5L07A

Crystal structure of quorum-sensing transcriptional activator from yersinia enterocolitica
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
162
Chain Sequence
b'YFDNESINEDIKNYIQRRIKAYGDLRYSYLVMNKKTPLHPTIISNYPLDWVKKYKKNSYHLIDPVILTAKDKVAPFAWDDNSVINKKSAVFKLAREYNIVNGYTFVLHDNSNNMATLNISNGSDDSISFDESIEINKEKIQMLLILTHEKMLGLYQSNSDKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quorum-sensing transcriptional activator
molecule tags Transcription
source organism Yersinia enterocolitica
publication title Crystal Structure of Quorum-Sensing Transcriptional Activator from Yersinia enterocolitica
rcsb
total genus 54
structure length 162
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 5l07A00
4NG2A 4Y13A 5L09A 3QP2A 4Y15A 3SZTA 3IX3A 5L10A 2AVXA 3QP1A 3QP5A 3QP4A 3IX4A 4LFUA 4LGWA 4Y17A 1H0MA 1L3LA 2UV0E 3JPUA 3IX8A 3QP8A 2Q0OA 5L07A 3QP6A
chains in the Genus database with same CATH superfamily
4X55A 1S1YA 4DDSA 4QB8A 2Y2QA 4QY5A 4Y15A 3IX3A 1NXYA 2PR5A 1Y4OA 3M6HA 5E2EA 3PTEA 4ZJ1A 1KE3A 4LV3A 5FAPA 4BMWA 2VGJA 2HGVA 4IEDA 4Y2FA 2EX2A 3UDXA 2QKPA 5HDSA 1PFLA 3CI6A 4Y3IA 4UHUA 4ESPA 2VEAA 3HVFA 3BEBA 3ZG8B 4S2MA 4GW9A 1Y28A 2J3WA 4ZTKA 3UB5P 2IWDA 4X25A 4UA6A 4N9LA 3S1YA 4PAUA 3E4OA 3RH8B 2Y2NA 3UE6A 4UA9A 5L10A 1PZOA 1H5XA 4PM9A 3KO6A 1D1JA 4RX2A 4OLGA 1TS8A 2Y2IA 3F1PA 1HTZA 3LR3A 2XRNA 4JKTA 3GR2A 4GD8A 4B4XA 4NXEA 5FAOA 2VK3A 1S67L 3ZQ5A 1CF0A 3V3RA 3I7JA 3NY4A 4IJGA 1Y54A 4HY8A 1LL5A 4UEYA 1GHPA 5FA7A 3BLMA 1XGJA 2V8CA 3OLOA 4FH2A 4PPRA 2ZD8A 5J4EA 4IHQA 2QHKA 4S2NA 2XR0A 4BD1A 4F3LA 1K4FA 1OMEA 3ZNTA 4Z1WA 3ZCZA 1JTDA 5BOHA 4OQIA 4KG5A 4FOFA 3G31A 1Z6FA 1K6RA 3A3IA 4WBGA 2OAP1 5FL3A 2GZAA 4OPRA 1AXBA 2H28A 3ZHHA 1YAXA 3BYDA 2V1AA 4LCLA 1IYQA 5MC7A 2V0UA 1NLZA 4GN2A 3BY9A 2BTFP 2H0TA 1K6SA 2PU4A 4CLCB 4WF0A 3CLOA 3V39A 1FCNA 2Y91A 1PIOA 2W3HA 5HFOA 3MZEA 4EESA 4O7DA 2O9AA 1NYMA 2INWA 1ZC2A 5HDCA 4S2KA 2EA9A 4G3VA 5E2GA 4XT2B 3H7WA 1ZG4A 4MMNA 5EV0A 2OV5A 3NCKA 1JWVA 5CHMA 1DY6A 3JYIA 1L0FA 1ES3A 5EOOA 1HD8A 4Y0TA 3FKWA 1CQAA 3IS2A 3ZVTA 5A91A 4EQIA 1MY8A 2XSSA 4YOFA 5EVLA 1WA9A 3LEZA 5M19A 1NRJA 2W3EA 1VETA 4B4ZA 1YLJA 1DP8A 2ZMVA 3OPHA 1OTDA 1YLTA 3Q7VA 1W79A 1I5QA 3CHWP 4DXCA 3GRJA 4WEKA 4XT2A 1H8ZA 3DBAA 2IWBA 5IS1A 5CEDA 3N8LA 1EW0A 1NLYA 3HCYA 5DFYA 5F1GA 4D60A 3BRMA 5HPIA 4M3KA 3N6IA 1PYYA 4R3JA 5CTMA 4R4SA 2VV6A 1Q2PA 1W5DA 4WZ5C 4HHDA 4KQRA 5HW3A 4GDNA 4CQHA 5FQMA 4PM5A 3C38A 1XGIA 1K25A 3KYZA 1LSXA 1OTEA 2QPNA 4FUWA 4X56A 3MXRA 4HP4A 4X68A 5GHZA 3P09A 4I3IA 1OTIA 2Q0OA 5FAQA 3CITA 4C75A 4DRTA 2WAEA 2G2UA 3KYEA 4GS9B 4EETB 4EBLA 3CAXA 2NUTC 3QP5A 5I94A 3G4PA 3FWLA 1FILA 1PWCA 4P87A 5FI6A 4P6BA 4QJGA 4DE2A 1YQSA 2W0NA 3U2AA 4U3TA 5F69A 1WYCA 2D01A 3H82A 2BG1A 3PBRA 2J3TC 4KUKA 3KX0X 4RQ9A 5FEFA 4EUVA 1FSWA 4ID4A 5HAQA 4E3LA 2ZMAA 4PKYA 4K0XA 3UDIA 1JVJA 4ME4A 2M1CA 1MWTA 3DWKA 2HDQA 3IX8A 1IELA 3VSKA 4JGRA 4GKUA 1K0KA 1NJ4A 1YLWA 3ICYA 5DJTA 1G5UA 1IOUA 3PXPA 5KSCA 1ERQA 4KQDA 5L2FA 1G68A 1KGGA 2EX6A 2JKFA 4YINA 1MWSA 1H0MA 3CUEA 2OSUA 5TFQA 1SDEA 1MPLA 4YFMA 4FCFA 2R9XA 3D9YA 1XJ3A 3NBLA 3TE8A 1D06A 2L0WA 1RGZA 3TSGA 4E3JA 1XX2A 3EGDC 1I2WA 5F1FA 1MBLA 3PYPA 1ES4A 2Y2HA 5DTSA 4NEED 1JNUA 3IF5A 1SZVA 5HWTA 3O86A 3Q82A 1WYBA 4P6ZM 4EEPA 3UB7A 1I2SA 3NECA 3GECA 3S7QA 1YLYA 3OPPA 2YKFA 4EEUA 4HH2A 3BQ8A 5EECA 1X0OA 2EX9A 3Q1FA 4Q8IA 2XLNA 3LY3A 2R9WA 5L09A 2HJ9C 3IF6C 3A3DA 1ZG6A 4LV1A 1S6RA 2W27A 3LI8A 3TG9A 5J3WA 3BECA 1MWRA 4X1MA 5HWWA 5DTTA 4JF6A 5G4YA 4KZBA 3N8RA 5CTNA 3E98A 3IXBA 3LR0A 2IWCA 4KQOA 4R3AA 4R4RA 3MXSA 3HJIA 3D3OA 3SW1A 2P04A 4ARZA 3G30A 2ZOHA 3BFDA 1ZHHB 5EVID 5EFWA 1MKMA 2ZOIA 4AFIA 5F83A 3E2LA 3E2KA 2EX8A 5L07A 3TJZC 2VGKA 5AQ9A 4HESA 1FQGA 1TS6A 4OH0A 4H6JA 4LV2A 1M6KA 2W3GA 3ITAA 1IYOA 3QHYA 1YT4A 1S0WA 3HUMA 3VE4A 2JE5A 2HP5A 4NXGA 5DF8A 1KDSA 4I38A 3W4OA 3T1SA 3DW0A 4LRYC 1TDLA 3AGFA 5HAIA 3LY4A 2LB5A 4WZ5A 2KOIA 2ZC7A 3FPVA 1K4EA 3U4LP 1K54C 3NDEA 4ZJ3A 1LI0A 4CLCE 1K57A 4DE3A 3VMAA 4QWOA 4KZ5A 3MQOA 4MN7A 5CEBA 4N9KA 2PHYA 4MN5A 1ACFA 4Y5FA 3CZDA 4UA7A 4KZ8A 1LHYA 4JBFA 3OPLA 4E3KA 1O7EA 4E3NA 4GDBA 4QD4A 3PHYA 5HL1A 4XXRA 1F5MA 4DF6A 2FH5A 4BJPA 1BLCA 4C6YA 1W63Q 3MQQA 1FIKA 1YMXA 3IXHA 3UE3A 3VOYA 3VP1A 2ZM8A 1K38A 2VX8A 4GCZA 5M18A 3RTYA 4I3JA 4DN0A 3UDFA 4WL9A 1RCJA 4S2PA 3UPPA 3AGDA 2XEPA 3D4FA 1W8QA 4DMZA 3FZCA 5FQ9A 3T1RA 2Y2GA 1TVFA 4EQ1A 1FCMA 4HNBA 2FFYA 2EFXA 4N1HA 4CLCA 1IFQA 2JN7A 3S7PA 1GA0A 1PW1A 2BLSA 3F1NA 4I39A 4JGPA 4KZ7A 4H6JB 3EOIA 1H8YA 4GHIA 1OT9A 5IHVA 4P0MA 4DJ3A 2JCHA 3P7NA 3IH8A 3G6OA 3NHQA 4BL2A 2VZWA 3QP1A 2B18A 3IX4A 4LFUA 2K7SA 5M1AA 4LLOB 3CMZA 3KSHA 3MFDA 5F5YA 2Q9MA 3M2JA 2Z2MB 2UV0E 1YKDA 1K57C 5DTKA 1CEFA 5FI7A 3MMHA 3IXGA 5GL9A 5D3OA 3PAEA 2WKEA 5CXWA 5J7EA 2XFTA 3JVUA 1K54A 4Q0IA 2VLGA 3HJKA 3OCLA 5FI2A 3BFCA 3IBJA 3DTEA 4DE1A 1O07A 3ZNYA 4K0WA 4I3AA 4PKYG 4O01A 3IT9A 4X69A 2W3FA 4NXFA 1K56D 1BLSA 3VP3A 1E25A 3DWZA 3UN7A 2EWWA 3F1PB 1PWDA 3LFVA 4JF5A 3S7OA 1T1BA 4MBKA 5KIZA 1KE4A 2HV1A 2HDSA 3CPTA 3Q07A 3NI9A 5E2HA 3NOUC 4JXVA 2E8IA 2VKSA 4O0PA 2P74A 2Y8HA 2V8FA 1IYPA 4CJNA 2W1TA 3LIDA 1PNEA 1S4RA 4OQGA 3R7WB 3GTCA 2VV7A 1IKIA 4WUJA 4KG2A 1L3LA 1EWZA 1YLZA 3GDIA 4Y0UA 1NRFA 4E6XA 2DMWA 3MFXA 3CWFA 1N9NA 5GHXA 4EWFA 3BM6A 4ZJ2A 2WZZA 1XJ4A 1E4DA 4K91A 3C7VA 4QU3A 3FV7A 2QJ7A 1DRMA 3VP4A 3GSGA 5AQAA 4B9OA 4UQIS 1YLPA 5LBRA 1L0EA 5KZHA 4U0XA 1G6AA 3VV4A 3B47A 5TBMA 4GOGA 2X02A 3ZVWA 1BULA 2J9PA 4OQHA 3HUOA 3RJUA 2HF6A 2Y2OA 4HJ4A 1T19A 2QZ6A 3WS4A 1VB6A 3F1OA 1FR1A 1BLHA 1G6OA 4QY6A 3T4TA 3ZG5A 4JGOA 4H8RA 3OOVA 5DFXA 3WWXA 3PBOA 3PBTA 3LICA 3LIAA 1K55C 1JWPA 4WMCD 3UE0A 3DTIA 4X1LA 5J8XA 5FATA 5G4ZA 2KX6A 2JHEA 4HEFA 1LLBA 1E3UA 4BBTA 2CC1A 1OJGA 4PM7A 2FZ0A 3HL9A 4S2LA 2GNXA 1YM1A 3A3JA 3ZFZA 5JYPA 2WGIA 2FFFB 2LB9A 3LR4A 4WMCA 3SOIA 4MCWA 5HDDA 1H3QA 3W2ZA 2Y79A 2ZM2A 2GJ3A 1D7EA 3E0YA 4FSFA 2ZQ8A 1HVBA 4EU0A 1ESUA 4E3MA 3HREA 4RX3A 2K31A 2WGVA 1P0ZA 3LIFA 3EQVA 4IVKA 4MEZA 1XJ2A 1LL8A 3VOLA 3SS5A 3EEAA 3UNWA 2W1RA 1N9LA 1STZA 2J9OA 3MKEA 3G2ZA 3LO7A 4NG2A 1XXMA 4Y13A 5CHJA 1EI5A 1T1AA 4DE0A 2I72A 3P98A 3H82B 2V1ZA 4CLCC 1GSWA 3GMWA 4R38A 4Y17A 1GCEA 3BY8A 3LIEA 3IQAA 1KGFA 5F6AA 2A24A 4RA7A 4ETXA 4NXBA 2DNSA 3ZG7B 3BFGA 2PAVP 3K3DA 4HQAA 2XA7M 5EM1A 3C30A 2PBDP 2ZQ7A 3W8KA 3H7WB 4R70A 1SKOA 3VP0A 3N7WA 5A93A 3CUEC 1CI9A 3D72A 3E4QA 2QJ5A 2B02A 1S1ZA 1P9RA 4Q0JA 5GLBA 3CPTB 5HWVA 5FASA 2R78A 2AVXA 2WKHA 1YSPA 5CGXA 2PD7A 5A8BA 1PI5A 2OOLA 3UO9A 1W63M 1J3WA 3QNBA 3A0VA 1LSWA 4WELA 4BL3A 2XROA 5HX9A 5IT5A 1PZPA 3OPRA 4S2OA 3C2WA 1XJ6A 3WS1A 3QNCA 3BWLA 3RXWA 3BLSA 1DP6A 2VGLM 4LPZA 4MLLA 2G7UA 4P6ZS 1KOUA 4ETZA 3IF6B 2XGNA 1UGUA 3VFHA 4PHTA 3N8SA 2PT7A 1VEUB 2P7JA 5EVIA 3HLFA 1NYYA 3VP2A 4F3LB 2XFSA 4KG6A 2JKGA 4MBHA 3QP4A 4E3IA 3LI9A 2B5RA 3Q81A 4B93A 3VE3A 3G2YA 4DJ2A 2O9CA 5DJUA 3UY6A 3WS5A 3MBZA 4WLAA 4OOMA 3B42A 3C4PA 2W1TB 3MSHA 4MN6A 1SKFA 5KMWA 4JLFA 3PBSA 5E2FA 4LCMA 1ZKJA 4KQQA 2Y2LA 4JGQA 4HBTA 5FEGA 2A2LA 4JXWA 2ZQDA 3HLDA 3BFEA 5FDSA 1XP4A 5HL6A 1HZOA 2HDUA 4GD6A 1ES5A 3T4LA 4ZRRA 1F98A 3NOTC 5IU1A 1VQQA 1U60A 3OZHA 3DAVA 1BSGA 3FKVA 3MJQA 2H0YA 5EVEA 2WKPA 4E3OA 3F1OB 4II7A 2OLUA 2QWSA 1GHIA 3NIAA 3GQZA 1PI4A 1XFQA 2C6WB 1M40A 4MDZA 1K56A 2WADA 3B3XA 5CX7A 1FR6A 4JXGA 1F2KA 3T50A 4HP9A 2ZL1B 4JPMA 5L8MA 3PAGA 5I5LA 2E8JA 5DKLA 4Q0HA 4LGWA 4GJ4A 4QHCA 3S4XA 2A49A 5A92A 1TD5A 3T4SA 2ZQCA 1NWZA 3BQAA 2WUQA 3A0RA 5EE8A 4WYYA 2Q9NA 3IS2B 2OWHA 3KSGA 1FSYA 1BYWA 4S2IA 4GHIB 1P9WA 4L0LA 2Y59A 1TF1A 3HLEA 4HIAA 3T4KA 1DP9A 2V9AA 2ZL1A 3FPWA 3T4OA 2OLVA 4NETA 2ZLYA 4EUZA 2ZJ9A 1GA9A 1OTAA 4OKPA 2V2FF 2ZM0A 5HPFA 3MR0A 1SDNA 5E43A 4C3QA 1OTBA 2CMNA 5TR7A 1T1CA 3T4JA 3GVBA 2WKRA 5TGFA 1L0GA 2ZC5B 4X53A 3Q7ZA 5EM0A 1GSXA 4XUZA 2Z6CA 1RP5A 2MJ6A 3MS6A 4QPRA 4I5SA 2WKQA 4GLQA 4M4XA 1UWNX 3V3SA 4BQMA 2O0YA 4P85A 5EOEA 3LUQA 4PM6A 3UB6A 3R7WA 4EW7A 1FOFA 2EFUA 3LYXA 4F94A 5CECA 4OP8A 4S2NC 3SH9A 1PRQA 3MQ0A 5HD5A 1QMEA 2Y2KA 4G3WA 3TRCA 1XKZA 1XA1A 3QP8A 3QP6A 2J80A 1OT6A 1JWZA 5HARA 3C8CA 4GB7A 4HOIA 4EXOA 3IHBA 3M2KA 4LRXC 5GLAA 2ZQAA 3T12B 2PU2A 1LL9A 4LV0A 5CHUA 3CG5A 3A3EA 2HDRA 3ZG9B 3E4PA 2M7VA 3WS0A 3WS2A 5FQKA 2JKTM 2QMIA 1W8YA 2V0WA 1JTGA 4RYEA 1BZAA 2P9VB 3UB8A 2Y2PA 4KZ9A 5FSRA 1N4OA 1ZTUA 3Q7VB 2C5WB 1VM1A 2PYRA 4B88A 4IBRA 1GSVA 2PDRA 3C7UA 4OPZA 3QP2A 3IF6A 1ONGA 5EVIB 2NUPC 4U0TA 2XK1A 5AVFA 2ZMFA 2I9VA 2BASA 2X01A 3LR5A 1MXOA 2PBYA 5EPHA 3EEHA 2XH9A 2WGWB 3WRZA 1SCWA 3IWQA 2XDMA 5KSHA 2XD5A 4RVAA 4OP5A 1OJ5A 1VHMA 3L7HA 1L2SA 4YNRA 4ZBEA 5HSQA 1BT5A 1XPBA 4Y0OA 3O5YA 4OOYA 2XA7S 2K2NA 2KDKA 3DTKA 4K08A 2JC7A 3BFFA 4EERA 4IUKA 5FQJA 1C3BA 4PMAA 1AWIA 1EROA 5DF7A 1LI9A 3RFBA 2PYPA 3LGOA 1ES2A 1S66L 2JKTI 2J8YA 3OCNA 5HAPA 5GLCA 3IXDA 2EWVA 4E04A 3ZYTA 4S2JA 4ARZB 1TS7A 3W4QA 2HP6A 4HH3A 3G34A 3ZGAB 5A90A 2DRWA 2A24B 4L9FA 2EXAA 2V20A 3N4IA 3ITBA 2B95A 5FQQA 4D2OA 1KVLA 1MZUA 4OVDA 3S22A 1MKIA 3K3CA 5HD3A 5FDHA 3W4PA 2QYBA 3B33A 2WK0A 2RCXA 3SS4A 3IWIA 2A3UA 5AQBA 4OPQA 1ERMA 1ONHA 3HLWA 2WYXA 4DDYA 4OQ0A 3A3FA 5CRFA 1N9OA 3EGXC 3HBRA 3MZDA 1QMFA 2PD8A 2ACGA 1CJFA 2WKIA 3T1QB 5C5KA 4KZAA 3HLGA 3NJAA 1KVMA 4BWIA 2VGLS 5DVAA 3NULA 1RGYA 1ODVA 4WEJA 3C4OA 4EBPA 3T4QA 3G32A 4WN5A 2D02A 1A0KA 1UWPX 3PBNA 1BTLA 2GX5A 3UMDA 3UB9A 5CGWA 1BLPA 3IH9A 2H5SA 4N92A 3KSIA 1IKGA 3S7NA 4R6LA 4EBNA 1MWUA 4GZBA 2HZ5A 4BD0A 1NY0A 1YPRA 4CPKA 4ZDXA 3IBRA 3UE1A 3NDGA 2EXBA 3UPOA 2J7VA 3MKFA 1F9IA 2ZC3B 5K5BA 1IYSA 5U47A 3IWOA 1V9YA 4LRZE 3CJMA 1W7FA 3GV9A 3P01A 3WRTA 2VJWA 4BLMA 1KDWA 4PM8A 4E6WA 4Y7PA 2X71A 1NZUA 2XQZA 1YMSA 1K55A 1MC0A 1HLUP 5G18A 3VOZA 2YKHA 4IVIA 5DF9A 3EWKA 2PRFA 2XD1A 3OC2A 3SS3A 3KYQA 1T18A 5GLDA 2WGWA 1TEMA 4G3KA 4XUXA 2W3DA 4NKPA 1E3UD 5F68A 1IEMA 2XF3A 3RXXA 2M7UA 5CERA 2O9BA 4KUOA 2HJEA 1J9MA 4CLCD 3JPUA 5AQ7A 3V50A 3C5AA 2ZBBA 4R23A 3AGEA 3FC7A 5EVIC 3DTMA 1LSVA 4FH4A 4BENA 3O87A 2KLIA 2Z2LB 4L9GA 4NK3A 1CK3A 1NZOA 1TS0A 5TJJA 2VV8A 4X6TA 4ZAMA 2DCFA 4MNRA 4LENA 3ZG0A 3LCEA 3JVVA 5AJGA 4BBVA 4IUHA 3EQUA 5DKKA 3G35A 4GNUA 2VA0A 5FQIA 3FG8A 2ZC4B 1CI8A 4KENB 3MZFA 3HUNA 4WZ4A 3T1XA 2ZQ9A 4EV4A 3ISGA 1PWGA 1YSQA 3V5MA 3UMEA 1TDGA 1XA7A 2Z6DA 4UAAA 3MF0A 2Y55A 1DJCA 4OPYA 4JXSA 4N1XA 1GHMA 1OPXA 4GS9A 1DJAA 3BJNA 4FD8A 4WM9A 3MXQA 2G2WA 3OBFA 4YWZA 1P97A 3TOIA 1VETB 3PR6A 5AVEA 1VEUA 3A0SA 2RL3A 5F82A 2P08A 1WE4A 3VFFA 3PBQA 3BW6A 3IHAA 2ZC6B 2HPBA 4Z9QA 3LEQA 4UQIM 5JYOA 4DKIA 1KGEA 4OOLA 5GHYA 5EUAA 4BBUA 1S4SA 4L9EA 1N9BA 3HLBA 2O99A 3L9KA 3FYZA 3O88A 3SZTA 3TW8A 2OAQ1 3VSLA 5TBMB 2JBFA 2WAFA 2Y2MA 1ALQA 2L4RA 1ESIA 1Q2QA 2H10A 3NC8A 4HBUA 4HJ3A 3LIBA 4DXBA 3SH8A 3M6BA 2Y2JA 4O8GA 1KE0A 2JKRM 4A5RA 3UPNA 2J3TD 1V9ZA 4OLDA 3ZDJA 1Z09A 2HP9A 1PW8A 4HI4A 3KSFA 1H8MA 4KZ4A 4OONA 2V1BA 1LT0A 3V67A 4R3BA 4IBXA 1SKOB 4JF4A 3NOPC 1SHVA 2PR6A 2IA2A 3R4KA 2UWXA 2P9VA 1XFNA 2L1MA 1L0DA 3H9WA 2JKRI 1DJBA 1CEGA 4MBFA 2OWJA 4FTXA 4HJ6A 4KZ3A 3HLCA 1BUEA 4R0QA 3F1NB 2Y4AA 4KZ6A 4R1GA 1G28A 3K2NA 2WZXA 5CGSA 3SH7A 5HZHA 3ULFA 3O3VA 2GDNA 1FCOA
chains in the Genus database with same CATH topology
4NG2A 4Y13A 5L09A 3QP2A 4Y15A 3SZTA 3IX3A 5L10A 2AVXA 3QP1A 3QP5A 3QP4A 3IX4A 4LFUA 4LGWA 4Y17A 1H0MA 1L3LA 2UV0E 3JPUA 3IX8A 3QP8A 2Q0OA 5L07A 3QP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NG2 A;  4Y13 A;  5L09 A;  3QP2 A;  4Y15 A;  3SZT A;  3IX3 A;  5L10 A;  2AVX A;  3QP1 A;  3QP5 A;  3QP4 A;  3IX4 A;  4LFU A;  4LGW A;  4Y17 A;  1H0M A;  1L3L A;  2UV0 E;  3JPU A;  3IX8 A;  3QP8 A;  2Q0O A;  5L07 A;  3QP6 A; 
#chains in the Genus database with same CATH topology
 4X55 A;  1S1Y A;  4DDS A;  4QB8 A;  2Y2Q A;  4QY5 A;  4Y15 A;  3IX3 A;  1NXY A;  2PR5 A;  1Y4O A;  3M6H A;  5E2E A;  3PTE A;  4ZJ1 A;  1KE3 A;  4LV3 A;  5FAP A;  4BMW A;  2VGJ A;  2HGV A;  4IED A;  4Y2F A;  2EX2 A;  3UDX A;  2QKP A;  5HDS A;  1PFL A;  3CI6 A;  4Y3I A;  4UHU A;  4ESP A;  2VEA A;  3HVF A;  3BEB A;  3ZG8 B;  4S2M A;  4GW9 A;  1Y28 A;  2J3W A;  4ZTK A;  3UB5 P;  2IWD A;  4X25 A;  4UA6 A;  4N9L A;  3S1Y A;  4PAU A;  3E4O A;  3RH8 B;  2Y2N A;  3UE6 A;  4UA9 A;  5L10 A;  1PZO A;  1H5X A;  4PM9 A;  3KO6 A;  1D1J A;  4RX2 A;  4OLG A;  1TS8 A;  2Y2I A;  3F1P A;  1HTZ A;  3LR3 A;  2XRN A;  4JKT A;  3GR2 A;  4GD8 A;  4B4X A;  4NXE A;  5FAO A;  2VK3 A;  1S67 L;  3ZQ5 A;  1CF0 A;  3V3R A;  3I7J A;  3NY4 A;  4IJG A;  1Y54 A;  4HY8 A;  1LL5 A;  4UEY A;  1GHP A;  5FA7 A;  3BLM A;  1XGJ A;  2V8C A;  3OLO A;  4FH2 A;  4PPR A;  2ZD8 A;  5J4E A;  4IHQ A;  2QHK A;  4S2N A;  2XR0 A;  4BD1 A;  4F3L A;  1K4F A;  1OME A;  3ZNT A;  4Z1W A;  3ZCZ A;  1JTD A;  5BOH A;  4OQI A;  4KG5 A;  4FOF A;  3G31 A;  1Z6F A;  1K6R A;  3A3I A;  4WBG A;  2OAP 1;  5FL3 A;  2GZA A;  4OPR A;  1AXB A;  2H28 A;  3ZHH A;  1YAX A;  3BYD A;  2V1A A;  4LCL A;  1IYQ A;  5MC7 A;  2V0U A;  1NLZ A;  4GN2 A;  3BY9 A;  2BTF P;  2H0T A;  1K6S A;  2PU4 A;  4CLC B;  4WF0 A;  3CLO A;  3V39 A;  1FCN A;  2Y91 A;  1PIO A;  2W3H A;  5HFO A;  3MZE A;  4EES A;  4O7D A;  2O9A A;  1NYM A;  2INW A;  1ZC2 A;  5HDC A;  4S2K A;  2EA9 A;  4G3V A;  5E2G A;  4XT2 B;  3H7W A;  1ZG4 A;  4MMN A;  5EV0 A;  2OV5 A;  3NCK A;  1JWV A;  5CHM A;  1DY6 A;  3JYI A;  1L0F A;  1ES3 A;  5EOO A;  1HD8 A;  4Y0T A;  3FKW A;  1CQA A;  3IS2 A;  3ZVT A;  5A91 A;  4EQI A;  1MY8 A;  2XSS A;  4YOF A;  5EVL A;  1WA9 A;  3LEZ A;  5M19 A;  1NRJ A;  2W3E A;  1VET A;  4B4Z A;  1YLJ A;  1DP8 A;  2ZMV A;  3OPH A;  1OTD A;  1YLT A;  3Q7V A;  1W79 A;  1I5Q A;  3CHW P;  4DXC A;  3GRJ A;  4WEK A;  4XT2 A;  1H8Z A;  3DBA A;  2IWB A;  5IS1 A;  5CED A;  3N8L A;  1EW0 A;  1NLY A;  3HCY A;  5DFY A;  5F1G A;  4D60 A;  3BRM A;  5HPI A;  4M3K A;  3N6I A;  1PYY A;  4R3J A;  5CTM A;  4R4S A;  2VV6 A;  1Q2P A;  1W5D A;  4WZ5 C;  4HHD A;  4KQR A;  5HW3 A;  4GDN A;  4CQH A;  5FQM A;  4PM5 A;  3C38 A;  1XGI A;  1K25 A;  3KYZ A;  1LSX A;  1OTE A;  2QPN A;  4FUW A;  4X56 A;  3MXR A;  4HP4 A;  4X68 A;  5GHZ A;  3P09 A;  4I3I A;  1OTI A;  2Q0O A;  5FAQ A;  3CIT A;  4C75 A;  4DRT A;  2WAE A;  2G2U A;  3KYE A;  4GS9 B;  4EET B;  4EBL A;  3CAX A;  2NUT C;  3QP5 A;  5I94 A;  3G4P A;  3FWL A;  1FIL A;  1PWC A;  4P87 A;  5FI6 A;  4P6B A;  4QJG A;  4DE2 A;  1YQS A;  2W0N A;  3U2A A;  4U3T A;  5F69 A;  1WYC A;  2D01 A;  3H82 A;  2BG1 A;  3PBR A;  2J3T C;  4KUK A;  3KX0 X;  4RQ9 A;  5FEF A;  4EUV A;  1FSW A;  4ID4 A;  5HAQ A;  4E3L A;  2ZMA A;  4PKY A;  4K0X A;  3UDI A;  1JVJ A;  4ME4 A;  2M1C A;  1MWT A;  3DWK A;  2HDQ A;  3IX8 A;  1IEL A;  3VSK A;  4JGR A;  4GKU A;  1K0K A;  1NJ4 A;  1YLW A;  3ICY A;  5DJT A;  1G5U A;  1IOU A;  3PXP A;  5KSC A;  1ERQ A;  4KQD A;  5L2F A;  1G68 A;  1KGG A;  2EX6 A;  2JKF A;  4YIN A;  1MWS A;  1H0M A;  3CUE A;  2OSU A;  5TFQ A;  1SDE A;  1MPL A;  4YFM A;  4FCF A;  2R9X A;  3D9Y A;  1XJ3 A;  3NBL A;  3TE8 A;  1D06 A;  2L0W A;  1RGZ A;  3TSG A;  4E3J A;  1XX2 A;  3EGD C;  1I2W A;  5F1F A;  1MBL A;  3PYP A;  1ES4 A;  2Y2H A;  5DTS A;  4NEE D;  1JNU A;  3IF5 A;  1SZV A;  5HWT A;  3O86 A;  3Q82 A;  1WYB A;  4P6Z M;  4EEP A;  3UB7 A;  1I2S A;  3NEC A;  3GEC A;  3S7Q A;  1YLY A;  3OPP A;  2YKF A;  4EEU A;  4HH2 A;  3BQ8 A;  5EEC A;  1X0O A;  2EX9 A;  3Q1F A;  4Q8I A;  2XLN A;  3LY3 A;  2R9W A;  5L09 A;  2HJ9 C;  3IF6 C;  3A3D A;  1ZG6 A;  4LV1 A;  1S6R A;  2W27 A;  3LI8 A;  3TG9 A;  5J3W A;  3BEC A;  1MWR A;  4X1M A;  5HWW A;  5DTT A;  4JF6 A;  5G4Y A;  4KZB A;  3N8R A;  5CTN A;  3E98 A;  3IXB A;  3LR0 A;  2IWC A;  4KQO A;  4R3A A;  4R4R A;  3MXS A;  3HJI A;  3D3O A;  3SW1 A;  2P04 A;  4ARZ A;  3G30 A;  2ZOH A;  3BFD A;  1ZHH B;  5EVI D;  5EFW A;  1MKM A;  2ZOI A;  4AFI A;  5F83 A;  3E2L A;  3E2K A;  2EX8 A;  5L07 A;  3TJZ C;  2VGK A;  5AQ9 A;  4HES A;  1FQG A;  1TS6 A;  4OH0 A;  4H6J A;  4LV2 A;  1M6K A;  2W3G A;  3ITA A;  1IYO A;  3QHY A;  1YT4 A;  1S0W A;  3HUM A;  3VE4 A;  2JE5 A;  2HP5 A;  4NXG A;  5DF8 A;  1KDS A;  4I38 A;  3W4O A;  3T1S A;  3DW0 A;  4LRY C;  1TDL A;  3AGF A;  5HAI A;  3LY4 A;  2LB5 A;  4WZ5 A;  2KOI A;  2ZC7 A;  3FPV A;  1K4E A;  3U4L P;  1K54 C;  3NDE A;  4ZJ3 A;  1LI0 A;  4CLC E;  1K57 A;  4DE3 A;  3VMA A;  4QWO A;  4KZ5 A;  3MQO A;  4MN7 A;  5CEB A;  4N9K A;  2PHY A;  4MN5 A;  1ACF A;  4Y5F A;  3CZD A;  4UA7 A;  4KZ8 A;  1LHY A;  4JBF A;  3OPL A;  4E3K A;  1O7E A;  4E3N A;  4GDB A;  4QD4 A;  3PHY A;  5HL1 A;  4XXR A;  1F5M A;  4DF6 A;  2FH5 A;  4BJP A;  1BLC A;  4C6Y A;  1W63 Q;  3MQQ A;  1FIK A;  1YMX A;  3IXH A;  3UE3 A;  3VOY A;  3VP1 A;  2ZM8 A;  1K38 A;  2VX8 A;  4GCZ A;  5M18 A;  3RTY A;  4I3J A;  4DN0 A;  3UDF A;  4WL9 A;  1RCJ A;  4S2P A;  3UPP A;  3AGD A;  2XEP A;  3D4F A;  1W8Q A;  4DMZ A;  3FZC A;  5FQ9 A;  3T1R A;  2Y2G A;  1TVF A;  4EQ1 A;  1FCM A;  4HNB A;  2FFY A;  2EFX A;  4N1H A;  4CLC A;  1IFQ A;  2JN7 A;  3S7P A;  1GA0 A;  1PW1 A;  2BLS A;  3F1N A;  4I39 A;  4JGP A;  4KZ7 A;  4H6J B;  3EOI A;  1H8Y A;  4GHI A;  1OT9 A;  5IHV A;  4P0M A;  4DJ3 A;  2JCH A;  3P7N A;  3IH8 A;  3G6O A;  3NHQ A;  4BL2 A;  2VZW A;  3QP1 A;  2B18 A;  3IX4 A;  4LFU A;  2K7S A;  5M1A A;  4LLO B;  3CMZ A;  3KSH A;  3MFD A;  5F5Y A;  2Q9M A;  3M2J A;  2Z2M B;  2UV0 E;  1YKD A;  1K57 C;  5DTK A;  1CEF A;  5FI7 A;  3MMH A;  3IXG A;  5GL9 A;  5D3O A;  3PAE A;  2WKE A;  5CXW A;  5J7E A;  2XFT A;  3JVU A;  1K54 A;  4Q0I A;  2VLG A;  3HJK A;  3OCL A;  5FI2 A;  3BFC A;  3IBJ A;  3DTE A;  4DE1 A;  1O07 A;  3ZNY A;  4K0W A;  4I3A A;  4PKY G;  4O01 A;  3IT9 A;  4X69 A;  2W3F A;  4NXF A;  1K56 D;  1BLS A;  3VP3 A;  1E25 A;  3DWZ A;  3UN7 A;  2EWW A;  3F1P B;  1PWD A;  3LFV A;  4JF5 A;  3S7O A;  1T1B A;  4MBK A;  5KIZ A;  1KE4 A;  2HV1 A;  2HDS A;  3CPT A;  3Q07 A;  3NI9 A;  5E2H A;  3NOU C;  4JXV A;  2E8I A;  2VKS A;  4O0P A;  2P74 A;  2Y8H A;  2V8F A;  1IYP A;  4CJN A;  2W1T A;  3LID A;  1PNE A;  1S4R A;  4OQG A;  3R7W B;  3GTC A;  2VV7 A;  1IKI A;  4WUJ A;  4KG2 A;  1L3L A;  1EWZ A;  1YLZ A;  3GDI A;  4Y0U A;  1NRF A;  4E6X A;  2DMW A;  3MFX A;  3CWF A;  1N9N A;  5GHX A;  4EWF A;  3BM6 A;  4ZJ2 A;  2WZZ A;  1XJ4 A;  1E4D A;  4K91 A;  3C7V A;  4QU3 A;  3FV7 A;  2QJ7 A;  1DRM A;  3VP4 A;  3GSG A;  5AQA A;  4B9O A;  4UQI S;  1YLP A;  5LBR A;  1L0E A;  5KZH A;  4U0X A;  1G6A A;  3VV4 A;  3B47 A;  5TBM A;  4GOG A;  2X02 A;  3ZVW A;  1BUL A;  2J9P A;  4OQH A;  3HUO A;  3RJU A;  2HF6 A;  2Y2O A;  4HJ4 A;  1T19 A;  2QZ6 A;  3WS4 A;  1VB6 A;  3F1O A;  1FR1 A;  1BLH A;  1G6O A;  4QY6 A;  3T4T A;  3ZG5 A;  4JGO A;  4H8R A;  3OOV A;  5DFX A;  3WWX A;  3PBO A;  3PBT A;  3LIC A;  3LIA A;  1K55 C;  1JWP A;  4WMC D;  3UE0 A;  3DTI A;  4X1L A;  5J8X A;  5FAT A;  5G4Z A;  2KX6 A;  2JHE A;  4HEF A;  1LLB A;  1E3U A;  4BBT A;  2CC1 A;  1OJG A;  4PM7 A;  2FZ0 A;  3HL9 A;  4S2L A;  2GNX A;  1YM1 A;  3A3J A;  3ZFZ A;  5JYP A;  2WGI A;  2FFF B;  2LB9 A;  3LR4 A;  4WMC A;  3SOI A;  4MCW A;  5HDD A;  1H3Q A;  3W2Z A;  2Y79 A;  2ZM2 A;  2GJ3 A;  1D7E A;  3E0Y A;  4FSF A;  2ZQ8 A;  1HVB A;  4EU0 A;  1ESU A;  4E3M A;  3HRE A;  4RX3 A;  2K31 A;  2WGV A;  1P0Z A;  3LIF A;  3EQV A;  4IVK A;  4MEZ A;  1XJ2 A;  1LL8 A;  3VOL A;  3SS5 A;  3EEA A;  3UNW A;  2W1R A;  1N9L A;  1STZ A;  2J9O A;  3MKE A;  3G2Z A;  3LO7 A;  4NG2 A;  1XXM A;  4Y13 A;  5CHJ A;  1EI5 A;  1T1A A;  4DE0 A;  2I72 A;  3P98 A;  3H82 B;  2V1Z A;  4CLC C;  1GSW A;  3GMW A;  4R38 A;  4Y17 A;  1GCE A;  3BY8 A;  3LIE A;  3IQA A;  1KGF A;  5F6A A;  2A24 A;  4RA7 A;  4ETX A;  4NXB A;  2DNS A;  3ZG7 B;  3BFG A;  2PAV P;  3K3D A;  4HQA A;  2XA7 M;  5EM1 A;  3C30 A;  2PBD P;  2ZQ7 A;  3W8K A;  3H7W B;  4R70 A;  1SKO A;  3VP0 A;  3N7W A;  5A93 A;  3CUE C;  1CI9 A;  3D72 A;  3E4Q A;  2QJ5 A;  2B02 A;  1S1Z A;  1P9R A;  4Q0J A;  5GLB A;  3CPT B;  5HWV A;  5FAS A;  2R78 A;  2AVX A;  2WKH A;  1YSP A;  5CGX A;  2PD7 A;  5A8B A;  1PI5 A;  2OOL A;  3UO9 A;  1W63 M;  1J3W A;  3QNB A;  3A0V A;  1LSW A;  4WEL A;  4BL3 A;  2XRO A;  5HX9 A;  5IT5 A;  1PZP A;  3OPR A;  4S2O A;  3C2W A;  1XJ6 A;  3WS1 A;  3QNC A;  3BWL A;  3RXW A;  3BLS A;  1DP6 A;  2VGL M;  4LPZ A;  4MLL A;  2G7U A;  4P6Z S;  1KOU A;  4ETZ A;  3IF6 B;  2XGN A;  1UGU A;  3VFH A;  4PHT A;  3N8S A;  2PT7 A;  1VEU B;  2P7J A;  5EVI A;  3HLF A;  1NYY A;  3VP2 A;  4F3L B;  2XFS A;  4KG6 A;  2JKG A;  4MBH A;  3QP4 A;  4E3I A;  3LI9 A;  2B5R A;  3Q81 A;  4B93 A;  3VE3 A;  3G2Y A;  4DJ2 A;  2O9C A;  5DJU A;  3UY6 A;  3WS5 A;  3MBZ A;  4WLA A;  4OOM A;  3B42 A;  3C4P A;  2W1T B;  3MSH A;  4MN6 A;  1SKF A;  5KMW A;  4JLF A;  3PBS A;  5E2F A;  4LCM A;  1ZKJ A;  4KQQ A;  2Y2L A;  4JGQ A;  4HBT A;  5FEG A;  2A2L A;  4JXW A;  2ZQD A;  3HLD A;  3BFE A;  5FDS A;  1XP4 A;  5HL6 A;  1HZO A;  2HDU A;  4GD6 A;  1ES5 A;  3T4L A;  4ZRR A;  1F98 A;  3NOT C;  5IU1 A;  1VQQ A;  1U60 A;  3OZH A;  3DAV A;  1BSG A;  3FKV A;  3MJQ A;  2H0Y A;  5EVE A;  2WKP A;  4E3O A;  3F1O B;  4II7 A;  2OLU A;  2QWS A;  1GHI A;  3NIA A;  3GQZ A;  1PI4 A;  1XFQ A;  2C6W B;  1M40 A;  4MDZ A;  1K56 A;  2WAD A;  3B3X A;  5CX7 A;  1FR6 A;  4JXG A;  1F2K A;  3T50 A;  4HP9 A;  2ZL1 B;  4JPM A;  5L8M A;  3PAG A;  5I5L A;  2E8J A;  5DKL A;  4Q0H A;  4LGW A;  4GJ4 A;  4QHC A;  3S4X A;  2A49 A;  5A92 A;  1TD5 A;  3T4S A;  2ZQC A;  1NWZ A;  3BQA A;  2WUQ A;  3A0R A;  5EE8 A;  4WYY A;  2Q9N A;  3IS2 B;  2OWH A;  3KSG A;  1FSY A;  1BYW A;  4S2I A;  4GHI B;  1P9W A;  4L0L A;  2Y59 A;  1TF1 A;  3HLE A;  4HIA A;  3T4K A;  1DP9 A;  2V9A A;  2ZL1 A;  3FPW A;  3T4O A;  2OLV A;  4NET A;  2ZLY A;  4EUZ A;  2ZJ9 A;  1GA9 A;  1OTA A;  4OKP A;  2V2F F;  2ZM0 A;  5HPF A;  3MR0 A;  1SDN A;  5E43 A;  4C3Q A;  1OTB A;  2CMN A;  5TR7 A;  1T1C A;  3T4J A;  3GVB A;  2WKR A;  5TGF A;  1L0G A;  2ZC5 B;  4X53 A;  3Q7Z A;  5EM0 A;  1GSX A;  4XUZ A;  2Z6C A;  1RP5 A;  2MJ6 A;  3MS6 A;  4QPR A;  4I5S A;  2WKQ A;  4GLQ A;  4M4X A;  1UWN X;  3V3S A;  4BQM A;  2O0Y A;  4P85 A;  5EOE A;  3LUQ A;  4PM6 A;  3UB6 A;  3R7W A;  4EW7 A;  1FOF A;  2EFU A;  3LYX A;  4F94 A;  5CEC A;  4OP8 A;  4S2N C;  3SH9 A;  1PRQ A;  3MQ0 A;  5HD5 A;  1QME A;  2Y2K A;  4G3W A;  3TRC A;  1XKZ A;  1XA1 A;  3QP8 A;  3QP6 A;  2J80 A;  1OT6 A;  1JWZ A;  5HAR A;  3C8C A;  4GB7 A;  4HOI A;  4EXO A;  3IHB A;  3M2K A;  4LRX C;  5GLA A;  2ZQA A;  3T12 B;  2PU2 A;  1LL9 A;  4LV0 A;  5CHU A;  3CG5 A;  3A3E A;  2HDR A;  3ZG9 B;  3E4P A;  2M7V A;  3WS0 A;  3WS2 A;  5FQK A;  2JKT M;  2QMI A;  1W8Y A;  2V0W A;  1JTG A;  4RYE A;  1BZA A;  2P9V B;  3UB8 A;  2Y2P A;  4KZ9 A;  5FSR A;  1N4O A;  1ZTU A;  3Q7V B;  2C5W B;  1VM1 A;  2PYR A;  4B88 A;  4IBR A;  1GSV A;  2PDR A;  3C7U A;  4OPZ A;  3QP2 A;  3IF6 A;  1ONG A;  5EVI B;  2NUP C;  4U0T A;  2XK1 A;  5AVF A;  2ZMF A;  2I9V A;  2BAS A;  2X01 A;  3LR5 A;  1MXO A;  2PBY A;  5EPH A;  3EEH A;  2XH9 A;  2WGW B;  3WRZ A;  1SCW A;  3IWQ A;  2XDM A;  5KSH A;  2XD5 A;  4RVA A;  4OP5 A;  1OJ5 A;  1VHM A;  3L7H A;  1L2S A;  4YNR A;  4ZBE A;  5HSQ A;  1BT5 A;  1XPB A;  4Y0O A;  3O5Y A;  4OOY A;  2XA7 S;  2K2N A;  2KDK A;  3DTK A;  4K08 A;  2JC7 A;  3BFF A;  4EER A;  4IUK A;  5FQJ A;  1C3B A;  4PMA A;  1AWI A;  1ERO A;  5DF7 A;  1LI9 A;  3RFB A;  2PYP A;  3LGO A;  1ES2 A;  1S66 L;  2JKT I;  2J8Y A;  3OCN A;  5HAP A;  5GLC A;  3IXD A;  2EWV A;  4E04 A;  3ZYT A;  4S2J A;  4ARZ B;  1TS7 A;  3W4Q A;  2HP6 A;  4HH3 A;  3G34 A;  3ZGA B;  5A90 A;  2DRW A;  2A24 B;  4L9F A;  2EXA A;  2V20 A;  3N4I A;  3ITB A;  2B95 A;  5FQQ A;  4D2O A;  1KVL A;  1MZU A;  4OVD A;  3S22 A;  1MKI A;  3K3C A;  5HD3 A;  5FDH A;  3W4P A;  2QYB A;  3B33 A;  2WK0 A;  2RCX A;  3SS4 A;  3IWI A;  2A3U A;  5AQB A;  4OPQ A;  1ERM A;  1ONH A;  3HLW A;  2WYX A;  4DDY A;  4OQ0 A;  3A3F A;  5CRF A;  1N9O A;  3EGX C;  3HBR A;  3MZD A;  1QMF A;  2PD8 A;  2ACG A;  1CJF A;  2WKI A;  3T1Q B;  5C5K A;  4KZA A;  3HLG A;  3NJA A;  1KVM A;  4BWI A;  2VGL S;  5DVA A;  3NUL A;  1RGY A;  1ODV A;  4WEJ A;  3C4O A;  4EBP A;  3T4Q A;  3G32 A;  4WN5 A;  2D02 A;  1A0K A;  1UWP X;  3PBN A;  1BTL A;  2GX5 A;  3UMD A;  3UB9 A;  5CGW A;  1BLP A;  3IH9 A;  2H5S A;  4N92 A;  3KSI A;  1IKG A;  3S7N A;  4R6L A;  4EBN A;  1MWU A;  4GZB A;  2HZ5 A;  4BD0 A;  1NY0 A;  1YPR A;  4CPK A;  4ZDX A;  3IBR A;  3UE1 A;  3NDG A;  2EXB A;  3UPO A;  2J7V A;  3MKF A;  1F9I A;  2ZC3 B;  5K5B A;  1IYS A;  5U47 A;  3IWO A;  1V9Y A;  4LRZ E;  3CJM A;  1W7F A;  3GV9 A;  3P01 A;  3WRT A;  2VJW A;  4BLM A;  1KDW A;  4PM8 A;  4E6W A;  4Y7P A;  2X71 A;  1NZU A;  2XQZ A;  1YMS A;  1K55 A;  1MC0 A;  1HLU P;  5G18 A;  3VOZ A;  2YKH A;  4IVI A;  5DF9 A;  3EWK A;  2PRF A;  2XD1 A;  3OC2 A;  3SS3 A;  3KYQ A;  1T18 A;  5GLD A;  2WGW A;  1TEM A;  4G3K A;  4XUX A;  2W3D A;  4NKP A;  1E3U D;  5F68 A;  1IEM A;  2XF3 A;  3RXX A;  2M7U A;  5CER A;  2O9B A;  4KUO A;  2HJE A;  1J9M A;  4CLC D;  3JPU A;  5AQ7 A;  3V50 A;  3C5A A;  2ZBB A;  4R23 A;  3AGE A;  3FC7 A;  5EVI C;  3DTM A;  1LSV A;  4FH4 A;  4BEN A;  3O87 A;  2KLI A;  2Z2L B;  4L9G A;  4NK3 A;  1CK3 A;  1NZO A;  1TS0 A;  5TJJ A;  2VV8 A;  4X6T A;  4ZAM A;  2DCF A;  4MNR A;  4LEN A;  3ZG0 A;  3LCE A;  3JVV A;  5AJG A;  4BBV A;  4IUH A;  3EQU A;  5DKK A;  3G35 A;  4GNU A;  2VA0 A;  5FQI A;  3FG8 A;  2ZC4 B;  1CI8 A;  4KEN B;  3MZF A;  3HUN A;  4WZ4 A;  3T1X A;  2ZQ9 A;  4EV4 A;  3ISG A;  1PWG A;  1YSQ A;  3V5M A;  3UME A;  1TDG A;  1XA7 A;  2Z6D A;  4UAA A;  3MF0 A;  2Y55 A;  1DJC A;  4OPY A;  4JXS A;  4N1X A;  1GHM A;  1OPX A;  4GS9 A;  1DJA A;  3BJN A;  4FD8 A;  4WM9 A;  3MXQ A;  2G2W A;  3OBF A;  4YWZ A;  1P97 A;  3TOI A;  1VET B;  3PR6 A;  5AVE A;  1VEU A;  3A0S A;  2RL3 A;  5F82 A;  2P08 A;  1WE4 A;  3VFF A;  3PBQ A;  3BW6 A;  3IHA A;  2ZC6 B;  2HPB A;  4Z9Q A;  3LEQ A;  4UQI M;  5JYO A;  4DKI A;  1KGE A;  4OOL A;  5GHY A;  5EUA A;  4BBU A;  1S4S A;  4L9E A;  1N9B A;  3HLB A;  2O99 A;  3L9K A;  3FYZ A;  3O88 A;  3SZT A;  3TW8 A;  2OAQ 1;  3VSL A;  5TBM B;  2JBF A;  2WAF A;  2Y2M A;  1ALQ A;  2L4R A;  1ESI A;  1Q2Q A;  2H10 A;  3NC8 A;  4HBU A;  4HJ3 A;  3LIB A;  4DXB A;  3SH8 A;  3M6B A;  2Y2J A;  4O8G A;  1KE0 A;  2JKR M;  4A5R A;  3UPN A;  2J3T D;  1V9Z A;  4OLD A;  3ZDJ A;  1Z09 A;  2HP9 A;  1PW8 A;  4HI4 A;  3KSF A;  1H8M A;  4KZ4 A;  4OON A;  2V1B A;  1LT0 A;  3V67 A;  4R3B A;  4IBX A;  1SKO B;  4JF4 A;  3NOP C;  1SHV A;  2PR6 A;  2IA2 A;  3R4K A;  2UWX A;  2P9V A;  1XFN A;  2L1M A;  1L0D A;  3H9W A;  2JKR I;  1DJB A;  1CEG A;  4MBF A;  2OWJ A;  4FTX A;  4HJ6 A;  4KZ3 A;  3HLC A;  1BUE A;  4R0Q A;  3F1N B;  2Y4A A;  4KZ6 A;  4R1G A;  1G28 A;  3K2N A;  2WZX A;  5CGS A;  3SH7 A;  5HZH A;  3ULF A;  3O3V A;  2GDN A;  1FCO A; 
#chains in the Genus database with same CATH homology
 4NG2 A;  4Y13 A;  5L09 A;  3QP2 A;  4Y15 A;  3SZT A;  3IX3 A;  5L10 A;  2AVX A;  3QP1 A;  3QP5 A;  3QP4 A;  3IX4 A;  4LFU A;  4LGW A;  4Y17 A;  1H0M A;  1L3L A;  2UV0 E;  3JPU A;  3IX8 A;  3QP8 A;  2Q0O A;  5L07 A;  3QP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...