5L07A

Crystal structure of quorum-sensing transcriptional activator from yersinia enterocolitica
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
165
structure length
162
Chain Sequence
YFDNESINEDIKNYIQRRIKAYGDLRYSYLVMNKKTPLHPTIISNYPLDWVKKYKKNSYHLIDPVILTAKDKVAPFAWDDNSVINKKSAVFKLAREYNIVNGYTFVLHDNSNNMATLNISNGSDDSISFDESIEINKEKIQMLLILTHEKMLGLYQSNSDKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quorum-sensing transcriptional activator
publication title Crystal Structure of Quorum-Sensing Transcriptional Activator from Yersinia enterocolitica
rcsb
source organism Yersinia enterocolitica
molecule tags Transcription
total genus 54
structure length 162
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 5l07A00
4Y17A 3JPUA 3QP1A 3QP4A 5L10A 4Y13A 1L3LA 3SZTA 3QP8A 2Q0OA 3QP2A 5L07A 5L09A 2UV0E 4Y15A 3QP6A 4NG2A 3IX4A 4LFUA 4LGWA 3IX8A 3QP5A 2AVXA 1H0MA 3IX3A
chains in the Genus database with same CATH superfamily
1TS8A 3PHYA 5CHUA 1PW8A 2XFTA 4HOIA 3HLEA 1F2KA 4F3LA 3OBFA 4BJPA 2B95A 2VGKA 2XGNA 1BUEA 3A3DA 3C7UA 3I7JA 2XH9A 3DTMA 3W4PA 2PDRA 2ZM0A 1NXYA 2JKTI 5AJGA 3BWLA 1YM1A 3LR3A 2P9VA 1DY6A 1PZOA 2JE5A 4IBRA 4Y5FA 1HD8A 2Y8HA 4E6WA 4GLQA 3HUNA 2ZMVA 4JKTA 1GHPA 1YLTA 4MMNA 1ZG6A 4EESA 5HL1A 3SZTA 1Z6FA 2Y2JA 3RJUA 1BTLA 1ESIA 4YWZA 3NCKA 3BQAA 3KO6A 3IF6B 3Q82A 2IWCA 4PKYG 4KQRA 2XEPA 3HLGA 5KSCA 1K4FA 3A0RA 1NJ4A 4XUZA 4DXCA 4Y13A 1EW0A 1PYYA 4KZ5A 2XR0A 2OWJA 2ACGA 4I3JA 4DE3A 1KGGA 3LO7A 3T12B 5HWTA 3C38A 4ZJ2A 3W2ZA 4E3MA 4JGOA 3B3XA 4KUOA 5DTKA 3R7WB 3VMAA 3IXBA 2L4RA 4LV1A 3H82A 2J9OA 2W3GA 3TRCA 4YOFA 2V1AA 3Q07A 2ZQ9A 4WMCA 4IUHA 4HBTA 1KE0A 3VSLA 3H7WB 1VHMA 2VX8A 3NOTC 1LSWA 3BQ8A 4NEED 4JF6A 4E3IA 1LHYA 4YINA 4DE0A 4DDYA 1WA9A 1LT0A 2B18A 1DJAA 3SW1A 4XXRA 5GL9A 3LUQA 1BLSA 5CX7A 4QY6A 2JKTM 5FQIA 2Y79A 2HJ9C 4R23A 1MZUA 4KZ4A 5TGFA 4LRZE 1VEUB 1EROA 1EI5A 3D4FA 2ZC7A 4GS9B 3E98A 4BMWA 5FQQA 2W1TB 1I2WA 3F1OB 4M4XA 4X25A 4DJ3A 4E3OA 4WMCD 4RQ9A 2Z2MB 2WGWB 3T4LA 3MKFA 2M7VA 4ZJ1A 1P0ZA 1N4OA 4GHIA 2EX2A 4A5RA 2V1ZA 1NRFA 1VETB 5F83A 3BY9A 1JWVA 4LPZA 1NRJA 3NDGA 2J9PA 1T19A 2A3UA 5CTNA 3T1QB 5EM0A 4HQAA 1L0EA 3IXHA 3HLBA 1CEFA 4QJGA 2WGVA 3CG5A 1PI4A 1K54A 2Y2KA 4N1XA 1K25A 2VK3A 1ES4A 3VE4A 2ZJ9A 2PR6A 5EOOA 3UE3A 3MQOA 2J7VA 4R0QA 4EERA 1FOFA 5M1AA 1OTIA 1RGZA 1OPXA 3G4PA 2VV6A 4GDNA 4H6JA 1OJGA 1MBLA 1SZVA 5L09A 5GLDA 4Y15A 4WEKA 4E6XA 1G28A 3Q7ZA 3UB6A 4OPZA 2FFFB 1YSPA 2VKSA 4JXVA 1G5UA 4CLCE 5TBMB 3KYEA 1NLYA 5E2FA 1A0KA 1T1BA 1LLBA 3NC8A 2A49A 3N6IA 4HP9A 4OH0A 4EW7A 4OVDA 3IBRA 5HSQA 1YAXA 3A3FA 5L10A 5C5KA 3G6OA 5F82A 4OOMA 3T50A 1MC0A 3VP0A 1VQQA 4R70A 1MKIA 3GVBA 1K57C 1MWTA 1S4SA 4L0LA 4Y3IA 4II7A 2IWBA 5J8XA 1HVBA 3IXGA 4C75A 2KLIA 1S1ZA 3W4OA 5HD5A 4RX2A 3LIBA 3T1XA 4L9GA 4KZBA 4E3LA 2HV1A 2X02A 1F9IA 1V9ZA 2NUTC 3OZHA 4R1GA 2VGLS 2UV0E 4MN7A 1ES2A 2XROA 2A24A 3NOUC 2W3EA 4JBFA 5FDSA 1FCOA 1JWZA 4KG2A 2HZ5A 3VOLA 1Z09A 4IBXA 1KDWA 4S2MA 1IELA 4GDBA 5IHVA 3ISGA 4EETB 2P04A 4O0PA 1XJ6A 3RXXA 2WGIA 5J3WA 4F3LB 4Y0TA 5EVIA 5HARA 3TOIA 3JVUA 3EOIA 4BBUA 3EEAA 4FH4A 5HPIA 5EV0A 1VEUA 4YFMA 4HJ4A 3EEHA 3NOPC 2PT7A 2IA2A 2P9VB 3P01A 1S4RA 4D2OA 5DFXA 2DRWA 3UDFA 2W1TA 1LSVA 3PAEA 4R3JA 4KUKA 2XK1A 2HJEA 3BFDA 5HX9A 4E04A 3A3IA 1H5XA 2PYRA 3UMDA 2XLNA 5IT5A 3MMHA 2W1RA 4UQIM 2OAP1 4OLDA 2Y2OA 1SHVA 4M3KA 4DN0A 5CXWA 1YMXA 4EBLA 4MN6A 1ODVA 4OQHA 1U60A 5DKKA 1VETA 3C2WA 4IEDA 1CJFA 1ERMA 2YKFA 4OOLA 5HW3A 5HDSA 2Y2QA 5EVID 3MFDA 4RYEA 1K55C 1W63M 2CC1A 3UPPA 3CWFA 5DJTA 5CEDA 1DP8A 2JC7A 3OOVA 3TG9A 2OWHA 2XD1A 1VM1A 2Q9MA 5AVEA 3DTIA 5FI7A 1KVMA 2DMWA 4S2KA 4ESPA 4P6BA 3H82B 1P9WA 2W3FA 1V9YA 2EA9A 5E2GA 1YLJA 5DVAA 1CI9A 3V5MA 4EQ1A 3PBRA 1CI8A 1TDLA 1T18A 3UB9A 1GHMA 5AQAA 1XJ2A 2XSSA 2XQZA 4U0XA 4ZAMA 4GW9A 3A3JA 2LB5A 4Q0JA 3MXQA 3B33A 1YLZA 3LICA 3Q7VA 4QPRA 2P74A 3MKEA 4WYYA 1KDSA 3ZGAB 3TW8A 1PW1A 2Y55A 2EX8A 2ZL1A 4ID4A 2WZZA 5U47A 3G34A 1LI9A 4MLLA 3IF5A 1HZOA 1SDEA 2ZC4B 1ACFA 3QP6A 3B42A 3PAGA 3T4KA 3FYZA 4LFUA 3KSGA 3RTYA 4O01A 1TVFA 1MY8A 3JPUA 4UHUA 4EV4A 1YQSA 2ZQCA 3LR0A 1D7EA 4UEYA 1TDGA 3PXPA 4LV0A 4OPYA 2I72A 4GHIB 3HJIA 3RFBA 3BY8A 1S66L 3VFFA 2L1MA 5HL6A 2Y91A 4Q0HA 1W8QA 1BLPA 5LBRA 1PWDA 4BL3A 1FIKA 3O3VA 1H8MA 1XGIA 2XA7S 2OLVA 4QWOA 3C4PA 2Y2LA 5DF7A 5F1FA 5EVIC 3ZG8B 5EM1A 2NUPC 4GD6A 3ULFA 2PHYA 2HPBA 3OPRA 2ZOIA 3A3EA 3F1NA 5FQ9A 4CQHA 4H6JB 1GSXA 1SKFA 3WRTA 2VEAA 3ZG5A 2J3TC 5CECA 1GA0A 3MXRA 3SH9A 3D3OA 1IYQA 1OT9A 4DJ2A 2HDUA 3E4PA 1D1JA 1FSWA 1RP5A 4HY8A 3N8LA 5L07A 4KQQA 2WKHA 4F94A 4RA7A 5EE8A 1RGYA 3E2KA 3LYXA 1FR6A 2OOLA 4BL2A 3AGFA 2H5SA 4K08A 4IJGA 1PWCA 4G3VA 5F5YA 2EX6A 5G18A 2Z2LB 4DRTA 1K57A 1L2SA 3VP4A 3LGOA 4O8GA 2Y2HA 3W8KA 3HVFA 1JTDA 2Y2NA 4YNRA 4AFIA 1STZA 1XJ3A 2Q9NA 3QNCA 3HLFA 2V8FA 2R9WA 2HGVA 4K91A 3BFGA 3K3CA 4ZBEA 2C6WB 2A24B 4OPRA 4PM8A 4PMAA 3T4OA 3ZNTA 4FH2A 5EECA 2O0YA 3ITAA 3PYPA 2H10A 2K2NA 1FSYA 4OQIA 3G31A 5HWVA 3S1YA 1XXMA 3PBNA 3MJQA 3EQUA 4OQ0A 2WKRA 2FH5A 4LV2A 1BSGA 1Y4OA 3OLOA 1K56D 3GV9A 2VV8A 4L9FA 2BLSA 4NKPA 3FKWA 3IWOA 4WN5A 1CEGA 3PBOA 3MZFA 1AWIA 5EVIB 1E25A 4NXFA 1ZTUA 3G30A 2VLGA 2I9VA 4N92A 3S7PA 2EXBA 5HAPA 1K0KA 4K0WA 5E43A 3MQQA 3WS2A 2GX5A 3IQAA 4BLMA 3G35A 3CITA 2PYPA 3D9YA 5DF9A 1L0DA 2OLUA 5I5LA 3T4QA 3SH7A 4ZDXA 2E8JA 3M2KA 5HWWA 2P08A 3QP1A 4NETA 2QKPA 3U4LP 4CJNA 5KSHA 1PRQA 5CERA 4WL9A 4OKPA 4WLAA 3JVVA 3H9WA 3L9KA 1TS6A 2C5WB 5HDDA 3S7NA 1OTBA 1YPRA 1BT5A 5DTSA 3RH8B 1XP4A 4E3KA 5FI2A 4P85A 4X55A 4B4ZA 2OSUA 4HI4A 4JF4A 1IFQA 2QMIA 5E2HA 3V50A 1K55A 2HF6A 1FQGA 4Z9QA 3PR6A 3CJMA 4UQIS 4GOGA 2B5RA 3BYDA 4JXGA 4BENA 2A2LA 2PU2A 2BG1A 1DJCA 3W4QA 3O87A 3UO9A 3KSHA 2P7JA 1LL5A 5IS1A 5AQ7A 4X1LA 4EEPA 2J80A 2JN7A 1DRMA 2D01A 3E0YA 5HFOA 3MF0A 3L7HA 3KYZA 1L0FA 4ME4A 4KZ3A 2PD8A 2VGJA 1ONHA 2QYBA 1ES3A 4JF5A 4S2IA 2GDNA 3FV7A 1MWUA 1CQAA 3NI9A 3OCNA 2VA0A 4DE1A 1QMFA 2LB9A 2ZC3B 1LSXA 1SDNA 4KENB 2E8IA 5HDCA 1KGFA 4ZJ3A 1GSWA 5MC7A 2Y2IA 3Q7VB 4JGRA 3OCLA 4PM5A 3P7NA 1KOUA 3EWKA 2ZLYA 3SS5A 3GECA 2W3DA 1YSQA 2ZL1B 3UN7A 1TD5A 1IEMA 1IYSA 3FC7A 2WKQA 1DP6A 1X0OA 3IWQA 1T1CA 1GSVA 5GLBA 5FI6A 4WBGA 4ETZA 3BW6A 3MSHA 2J8YA 4DMZA 5FL3A 1TEMA 5AQ9A 4Y0OA 4DXBA 1L0GA 2H28A 5M19A 4R6LA 5GLCA 5FAOA 3LFVA 2G2UA 5EUAA 3CPTA 1F98A 1KVLA 4FUWA 4DKIA 4GNUA 4WZ5C 3CUEC 3NHQA 5CGSA 5L2FA 5A92A 2BASA 3IX8A 4ZRRA 2M1CA 1W79A 1BULA 3MBZA 4QD4A 1OTDA 2H0TA 2ZBBA 2X01A 3UMEA 2ZQAA 3PBTA 2M7UA 4MN5A 2JBFA 3IH9A 1BLHA 1GCEA 3K3DA 2Z6DA 3ZQ5A 4CLCC 4S2JA 3WS5A 5GHYA 4Y7PA 1H3QA 3ITBA 4OP8A 3M6BA 3SH8A 1P9RA 2HDRA 4KG5A 2DNSA 3S7OA 2WAEA 2L0WA 1Q2QA 1IKIA 3KYQA 3WS0A 3VP2A 3F1NB 2ZD8A 4NXGA 4KQDA 1XFNA 4QY5A 1ES5A 2JKFA 4EEUA 3CAXA 5FQMA 3LCEA 2QPNA 1MWRA 4DE2A 1KE3A 1FR1A 3LIFA 2HP9A 1YT4A 2WADA 4FCFA 3JYIA 4R3BA 4I3IA 1WE4A 1XPBA 4HNBA 4P6ZM 4RX3A 4GCZA 5GLAA 2V0UA 3N8SA 1XFQA 3BM6A 3S22A 2MJ6A 3MS6A 2V2FF 1RCJA 4K0XA 4E3NA 5FEFA 4NK3A 2PD7A 2EFXA 4FD8A 2HDQA 2ZC6B 2JKGA 4LENA 5IU1A 4IHQA 3V39A 3Q81A 2JCHA 2QHKA 3R4KA 3O86A 1O7EA 2D02A 1W63Q 3T1SA 3M2JA 1S67L 3DW0A 3FZCA 2J3TD 3N7WA 3VSKA 2GJ3A 3BRMA 2RCXA 1HLUP 4DDSA 2KOIA 5HAIA 3MFXA 5F68A 3GDIA 4H8RA 4S2LA 4BQMA 3TJZC 1Q2PA 2WZXA 3A0SA 1L3LA 3IS2B 4HIAA 1IKGA 1Y54A 1N9OA 3UPOA 3ZNYA 5G4ZA 5A8BA 3V3SA 2UWXA 3FG8A 3QHYA 4EWFA 1WYCA 1UWNX 4MDZA 4E3JA 1S0WA 3CMZA 3EQVA 4BBVA 2KDKA 3UDIA 3UPNA 4QU3A 3LI8A 3PBQA 3UNWA 3NECA 1MPLA 5E2EA 4GKUA 1O07A 5F1GA 1PIOA 2WYXA 4S2OA 4X1MA 2VJWA 5CRFA 4IUKA 5JYPA 1P97A 5CHMA 3GMWA 5FDHA 3BLMA 3UB5P 1S6RA 5TR7A 2XRNA 5EVEA 3VOZA 4R4RA 1IYOA 4EQIA 5BOHA 4EBPA 1G6AA 4FSFA 3P98A 3MQ0A 1XKZA 3IBJA 3QP2A 2ZQ7A 4LCMA 3O88A 4X68A 5CTMA 4PPRA 2PU4A 3OC2A 1YLPA 3V3RA 1DP9A 4I39A 4DF6A 4HH3A 1I5QA 2AVXA 2VZWA 1FCMA 4QB8A 1N9BA 4R3AA 5GHZA 3IHAA 4Y2FA 1E3UD 4PAUA 2EWVA 4JXWA 4X53A 5J4EA 3E4OA 1M6KA 1Y28A 4CPKA 3ZG9B 3BLSA 2B02A 2WKEA 4GD8A 3VV4A 4C3QA 3S7QA 4WUJA 3UE6A 4EU0A 3IXDA 2V20A 5FASA 1ZG4A 1LL9A 2BTFP 3HL9A 3B47A 5K5BA 4O7DA 1PFLA 4WF0A 4GB7A 2KX6A 2ZQDA 4JGQA 1NYMA 1E4DA 3IX4A 3UE0A 4G3WA 1DJBA 3LR5A 1K6SA 1OJ5A 2W3HA 4R38A 3HBRA 1XGJA 2OAQ1 3KSFA 1K56A 3ZFZA 2O9BA 1KGEA 3E4QA 4PM9A 3LI9A 2J3WA 3QP8A 4Q8IA 5TFQA 1NZUA 2IWDA 3A0VA 4RVAA 5TJJA 1IYPA 5DKLA 1YLYA 1OTEA 4HP4A 4KZ7A 1VB6A 3IX3A 1XJ4A 2JKRM 3PTEA 1NZOA 1GA9A 4EUVA 2V1BA 4S2NA 5I94A 3WS1A 2PBDP 1ERQA 1LI0A 3UDXA 4UA7A 4HH2A 2OV5A 1XA7A 1PI5A 3CPTB 2INWA 3ZVTA 4WZ5A 3CUEA 1F5MA 1TS7A 4NXBA 3SS4A 5KZHA 1UGUA 3C7VA 4X6TA 3EGDC 4MCWA 1D06A 1MXOA 3IS2A 3WS4A 5DTTA 1C3BA 3DWZA 1CK3A 3VOYA 3T4SA 3HLDA 5HZHA 1K6RA 4BWIA 3HCYA 1NYYA 4KZ6A 4CLCA 1T1AA 3OPLA 4B4XA 4P0MA 3CHWP 3P09A 1AXBA 3D72A 2Z6CA 3LR4A 1K38A 1BYWA 2QZ6A 1LL8A 3UE1A 1OMEA 3GSGA 4KQOA 2V8CA 4XUXA 3DTKA 4ARZA 4ETXA 4UAAA 5A91A 1J3WA 5CGWA 1N9NA 2H0YA 4OQGA 2QWSA 4UA9A 4FTXA 5CHJA 1I2SA 4LV3A 1XA1A 5DF8A 2PAVP 2XA7M 3LY3A 4OOYA 3VE3A 4WZ4A 2CMNA 1PNEA 1SKOA 1CF0A 3CLOA 1H8ZA 3UB8A 5J7EA 3IT9A 4CLCD 3NULA 5F6AA 3F1PA 3ICYA 4XT2A 3S4XA 2RL3A 3T4TA 4B88A 2Y2PA 1ZKJA 1W7FA 1G6OA 4PM6A 4P6ZS 3QP4A 5D3OA 2WK0A 3DAVA 4N9KA 4JXSA 1PWGA 1WYBA 3Q1FA 2W0NA 4LRYC 5CEBA 3MR0A 1IOUA 1JNUA 4UA6A 4G3KA 2ZC5B 4B9OA 1M40A 4B93A 4JGPA 3GR2A 3BECA 4EBNA 3LIDA 4Z1WA 3E2LA 2XF3A 2X71A 5KIZA 3TSGA 5A90A 2Y4AA 4I3AA 3HREA 3G2YA 3NY4A 2ZQ8A 4PKYA 5FA7A 3T1RA 1NLZA 4KZ9A 3FWLA 4BD1A 1JWPA 3IF6A 3BEBA 2XFSA 1OT6A 4WM9A 4Y0UA 3BFFA 4BBTA 2ZM8A 3ZG7B 3N8RA 3M6HA 3HLWA 3G32A 3GTCA 1SCWA 4LRXC 4S2NC 2EX9A 1MKMA 1ZC2A 1JTGA 2ZM2A 3G2ZA 4X69A 2GZAA 3ZYTA 5KMWA 2HP6A 1W5DA 4PM7A 1EWZA 2R9XA 2V0WA 3HUOA 2WAFA 2XD5A 5FAPA 3R7WA 3ZDJA 2O9AA 4JPMA 1QMEA 5CGXA 3FPVA 4KZAA 3LIEA 3AGDA 4EUZA 3GQZA 4IVKA 4WEJA 5DJUA 4KG6A 2HDSA 3LEQA 3EGXC 3WWXA 1N9LA 4KZ8A 4GJ4A 3H7WA 1YKDA 4FOFA 1H8YA 4Q0IA 4Y17A 4OLGA 3NBLA 1PZPA 4I5SA 3C4OA 5JYOA 3WRZA 3ZHHA 4I38A 5EOEA 4HBUA 5A93A 2VV7A 4NXEA 4MNRA 4MBHA 2XDMA 5HD3A 3NIAA 1K4EA 1XX2A 1H0MA 2JHEA 2EFUA 2PRFA 5EVLA 4LCLA 2K7SA 1NWZA 2QJ7A 4PHTA 3BFCA 2G7UA 4GZBA 5L8MA 4GS9A 5EPHA 2ZMFA 1GHIA 1TS0A 1G68A 4C6YA 3VFHA 3AGEA 2FZ0A 3OPPA 3LEZA 3F1OA 2G2WA 3PBSA 4WELA 2Y2GA 5FAQA 5GHXA 2WGWA 3KX0X 2R78A 4D60A 3QNBA 5FATA 3T4JA 3LIAA 5FSRA 3KSIA 4OONA 1BLCA 3DTEA 3GRJA 4GN2A 3C5AA 4L9EA 3VP1A 1S1YA 4BD0A 4U0TA 4HJ3A 2Q0OA 3TE8A 3FKVA 1K54C 3DBAA 3K2NA 1OTAA 3ZCZA 4R4SA 2ZOHA 1HTZA 3V67A 4S2PA 4JLFA 3MZEA 2Y2MA 1ALQA 2PR5A 4U3TA 1UWPX 5F69A 5HAQA 5EFWA 2ZMAA 2W27A 3DWKA 3SS3A 3UY6A 5HPFA 2YKHA 3FPWA 3LY4A 5AQBA 2GNXA 1FILA 1MWSA 3ZVWA 3MXSA 1FCNA 3C8CA 3MZDA 3C30A 3CZDA 3UB7A 4HJ6A 4N1HA 2PBYA 4ZTKA 4MEZA 4HHDA 3IHBA 2WUQA 5TBMA 4CLCB 4IVIA 1NY0A 2V9AA 5FQJA 4MBFA 3IF6C 4P87A 2WKIA 1W8YA 4OP5A 1E3UA 3HJKA 3IH8A 3QP5A 2K31A 5M18A 4QHCA 2VGLM 2FFYA 1YLWA 2EXAA 3ZG0A 5AVFA 4HEFA 3N4IA 4ARZB 2EWWA 4LLOB 5FQKA 5FEGA 3CI6A 2HP5A 3RXWA 2QJ5A 1ESUA 2JKRI 4NG2A 1BZAA 1KE4A 3HLCA 4LGWA 3NDEA 1ONGA 2Y59A 3BFEA 2O9CA 3O5YA 3NJAA 3OPHA 4OPQA 3IWIA 3U2AA 2O99A 1TF1A 2WKPA 5G4YA 3SOIA 1SKOB 4EXOA 4N9LA 1J9MA 1JVJA 5DFYA 3F1PB 4X56A 3BJNA 2DCFA 3HUMA 4XT2B 1YMSA 3VP3A 1ZHHB 4HESA 4MBKA
chains in the Genus database with same CATH topology
4Y17A 3JPUA 3QP1A 3QP4A 5L10A 4Y13A 1L3LA 3SZTA 3QP8A 2Q0OA 3QP2A 5L07A 5L09A 2UV0E 4Y15A 3QP6A 4NG2A 3IX4A 4LFUA 4LGWA 3IX8A 3QP5A 2AVXA 1H0MA 3IX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y17 A;  3JPU A;  3QP1 A;  3QP4 A;  5L10 A;  4Y13 A;  1L3L A;  3SZT A;  3QP8 A;  2Q0O A;  3QP2 A;  5L07 A;  5L09 A;  2UV0 E;  4Y15 A;  3QP6 A;  4NG2 A;  3IX4 A;  4LFU A;  4LGW A;  3IX8 A;  3QP5 A;  2AVX A;  1H0M A;  3IX3 A; 
#chains in the Genus database with same CATH topology
 1TS8 A;  3PHY A;  5CHU A;  1PW8 A;  2XFT A;  4HOI A;  3HLE A;  1F2K A;  4F3L A;  3OBF A;  4BJP A;  2B95 A;  2VGK A;  2XGN A;  1BUE A;  3A3D A;  3C7U A;  3I7J A;  2XH9 A;  3DTM A;  3W4P A;  2PDR A;  2ZM0 A;  1NXY A;  2JKT I;  5AJG A;  3BWL A;  1YM1 A;  3LR3 A;  2P9V A;  1DY6 A;  1PZO A;  2JE5 A;  4IBR A;  4Y5F A;  1HD8 A;  2Y8H A;  4E6W A;  4GLQ A;  3HUN A;  2ZMV A;  4JKT A;  1GHP A;  1YLT A;  4MMN A;  1ZG6 A;  4EES A;  5HL1 A;  3SZT A;  1Z6F A;  2Y2J A;  3RJU A;  1BTL A;  1ESI A;  4YWZ A;  3NCK A;  3BQA A;  3KO6 A;  3IF6 B;  3Q82 A;  2IWC A;  4PKY G;  4KQR A;  2XEP A;  3HLG A;  5KSC A;  1K4F A;  3A0R A;  1NJ4 A;  4XUZ A;  4DXC A;  4Y13 A;  1EW0 A;  1PYY A;  4KZ5 A;  2XR0 A;  2OWJ A;  2ACG A;  4I3J A;  4DE3 A;  1KGG A;  3LO7 A;  3T12 B;  5HWT A;  3C38 A;  4ZJ2 A;  3W2Z A;  4E3M A;  4JGO A;  3B3X A;  4KUO A;  5DTK A;  3R7W B;  3VMA A;  3IXB A;  2L4R A;  4LV1 A;  3H82 A;  2J9O A;  2W3G A;  3TRC A;  4YOF A;  2V1A A;  3Q07 A;  2ZQ9 A;  4WMC A;  4IUH A;  4HBT A;  1KE0 A;  3VSL A;  3H7W B;  1VHM A;  2VX8 A;  3NOT C;  1LSW A;  3BQ8 A;  4NEE D;  4JF6 A;  4E3I A;  1LHY A;  4YIN A;  4DE0 A;  4DDY A;  1WA9 A;  1LT0 A;  2B18 A;  1DJA A;  3SW1 A;  4XXR A;  5GL9 A;  3LUQ A;  1BLS A;  5CX7 A;  4QY6 A;  2JKT M;  5FQI A;  2Y79 A;  2HJ9 C;  4R23 A;  1MZU A;  4KZ4 A;  5TGF A;  4LRZ E;  1VEU B;  1ERO A;  1EI5 A;  3D4F A;  2ZC7 A;  4GS9 B;  3E98 A;  4BMW A;  5FQQ A;  2W1T B;  1I2W A;  3F1O B;  4M4X A;  4X25 A;  4DJ3 A;  4E3O A;  4WMC D;  4RQ9 A;  2Z2M B;  2WGW B;  3T4L A;  3MKF A;  2M7V A;  4ZJ1 A;  1P0Z A;  1N4O A;  4GHI A;  2EX2 A;  4A5R A;  2V1Z A;  1NRF A;  1VET B;  5F83 A;  3BY9 A;  1JWV A;  4LPZ A;  1NRJ A;  3NDG A;  2J9P A;  1T19 A;  2A3U A;  5CTN A;  3T1Q B;  5EM0 A;  4HQA A;  1L0E A;  3IXH A;  3HLB A;  1CEF A;  4QJG A;  2WGV A;  3CG5 A;  1PI4 A;  1K54 A;  2Y2K A;  4N1X A;  1K25 A;  2VK3 A;  1ES4 A;  3VE4 A;  2ZJ9 A;  2PR6 A;  5EOO A;  3UE3 A;  3MQO A;  2J7V A;  4R0Q A;  4EER A;  1FOF A;  5M1A A;  1OTI A;  1RGZ A;  1OPX A;  3G4P A;  2VV6 A;  4GDN A;  4H6J A;  1OJG A;  1MBL A;  1SZV A;  5L09 A;  5GLD A;  4Y15 A;  4WEK A;  4E6X A;  1G28 A;  3Q7Z A;  3UB6 A;  4OPZ A;  2FFF B;  1YSP A;  2VKS A;  4JXV A;  1G5U A;  4CLC E;  5TBM B;  3KYE A;  1NLY A;  5E2F A;  1A0K A;  1T1B A;  1LLB A;  3NC8 A;  2A49 A;  3N6I A;  4HP9 A;  4OH0 A;  4EW7 A;  4OVD A;  3IBR A;  5HSQ A;  1YAX A;  3A3F A;  5L10 A;  5C5K A;  3G6O A;  5F82 A;  4OOM A;  3T50 A;  1MC0 A;  3VP0 A;  1VQQ A;  4R70 A;  1MKI A;  3GVB A;  1K57 C;  1MWT A;  1S4S A;  4L0L A;  4Y3I A;  4II7 A;  2IWB A;  5J8X A;  1HVB A;  3IXG A;  4C75 A;  2KLI A;  1S1Z A;  3W4O A;  5HD5 A;  4RX2 A;  3LIB A;  3T1X A;  4L9G A;  4KZB A;  4E3L A;  2HV1 A;  2X02 A;  1F9I A;  1V9Z A;  2NUT C;  3OZH A;  4R1G A;  2VGL S;  2UV0 E;  4MN7 A;  1ES2 A;  2XRO A;  2A24 A;  3NOU C;  2W3E A;  4JBF A;  5FDS A;  1FCO A;  1JWZ A;  4KG2 A;  2HZ5 A;  3VOL A;  1Z09 A;  4IBX A;  1KDW A;  4S2M A;  1IEL A;  4GDB A;  5IHV A;  3ISG A;  4EET B;  2P04 A;  4O0P A;  1XJ6 A;  3RXX A;  2WGI A;  5J3W A;  4F3L B;  4Y0T A;  5EVI A;  5HAR A;  3TOI A;  3JVU A;  3EOI A;  4BBU A;  3EEA A;  4FH4 A;  5HPI A;  5EV0 A;  1VEU A;  4YFM A;  4HJ4 A;  3EEH A;  3NOP C;  2PT7 A;  2IA2 A;  2P9V B;  3P01 A;  1S4R A;  4D2O A;  5DFX A;  2DRW A;  3UDF A;  2W1T A;  1LSV A;  3PAE A;  4R3J A;  4KUK A;  2XK1 A;  2HJE A;  3BFD A;  5HX9 A;  4E04 A;  3A3I A;  1H5X A;  2PYR A;  3UMD A;  2XLN A;  5IT5 A;  3MMH A;  2W1R A;  4UQI M;  2OAP 1;  4OLD A;  2Y2O A;  1SHV A;  4M3K A;  4DN0 A;  5CXW A;  1YMX A;  4EBL A;  4MN6 A;  1ODV A;  4OQH A;  1U60 A;  5DKK A;  1VET A;  3C2W A;  4IED A;  1CJF A;  1ERM A;  2YKF A;  4OOL A;  5HW3 A;  5HDS A;  2Y2Q A;  5EVI D;  3MFD A;  4RYE A;  1K55 C;  1W63 M;  2CC1 A;  3UPP A;  3CWF A;  5DJT A;  5CED A;  1DP8 A;  2JC7 A;  3OOV A;  3TG9 A;  2OWH A;  2XD1 A;  1VM1 A;  2Q9M A;  5AVE A;  3DTI A;  5FI7 A;  1KVM A;  2DMW A;  4S2K A;  4ESP A;  4P6B A;  3H82 B;  1P9W A;  2W3F A;  1V9Y A;  2EA9 A;  5E2G A;  1YLJ A;  5DVA A;  1CI9 A;  3V5M A;  4EQ1 A;  3PBR A;  1CI8 A;  1TDL A;  1T18 A;  3UB9 A;  1GHM A;  5AQA A;  1XJ2 A;  2XSS A;  2XQZ A;  4U0X A;  4ZAM A;  4GW9 A;  3A3J A;  2LB5 A;  4Q0J A;  3MXQ A;  3B33 A;  1YLZ A;  3LIC A;  3Q7V A;  4QPR A;  2P74 A;  3MKE A;  4WYY A;  1KDS A;  3ZGA B;  3TW8 A;  1PW1 A;  2Y55 A;  2EX8 A;  2ZL1 A;  4ID4 A;  2WZZ A;  5U47 A;  3G34 A;  1LI9 A;  4MLL A;  3IF5 A;  1HZO A;  1SDE A;  2ZC4 B;  1ACF A;  3QP6 A;  3B42 A;  3PAG A;  3T4K A;  3FYZ A;  4LFU A;  3KSG A;  3RTY A;  4O01 A;  1TVF A;  1MY8 A;  3JPU A;  4UHU A;  4EV4 A;  1YQS A;  2ZQC A;  3LR0 A;  1D7E A;  4UEY A;  1TDG A;  3PXP A;  4LV0 A;  4OPY A;  2I72 A;  4GHI B;  3HJI A;  3RFB A;  3BY8 A;  1S66 L;  3VFF A;  2L1M A;  5HL6 A;  2Y91 A;  4Q0H A;  1W8Q A;  1BLP A;  5LBR A;  1PWD A;  4BL3 A;  1FIK A;  3O3V A;  1H8M A;  1XGI A;  2XA7 S;  2OLV A;  4QWO A;  3C4P A;  2Y2L A;  5DF7 A;  5F1F A;  5EVI C;  3ZG8 B;  5EM1 A;  2NUP C;  4GD6 A;  3ULF A;  2PHY A;  2HPB A;  3OPR A;  2ZOI A;  3A3E A;  3F1N A;  5FQ9 A;  4CQH A;  4H6J B;  1GSX A;  1SKF A;  3WRT A;  2VEA A;  3ZG5 A;  2J3T C;  5CEC A;  1GA0 A;  3MXR A;  3SH9 A;  3D3O A;  1IYQ A;  1OT9 A;  4DJ2 A;  2HDU A;  3E4P A;  1D1J A;  1FSW A;  1RP5 A;  4HY8 A;  3N8L A;  5L07 A;  4KQQ A;  2WKH A;  4F94 A;  4RA7 A;  5EE8 A;  1RGY A;  3E2K A;  3LYX A;  1FR6 A;  2OOL A;  4BL2 A;  3AGF A;  2H5S A;  4K08 A;  4IJG A;  1PWC A;  4G3V A;  5F5Y A;  2EX6 A;  5G18 A;  2Z2L B;  4DRT A;  1K57 A;  1L2S A;  3VP4 A;  3LGO A;  4O8G A;  2Y2H A;  3W8K A;  3HVF A;  1JTD A;  2Y2N A;  4YNR A;  4AFI A;  1STZ A;  1XJ3 A;  2Q9N A;  3QNC A;  3HLF A;  2V8F A;  2R9W A;  2HGV A;  4K91 A;  3BFG A;  3K3C A;  4ZBE A;  2C6W B;  2A24 B;  4OPR A;  4PM8 A;  4PMA A;  3T4O A;  3ZNT A;  4FH2 A;  5EEC A;  2O0Y A;  3ITA A;  3PYP A;  2H10 A;  2K2N A;  1FSY A;  4OQI A;  3G31 A;  5HWV A;  3S1Y A;  1XXM A;  3PBN A;  3MJQ A;  3EQU A;  4OQ0 A;  2WKR A;  2FH5 A;  4LV2 A;  1BSG A;  1Y4O A;  3OLO A;  1K56 D;  3GV9 A;  2VV8 A;  4L9F A;  2BLS A;  4NKP A;  3FKW A;  3IWO A;  4WN5 A;  1CEG A;  3PBO A;  3MZF A;  1AWI A;  5EVI B;  1E25 A;  4NXF A;  1ZTU A;  3G30 A;  2VLG A;  2I9V A;  4N92 A;  3S7P A;  2EXB A;  5HAP A;  1K0K A;  4K0W A;  5E43 A;  3MQQ A;  3WS2 A;  2GX5 A;  3IQA A;  4BLM A;  3G35 A;  3CIT A;  2PYP A;  3D9Y A;  5DF9 A;  1L0D A;  2OLU A;  5I5L A;  3T4Q A;  3SH7 A;  4ZDX A;  2E8J A;  3M2K A;  5HWW A;  2P08 A;  3QP1 A;  4NET A;  2QKP A;  3U4L P;  4CJN A;  5KSH A;  1PRQ A;  5CER A;  4WL9 A;  4OKP A;  4WLA A;  3JVV A;  3H9W A;  3L9K A;  1TS6 A;  2C5W B;  5HDD A;  3S7N A;  1OTB A;  1YPR A;  1BT5 A;  5DTS A;  3RH8 B;  1XP4 A;  4E3K A;  5FI2 A;  4P85 A;  4X55 A;  4B4Z A;  2OSU A;  4HI4 A;  4JF4 A;  1IFQ A;  2QMI A;  5E2H A;  3V50 A;  1K55 A;  2HF6 A;  1FQG A;  4Z9Q A;  3PR6 A;  3CJM A;  4UQI S;  4GOG A;  2B5R A;  3BYD A;  4JXG A;  4BEN A;  2A2L A;  2PU2 A;  2BG1 A;  1DJC A;  3W4Q A;  3O87 A;  3UO9 A;  3KSH A;  2P7J A;  1LL5 A;  5IS1 A;  5AQ7 A;  4X1L A;  4EEP A;  2J80 A;  2JN7 A;  1DRM A;  2D01 A;  3E0Y A;  5HFO A;  3MF0 A;  3L7H A;  3KYZ A;  1L0F A;  4ME4 A;  4KZ3 A;  2PD8 A;  2VGJ A;  1ONH A;  2QYB A;  1ES3 A;  4JF5 A;  4S2I A;  2GDN A;  3FV7 A;  1MWU A;  1CQA A;  3NI9 A;  3OCN A;  2VA0 A;  4DE1 A;  1QMF A;  2LB9 A;  2ZC3 B;  1LSX A;  1SDN A;  4KEN B;  2E8I A;  5HDC A;  1KGF A;  4ZJ3 A;  1GSW A;  5MC7 A;  2Y2I A;  3Q7V B;  4JGR A;  3OCL A;  4PM5 A;  3P7N A;  1KOU A;  3EWK A;  2ZLY A;  3SS5 A;  3GEC A;  2W3D A;  1YSQ A;  2ZL1 B;  3UN7 A;  1TD5 A;  1IEM A;  1IYS A;  3FC7 A;  2WKQ A;  1DP6 A;  1X0O A;  3IWQ A;  1T1C A;  1GSV A;  5GLB A;  5FI6 A;  4WBG A;  4ETZ A;  3BW6 A;  3MSH A;  2J8Y A;  4DMZ A;  5FL3 A;  1TEM A;  5AQ9 A;  4Y0O A;  4DXB A;  1L0G A;  2H28 A;  5M19 A;  4R6L A;  5GLC A;  5FAO A;  3LFV A;  2G2U A;  5EUA A;  3CPT A;  1F98 A;  1KVL A;  4FUW A;  4DKI A;  4GNU A;  4WZ5 C;  3CUE C;  3NHQ A;  5CGS A;  5L2F A;  5A92 A;  2BAS A;  3IX8 A;  4ZRR A;  2M1C A;  1W79 A;  1BUL A;  3MBZ A;  4QD4 A;  1OTD A;  2H0T A;  2ZBB A;  2X01 A;  3UME A;  2ZQA A;  3PBT A;  2M7U A;  4MN5 A;  2JBF A;  3IH9 A;  1BLH A;  1GCE A;  3K3D A;  2Z6D A;  3ZQ5 A;  4CLC C;  4S2J A;  3WS5 A;  5GHY A;  4Y7P A;  1H3Q A;  3ITB A;  4OP8 A;  3M6B A;  3SH8 A;  1P9R A;  2HDR A;  4KG5 A;  2DNS A;  3S7O A;  2WAE A;  2L0W A;  1Q2Q A;  1IKI A;  3KYQ A;  3WS0 A;  3VP2 A;  3F1N B;  2ZD8 A;  4NXG A;  4KQD A;  1XFN A;  4QY5 A;  1ES5 A;  2JKF A;  4EEU A;  3CAX A;  5FQM A;  3LCE A;  2QPN A;  1MWR A;  4DE2 A;  1KE3 A;  1FR1 A;  3LIF A;  2HP9 A;  1YT4 A;  2WAD A;  4FCF A;  3JYI A;  4R3B A;  4I3I A;  1WE4 A;  1XPB A;  4HNB A;  4P6Z M;  4RX3 A;  4GCZ A;  5GLA A;  2V0U A;  3N8S A;  1XFQ A;  3BM6 A;  3S22 A;  2MJ6 A;  3MS6 A;  2V2F F;  1RCJ A;  4K0X A;  4E3N A;  5FEF A;  4NK3 A;  2PD7 A;  2EFX A;  4FD8 A;  2HDQ A;  2ZC6 B;  2JKG A;  4LEN A;  5IU1 A;  4IHQ A;  3V39 A;  3Q81 A;  2JCH A;  2QHK A;  3R4K A;  3O86 A;  1O7E A;  2D02 A;  1W63 Q;  3T1S A;  3M2J A;  1S67 L;  3DW0 A;  3FZC A;  2J3T D;  3N7W A;  3VSK A;  2GJ3 A;  3BRM A;  2RCX A;  1HLU P;  4DDS A;  2KOI A;  5HAI A;  3MFX A;  5F68 A;  3GDI A;  4H8R A;  4S2L A;  4BQM A;  3TJZ C;  1Q2P A;  2WZX A;  3A0S A;  1L3L A;  3IS2 B;  4HIA A;  1IKG A;  1Y54 A;  1N9O A;  3UPO A;  3ZNY A;  5G4Z A;  5A8B A;  3V3S A;  2UWX A;  3FG8 A;  3QHY A;  4EWF A;  1WYC A;  1UWN X;  4MDZ A;  4E3J A;  1S0W A;  3CMZ A;  3EQV A;  4BBV A;  2KDK A;  3UDI A;  3UPN A;  4QU3 A;  3LI8 A;  3PBQ A;  3UNW A;  3NEC A;  1MPL A;  5E2E A;  4GKU A;  1O07 A;  5F1G A;  1PIO A;  2WYX A;  4S2O A;  4X1M A;  2VJW A;  5CRF A;  4IUK A;  5JYP A;  1P97 A;  5CHM A;  3GMW A;  5FDH A;  3BLM A;  3UB5 P;  1S6R A;  5TR7 A;  2XRN A;  5EVE A;  3VOZ A;  4R4R A;  1IYO A;  4EQI A;  5BOH A;  4EBP A;  1G6A A;  4FSF A;  3P98 A;  3MQ0 A;  1XKZ A;  3IBJ A;  3QP2 A;  2ZQ7 A;  4LCM A;  3O88 A;  4X68 A;  5CTM A;  4PPR A;  2PU4 A;  3OC2 A;  1YLP A;  3V3R A;  1DP9 A;  4I39 A;  4DF6 A;  4HH3 A;  1I5Q A;  2AVX A;  2VZW A;  1FCM A;  4QB8 A;  1N9B A;  4R3A A;  5GHZ A;  3IHA A;  4Y2F A;  1E3U D;  4PAU A;  2EWV A;  4JXW A;  4X53 A;  5J4E A;  3E4O A;  1M6K A;  1Y28 A;  4CPK A;  3ZG9 B;  3BLS A;  2B02 A;  2WKE A;  4GD8 A;  3VV4 A;  4C3Q A;  3S7Q A;  4WUJ A;  3UE6 A;  4EU0 A;  3IXD A;  2V20 A;  5FAS A;  1ZG4 A;  1LL9 A;  2BTF P;  3HL9 A;  3B47 A;  5K5B A;  4O7D A;  1PFL A;  4WF0 A;  4GB7 A;  2KX6 A;  2ZQD A;  4JGQ A;  1NYM A;  1E4D A;  3IX4 A;  3UE0 A;  4G3W A;  1DJB A;  3LR5 A;  1K6S A;  1OJ5 A;  2W3H A;  4R38 A;  3HBR A;  1XGJ A;  2OAQ 1;  3KSF A;  1K56 A;  3ZFZ A;  2O9B A;  1KGE A;  3E4Q A;  4PM9 A;  3LI9 A;  2J3W A;  3QP8 A;  4Q8I A;  5TFQ A;  1NZU A;  2IWD A;  3A0V A;  4RVA A;  5TJJ A;  1IYP A;  5DKL A;  1YLY A;  1OTE A;  4HP4 A;  4KZ7 A;  1VB6 A;  3IX3 A;  1XJ4 A;  2JKR M;  3PTE A;  1NZO A;  1GA9 A;  4EUV A;  2V1B A;  4S2N A;  5I94 A;  3WS1 A;  2PBD P;  1ERQ A;  1LI0 A;  3UDX A;  4UA7 A;  4HH2 A;  2OV5 A;  1XA7 A;  1PI5 A;  3CPT B;  2INW A;  3ZVT A;  4WZ5 A;  3CUE A;  1F5M A;  1TS7 A;  4NXB A;  3SS4 A;  5KZH A;  1UGU A;  3C7V A;  4X6T A;  3EGD C;  4MCW A;  1D06 A;  1MXO A;  3IS2 A;  3WS4 A;  5DTT A;  1C3B A;  3DWZ A;  1CK3 A;  3VOY A;  3T4S A;  3HLD A;  5HZH A;  1K6R A;  4BWI A;  3HCY A;  1NYY A;  4KZ6 A;  4CLC A;  1T1A A;  3OPL A;  4B4X A;  4P0M A;  3CHW P;  3P09 A;  1AXB A;  3D72 A;  2Z6C A;  3LR4 A;  1K38 A;  1BYW A;  2QZ6 A;  1LL8 A;  3UE1 A;  1OME A;  3GSG A;  4KQO A;  2V8C A;  4XUX A;  3DTK A;  4ARZ A;  4ETX A;  4UAA A;  5A91 A;  1J3W A;  5CGW A;  1N9N A;  2H0Y A;  4OQG A;  2QWS A;  4UA9 A;  4FTX A;  5CHJ A;  1I2S A;  4LV3 A;  1XA1 A;  5DF8 A;  2PAV P;  2XA7 M;  3LY3 A;  4OOY A;  3VE3 A;  4WZ4 A;  2CMN A;  1PNE A;  1SKO A;  1CF0 A;  3CLO A;  1H8Z A;  3UB8 A;  5J7E A;  3IT9 A;  4CLC D;  3NUL A;  5F6A A;  3F1P A;  3ICY A;  4XT2 A;  3S4X A;  2RL3 A;  3T4T A;  4B88 A;  2Y2P A;  1ZKJ A;  1W7F A;  1G6O A;  4PM6 A;  4P6Z S;  3QP4 A;  5D3O A;  2WK0 A;  3DAV A;  4N9K A;  4JXS A;  1PWG A;  1WYB A;  3Q1F A;  2W0N A;  4LRY C;  5CEB A;  3MR0 A;  1IOU A;  1JNU A;  4UA6 A;  4G3K A;  2ZC5 B;  4B9O A;  1M40 A;  4B93 A;  4JGP A;  3GR2 A;  3BEC A;  4EBN A;  3LID A;  4Z1W A;  3E2L A;  2XF3 A;  2X71 A;  5KIZ A;  3TSG A;  5A90 A;  2Y4A A;  4I3A A;  3HRE A;  3G2Y A;  3NY4 A;  2ZQ8 A;  4PKY A;  5FA7 A;  3T1R A;  1NLZ A;  4KZ9 A;  3FWL A;  4BD1 A;  1JWP A;  3IF6 A;  3BEB A;  2XFS A;  1OT6 A;  4WM9 A;  4Y0U A;  3BFF A;  4BBT A;  2ZM8 A;  3ZG7 B;  3N8R A;  3M6H A;  3HLW A;  3G32 A;  3GTC A;  1SCW A;  4LRX C;  4S2N C;  2EX9 A;  1MKM A;  1ZC2 A;  1JTG A;  2ZM2 A;  3G2Z A;  4X69 A;  2GZA A;  3ZYT A;  5KMW A;  2HP6 A;  1W5D A;  4PM7 A;  1EWZ A;  2R9X A;  2V0W A;  3HUO A;  2WAF A;  2XD5 A;  5FAP A;  3R7W A;  3ZDJ A;  2O9A A;  4JPM A;  1QME A;  5CGX A;  3FPV A;  4KZA A;  3LIE A;  3AGD A;  4EUZ A;  3GQZ A;  4IVK A;  4WEJ A;  5DJU A;  4KG6 A;  2HDS A;  3LEQ A;  3EGX C;  3WWX A;  1N9L A;  4KZ8 A;  4GJ4 A;  3H7W A;  1YKD A;  4FOF A;  1H8Y A;  4Q0I A;  4Y17 A;  4OLG A;  3NBL A;  1PZP A;  4I5S A;  3C4O A;  5JYO A;  3WRZ A;  3ZHH A;  4I38 A;  5EOE A;  4HBU A;  5A93 A;  2VV7 A;  4NXE A;  4MNR A;  4MBH A;  2XDM A;  5HD3 A;  3NIA A;  1K4E A;  1XX2 A;  1H0M A;  2JHE A;  2EFU A;  2PRF A;  5EVL A;  4LCL A;  2K7S A;  1NWZ A;  2QJ7 A;  4PHT A;  3BFC A;  2G7U A;  4GZB A;  5L8M A;  4GS9 A;  5EPH A;  2ZMF A;  1GHI A;  1TS0 A;  1G68 A;  4C6Y A;  3VFH A;  3AGE A;  2FZ0 A;  3OPP A;  3LEZ A;  3F1O A;  2G2W A;  3PBS A;  4WEL A;  2Y2G A;  5FAQ A;  5GHX A;  2WGW A;  3KX0 X;  2R78 A;  4D60 A;  3QNB A;  5FAT A;  3T4J A;  3LIA A;  5FSR A;  3KSI A;  4OON A;  1BLC A;  3DTE A;  3GRJ A;  4GN2 A;  3C5A A;  4L9E A;  3VP1 A;  1S1Y A;  4BD0 A;  4U0T A;  4HJ3 A;  2Q0O A;  3TE8 A;  3FKV A;  1K54 C;  3DBA A;  3K2N A;  1OTA A;  3ZCZ A;  4R4S A;  2ZOH A;  1HTZ A;  3V67 A;  4S2P A;  4JLF A;  3MZE A;  2Y2M A;  1ALQ A;  2PR5 A;  4U3T A;  1UWP X;  5F69 A;  5HAQ A;  5EFW A;  2ZMA A;  2W27 A;  3DWK A;  3SS3 A;  3UY6 A;  5HPF A;  2YKH A;  3FPW A;  3LY4 A;  5AQB A;  2GNX A;  1FIL A;  1MWS A;  3ZVW A;  3MXS A;  1FCN A;  3C8C A;  3MZD A;  3C30 A;  3CZD A;  3UB7 A;  4HJ6 A;  4N1H A;  2PBY A;  4ZTK A;  4MEZ A;  4HHD A;  3IHB A;  2WUQ A;  5TBM A;  4CLC B;  4IVI A;  1NY0 A;  2V9A A;  5FQJ A;  4MBF A;  3IF6 C;  4P87 A;  2WKI A;  1W8Y A;  4OP5 A;  1E3U A;  3HJK A;  3IH8 A;  3QP5 A;  2K31 A;  5M18 A;  4QHC A;  2VGL M;  2FFY A;  1YLW A;  2EXA A;  3ZG0 A;  5AVF A;  4HEF A;  3N4I A;  4ARZ B;  2EWW A;  4LLO B;  5FQK A;  5FEG A;  3CI6 A;  2HP5 A;  3RXW A;  2QJ5 A;  1ESU A;  2JKR I;  4NG2 A;  1BZA A;  1KE4 A;  3HLC A;  4LGW A;  3NDE A;  1ONG A;  2Y59 A;  3BFE A;  2O9C A;  3O5Y A;  3NJA A;  3OPH A;  4OPQ A;  3IWI A;  3U2A A;  2O99 A;  1TF1 A;  2WKP A;  5G4Y A;  3SOI A;  1SKO B;  4EXO A;  4N9L A;  1J9M A;  1JVJ A;  5DFY A;  3F1P B;  4X56 A;  3BJN A;  2DCF A;  3HUM A;  4XT2 B;  1YMS A;  3VP3 A;  1ZHH B;  4HES A;  4MBK A; 
#chains in the Genus database with same CATH homology
 4Y17 A;  3JPU A;  3QP1 A;  3QP4 A;  5L10 A;  4Y13 A;  1L3L A;  3SZT A;  3QP8 A;  2Q0O A;  3QP2 A;  5L07 A;  5L09 A;  2UV0 E;  4Y15 A;  3QP6 A;  4NG2 A;  3IX4 A;  4LFU A;  4LGW A;  3IX8 A;  3QP5 A;  2AVX A;  1H0M A;  3IX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...