0A 3GJEA 1DBBL 3LKNA 4ZNEE 2J12B 2DQFA 1OAKH 4WTWA 3I3EA 3LQAL 2OS7A 1LP9A 2KZ1B 4HHAA 2E7MA 1NEZA 4I3RL 4LDOB 1IGFL 5D5ME 4LF3A 1CGWA 3MJ8B 2C3HA 2IPTH 5HGHA 5IFHL 4OD1H 1R3JA 5D96C 1KB9J 2MFNA 4G5ZL 3QEQE 4IDJL 4WEUD 4LAQL 2Y07H 5IB2A 1KOAA 3ABZA 5EOCL 1PQZA 1J5OH 3CCHB 5BV7H 4MD0B 4F7TB 3UO1L 3AS0A 2RAMA 1OSZB 3QUMA 4OUUA 2F19H 2HLFC 4NQCE 4PJDE 2Z8SA 1J8HA 5GGVH 4DVBB 1AE6H 2R4SH 1RZ8A 2KQNA 2P8PA 1UXSA 1G7JA 2FBJH 3VXQB 4F7TA 1PJ9A 4XAWH 4C55A 2DYPA 3PHSA 3DMMA 3QEQA 5IB1A 5F89B 3RU8L 4FQCL 2XWTB 4PJ7B 4JRXE 2H32A 4GW1A 1KXTB 5JW5A 1BQHB 3C6LD 4LPCA 1F45A 7CGTA 1JPGA 4TVPE 4ZDHB 1DQJA 3EFFA 3STLB 3QWRD 2XRAH 5DJCA 4I13B 1MREH 4NQTA 1VACB 2FX8H 1D5IH 5DD3H 2VQ1A 1H3PH 1C5DA 2WV3A 4HKJB 2W1NA 4KGLA 1HZHL 5CMAB 3GSNL 2PXYA 2FLBT 3NPSB 4P2QB 4ZTPH 1OP5H 1DUZA 5GRUL 2FX8L 3QI9B 3RQ3A 4YC2C 3WXVL 1RZKC 3GMOB 5ITBH 1DSFL 5MHSD 4TUKL 5ELIA 5DD5L 2OK0H 4L4JA 5FDYA 1PSKH 5C0AE 3FQUB 2V7HB 2ZUXA 1RI8A 4LASH 5ICXA 1YUHA 2NY3B 1FNEB 4Z0XA 3ZTNH 1XF2A 4LCCC 1DBAH 2G75B 4F3FA 2WBJB 3FO1A 3GHBH 4DEPC 3UTZA 3RZCD 4I4WB 3W0WA 3FN0H 1OTTC 3WMSA 2D31B 2NY4B 1GGIH 3E0GA 5EC2B 5GGVL 5AYQA 1A7OL 4X6CB 4LRIC 3K2UH 4P59L 3A67H 5IKCB 5DUPL 4TSCH 5C0GA 3S5LB 2APTA 5F9JB 3QNZA 2FH8A 1NFIB 3H9SB 1OTSC 2BXYA 4N9GB 2EDQA 3W0WD 4KI5D 4NSKB 3JV4B 3VJ6A 3BH8B 5H2BA 3PQYA 3RNKB 1UM5L 4XCEB 5F6IB 3BT2L 2HLAA 3QDGB 4JZOB 3TA3C 4NKMA 5KANI 1U8OB 3RHWF 2YRLA 1WT5A 4NKOB 1J8HD 2J8UA 4Q74A 1ZVSA 2ICCA 3AVEA 3MYJA 2BP3A 5IUSA 3O3DB 3OTTA 1R6VA 4WHCA 1A6ZA 4GJTB 4Y4KB 3V4UL 1GZPB 5DR5H 2X44D 4ONGH 2VDNL 3EOAB 5I8EA 4LSUH 3H42L 5TE6H 2XNAB 4JQIH 5ACLA 4PJXB 4Q6IA 1ZANH 4H88H 1PG7X 1J0ZA 4HH9A 4OF3A 4Z7WB 5JXAL 1ZGLA 3PG2A 2V2WA 4MHHI 5KSUB 2X4NA 3R0NA 4NIKB 2XZAL 4WNQB 3CX5K 4BELD 2MHAA 5D7SH 1LO3L 4GAGL 2P5WD 3KPLB 2R8SH 1GH7A 3AM8A 4X4XB 5DJZB 1GL4B 5DJ2A 1DQDH 1KENL 3FB8B 5IGXH 3NH7L 5ERWB 3UTQA 5BRZB 2A1WH 3MV7B 3PXJA 3UTSB 2OL3L 1KG0B 4U1HB 1NDGA 2PW2A 1V8HA 4NNYA 3ZE2F 4OZIA 4KUZH 3FOMB 4O2EA 4PTTB 1QYGL 4U6VL 3H3PH 4ZUWA 4AEFA 4L29A 4TSBL 3PE9A 1NC2B 4TOYL 4AIZA 5BJTB 4K8RH 4MDJA 1BEYL 3BZFB 3VD5A 4LVNC 2OR8A 3ET9F 5H37G 1TJIH 3N85H 4MZ2A 4YAQB 3SE9L 1UT9A 4NRXA 3QDJB 3ARFD 1D5ZA 1MCLA 5IG7A 4Q97A 2DTML 4OZHF 4LCCA 2YC1A 5DMGD 1CDJA 1KPRB 3KPOB 3VFRB 1SYSA 3QULB 3N1MC 4X8JB 3AFLA 1UYWH 3F7VB 3ALWA 5AUMB 5I17B 2JELL 5GRVK 4UTBL 1OTUC 1T1XA 4Y16D 4X6EB 4XXCA 1DFBL 1QQDB 4JFFB 1VESA 5E2VL 6FABL 3LDBB 5B3JF 1NMAL 2R56H 1MHPL 3QI9C 4TUKH 5IVXA 2CR6A 5GSRA 2VXQH 4H8WH 2B1AH 4JG1H 1I8MB 1EO8L 2F54E 2GSGA 4XP1L 4QHLB 3CX5J 3HKFA 2AV7A 4U1NB 4XP4H 5C0AA 1I7RB 4Z7VA 4DZBB 5C0IA 4MAUL 2X4SA 2YRZA 1JVKA 4JRYE 4MQ7A 4LEXH 4PGZA 1A4KB 3MRGA 3C09B 1UB5A 1L6ZA 3TO4B 2MCPL 3FL7A 2XQBH 2IMMA 5KW9H 4ONHB 1P2CB 5L6YL 4XP6L 5K9QG 3TJEH 4ELME 2H2PD 2YXFA 4NNPL 2HMIC 2P5WB 5ISZA 3DRQB 4M6MH 4GKSB 2X1OA 4RX4D 4WU5A 2NZIA 1X5XA 4I9WD 4NN5C 4IOIA 2XY2A 2Y1VA 2IQ9H 2NNAA 3MV9A 2UUDH 1WIPA 3X14A 4QOKE 1NCDL 3KYAA 4P5TB 1CK0L 1NC4A 1QFUH 1RZFL 1KPUA 4MXWH 4U1LA 1FN4A 1M7DA 4LVHB 1HH6B 4XH2A 3B43A 3BEWB 2JLLA 3KYOA 4GH7B 4RDQG 2F8XC 1WIUA 1HXMB 4MYWB 4Y8AA 3N9GH 3HMXL 3FRPG 2D7TH 2A77L 3OL2A 1KLUB 2PCPB 2DQTH 4JN1H 3UZVB 3OKKB 1B4RA 5DJXA 1P7KB 3BKCL 1DFBH 1LO4L 4M7KH 3TVMD 5C7XL 2OP4L 3MRFA 3DHJA 2MQ0A 1NAMH 2WWKT 3LMJL 3MRJA 5KG9B 3GSXB 5ENWB 3O0RL 3ZT5A 2E5EA 1YEGH 5CS7A 4LCYA 4EI5C 3QFDA 3SDXE 4GW5A 1N5AA 2EKJA 4FFVC 5L2KB 3O8XC 2E7CA 1G7IB 5EU6A 3GRWH 1DDHA 4IEFB 1V3MA 5C0BE 4JFFE 1L0QA 1P84K 3SE9H 1A1OB 3NTCH 3DXAE 3TV3L 4F15B 6CGTA 4JO3L 5D1XC 5DSCB 2H3NA 4UI2A 1U8NA 4G6ML 4U1GC 4TSBH 4YHLL 1CXEA 5J11B 1AY1L 5KVDH 4NQSB 1F3RB 3H3PL 1W8NA 2D9CA 1ZTXL 1JF1A 3ROLA 3AXLA 2DD8L 3V9FA 3Q5YA 4JO4L 2QV2A 3MOBH 5JR1L 1HCFX 1Q1JH 2HT3C 4A6YA 4JE4B 5ID1B 3DV6A 3FZUC 4ELMB 3UTZB 3QH3A 3RWEB 1X5YA 4M03A 4Z5RB 2OL3A 1S7XB 5D2NE 2NR6D 4X7SH 5MEOB 2W59A 4MVBC 4MZ3A 1DL7H 4OSUL 4RX4A 3TBSB 1UVQB 2ED8A 3KJ6H 3P77A 4GG6F 4J3SA 5SWSD 3DV4A 5T3XD 3WJLC 2AERT 1U3HD 5TQ2H 5J13C 2NY1B 5F9WB 4OV5B 2AGJL 3QJHB 3U0TB 3L5XL 5DVKA 5TDPB 4C83A 3BKJH 3JTSA 3LCYA 5E4EB 4NC1E 5EN2B 3F5WB 3EIFA 2DIAA 4L4TA 1GHFH 3T4YB 1JHKH 5F7DB 1EJ6A 1XGQB 3QA3A 5IROC 4NGHH 2WUCL 1X7QB 1PW3A 4WO4D 4B0MM 3DV6B 5FUZH 2EKSA 3G6JB 2OBGA 1CDBA 3GSRA 3UPAA 1B0WA 4HC1H 3NCEB 3S3PA 3UBXA 1MY7A 4Z7UB 3O3AA 5T1DL 2E3VA 1G7PB 3S5LG 4PJ8C 1NFDE 2NY3D 1T2QH 1UACH 2CQVA 4NZRH 1F42A 2ESVB 1ZOXA 1JRHL 1MQKL 4WO4B 4GO6B 1ZLUK 5FGCE 4JRXA 3VRIA 1KJMA 3V7AE 2PW1B 4KK9D 1OWRM 5IM7B 5IK3B 3MFFA 2DDQH 3PWJB 2JTDA 3ARRA 3RGHA 3EYOB 3GSWA 5CD3A 1W0YT 2OTUB 2C1OA 5I1LA 3HUJE 1FIEA 5JW3H 1PFCA 4XCEA 1WWBX 3IDMA 2X4QA 3QWOB 1N6UA 3KHQA 4IMLA 1TZHB 4OZIB 4MDIA 3P2TA 4OZFG 4MA7H 2VZUA 4PGCA 1T5XB 3G5XA 4MQSB 2ZG1A 2J8OA 2X89D 1XIWB 2C3VB 3WJJA 3MRPB 3O6FB 4F2MA 1TCRB 3SKUD 1EPFA 2LTQC 4R3SB 3CDGB 2Q3ZA 4G6MH 1KBGL 2QBWA 1MFEL 5DJDB 3ZYJA 3LQAC 3S88L 3EJZC 1N0XH 1IM9B 2EDEA 3QDAA 2AEPL 4PJDB 4D0CB 3W9DB 5C09D 4LL9A 4DN4L 1CIDA 4ZFZA 4P4KC 5KVEL 2YXMA 1QFWM 5DGQA 5I15H 1ZHBB 1CDHA 1GGTA 3O4LD 4RAVB 4F33A 3MUZ1 4HBCH 1MHHB 3OJ2C 4QXGH 4AMKL 1YEIL 4CNIA 3RU8H 4KVCL 1UQSB 4DZ8A 1R0AL 1ITCA 3VGAB 1U8PB 3KYKL 1E4XI 4M48L 5J1TC 5CMAA 2CDEB 4JZNA 3LIZL 4PP1C 4XC1L 1P2CA 1RZ7H 4YHML 2OR9H 4JDTL 1FDLH 4C56A 9CGTA 1NFDA 3FQTB 4TVPH 3D9AL 3WD5L 5F7HA 2VE6A 4K71B 2H2PC 3RWHA 4KVCH 1ZA3B 1MY5A 5DZNA 5T1LD 1CD0A 2ZUUA 5CEXB 2BNQD 1QSFD 4MSWA 4RGNE 5EDXA 5E8EA 2GAZB 4PREA 4OLWL 1KIRB 4KJYA 4LAQH 2K3TA 3KPLA 4JFEB 3WE6A 1J0KA 1X5IA 5IVZA 3DMMB 3T0ED 4ALAL 1T20B 1T5WA 3CMOL 1U8QA 3V0VA 5DK3A 2A6IA 1VFUA 1J7VR 1HINL 4LEOB 1D5MA 2A9NH 3RVTC 1CTOA 3S9DB 4JHAH 4XNZC 5F9JA 2CRMA 3S5LA 3IF1A 2FO1A 3M45A 3THML 5IEHA 4QT5B 3LQMA 1M7IA 3CMOH 4O02L 1NDMB 3BISA 1K5NB 5GRZA 5L88L 4JRXD 4QRPD 3MRFB 2QSCH 4R7DA 2EO1A 3G5ZA 4PRIE 3BWAB 1WBZB 3KWWA 1FG2A 2VISB 5D1ZB 3FO0H 3SY0B 3NCJL 1J1PL 2ZP0T 3U83A 4HJGB 5D9SB 5D7LA 4F7EA 1YPZE 2ZCHL 5INDB 4FFZL 1BPVA 1FG2B 1A22B 1P7QA 4JQXA 3ZLQC 1SYVA 4K55A 4S1SH 3VFRA 5BMFH 4NBZB 4NQDE 4RFNB 2CK2A 3ZDXE 4ODSH 1KTLA 3I3BA 4XVUC 1YNTA 2YOCA 4D9QD 4ZTOL 3QJFA 3MRBA 2V2WB 5KSUA 4PD4J 1N3NB 1XGUB 1ZMYA 3SKOB 1A3QA 1D9KB 2HT2D 4KK8D 1LNUB 2FJGB 3E6FB 3IKCA 3VI4F 1KTLB 2IC2A 5IBUB 1FL6A 1I8KA 2PTVA 3F58H 2X70B 3DO7B 1E28B 1IBGL 2KUTA 1CXFA 1X6LA 3C8KA 2WK2A 1CLZH 4O4YH 3IXTB 3MV7E 2X7LB 2J8UB 3ZKQD 3R06A 1OB1B 1V3JA 4Y4HC 4KJPC 3WFEH 4OCRL 3E3QE 2X70A 4XNMA 3DO7A 4YBQD 4HWBA 4LQFL 2H1PH 2EH7H 4QRRE 1T22A 5IB5A 4NO0A 1QLRA 3U30B 4OGZA 2XWJA 1I4FA 2E6JA 5ANMA 5AUMA 3AGVA 4KDTA 1CG9A 1S7QB 3D39E 4CBPA 1ZHNB 4PJGB 1QSFE 1S8DB 4JFEE 4LU5L 1FL6B 1I8KB 5BZDB 2P43B 1XR8B 3IJYA 1QBBA 1DLFH 15C8H 1D5IL 4L5FH 2VABA 3LRGA 3IETB 5HSFA 1VFOA 1YN7B 2H8PB 3ECBA 4Q9QH 4JFOA 4RRPA 2QKIA 4UDUA 1U8NB 2H9GA 1RZ7L 2C26A 4YIQA 4YHMH 1PYWA 2WBJC 4HUXB 2W0FA 5KAQF 4D8PA 2Z8WC 1IE5A 3A6OA 4XGZA 1NSNL 5AAMA 2EIZA 1RVFL 2I60L 1XIWD 4NQCD 3O3AB 1JV5A 3DNKA 5HHXL 4C59B 2CGRL 1IKFL 5EIIB 2QSVA 3L7FA 3VXSA 1JHKL 1CLOH 4ZSOA 4Y4KD 3SGDI 4NQDB 2AQ3A 5GHWL 4HCRH 4E0RA 4U1HA 1D9KD 2NW2B 3BDYL 1E6OH 3EJYC 2GTWA 4U6VH 3HCVB 4NPYB 5E5RB 1A7RL 4KAQH 2PN5A 4F37K 2DQEL 5IK3A 5IM7A 5BQ7B 3H9HB 4FQHA 3QUYB 3TCLB 2EZ0D 3ARFA 1YNKH 3K80A 1SEQH 5HHQA 3SO3B 1FN4B 3FRUA 1LILA 2PR4H 3BKYH 2Z92B 1S9XA 2WP3O 3C60C 3KG5A 4JPWH 1CFTB 3L1OL 3VU2A 2P24A 3QDMA 4JO4H 4PGEA 5IFJB 5HYJA 4XB8A 4HPYH 5HGDA 3KR3L 3S36H 1CGSH 1X4XA 3LKSB 1RZ8B 1S7TA 4FQJH 4UINL 1P4LA 2N4IA 4KDWA 3BEWA 3DI3B 5HGBA 1HHGA 1DSFH 1K6QL 4GQPH 1SJHB 4PJHF 5HI4D 4KWUA 4XMLL 4PJAB 3QDMB 2X6MA 1R5IB 4NKDA 2LAGB 2MTPA 1BD2E 3BEVA 1QFOA 2Y6SD 1T04B 3QDJE 3IJHA 3C5JB 4BFGA 5D8JL 3IB4A 4R26L 4NCDA 4MWFA 1JPGB 2B1HL 4ZPVB 3V5DA 3QJHA 5JPNA 2R4SL 3OZ9H 3KPTA 1A8JH 1KLFA 1KIQA 2OMBA 1N5YL 2X4SB 4LCWB 4N0UB 1RZJL 2AW2A 5F89A 5SV4A 3QQ3B 5EU6B 1GGBL 3T0EA 4R8WH 4P2OA 3FTGB 2Q7NA 5E2UH 3FQNA 5GRWA 1G7MB 2BVQB 1IGYA 1RUPH 4HMDA 5GSRB 5GGRA 1NAML 1IGTA 2VMFA 3CFKA 5K33A 4ZUUB 2BNQA 2LABA 2BDNH 3ZO0A 5D7JB 1YY8A 3NIFF 4FABH 4UQ2B 2O5XH 4Q6YA 1XGTA 2K9UA 2GIYA 4YHKL 3MLZL 1RZKL 2APVA 2VN4A 5JOEA 3L6FA 2CD0A 5T1KD 3JWDL 4WY7H 2FIRT 4WRLA 1K9TA 2PCPA 2WBJA 3FO1B 3LMJH 4C57C 5F7LB 3OKEB 2BSSA 2YPLB 5I1JL 3BMVA 5ANMB 5BVPH 4XVTL 5T3ZH 3LQAH 4YHKH 1C5CH 5KANG 4OQTA 2BSTA 5CD3B 1U8KB 4YC2B 3V6BR 2EEDA 3CSPA 5IFAH 3HMXH 3N9GL 4EQ3A 3O4OC 2PF6A 2A9ML 1IGYB 2BZDA 2VISA 5D1ZA 3F7RA 1M71B 4OGYL 4I1NB 5K59E 4FNLL 4U6XA 4LRNL 1I7UA 2DAVA 3HMXA 1KIUA 4P2RD 4URTB 1KB9K 4JGUA 2V6HA 4XNQA 2EEAA 4I77L 4XP6H 4MJIE 1DVFB 1O5DT 4TSAH 1YYML 4N0RA 1FFPA 5JA9A 4GLRI 2XRAL 5E56A 3VXMB 1A3LL 1SVZA 2EIEA 4PJFE 4OFVA 4Z7UA 2IH1A 3D18B 2Q6WA 5LGKA 4MX7A 3ZKXB 5GGUB 4WDIB 2FWOB 4N0YL 2EKSB 1NAKH 3SPVA 4F9PC 2ESVA 3UMTA 3WNPA 2B5IB 1NL0H 3MLPA 4PJCB 3BIBX 3IXTA 2EH8H 4TPRH 1AXSA 3GO1H 4XWGL 4ZFOA 2GCYB 4YK4C 4KMQA 1W0VB 1F4YH 4NBYB 4O00A 3QWRA 2VXSL 2ADJB 4ODHL 3RA7H 3T04D 4Y0GA 5SWSE 3TBSA 4I0PB 2DI9A 3ARQA 3H42H 3VWKD 1L6XA 2Q8BL 4M4PA 1T66C 3QEQD 2EE6A 3TN0A 1W2KT 3V2AR 1F4WL 2B20A 3QH3B 1FLRL 4KJPD 1LK3L 4MA8L 4LSPL 4WI6A 4XP5L 3QCTH 5CHNB 5AZEH 5I1LB 1FSKB 1U42A 5CAYB 3KPQB 3QNZB 4PLNC 2APFA 1MAML 1OY3B 1ZHKA 1L9MA 1UEYA 1JZ8A 3QWQB 5SX5H 3IDGA 5I9QC 3P0VL 1IKFH 1T2JA 5FOJA 3CDFA 2A6IB 1HN1A 3V4VL 2HN7B 4WFED 5D8JH 3G6DL 3MRMB 1HNFA 5E9DA 5FV1L 2MKLC 1CN4A 3S34L 1U8HB 4NWTL 2YKLH 2VSCA 2QKIB 3U1SH 1P7HL 4KTEL 1QR1A 1WAAE 2P48B 4X80H 3VWJC 3NACH 5EFIA 2EXWD 3IKKA 3GSRB 4X8JA 1UM4H 1BOYA 1T21B 5DK2B 1DBKL 1CDUA 4FMKA 4UAOC 1U8HA 4R96B 3CFKB 4X5WA 3QRGH 3HS0B 4IIQB 4PJFB 4NWTH 3C2SA 4ODXA 5DEFB 3S96A 4QRRA 4XCFH 2HFGH 4ZUSB 4Y5YB 1MFBL 4ZNEA 2ZZUT 3FCTA 3EO0B 4LIQE 3VFGH 1HHJB 2A6DA 4APQC 3FT4A 3SJVE 1PY9A 2QQKH 3QXDB 1TDQA 2HT4C 4LLWA 4LKCB 1AR2A 2V5RA 1RK1A 2BNRD 4XNZB 4MQ7B 4LSPH 4PJBB 2E27H 3ULSA 4KTDL 5EUOA 3U0PB 2DQCH 3B9KC 4KKAC 5CEZE 5L0QB 2YPVH 3ULVF 1FVCA 4Y4FC 2ESVE 1T6VN 5CFHA 2GJJA 4P9HL 5DJYB 4F9PA 1N7MH 5D6DC 2NY5L 4HX1A 1FFNA 4QT5A 1NJ9B 3CFBB 3OXSB 1R3HB 4ZODA 2FHCA 5DD1H 3X13A 5DJCB 5ISZB 2NTFB 4G6FB 3T2NL 1WTLA 4K3HA 5DMKB 5FA4A 2R0WH 3PWVA 5FO9A 2LV4A 1U93B 4UUJB 3TVMB 3M17B 3RIAK 2VXSH 1UM5H 4L8SB 1MCRA 1A1NA 4LKXB 3MLUH 3PL6C 3G6AA 4QRTA 4IRSD 2Q8AH 1BREA 4RIRB 2KQMA 4XBPB 1YPZA 2GY7B 5M95B 2NR6C 4YX2L 5HHVH 2D7NA 4E41B 3FB5A 4JPIA 3K7UA 3QFJB 3VXMD 1NFDB 1G7LB 2EC9U 4Z0XB 5HHNB 5HGAA 4ZO9A 1FP5A 2BRQA 2VWEE 4KFZC 4NQCB 3VRJA 3P3YA 4RMWA 4PS4L 3GSQB 4GKNB 1VFBB 4P23D 4GRLB 4G6JH 2HG5A 4CVZB 1RJZA 1YYLL 3DYPA 4KHXH 1IQDA 4M43H 4U1JB 1LE5B 1G1CA 1TENA 3SO3C 5LJYH 2YK1L 3BWUC 5GZNC 3ZE1E 4X83A 4PJHE 2FSEA 2B0SH 2A9MH 3EDEA 3T65A 2ADGA 4V2CB 1KYOJ 5I16B 1G6RH 1X5LA 2OSLA 5C08A 1JGEB 3HNSL 2FATH 2P4AB 1I1FA 2YWYA 4OF8A 3VGHA 4ZDHA 5J3HC 2BOBB 1IGTB 3OJDB 2UV3A 2UWEF 1JTTA 4QRPE 4HH9B 4I2XB 3WKML 3RTQD 1MIEL 2DS4A 1MJ7H 1KUMA 5ADOL 2EYRA 4OFYA 3LKPA 4HPOH 5ADPH 5I0DA 3LN4A 1P53A 4LDEB 3JWNC 1L7IL 2CKBL 5D93C 2ZPKH 4KMTH 2D4FA 3H8NA 4K23H 4MNQD 1QR4A 4Z76B 5J9PB 5HHOE 5T1LB 5KVFL 3WL9B 3L3OB 4Q9BA 2NY6B 3CFEA 5E8NA 1EHLL 4DK6A 2OTPA 2VXVH 4NN6B 4WUKH 4OCYL 2CRYA 3LEVH 3MXVL 1RUAH 1TVHB 4QEGA 4G7YL 4G8FA 4LGPB 1MCHA 1VENA 4YR6A 4DUXA 3KLDA 4F37F 2QADD 5ICZA 2ICWA 4FQLL 4LAJH 1KPVA 3MBEB 3DMMC 4YHIA 3L7EA 1B2WL 1OARH 2ZCKL 4EKXA 1A2YB 1JI2A 4JY4A 3SDAB 1HHGB 1N64H 3LY6A 1KEMH 2IG2L 5A1AA 1UH3A 1K6QH 5C0AD 3BQUD 1MJJB 4I3GA 2QQLH 3PWPD 1HYSD 2DQDL 1GSMA 1KJVB 4DVRL 1BBDL 2Q3AA 1U8OA 2R1XA 5ACMA 4X7TA 5J1AA 2Y72A 4ZSOE 5C07D 1FRGH 3IFLL 5L2JA 2R39A 2VLRA 3QBTB 3IU4L 3MTRA 2BCKB 4HH8A 1GZPA 1I1YA 1CCZA 3QUZC 2BVTA 1ZKAA 3T3MF 3ESVF 5FYJH 5I0ZA 4RAUA 3LB6C 4Y1AA 2GT9A 2Y5TA 4QRQB 1I8MA 4G9FB 3MRRB 4FQCH 2OM5A 3GMRA 2NXZB 4O2CA 1D5XA 4LGRB 4UOW1 5C0NC 4NPYA 2D3VA 3GSUA 4YDVB 4FQQB 1A6TA 1G9ML 5D6CB 3I75B 2VC2L 2J5LC 3ROOB 3D85B 3EDKA 1T1YA 3I85A 3DX8A 2AJZA 3DURA 5DR5L 4D0DA 5T33L 1CE1L 1IEHA 1SY6A 3TBTA 5EZIL 4FQIH 1DZBA 5DWUH 1TJIL 2NXYC 4G7YH 3V8CA 1JYNA 3EOBB 4HIXH 3B8SA 4UU9B 1BZ9B 1MLBA 2I9LB 2NLJB 1S8DA 3KPSE 4P3DB 2GJ6E 2PYFA 1VA9A 1YECL 2FB4L 1T83C 3RWGB 4O5LL 5F96H 4YK4B 2H45A 5C0JA 5KSAA 5DC9B 4NO3A 4UQ3A 2PUQT 4X6DE 3V8OA 1V5JA 3I6LE 4KJYB 1WWAX 3MSPA 4M1GL 1OAXL 1J1OH 4EN3C 4PJIA 2GFBB 4QF1A 1BJ1J 1HEZA 1T0MA 5FOBA 5HYEA 3EOTL 2NY2D 3Q6GH 3AS3A 4ZFGH 4XCCH 4P23B 1SBSL 2O26U 3NZ8A 4YO0B 3BZ4B 1HSBB 3MXWL 4YXHH 1FORL 5DJ6B 2PXYB 3GHBL 4XP9L 3HG1A 2V2TA 1FH5H 1BQLH 2HTLD 1NUGA 2MPAH 3WS3B 5JQHC 1JCKA 1JPFA 1UB6B 3CXHJ 2RFXB 4OGXL 5JTWA 5JQ6L 3D0VA 3I6KA 3GHEL 2Z31A 1WITA 1HDMA 5JHDA 4D3CH 1E4XH 3MODL 2H26A 3BH9B 4NZUH 1KSRA 1CLZL 2FRGP 1MLCA 2ITCB 4JN2A 4W6YB 5DJ8B 5CLTA 3ARED 1S5HB 5ESAA 5IB1B 2ZG2A 4KVNL 3EYUH 5B3NA 1T7VA 3BVNA 2QR0A 4YHNA 3I6LD 1CXIA 4L8SC 1TNNA 1MQKH 4UUJA 3DSFH 5IW1B 3T1FA 1NAMB 4BH7B 3BP4B 1RZIA 4OCXL 4U1KA 4ETYA 4NN7B 1QSFB 1QUNA 5I19L 1OGAD 5J1SC 2UYLB 1KCRL 3GIZL 3L3GA 3BKML 4M61B 5ALCL 3BMWA 1UWEL 4LLDB 1P1ZB 1WFNA 2R1YB 1HHIB 3D18A 2Q6WB 3OKLB 5EOTA 3EDJA 3P73B 1C5CL 4BZ2L 3WIIL 2HG5B 1JGVL 4W6XB 4CVZA 5JMOC 3QNYA 1G7QB 3ZDYE 3DGGA 5TFSL 1A0QH 4O51B 4JDVA 3VI3E 2FL5A 4EBQH 1DQLH 4GS7B 1EEUA 3UX9B 1BMGA 3QIUC 4FTVB 5ADPL 3ZT6A 1FL5A 1H15A 3C6LC 3W0WB 1RPQA 1MJUL 5L88H 3FO0L 2KBGA 1GGYA 2GY5A 3FT2B 3OHXB 4MNQB 3CVHH 4R4ND 2ERJB 3RVXD 3S36X 1MCWM 1YEEL 3X17A 1CFQA 1UM6H 3VE0B 1RUMH 4U1SB 4ZTPL 3D48R 1KCKA 5TF1H 2CLZA 3MACH 5BXFA 4HJJL 1P4IL 2Q86A 3QEGH 4JLRA 4TTDD 3MGOA 4K3EL 4PB9H 4CN6A 2WBJD 1Q38A 3KNBA 5L8LB 5CJQL 3SQOH 3HAEA 2BFVL 4QYOB 4Z0BL 5E7FA 1U91A 1BX2B 4NKMB 1W72H 3QNXA 3ZE1F 4C83B 3QAZB 4F57L 1S7RB 1JHLH 2NXZD 5F88B 3RWJA 5D2LB 5BS0B 4K94H 1AHWB 1I9IL 3G04A 3MNWA 4GLRH 4GUPB 2IANB 1RZGB 1UM4L 2EE9A 3PIQA 5BJTA 1KT2B 2PO6B 1B4JH 4JRYA 4WW1B 5I1CH 3D9AH 3WD5H 3L3JB 3VD4A 1EEYB 4DGVL 5I8EB 5EBMB 2XPGA 1CBVH 3QXUA 3SGJA 4ZPTA 4PY8J 3UJTL 1KNOA 4POZC 1FZJA 1RZGA 5T1KA 2VLJB 1CVSC 1S9KC 4XNUL 1GC1L 1OAUL 3KNBB 1JRHH 3WS6A 4KK5C 4X5XB 1MCIA 4XNYL 4WU7B 1L7IH 3TZVB 1SJHA 1I1CA 1PX3A 2Y07L 5HDQH 1U3HB 1MJUH 3OG6B 3LV3A 4JZJC 1YEIH 5I15L 3GJFH 4MD5A 2HVKA 5SWZD 4M5ZL 4Y4HB 1C16A 3NZHH 2BK8A 4R2GD 4Z7WA 1ZGLB 4XP5H 1T1WB 3BP6A 4KV5F 5E2TH 3QI9D 4XWOC 2F5BH 1T2XA 3GMLB 1GJIA 4OQ1A 1JI1A 4P2QA 1FE8H 1H3GA 2Q87A 5IOPB 3O45B 3SPVB 1R5VA 2AJZB 4KTDH 3QUZD 3RA7L 3FN9A 2XN9E 3MZGB 3O8XA 5FYJE 1VCAA 1QKZL 4NQEA 1D6EA 3EO0A 2YK1H 3QCVH 1C1EH 2Z91B 4O2CB 4PRAB 1WCBA 5H37H 4Z7WF 3HZMB 2AJUL 3GMNB 4Y5XB 5KS9E 5M7QA 1MUJB 2PYFB 3ARDC 4KC3B 5F1NB 4IM8A 1FNSH 3D2UB 3ISWA 1VKXA 3DUSB 3H9SD 5E03A 2EDYA 4PB0L 1OD9A 5C0GB 1F3JB 4G6AD 4XP4L 2IGFH 3L3DB 3MGTB 4NT6B 4QNPF 5HI5C 4L3CB 4WI4A 1OM3L 5DDHA 1N6QL 4LSSL 2V17L 3CAFA 1CTNA 2QSTA 2R1WA 1QSEB 1QVOA 3NA9L 1UCTA 1VFMA 3M1BA 4XPBH 5JOFA 2ZOLA 4NJAL 5E6IB 1G7HB 3V4PH 4YEEA 3TVMA 1ERNA 4PRHD 2HT2C 1LO5B 1T2QL 3IJYB 1ZHLB 4OLVL 5FA3A 2EDBA 3CUPA 3RWHB 2VKXA 3NOIA 3HAEG 1ZLUH 3B5TA 4LSUL 3MRQA 4LSRL 4PJAA 1DUZB 3BOVA 4X7TB 5DTFB 1YMHB 4JQVA 5CUSL 4F58L 2V2TB 1TXKA 3KS0H 1EUUA 2IQAA 1DBJL 5CCKL 4QXTB 5EUOB 5C6TL 3U0PA 4ZQKB 1QNZL 1JTOA 3PWPA 5AZEL 3LEYH 4N90D 4NKIL 1J05B 4ZTOH 2N56A 2YS4A 4AEIL 2DQTL 3WS6C 4FXGA 4HKBA 1KJ2A 3C5ZD 1CQKA 4MMZC 4ENED 1A1MA 4ZUSA 2A0LD 2CXGA 1Q72H 1NFDF 4EI5D 5CZVL 1CD1B 1LK2B 1J0JA 1M4KA 1YEKL 2D7PA 2DWEA 1VFAA 1PX4A 1MCSA 3QIBA 2BOBA 1LWRA 4G8EA 4YFLF 3HB3C 4LLAA 5DRXA 5I1GH 3VFVB 1TQCC 2FWOA 4P3DA 5TQ0H 1DBKH 1Z9OA 4JHZA 2GJZB 1MHCB 5F7EH 5FV2A 1CL7L 2PO6D 3K4ZA 1S9XB 1RU9H 1OVZA 2F58L 4MJIB 4E5XB 1BQUA 3U4EA 4NZJA 4PRBA 1T6WA 1I3RA 3EO9L 4PJIE 5T5FL 1LHZA 3V5HB 2JIXA 2PTTA 4Y16B 3FT3A 1SMAA 3D85A 1U6AL 2VYRE 5TQ0L 3LRHA 4UMGA 4E41A 1M71A 4MS8C 2BRRH 3N1GC 4JM2D 3B9KD 1RD6A 3BP7A 4KKAD 4LLDA 4LSTH 4MNGB 1FVDB 5HHNA 4X4YB 3P11L 1U58A 2I07B 2H41A 2VQ1B 3QZWA 4K3EH 4PB9L 4NUGL 4HC1A 1RIVL 2YHGA 4TRPL 2BSTB 2DLTA 4PJ5B 2NYYD 5HDBE 3U79A 4N5UA 2HWZH 1CL7I 5DZLA 1QA9B 2AS5M 1NMAH 2FYYB 3LKRB 3S7GA 2COQA 3LH2L 1KB5B 4X9FA 5GS1A 5SX5K 5BW7C 2YPKA 1JF5A 3QUZB 2DBLL 4I18C 5FCUH 3U7YL 5D1QB 5DA0B 1MCPH 3KYMA 1QD0A 4DAGL 3S4SA 5CJXC 1JGVH 5ESQB 1FNLA 3CZJA 4RNRA 3T3PE 4NKQB 1A0QL 4Y19A 3Q48A 3HPJA 4JM4L 3RGVD 3DUSA 3GSOA 1WZ1H 4RISH 3UO1H 2A2QT 2VUOA 3ELAT 4HIEB 5DRZB 4PJBA 3ZSTA 3D0LB 5JLZB 1U95B 4P0DA 5T5FH 3OR6B 4Y5VA 5FXCH 4PJIF 4GSDL 5D70L 3V79C 4PY7A 5DF0A 3VFSA 2G9HB 3C9NB 4KHTL 5KVEH 3TYFB 1OW0A 4HXAH 2VRAA 4U2YA 4WFHD 4YXKH 2ED9A 5H2BB 1E6JH 3MJ8A 3GBNH 4LP4A 5DK0B 1N3NA 4HW6A 4Z0BH 5EOQL 2FD6H 4GBXC 4PRIB 4GXVL 3G5VA 3HPLB 4EN3B 4OB5H 2AXGB 5J12C 4X6BB 4NHUB 2P5WE 4IJ3C 4LCIL 4FFYL 5DJDA 5KSBF 2XXMB 3LKQA 1EAPB 3U9UA 4UU9A 4P2RB 1J11A 3QIBC 1EGJH 3MRMA 4D0CA 1KYOK 1KCSH 5I18H 3QQ9D 3EYVA 2HN7A