5L09A

Crystal structure of quorum-sensing transcriptional activator from yersinia enterocolitica in complex with 3-oxo-n-[(3s)-2-oxotetrahydrofuran-3-yl]hexanamide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
161
Chain Sequence
IIDYFDNESINEDIKNYIQRRIKAYGDLRYSYLVMNKKTPLHPTIISNYPLDWVKKYKKNSYHLIDPVILTAKDKVAPFAWDDNSVINKKDSAVFKLAREYNIVNGYTFVLHDNSNNMATLNISNGSDDSISFDESIEINKEKIQMLLILTHEKMLGLYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quorum-sensing transcriptional activator
publication title Crystal Structure of Quorum-Sensing Transcriptional Activator from Yersinia enterocolitica
rcsb
source organism Yersinia enterocolitica serotype o:8 / biotype 1b (strain nctc 13174 / 8081)
molecule tags Transcription
total genus 52
structure length 161
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 5l09A00
2Q0OA 3QP4A 4Y13A 4Y15A 5L09A 3IX4A 3SZTA 2UV0E 4Y17A 4NG2A 3IX3A 5L07A 4LFUA 3QP1A 3QP8A 1L3LA 3QP6A 2AVXA 3JPUA 4LGWA 3QP5A 3QP2A 3IX8A 1H0MA 5L10A
chains in the Genus database with same CATH superfamily
3T1XA 5CTNA 2W1TA 4HH2A 3VP2A 1NY0A 4MDZA 3QP1A 3SH7A 3IXGA 1JTDA 1OJGA 1MY8A 1UWNX 2C6WB 4OQIA 1W8YA 4JGOA 1K57C 2VGLM 3C7VA 4QWOA 2W3EA 1LSXA 5EVIB 4B4XA 5HWWA 4E3MA 3G6OA 4U0XA 3MFDA 3EQUA 2WGWB 5I5LA 2I72A 2D02A 3VSKA 1JVJA 3ZGAB 4CPKA 2E8IA 4OPYA 4P6BA 2PHYA 4X25A 2JKGA 3UPNA 1XJ4A 3LFVA 3RXWA 4EBLA 1VHMA 3DBAA 2VGKA 4RX3A 1SCWA 1FSYA 5HFOA 4PPRA 2PU4A 3SS4A 2JN7A 1D1JA 1LHYA 2WK0A 2Y2GA 5FQIA 5GHYA 3VFFA 4D60A 2HDQA 2OSUA 3SW1A 4R3JA 5DKLA 1K25A 2VGJA 4EESA 5I94A 4HI4A 1DP6A 1XA7A 2W1TB 4EBPA 1GSXA 3FYZA 4QPRA 3H82A 4F94A 4UAAA 1YQSA 1K57A 1OT9A 4MEZA 2WADA 5GLDA 2XROA 1GCEA 2JC7A 2R9WA 3LR4A 4PKYG 4DRTA 3N6IA 4NK3A 3H9WA 3W4OA 3OOVA 1DJAA 5FQMA 2ZMAA 3ZG9B 4KZ3A 1L0DA 2O9BA 5FQKA 5F68A 2BG1A 2HF6A 4ZBEA 3BFGA 1PWCA 5CHMA 3TE8A 4JLFA 2XD5A 3UDIA 1K0KA 1KDWA 1K56D 5GLBA 3G35A 1C3BA 4MBFA 4HNBA 1K6RA 4KG6A 1YLPA 1MKIA 4E3OA 3B33A 3RFBA 4R70A 4MBHA 2DMWA 2WKHA 2XFSA 3KSGA 2V8FA 3C30A 2J9PA 1GHIA 4FH2A 3CMZA 3D3OA 4M4XA 3WS5A 1FSWA 3G34A 3P09A 3IH8A 1P9RA 2ZQAA 5DTTA 5CGXA 1Z09A 1KVLA 2Y2IA 3BY8A 3D4FA 1ZC2A 4D2OA 1KOUA 3IX8A 1ONHA 2HDSA 4NXFA 3S1YA 5CECA 2WAFA 1O07A 3H82B 4BBVA 2QHKA 3FZCA 1L2SA 4BBUA 3Q81A 5EV0A 1S4RA 5TFQA 5TGFA 5E2HA 4GS9A 4UA7A 3OC2A 5A8BA 4KG2A 5L10A 4CLCD 2GZAA 4R38A 3QP4A 3QHYA 1BSGA 5AQ9A 2DCFA 2RL3A 1YAXA 3JVVA 1NXYA 4IEDA 3OPPA 1HZOA 5FQ9A 3OBFA 1G6AA 4S2MA 3BFCA 1WYBA 4EU0A 1IFQA 1XKZA 5G4ZA 3UDFA 4GZBA 3T12B 3PYPA 4EETB 2VA0A 4UQIM 4K0WA 3ZHHA 2QMIA 4KZBA 5A91A 2OLUA 1TEMA 2QJ5A 4DDSA 1BZAA 5EUAA 3V39A 1NRJA 4LGWA 3HLFA 3Q1FA 4JXVA 1ESIA 5GLAA 4OQ0A 4Y13A 3NDEA 1J3WA 2L4RA 2Y4AA 2K31A 4GD8A 4DKIA 1GA9A 5FSRA 1OJ5A 1N9BA 4QHCA 3O5YA 3PHYA 2KOIA 2XSSA 4OPQA 3IH9A 2D01A 4IJGA 4GS9B 3UE6A 1QMFA 4YWZA 2PYPA 2CMNA 1P97A 2X71A 2ACGA 3KSFA 5JYPA 5HAQA 1RGYA 3UE3A 3OZHA 3NC8A 4RQ9A 3ISGA 3PBTA 4L9FA 3ZQ5A 3PBOA 4P87A 1G28A 1GSWA 3SZTA 3UE1A 4X56A 3RJUA 4WL9A 4DE3A 2G2WA 4Z9QA 3IBRA 1M40A 2FFFB 3ICYA 3Q7ZA 4JF4A 5KSHA 3PBNA 3T4KA 1KGEA 5IHVA 4U0TA 2M1CA 1LT0A 4RA7A 1IKIA 2OLVA 4DE0A 2X01A 4HHDA 2OAQ1 3L7HA 1MZUA 2WGVA 3KYQA 1OTDA 4WBGA 1H5XA 1F5MA 4Z1WA 1GA0A 1CJFA 4B9OA 2EWVA 3LEZA 3BYDA 3CLOA 2R78A 3LIEA 3VE4A 3VP4A 5CHUA 2Y55A 2FZ0A 2PRFA 4O01A 1V9YA 3G30A 4G3WA 2O9AA 3VFHA 2PD7A 5FASA 2XA7S 4DDYA 2XD1A 2FFYA 3DTIA 3LI9A 2PBDP 1NYMA 1TS6A 4MBKA 2RCXA 5KZHA 1S4SA 1TS7A 3NOUC 4KZ7A 3NCKA 3GR2A 1CI9A 1QMEA 2W3GA 4WZ4A 4WLAA 3RXXA 5IS1A 2B02A 4YINA 3O87A 3VOYA 3GTCA 4ZDXA 4EEUA 3ZVTA 3G31A 4KENB 1G5UA 4KQOA 4BQMA 2R9XA 1LL8A 1N4OA 3LIDA 2B95A 3HJIA 3PAGA 3MQQA 4NETA 3LY3A 2XFTA 3Q7VA 4I39A 2WZXA 4EBNA 3IXHA 5L2FA 3OCNA 1N9NA 3AGDA 1KE0A 2ZBBA 3NULA 3HLWA 3LY4A 4YOFA 4KZAA 2XGNA 3S7OA 3ZDJA 3UN7A 4F3LA 3HVFA 1IYPA 3EEAA 2V20A 4ETZA 4MCWA 2NUPC 2Y2PA 1JWVA 2EA9A 1SHVA 4WF0A 2JKRI 2EX6A 2H10A 4HESA 1G68A 3E4OA 3BY9A 3EEHA 3HUMA 1FILA 4Q0HA 1X0OA 1ZG6A 3MQOA 5DJUA 3ZG8B 3BW6A 4N9LA 2JE5A 4LENA 1JTGA 3MXRA 4CQHA 1FCMA 3T4TA 3NIAA 4HBTA 4S2NC 3MBZA 3AGFA 3HCYA 3HLGA 1AWIA 2WZZA 3BFFA 1XFQA 4EV4A 4Y0OA 4KZ9A 2O9CA 3LR3A 1DJBA 2Z6DA 1YLJA 2GX5A 1K4FA 2J80A 5E2GA 4BD0A 3NDGA 5HL1A 1MKMA 3SOIA 1CK3A 4NXBA 4Y5FA 1BTLA 4UHUA 2H0TA 4C6YA 4JXGA 5FI2A 2VLGA 2XEPA 3GRJA 2A2LA 3TW8A 4WMCD 4S2IA 3S22A 3VOLA 4LPZA 4F3LB 2M7UA 4GHIA 1FCNA 1LSVA 4S2PA 2VV7A 1K38A 3F1OA 4MN7A 5FI6A 4HY8A 4RX2A 3CJMA 1PW1A 3DAVA 4FTXA 3W4QA 1LI0A 1XPBA 5A90A 3T4QA 1JWPA 4M3KA 4H6JA 1J9MA 3G4PA 1WYCA 5AQBA 4HH3A 2J7VA 1E3UD 4O7DA 1IOUA 2EX9A 4S2NA 1PRQA 5CRFA 2Q9NA 5FDHA 1S0WA 2DNSA 4ZJ1A 3QP8A 2ZLYA 5EECA 3JPUA 1I2WA 3EGDC 1ODVA 5F1GA 5DTKA 1KGFA 5HD3A 3VP3A 3RTYA 4QY5A 3AGEA 2WAEA 3RH8B 3QNCA 5HZHA 1IYQA 5K5BA 4KZ4A 4P6ZS 1IYOA 5J3WA 2V2FF 3S7PA 1ERQA 3IWQA 1YT4A 3HJKA 3GV9A 3B42A 3CITA 5E43A 3N8LA 4E3JA 5DF8A 3PAEA 4GHIB 5DVAA 5FI7A 4Y17A 2OV5A 1ESUA 4CLCC 2XQZA 1Q2PA 3E4PA 2H5SA 3PBRA 2HP9A 3F1OB 4PM7A 3BLMA 3D9YA 3NHQA 3M6BA 2IWDA 1S6RA 2XA7M 4HJ6A 4FD8A 4FH4A 1YLTA 4QB8A 3T50A 2YKHA 4H6JB 3LCEA 2HGVA 4EQIA 4DXBA 2HP6A 4ARZA 2BLSA 2XDMA 4GCZA 1RP5A 4OOLA 2HJEA 4Y2FA 4DMZA 3CWFA 4PM8A 4S2JA 2HDRA 4IVIA 4S2OA 5KIZA 5CGSA 2ZQDA 1BT5A 4MN6A 1TDGA 3T4OA 3BM6A 3JYIA 4QD4A 2WYXA 4C3QA 2O0YA 3HLDA 4JF6A 1L3LA 4GB7A 2Y59A 2PYRA 3U2AA 2INWA 4GDBA 2XRNA 4YFMA 4HP9A 2PDRA 3Q07A 3ITAA 4PHTA 2VEAA 2ZC7A 5G4YA 3UB5P 4DF6A 4Q0JA 4N9KA 4CLCA 2V1ZA 5HD5A 3BJNA 1TF1A 3LICA 2V1BA 4LLOB 2M7VA 3BLSA 2GNXA 2UWXA 3LI8A 1YM1A 2GJ3A 4E3LA 1H8MA 3LR0A 4JGQA 3I7JA 1WA9A 5AVFA 3IF6C 5FAOA 3BQAA 4I5SA 4ARZB 3HUOA 3DTEA 3IS2A 4IBXA 5HWTA 1KDSA 4O0PA 1NZOA 1P0ZA 3A3FA 1MC0A 1ERMA 4OONA 2W27A 3IT9A 3LYXA 2E8JA 4WM9A 4JXWA 3K3DA 4U3TA 3HUNA 2ZC3B 3UB6A 2ZJ9A 4MNRA 1XJ3A 3A3DA 5C5KA 5TJJA 1L0EA 1N9OA 4R4RA 2K2NA 4OH0A 4YNRA 1ES3A 3IBJA 1XJ2A 3S7QA 2WKIA 2G7UA 4JF5A 5FL3A 2KX6A 3NI9A 1IELA 2PU2A 3ZVWA 5FATA 4I3AA 5DF7A 4CLCB 2Z2LB 3HL9A 5EOOA 1PNEA 3VSLA 3BFEA 5FAQA 2Y2OA 1KGGA 3TJZC 4MN5A 2JKRM 3MJQA 3HLCA 4HEFA 4EW7A 2G2UA 4RVAA 1F9IA 3TSGA 2ZQ8A 3IF6A 3C4PA 3LIAA 2Q0OA 4IUHA 4X53A 1U60A 3MKEA 5HPFA 3KYEA 3NECA 3IS2B 2WGIA 1XGIA 4Y0UA 5EM0A 4BENA 5KMWA 1LI9A 3VP1A 3M2KA 4KUKA 4Y0TA 3N8RA 3FC7A 4ETXA 3O86A 5HAPA 1Y4OA 3U4LP 3C7UA 1PFLA 3E2KA 2IA2A 2JKTI 5FEFA 3K3CA 4L9GA 3GECA 1LSWA 2HZ5A 2VK3A 1BLPA 3ZFZA 4ME4A 3EOIA 5HDCA 3T1QB 1NLZA 1ES4A 4XUXA 1ONGA 3M6HA 4NXEA 2VV6A 2ZM8A 3JVUA 4BLMA 4PMAA 4FOFA 1NLYA 5F83A 1XA1A 4PM6A 3W4PA 1IKGA 2YKFA 2QJ7A 3GDIA 4X68A 4HOIA 5FA7A 1LL9A 5HX9A 1P9WA 5J7EA 3UO9A 2Z2MB 1GSVA 3CHWP 1JNUA 1YPRA 3PBQA 4L9EA 1M6KA 5F82A 4OLDA 1FR6A 3IF6B 3PTEA 2QKPA 4CJNA 5HW3A 2VZWA 4HQAA 3OPHA 4IHQA 4A5RA 3MS6A 2ZC4B 4R0QA 5J4EA 3WRTA 2OWHA 5EE8A 3NOTC 2A24A 3LR5A 4JGPA 1SDEA 1TDLA 3DTMA 1EROA 3V5MA 4EEPA 2B5RA 1DJCA 4P85A 3V50A 3MZFA 2OOLA 1RGZA 3KSHA 4I3IA 5M19A 2IWBA 5TR7A 2J9OA 1VEUA 4DXCA 1DP9A 3BWLA 4RYEA 2XR0A 3C5AA 5JYOA 4G3KA 4ZRRA 4X69A 5FAPA 4CLCE 4LRXC 1TS0A 4XXRA 5D3OA 2WKEA 4NXGA 5A92A 5M1AA 2XLNA 2KLIA 1YLWA 3CUEC 1HD8A 1XGJA 1MWSA 2AVXA 2HPBA 3SS3A 1MXOA 1UGUA 3A3JA 3GSGA 1UWPX 1XJ6A 5GL9A 5HAIA 4OQGA 1LLBA 2X02A 4BJPA 4EUZA 1EWZA 5HWVA 2Y8HA 1KVMA 5CGWA 1SDNA 1RCJA 4DJ2A 2WUQA 2PBYA 4DN0A 1Y28A 4B88A 4GD6A 1DY6A 3UPPA 1CI8A 2A24B 1CEGA 1HLUP 1MWUA 3LUQA 5EVEA 1YKDA 1FQGA 4R1GA 5FQJA 3KYZA 1OT6A 4N92A 3IF5A 3V67A 3R7WA 5F1FA 1AXBA 1VEUB 4EXOA 1FOFA 3F1PA 4QY6A 4O8GA 1HTZA 1N9LA 1XX2A 3R4KA 4BWIA 3MZDA 3BEBA 1BUEA 3FWLA 3F1NA 3DW0A 4JGRA 3CUEA 4WEJA 3FKWA 2A3UA 5HSQA 4X1LA 3IXDA 3N7WA 4ZTKA 5DKKA 3Q7VB 4ESPA 3VE3A 3EWKA 3LEQA 3FV7A 5AJGA 4PAUA 2Y79A 4LV1A 5DTSA 3UE0A 1EW0A 1WE4A 4H8RA 5EVID 1PYYA 4LRYC 3L9KA 3C2WA 1G6OA 1ZHHB 4UQIS 5DFXA 4QJGA 3HBRA 2UV0E 3G32A 4GN2A 2V0WA 1OMEA 1JWZA 5L07A 2EX8A 4S2KA 3UPOA 5CXWA 4JXSA 4KZ5A 3LO7A 4WYYA 1K55C 3KX0X 4KQRA 2A49A 3T4JA 5HDDA 3BFDA 2WKQA 3CZDA 3Q82A 1PWGA 4LRZE 1YLZA 3UY6A 3ZNYA 3R7WB 1XP4A 3NOPC 4GJ4A 4OPRA 3SS5A 1W5DA 3F1PB 4OOYA 1BLHA 4KQDA 3CI6A 5EVLA 4WELA 1PZOA 4N1XA 3FPWA 2J3TD 4JPMA 4K91A 3F1NB 4R23A 2I9VA 3MR0A 1MPLA 3ULFA 1K6SA 1KE3A 1W79A 3ZYTA 3EQVA 2V9AA 2XF3A 4LV3A 3MFXA 3MKFA 5KSCA 4GDNA 3A3EA 4WEKA 4BBTA 1L0GA 5IU1A 2VKSA 1W7FA 2BTFP 3PBSA 5CHJA 3DWZA 2ZC6B 5BOHA 4HJ3A 2BASA 1K56A 1K55A 2W1RA 4GKUA 4FSFA 1LL5A 1KE4A 3GMWA 4ID4A 2W3FA 4I3JA 1BULA 4UEYA 1OTEA 2JKFA 4JBFA 2JKTM 2EFUA 1IEMA 1D7EA 3OCLA 4OQHA 4B4ZA 4UA6A 1Y54A 1I2SA 3B3XA 3QNBA 2Z6CA 3IX3A 4S2LA 1ALQA 1T1BA 2Y91A 4IUKA 4IVKA 1ES5A 1CF0A 4GLQA 4EERA 4EQ1A 3WRZA 2XK1A 3IWOA 5GLCA 2Q9MA 4Y7PA 4ZAMA 2PD8A 4R4SA 3HLBA 5F5YA 2V8CA 5LBRA 4GNUA 4HJ4A 3M2JA 1T18A 1IYSA 3P98A 1BLSA 3QP5A 3G2YA 3HLEA 5J8XA 3LIBA 1XFNA 1L0FA 3FKVA 1TVFA 1ZG4A 3A0RA 1PI5A 3FPVA 3E4QA 1VQQA 1YSPA 4Q8IA 2OWJA 3EGXC 4WUJA 1STZA 4OPZA 5EFWA 4G3VA 2PAVP 2QYBA 1YMSA 1ZKJA 4C75A 3W8KA 3WS4A 5CTMA 3DTKA 3SH8A 5AQAA 3P7NA 2P74A 3UNWA 5EM1A 3CPTA 1D06A 4L0LA 3CAXA 3KO6A 2J3WA 2Y2MA 4PKYA 4OKPA 2H0YA 3LGOA 1OTAA 2GDNA 3NY4A 3TOIA 5E2FA 4II7A 2L1MA 1H3QA 1T1CA 1VM1A 3QP6A 3G2ZA 2V1AA 1CEFA 2VV8A 2ZQ7A 4NG2A 5EPHA 3W2ZA 4Y15A 1PIOA 3MF0A 2LB5A 3LIFA 4KZ8A 4OLGA 4JKTA 4PM5A 1OTBA 1Z6FA 4XUZA 4BD1A 4MLLA 1PW8A 4OP8A 4HIAA 4P0MA 3UB9A 4MMNA 2ZMFA 5CEBA 3UB7A 1I5QA 4R3AA 2EXAA 3BECA 4OVDA 2ZQCA 5A93A 1K4EA 3CPTB 2DRWA 4UA9A 1SKFA 3A3IA 3V3RA 3WS1A 3A0VA 2JCHA 1OPXA 2NUTC 2IWCA 2Y2KA 2ZMVA 2Y2HA 2ZOIA 5G18A 1S1ZA 1DP8A 2L0WA 2V0UA 3CG5A 3T1RA 5HDSA 1ZTUA 3ZCZA 1E25A 2VGLS 4BL3A 2HP5A 4OOMA 2PR6A 3VOZA 4P6ZM 2Y2QA 1TD5A 4NKPA 5EOEA 4K08A 5CERA 1YSQA 2ZC5B 4HP4A 3C4OA 1TS8A 5HPIA 3NBLA 4R3BA 1H8YA 3VV4A 3ZG5A 4DE2A 3TG9A 3P01A 1GHMA 2C5WB 2EWWA 2W3HA 4E6WA 2OAP1 4R6LA 3V3SA 3UB8A 5U47A 4XT2A 2HV1A 4KZ6A 1NJ4A 5AVEA 5TBMA 1S67L 2PT7A 3GQZA 2Y2JA 4KUOA 2EFXA 1SKOA 2J8YA 3B47A 4WN5A 1A0KA 2PR5A 4HBUA 2B18A 4I38A 3MQ0A 4PM9A 3WWXA 1S1YA 2ZM0A 2ZL1A 5FEGA 2H28A 1YMXA 1PZPA 3OPLA 4X6TA 4X1MA 5CX7A 1HVBA 1NRFA 3IX4A 2FH5A 4GOGA 1BYWA 2P04A 1S66L 4WZ5C 1VETA 3MSHA 4KG5A 5F6AA 1K54C 2ZD8A 3UMEA 4E3NA 1F2KA 4EWFA 3E0YA 3QP2A 3T1SA 1E4DA 2P9VA 3D72A 5M18A 4NEED 3H7WA 3A0SA 3K2NA 2HJ9C 3IQAA 1NWZA 3C8CA 3ITBA 1DRMA 4AFIA 1H8ZA 5EVIC 5HARA 2JBFA 5DFYA 3MXSA 3E2LA 4IBRA 3MMHA 1GHPA 4ZJ3A 2O99A 2WKPA 4KQQA 4LCMA 2MJ6A 4XT2B 1YLYA 4FCFA 5TBMB 3MZEA 1SZVA 3FG8A 4E04A 2Y2LA 1MWTA 4BL2A 1W63M 4FUWA 2ZM2A 1Q2QA 1SKOB 1BLCA 5GHZA 4LCLA 3IXBA 3HREA 1NZUA 1MWRA 4LV0A 3TRCA 3GVBA 2ZL1B 2QWSA 3S7NA 1F98A 5IT5A 1T1AA 3VMAA 1W8QA 1ACFA 2J3TC 2HDUA 3T4SA 4EUVA 2W0NA 4WZ5A 3OPRA 2Y2NA 2K7SA 3OLOA 1VETB 1K54A 3E98A 3ZNTA 3ZG0A 5F69A 1O7EA 3C38A 1H0MA 5MC7A 4E6XA 2WKRA 2VX8A 5CEDA 1FR1A 1NYYA 2EX2A 3BQ8A 2P9VB 3IWIA 1XXMA 4DJ3A 2KDKA 4B93A 5L8MA 3H7WB 4WMCA 5DJTA 4N1HA 5DF9A 5EVIA 2XH9A 2P7JA 1FCOA 2ZOHA 1MBLA 4GW9A 3VP0A 1PWDA 1T19A 4Q0IA 3O88A 1EI5A 1VB6A 3ZG7B 2WGWA 3IHBA 2JHEA 4BMWA 3WS0A 5L09A 5AQ7A 2ZQ9A 5HL6A 3UDXA 1OTIA 3N8SA 1PI4A 3MXQA 4X55A 4LFUA 1CQAA 2QZ6A 2P08A 1W63Q 2LB9A 4Y3IA 2CC1A 5GHXA 3NJAA 5FDSA 4QU3A 1E3UA 3N4IA 1V9ZA 2EXBA 3PXPA 3BRMA 4K0XA 1FIKA 2W3DA 3T4LA 4E3KA 3KSIA 1ES2A 5FQQA 3WS2A 3DWKA 4E3IA 3IHAA 4ZJ2A 3O3VA 3SH9A 3PR6A 4OP5A 2VJWA 4LV2A 5E2EA 4DE1A 3UMDA 2QPNA 3S4XA
chains in the Genus database with same CATH topology
2Q0OA 3QP4A 4Y13A 4Y15A 5L09A 3IX4A 3SZTA 2UV0E 4Y17A 4NG2A 3IX3A 5L07A 4LFUA 3QP1A 3QP8A 1L3LA 3QP6A 2AVXA 3JPUA 4LGWA 3QP5A 3QP2A 3IX8A 1H0MA 5L10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0O A;  3QP4 A;  4Y13 A;  4Y15 A;  5L09 A;  3IX4 A;  3SZT A;  2UV0 E;  4Y17 A;  4NG2 A;  3IX3 A;  5L07 A;  4LFU A;  3QP1 A;  3QP8 A;  1L3L A;  3QP6 A;  2AVX A;  3JPU A;  4LGW A;  3QP5 A;  3QP2 A;  3IX8 A;  1H0M A;  5L10 A; 
#chains in the Genus database with same CATH topology
 3T1X A;  5CTN A;  2W1T A;  4HH2 A;  3VP2 A;  1NY0 A;  4MDZ A;  3QP1 A;  3SH7 A;  3IXG A;  1JTD A;  1OJG A;  1MY8 A;  1UWN X;  2C6W B;  4OQI A;  1W8Y A;  4JGO A;  1K57 C;  2VGL M;  3C7V A;  4QWO A;  2W3E A;  1LSX A;  5EVI B;  4B4X A;  5HWW A;  4E3M A;  3G6O A;  4U0X A;  3MFD A;  3EQU A;  2WGW B;  5I5L A;  2I72 A;  2D02 A;  3VSK A;  1JVJ A;  3ZGA B;  4CPK A;  2E8I A;  4OPY A;  4P6B A;  2PHY A;  4X25 A;  2JKG A;  3UPN A;  1XJ4 A;  3LFV A;  3RXW A;  4EBL A;  1VHM A;  3DBA A;  2VGK A;  4RX3 A;  1SCW A;  1FSY A;  5HFO A;  4PPR A;  2PU4 A;  3SS4 A;  2JN7 A;  1D1J A;  1LHY A;  2WK0 A;  2Y2G A;  5FQI A;  5GHY A;  3VFF A;  4D60 A;  2HDQ A;  2OSU A;  3SW1 A;  4R3J A;  5DKL A;  1K25 A;  2VGJ A;  4EES A;  5I94 A;  4HI4 A;  1DP6 A;  1XA7 A;  2W1T B;  4EBP A;  1GSX A;  3FYZ A;  4QPR A;  3H82 A;  4F94 A;  4UAA A;  1YQS A;  1K57 A;  1OT9 A;  4MEZ A;  2WAD A;  5GLD A;  2XRO A;  1GCE A;  2JC7 A;  2R9W A;  3LR4 A;  4PKY G;  4DRT A;  3N6I A;  4NK3 A;  3H9W A;  3W4O A;  3OOV A;  1DJA A;  5FQM A;  2ZMA A;  3ZG9 B;  4KZ3 A;  1L0D A;  2O9B A;  5FQK A;  5F68 A;  2BG1 A;  2HF6 A;  4ZBE A;  3BFG A;  1PWC A;  5CHM A;  3TE8 A;  4JLF A;  2XD5 A;  3UDI A;  1K0K A;  1KDW A;  1K56 D;  5GLB A;  3G35 A;  1C3B A;  4MBF A;  4HNB A;  1K6R A;  4KG6 A;  1YLP A;  1MKI A;  4E3O A;  3B33 A;  3RFB A;  4R70 A;  4MBH A;  2DMW A;  2WKH A;  2XFS A;  3KSG A;  2V8F A;  3C30 A;  2J9P A;  1GHI A;  4FH2 A;  3CMZ A;  3D3O A;  4M4X A;  3WS5 A;  1FSW A;  3G34 A;  3P09 A;  3IH8 A;  1P9R A;  2ZQA A;  5DTT A;  5CGX A;  1Z09 A;  1KVL A;  2Y2I A;  3BY8 A;  3D4F A;  1ZC2 A;  4D2O A;  1KOU A;  3IX8 A;  1ONH A;  2HDS A;  4NXF A;  3S1Y A;  5CEC A;  2WAF A;  1O07 A;  3H82 B;  4BBV A;  2QHK A;  3FZC A;  1L2S A;  4BBU A;  3Q81 A;  5EV0 A;  1S4R A;  5TFQ A;  5TGF A;  5E2H A;  4GS9 A;  4UA7 A;  3OC2 A;  5A8B A;  4KG2 A;  5L10 A;  4CLC D;  2GZA A;  4R38 A;  3QP4 A;  3QHY A;  1BSG A;  5AQ9 A;  2DCF A;  2RL3 A;  1YAX A;  3JVV A;  1NXY A;  4IED A;  3OPP A;  1HZO A;  5FQ9 A;  3OBF A;  1G6A A;  4S2M A;  3BFC A;  1WYB A;  4EU0 A;  1IFQ A;  1XKZ A;  5G4Z A;  3UDF A;  4GZB A;  3T12 B;  3PYP A;  4EET B;  2VA0 A;  4UQI M;  4K0W A;  3ZHH A;  2QMI A;  4KZB A;  5A91 A;  2OLU A;  1TEM A;  2QJ5 A;  4DDS A;  1BZA A;  5EUA A;  3V39 A;  1NRJ A;  4LGW A;  3HLF A;  3Q1F A;  4JXV A;  1ESI A;  5GLA A;  4OQ0 A;  4Y13 A;  3NDE A;  1J3W A;  2L4R A;  2Y4A A;  2K31 A;  4GD8 A;  4DKI A;  1GA9 A;  5FSR A;  1OJ5 A;  1N9B A;  4QHC A;  3O5Y A;  3PHY A;  2KOI A;  2XSS A;  4OPQ A;  3IH9 A;  2D01 A;  4IJG A;  4GS9 B;  3UE6 A;  1QMF A;  4YWZ A;  2PYP A;  2CMN A;  1P97 A;  2X71 A;  2ACG A;  3KSF A;  5JYP A;  5HAQ A;  1RGY A;  3UE3 A;  3OZH A;  3NC8 A;  4RQ9 A;  3ISG A;  3PBT A;  4L9F A;  3ZQ5 A;  3PBO A;  4P87 A;  1G28 A;  1GSW A;  3SZT A;  3UE1 A;  4X56 A;  3RJU A;  4WL9 A;  4DE3 A;  2G2W A;  4Z9Q A;  3IBR A;  1M40 A;  2FFF B;  3ICY A;  3Q7Z A;  4JF4 A;  5KSH A;  3PBN A;  3T4K A;  1KGE A;  5IHV A;  4U0T A;  2M1C A;  1LT0 A;  4RA7 A;  1IKI A;  2OLV A;  4DE0 A;  2X01 A;  4HHD A;  2OAQ 1;  3L7H A;  1MZU A;  2WGV A;  3KYQ A;  1OTD A;  4WBG A;  1H5X A;  1F5M A;  4Z1W A;  1GA0 A;  1CJF A;  4B9O A;  2EWV A;  3LEZ A;  3BYD A;  3CLO A;  2R78 A;  3LIE A;  3VE4 A;  3VP4 A;  5CHU A;  2Y55 A;  2FZ0 A;  2PRF A;  4O01 A;  1V9Y A;  3G30 A;  4G3W A;  2O9A A;  3VFH A;  2PD7 A;  5FAS A;  2XA7 S;  4DDY A;  2XD1 A;  2FFY A;  3DTI A;  3LI9 A;  2PBD P;  1NYM A;  1TS6 A;  4MBK A;  2RCX A;  5KZH A;  1S4S A;  1TS7 A;  3NOU C;  4KZ7 A;  3NCK A;  3GR2 A;  1CI9 A;  1QME A;  2W3G A;  4WZ4 A;  4WLA A;  3RXX A;  5IS1 A;  2B02 A;  4YIN A;  3O87 A;  3VOY A;  3GTC A;  4ZDX A;  4EEU A;  3ZVT A;  3G31 A;  4KEN B;  1G5U A;  4KQO A;  4BQM A;  2R9X A;  1LL8 A;  1N4O A;  3LID A;  2B95 A;  3HJI A;  3PAG A;  3MQQ A;  4NET A;  3LY3 A;  2XFT A;  3Q7V A;  4I39 A;  2WZX A;  4EBN A;  3IXH A;  5L2F A;  3OCN A;  1N9N A;  3AGD A;  1KE0 A;  2ZBB A;  3NUL A;  3HLW A;  3LY4 A;  4YOF A;  4KZA A;  2XGN A;  3S7O A;  3ZDJ A;  3UN7 A;  4F3L A;  3HVF A;  1IYP A;  3EEA A;  2V20 A;  4ETZ A;  4MCW A;  2NUP C;  2Y2P A;  1JWV A;  2EA9 A;  1SHV A;  4WF0 A;  2JKR I;  2EX6 A;  2H10 A;  4HES A;  1G68 A;  3E4O A;  3BY9 A;  3EEH A;  3HUM A;  1FIL A;  4Q0H A;  1X0O A;  1ZG6 A;  3MQO A;  5DJU A;  3ZG8 B;  3BW6 A;  4N9L A;  2JE5 A;  4LEN A;  1JTG A;  3MXR A;  4CQH A;  1FCM A;  3T4T A;  3NIA A;  4HBT A;  4S2N C;  3MBZ A;  3AGF A;  3HCY A;  3HLG A;  1AWI A;  2WZZ A;  3BFF A;  1XFQ A;  4EV4 A;  4Y0O A;  4KZ9 A;  2O9C A;  3LR3 A;  1DJB A;  2Z6D A;  1YLJ A;  2GX5 A;  1K4F A;  2J80 A;  5E2G A;  4BD0 A;  3NDG A;  5HL1 A;  1MKM A;  3SOI A;  1CK3 A;  4NXB A;  4Y5F A;  1BTL A;  4UHU A;  2H0T A;  4C6Y A;  4JXG A;  5FI2 A;  2VLG A;  2XEP A;  3GRJ A;  2A2L A;  3TW8 A;  4WMC D;  4S2I A;  3S22 A;  3VOL A;  4LPZ A;  4F3L B;  2M7U A;  4GHI A;  1FCN A;  1LSV A;  4S2P A;  2VV7 A;  1K38 A;  3F1O A;  4MN7 A;  5FI6 A;  4HY8 A;  4RX2 A;  3CJM A;  1PW1 A;  3DAV A;  4FTX A;  3W4Q A;  1LI0 A;  1XPB A;  5A90 A;  3T4Q A;  1JWP A;  4M3K A;  4H6J A;  1J9M A;  3G4P A;  1WYC A;  5AQB A;  4HH3 A;  2J7V A;  1E3U D;  4O7D A;  1IOU A;  2EX9 A;  4S2N A;  1PRQ A;  5CRF A;  2Q9N A;  5FDH A;  1S0W A;  2DNS A;  4ZJ1 A;  3QP8 A;  2ZLY A;  5EEC A;  3JPU A;  1I2W A;  3EGD C;  1ODV A;  5F1G A;  5DTK A;  1KGF A;  5HD3 A;  3VP3 A;  3RTY A;  4QY5 A;  3AGE A;  2WAE A;  3RH8 B;  3QNC A;  5HZH A;  1IYQ A;  5K5B A;  4KZ4 A;  4P6Z S;  1IYO A;  5J3W A;  2V2F F;  3S7P A;  1ERQ A;  3IWQ A;  1YT4 A;  3HJK A;  3GV9 A;  3B42 A;  3CIT A;  5E43 A;  3N8L A;  4E3J A;  5DF8 A;  3PAE A;  4GHI B;  5DVA A;  5FI7 A;  4Y17 A;  2OV5 A;  1ESU A;  4CLC C;  2XQZ A;  1Q2P A;  3E4P A;  2H5S A;  3PBR A;  2HP9 A;  3F1O B;  4PM7 A;  3BLM A;  3D9Y A;  3NHQ A;  3M6B A;  2IWD A;  1S6R A;  2XA7 M;  4HJ6 A;  4FD8 A;  4FH4 A;  1YLT A;  4QB8 A;  3T50 A;  2YKH A;  4H6J B;  3LCE A;  2HGV A;  4EQI A;  4DXB A;  2HP6 A;  4ARZ A;  2BLS A;  2XDM A;  4GCZ A;  1RP5 A;  4OOL A;  2HJE A;  4Y2F A;  4DMZ A;  3CWF A;  4PM8 A;  4S2J A;  2HDR A;  4IVI A;  4S2O A;  5KIZ A;  5CGS A;  2ZQD A;  1BT5 A;  4MN6 A;  1TDG A;  3T4O A;  3BM6 A;  3JYI A;  4QD4 A;  2WYX A;  4C3Q A;  2O0Y A;  3HLD A;  4JF6 A;  1L3L A;  4GB7 A;  2Y59 A;  2PYR A;  3U2A A;  2INW A;  4GDB A;  2XRN A;  4YFM A;  4HP9 A;  2PDR A;  3Q07 A;  3ITA A;  4PHT A;  2VEA A;  2ZC7 A;  5G4Y A;  3UB5 P;  4DF6 A;  4Q0J A;  4N9K A;  4CLC A;  2V1Z A;  5HD5 A;  3BJN A;  1TF1 A;  3LIC A;  2V1B A;  4LLO B;  2M7V A;  3BLS A;  2GNX A;  2UWX A;  3LI8 A;  1YM1 A;  2GJ3 A;  4E3L A;  1H8M A;  3LR0 A;  4JGQ A;  3I7J A;  1WA9 A;  5AVF A;  3IF6 C;  5FAO A;  3BQA A;  4I5S A;  4ARZ B;  3HUO A;  3DTE A;  3IS2 A;  4IBX A;  5HWT A;  1KDS A;  4O0P A;  1NZO A;  1P0Z A;  3A3F A;  1MC0 A;  1ERM A;  4OON A;  2W27 A;  3IT9 A;  3LYX A;  2E8J A;  4WM9 A;  4JXW A;  3K3D A;  4U3T A;  3HUN A;  2ZC3 B;  3UB6 A;  2ZJ9 A;  4MNR A;  1XJ3 A;  3A3D A;  5C5K A;  5TJJ A;  1L0E A;  1N9O A;  4R4R A;  2K2N A;  4OH0 A;  4YNR A;  1ES3 A;  3IBJ A;  1XJ2 A;  3S7Q A;  2WKI A;  2G7U A;  4JF5 A;  5FL3 A;  2KX6 A;  3NI9 A;  1IEL A;  2PU2 A;  3ZVW A;  5FAT A;  4I3A A;  5DF7 A;  4CLC B;  2Z2L B;  3HL9 A;  5EOO A;  1PNE A;  3VSL A;  3BFE A;  5FAQ A;  2Y2O A;  1KGG A;  3TJZ C;  4MN5 A;  2JKR M;  3MJQ A;  3HLC A;  4HEF A;  4EW7 A;  2G2U A;  4RVA A;  1F9I A;  3TSG A;  2ZQ8 A;  3IF6 A;  3C4P A;  3LIA A;  2Q0O A;  4IUH A;  4X53 A;  1U60 A;  3MKE A;  5HPF A;  3KYE A;  3NEC A;  3IS2 B;  2WGI A;  1XGI A;  4Y0U A;  5EM0 A;  4BEN A;  5KMW A;  1LI9 A;  3VP1 A;  3M2K A;  4KUK A;  4Y0T A;  3N8R A;  3FC7 A;  4ETX A;  3O86 A;  5HAP A;  1Y4O A;  3U4L P;  3C7U A;  1PFL A;  3E2K A;  2IA2 A;  2JKT I;  5FEF A;  3K3C A;  4L9G A;  3GEC A;  1LSW A;  2HZ5 A;  2VK3 A;  1BLP A;  3ZFZ A;  4ME4 A;  3EOI A;  5HDC A;  3T1Q B;  1NLZ A;  1ES4 A;  4XUX A;  1ONG A;  3M6H A;  4NXE A;  2VV6 A;  2ZM8 A;  3JVU A;  4BLM A;  4PMA A;  4FOF A;  1NLY A;  5F83 A;  1XA1 A;  4PM6 A;  3W4P A;  1IKG A;  2YKF A;  2QJ7 A;  3GDI A;  4X68 A;  4HOI A;  5FA7 A;  1LL9 A;  5HX9 A;  1P9W A;  5J7E A;  3UO9 A;  2Z2M B;  1GSV A;  3CHW P;  1JNU A;  1YPR A;  3PBQ A;  4L9E A;  1M6K A;  5F82 A;  4OLD A;  1FR6 A;  3IF6 B;  3PTE A;  2QKP A;  4CJN A;  5HW3 A;  2VZW A;  4HQA A;  3OPH A;  4IHQ A;  4A5R A;  3MS6 A;  2ZC4 B;  4R0Q A;  5J4E A;  3WRT A;  2OWH A;  5EE8 A;  3NOT C;  2A24 A;  3LR5 A;  4JGP A;  1SDE A;  1TDL A;  3DTM A;  1ERO A;  3V5M A;  4EEP A;  2B5R A;  1DJC A;  4P85 A;  3V50 A;  3MZF A;  2OOL A;  1RGZ A;  3KSH A;  4I3I A;  5M19 A;  2IWB A;  5TR7 A;  2J9O A;  1VEU A;  4DXC A;  1DP9 A;  3BWL A;  4RYE A;  2XR0 A;  3C5A A;  5JYO A;  4G3K A;  4ZRR A;  4X69 A;  5FAP A;  4CLC E;  4LRX C;  1TS0 A;  4XXR A;  5D3O A;  2WKE A;  4NXG A;  5A92 A;  5M1A A;  2XLN A;  2KLI A;  1YLW A;  3CUE C;  1HD8 A;  1XGJ A;  1MWS A;  2AVX A;  2HPB A;  3SS3 A;  1MXO A;  1UGU A;  3A3J A;  3GSG A;  1UWP X;  1XJ6 A;  5GL9 A;  5HAI A;  4OQG A;  1LLB A;  2X02 A;  4BJP A;  4EUZ A;  1EWZ A;  5HWV A;  2Y8H A;  1KVM A;  5CGW A;  1SDN A;  1RCJ A;  4DJ2 A;  2WUQ A;  2PBY A;  4DN0 A;  1Y28 A;  4B88 A;  4GD6 A;  1DY6 A;  3UPP A;  1CI8 A;  2A24 B;  1CEG A;  1HLU P;  1MWU A;  3LUQ A;  5EVE A;  1YKD A;  1FQG A;  4R1G A;  5FQJ A;  3KYZ A;  1OT6 A;  4N92 A;  3IF5 A;  3V67 A;  3R7W A;  5F1F A;  1AXB A;  1VEU B;  4EXO A;  1FOF A;  3F1P A;  4QY6 A;  4O8G A;  1HTZ A;  1N9L A;  1XX2 A;  3R4K A;  4BWI A;  3MZD A;  3BEB A;  1BUE A;  3FWL A;  3F1N A;  3DW0 A;  4JGR A;  3CUE A;  4WEJ A;  3FKW A;  2A3U A;  5HSQ A;  4X1L A;  3IXD A;  3N7W A;  4ZTK A;  5DKK A;  3Q7V B;  4ESP A;  3VE3 A;  3EWK A;  3LEQ A;  3FV7 A;  5AJG A;  4PAU A;  2Y79 A;  4LV1 A;  5DTS A;  3UE0 A;  1EW0 A;  1WE4 A;  4H8R A;  5EVI D;  1PYY A;  4LRY C;  3L9K A;  3C2W A;  1G6O A;  1ZHH B;  4UQI S;  5DFX A;  4QJG A;  3HBR A;  2UV0 E;  3G32 A;  4GN2 A;  2V0W A;  1OME A;  1JWZ A;  5L07 A;  2EX8 A;  4S2K A;  3UPO A;  5CXW A;  4JXS A;  4KZ5 A;  3LO7 A;  4WYY A;  1K55 C;  3KX0 X;  4KQR A;  2A49 A;  3T4J A;  5HDD A;  3BFD A;  2WKQ A;  3CZD A;  3Q82 A;  1PWG A;  4LRZ E;  1YLZ A;  3UY6 A;  3ZNY A;  3R7W B;  1XP4 A;  3NOP C;  4GJ4 A;  4OPR A;  3SS5 A;  1W5D A;  3F1P B;  4OOY A;  1BLH A;  4KQD A;  3CI6 A;  5EVL A;  4WEL A;  1PZO A;  4N1X A;  3FPW A;  2J3T D;  4JPM A;  4K91 A;  3F1N B;  4R23 A;  2I9V A;  3MR0 A;  1MPL A;  3ULF A;  1K6S A;  1KE3 A;  1W79 A;  3ZYT A;  3EQV A;  2V9A A;  2XF3 A;  4LV3 A;  3MFX A;  3MKF A;  5KSC A;  4GDN A;  3A3E A;  4WEK A;  4BBT A;  1L0G A;  5IU1 A;  2VKS A;  1W7F A;  2BTF P;  3PBS A;  5CHJ A;  3DWZ A;  2ZC6 B;  5BOH A;  4HJ3 A;  2BAS A;  1K56 A;  1K55 A;  2W1R A;  4GKU A;  4FSF A;  1LL5 A;  1KE4 A;  3GMW A;  4ID4 A;  2W3F A;  4I3J A;  1BUL A;  4UEY A;  1OTE A;  2JKF A;  4JBF A;  2JKT M;  2EFU A;  1IEM A;  1D7E A;  3OCL A;  4OQH A;  4B4Z A;  4UA6 A;  1Y54 A;  1I2S A;  3B3X A;  3QNB A;  2Z6C A;  3IX3 A;  4S2L A;  1ALQ A;  1T1B A;  2Y91 A;  4IUK A;  4IVK A;  1ES5 A;  1CF0 A;  4GLQ A;  4EER A;  4EQ1 A;  3WRZ A;  2XK1 A;  3IWO A;  5GLC A;  2Q9M A;  4Y7P A;  4ZAM A;  2PD8 A;  4R4S A;  3HLB A;  5F5Y A;  2V8C A;  5LBR A;  4GNU A;  4HJ4 A;  3M2J A;  1T18 A;  1IYS A;  3P98 A;  1BLS A;  3QP5 A;  3G2Y A;  3HLE A;  5J8X A;  3LIB A;  1XFN A;  1L0F A;  3FKV A;  1TVF A;  1ZG4 A;  3A0R A;  1PI5 A;  3FPV A;  3E4Q A;  1VQQ A;  1YSP A;  4Q8I A;  2OWJ A;  3EGX C;  4WUJ A;  1STZ A;  4OPZ A;  5EFW A;  4G3V A;  2PAV P;  2QYB A;  1YMS A;  1ZKJ A;  4C75 A;  3W8K A;  3WS4 A;  5CTM A;  3DTK A;  3SH8 A;  5AQA A;  3P7N A;  2P74 A;  3UNW A;  5EM1 A;  3CPT A;  1D06 A;  4L0L A;  3CAX A;  3KO6 A;  2J3W A;  2Y2M A;  4PKY A;  4OKP A;  2H0Y A;  3LGO A;  1OTA A;  2GDN A;  3NY4 A;  3TOI A;  5E2F A;  4II7 A;  2L1M A;  1H3Q A;  1T1C A;  1VM1 A;  3QP6 A;  3G2Z A;  2V1A A;  1CEF A;  2VV8 A;  2ZQ7 A;  4NG2 A;  5EPH A;  3W2Z A;  4Y15 A;  1PIO A;  3MF0 A;  2LB5 A;  3LIF A;  4KZ8 A;  4OLG A;  4JKT A;  4PM5 A;  1OTB A;  1Z6F A;  4XUZ A;  4BD1 A;  4MLL A;  1PW8 A;  4OP8 A;  4HIA A;  4P0M A;  3UB9 A;  4MMN A;  2ZMF A;  5CEB A;  3UB7 A;  1I5Q A;  4R3A A;  2EXA A;  3BEC A;  4OVD A;  2ZQC A;  5A93 A;  1K4E A;  3CPT B;  2DRW A;  4UA9 A;  1SKF A;  3A3I A;  3V3R A;  3WS1 A;  3A0V A;  2JCH A;  1OPX A;  2NUT C;  2IWC A;  2Y2K A;  2ZMV A;  2Y2H A;  2ZOI A;  5G18 A;  1S1Z A;  1DP8 A;  2L0W A;  2V0U A;  3CG5 A;  3T1R A;  5HDS A;  1ZTU A;  3ZCZ A;  1E25 A;  2VGL S;  4BL3 A;  2HP5 A;  4OOM A;  2PR6 A;  3VOZ A;  4P6Z M;  2Y2Q A;  1TD5 A;  4NKP A;  5EOE A;  4K08 A;  5CER A;  1YSQ A;  2ZC5 B;  4HP4 A;  3C4O A;  1TS8 A;  5HPI A;  3NBL A;  4R3B A;  1H8Y A;  3VV4 A;  3ZG5 A;  4DE2 A;  3TG9 A;  3P01 A;  1GHM A;  2C5W B;  2EWW A;  2W3H A;  4E6W A;  2OAP 1;  4R6L A;  3V3S A;  3UB8 A;  5U47 A;  4XT2 A;  2HV1 A;  4KZ6 A;  1NJ4 A;  5AVE A;  5TBM A;  1S67 L;  2PT7 A;  3GQZ A;  2Y2J A;  4KUO A;  2EFX A;  1SKO A;  2J8Y A;  3B47 A;  4WN5 A;  1A0K A;  2PR5 A;  4HBU A;  2B18 A;  4I38 A;  3MQ0 A;  4PM9 A;  3WWX A;  1S1Y A;  2ZM0 A;  2ZL1 A;  5FEG A;  2H28 A;  1YMX A;  1PZP A;  3OPL A;  4X6T A;  4X1M A;  5CX7 A;  1HVB A;  1NRF A;  3IX4 A;  2FH5 A;  4GOG A;  1BYW A;  2P04 A;  1S66 L;  4WZ5 C;  1VET A;  3MSH A;  4KG5 A;  5F6A A;  1K54 C;  2ZD8 A;  3UME A;  4E3N A;  1F2K A;  4EWF A;  3E0Y A;  3QP2 A;  3T1S A;  1E4D A;  2P9V A;  3D72 A;  5M18 A;  4NEE D;  3H7W A;  3A0S A;  3K2N A;  2HJ9 C;  3IQA A;  1NWZ A;  3C8C A;  3ITB A;  1DRM A;  4AFI A;  1H8Z A;  5EVI C;  5HAR A;  2JBF A;  5DFY A;  3MXS A;  3E2L A;  4IBR A;  3MMH A;  1GHP A;  4ZJ3 A;  2O99 A;  2WKP A;  4KQQ A;  4LCM A;  2MJ6 A;  4XT2 B;  1YLY A;  4FCF A;  5TBM B;  3MZE A;  1SZV A;  3FG8 A;  4E04 A;  2Y2L A;  1MWT A;  4BL2 A;  1W63 M;  4FUW A;  2ZM2 A;  1Q2Q A;  1SKO B;  1BLC A;  5GHZ A;  4LCL A;  3IXB A;  3HRE A;  1NZU A;  1MWR A;  4LV0 A;  3TRC A;  3GVB A;  2ZL1 B;  2QWS A;  3S7N A;  1F98 A;  5IT5 A;  1T1A A;  3VMA A;  1W8Q A;  1ACF A;  2J3T C;  2HDU A;  3T4S A;  4EUV A;  2W0N A;  4WZ5 A;  3OPR A;  2Y2N A;  2K7S A;  3OLO A;  1VET B;  1K54 A;  3E98 A;  3ZNT A;  3ZG0 A;  5F69 A;  1O7E A;  3C38 A;  1H0M A;  5MC7 A;  4E6X A;  2WKR A;  2VX8 A;  5CED A;  1FR1 A;  1NYY A;  2EX2 A;  3BQ8 A;  2P9V B;  3IWI A;  1XXM A;  4DJ3 A;  2KDK A;  4B93 A;  5L8M A;  3H7W B;  4WMC A;  5DJT A;  4N1H A;  5DF9 A;  5EVI A;  2XH9 A;  2P7J A;  1FCO A;  2ZOH A;  1MBL A;  4GW9 A;  3VP0 A;  1PWD A;  1T19 A;  4Q0I A;  3O88 A;  1EI5 A;  1VB6 A;  3ZG7 B;  2WGW A;  3IHB A;  2JHE A;  4BMW A;  3WS0 A;  5L09 A;  5AQ7 A;  2ZQ9 A;  5HL6 A;  3UDX A;  1OTI A;  3N8S A;  1PI4 A;  3MXQ A;  4X55 A;  4LFU A;  1CQA A;  2QZ6 A;  2P08 A;  1W63 Q;  2LB9 A;  4Y3I A;  2CC1 A;  5GHX A;  3NJA A;  5FDS A;  4QU3 A;  1E3U A;  3N4I A;  1V9Z A;  2EXB A;  3PXP A;  3BRM A;  4K0X A;  1FIK A;  2W3D A;  3T4L A;  4E3K A;  3KSI A;  1ES2 A;  5FQQ A;  3WS2 A;  3DWK A;  4E3I A;  3IHA A;  4ZJ2 A;  3O3V A;  3SH9 A;  3PR6 A;  4OP5 A;  2VJW A;  4LV2 A;  5E2E A;  4DE1 A;  3UMD A;  2QPN A;  3S4X A; 
#chains in the Genus database with same CATH homology
 2Q0O A;  3QP4 A;  4Y13 A;  4Y15 A;  5L09 A;  3IX4 A;  3SZT A;  2UV0 E;  4Y17 A;  4NG2 A;  3IX3 A;  5L07 A;  4LFU A;  3QP1 A;  3QP8 A;  1L3L A;  3QP6 A;  2AVX A;  3JPU A;  4LGW A;  3QP5 A;  3QP2 A;  3IX8 A;  1H0M A;  5L10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...