5L2KE

Crystal structure of gem42 tcr-cd1b-gmm complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
b'AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSPRLAGDEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor recognition of CD1b presenting a mycobacterial glycolipid.
pubmed doi rcsb
molecule keywords T-cell surface glycoprotein CD1b
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE02
1CFNA 1K8IA 2ESVD 3I9GL 2FRGP 4W70A 3EOTH 4DZ8B 5FGBA 3SDCD 3D18B 3QP3A 1HXMB 1SJVA 1ORQA 3WNKA 3QNZA 3R4DA 2Y7QB 1M7IB 2CMRH 4XPTL 3T2PA 1LEKA 5CJ5A 5IT2L 4PRPD 2QQLH 4OLZL 3ZYZA 2R56H 4J3WA 5HVWA 1IGIL 1AQDA 4LNVA 4Z0XA 5KBNC 3KPSE 4FFWD 4ERSH 3HC4L 5KG9B 1T3FB 3MYJB 4DVRH 5HI5D 4PBVC 4Z8FL 5C0BB 2BSRB 2ICWA 4I0PB 4X83A 5IK3B 1RUQH 1P9MA 3ULSA 1MI5E 2BC4B 3BKCH 5LGHL 1OARL 1ZXQA 4K2UL 1NANI 2YS4A 3CVIL 5J1TC 2F58H 4Q0XL 3JWDC 1DZBA 4LLWA 2IMNA 4FQHA 3O3BA 1S7UB 4DTGH 1TCRA 2FEDD 4JAMA 3FOLA 1A2YB 3K8MA 4QRRD 5DD5L 4PJEE 3UO1L 5A16A 1CWVA 2IPTL 3EOYG 1BOGB 3ZE0F 4OGXH 3PHOA 5KSAC 4KY1L 3P9LB 3B9DA 1JV5A 3E6FB 5EO9A 3WNLA 4QOKB 4UDTA 5TE4H 2X7LB 5IB2A 1C7SA 3HI5L 3E8UH 2AV7A 1FFRA 1LP9F 5F9AC 2DYPD 5F44A 5BS0D 3EDFA 3MV7B 5E5MA 3ECBB 3U0PB 2HKHL 4LNRB 5JO5A 4LK4A 3WIHA 4E41E 2MJWA 4XPFH 5CJOL 3MA9H 2VZOA 1XF4B 5CBEB 12E8H 4PS4L 2GK2A 1E27B 4HW6A 4ZSOB 2GJ6E 5EC2A 2UZIL 1JNNL 4WW2A 1MCWW 4HX1B 4JFDD 5HI5C 1UYWL 2IC2A 4UUJA 3UX9B 3VXNA 4PP2B 3N85L 5DRZB 5HI4D 5HDBF 3BPCB 1BM3L 4HJ0D 5DS8B 2CLRA 2J6EH 1E4WL 2L7JA 3N1PC 5GGUB 2FEDC 4GRMB 1TPXB 2I24N 2WV3A 1QO3B 1JZ7A 3VXME 1OP5K 4L8SB 5CD3A 1GC1H 3DURB 3MLSH 4JPWL 3MLPA 1AO7E 2OJEA 5ADPL 3IU3B 3D1MC 4F7CB 1JJUA 3JV5A 3MCLL 4JANB 3V4UL 4TNWF 2BSED 4PP1D 5IW3A 5BO1H 3MODL 4IRSB 4JM2F 3ROLA 1NFDA 3C5JB 5E0QA 1RIVL 4DUWA 2D03L 3GRWL 1YNLL 1J88A 5DUPL 3FB5B 5EWIH 4F33B 1JWSA 4AQOA 4HH9B 3CAFA 5FCUH 4HKJA 5D5MB 1WT5C 1ZT7A 5EBMB 1QG3A 2BVEA 4FMFA 5SWZA 3B8YA 1YY8B 2X40A 3F12A 4UQ2A 1K3ZA 5HI4C 4HJ0C 1S7SB 4Y5XC 3VFVA 4R4ND 1IGFH 4JFXA 4LLUB 4G9FB 1DE4B 1DQJA 4KAQH 1Z5LB 5L2KE 3OB8A 2DJSA 1FNEB 3CXHJ 2D0FA 2HLAB 4ACPA 1HHKA 1I1AA 2MNUA 3EO1B 1YZZA 5AAWA 1TVBB 5FV1L 3T4YA 3DX6B 4EDWH 1YA5A 3DROA 1CU4H 3E3QE 5F6IB 1BBJA 5E08H 4PP1C 2MQCA 4FQCL 2ADJA 4CVXA 3QCTL 2BY2A 4GW1A 2NY3D 1HHGB 2ZUQC 4CDGC 5ITBH 5T3XD 2BVUA 2VSCA 2B2XH 3H8NA 1KCKA 3ILQD 1MPAH 2PCPB 4QTHB 4G80B 2OMBA 3MA7B 3DXAE 4HULB 2BXZA 3IDMB 3P30L 1LO0L 4AYFA 1I1RA 4PY8I 5FO8B 3SDYH 1BQLH 2NX5B 4P5MB 4GMSL 4R4NC 2O5YH 3TLRA 3RUGB 1E4KA 5KOVC 4X6EA 1P4IH 3VDCA 5EUKB 3UP1A 3CU1A 5HYSA 5I1JH 1MREL 3QRFM 2YN5A 4DW2L 3TM6A 5L6YL 2D31A 1YEDB 1QLEL 4TNWK 3RY6C 3UYRL 5I18L 1NGXB 5DJ2B 5C8JA 2DL2A 4NO5B 4NNYA 1Q1JL 3OAYK 1AH1A 2J8HA 2A6DB 2BY1A 1AGCB 1WBZA 2ZUVA 1C5BH 3TT1H 5SWQB 4M3KB 1AD9A 1VEMA 2ARWA 2NY3C 4KDVA 4KJYA 1M71A 5EN2B 1CE1H 5DURD 3IDYC 4ZO7A 5JUEH 3QDMA 1Z9LA 4GKZA 4O2CB 2VDRL 1DSFH 4OQTL 3ILQC 4UDUB 4WWKC 2F15A 3CFBB 3LRSB 4ZNCD 4EN3B 1X5LA 3WFCH 2NW3A 1RUAL 5F9JB 5MERB 2C4XA 2ED9A 4GLRI 4JRXB 2PR4L 3IFOB 4G8GB 2BOBA 4NSKB 2Y5TB 3O6MH 2HJFB 3S5LB 4NNPL 2K7QA 1UH4A 4YDLB 2OTWA 1YY9D 4YE4L 5IW1A 2EYRA 1BQSA 1CF8L 4NDMB 2D7OA 4LU5L 4WO4B 2PO6C 4YDKL 3HLAA 2C3VA 1IGTA 1X5FA 1OW0C 4U6HB 5CGYD 4HKXB 2D2OA 4GRLA 1NLDL 1YDPB 1SY6A 4HIEB 4GJTB 3MGTB 3ALXA 3AXLA 2KPNA 3V6OE 4UB0H 4NUGH 1MRDH 4K7FB 2ENSA 3TCLB 3CFKA 4JKPH 3P0VH 1WZ1L 5CJ8A 4HAGA 1VPOH 5ABDE 1MJ8L 3OB0H 4Y8DC 3LS4H 1K4DA 2F8VA 3MRRA 2CR3A 1CLYH 1ZLVH 3L7EA 5K9JL 1EO5A 3NCJH 3TO2B 3MBED 4MQSB 1D5BA 3FQXA 1KB5B 4JY4B 1ND0B 5FYKE 4XX1G 1EIBA 5GRUH 3B9KC 3BPOC 4O9HH 2EIBA 3IF1A 3QHZL 3MOBH 4TUOB 1LD9A 5BVPH 4ZNEA 1YY9C 1A3LL 1FPTL 4V1DD 1CFQA 3ZT5A 5T3ZE 5EO1A 2AJZB 2PYEB 5CGYC 4BZ1H 2HJKA 2AERT 3MRCB 4PRIA 4TSCL 2YPLA 4PJAA 1FLTX 3MLWL 3WHXA 3NCYS 2DQDL 1I9RL 4M5YL 3DARA 5EA0H 3OKLB 1OAXH 3PL6B 4C57C 4PTUA 2FX8H 1KN4H 4L9LC 3EYQD 3BO8B 4Q7DA 5IBTL 2AK4A 2Y5EA 4QF1B 3MLUH 3L3JB 3CFCH 4FXKA 3GDBA 1NBYB 5GGVL 3QNXB 4HBCH 4KQ3H 3CH8A 1PVHA 2BSTA 4LGSB 5J13B 5GHWL 3WE6A 4YAQB 1CFVL 3BW9A 4D8PB 3MBEC 3QUZD 3IFNH 2G5BA 4ISVB 5B3JF 1FNGB 1QSED 3BJ91 3S88L 4IDLA 4XBPA 1MWAA 3QDGB 3GBNL 1L9MA 1VEPA 2H3NA 5C07A 1VACA 1JPFB 1F90H 2W0FA 3TNNA 4NJAL 2JCCA 4AEEA 5ID0B 4JZOB 4OFYD 3G04A 3TBWB 4BSJA 4HS8H 3UTPD 2XKUA 3SN6N 1XF3A 3IKCB 4WU7B 4XGZB 5DHVH 3SOBL 5I8OH 2YR3A 4NC1C 4R7NA 2F5AL 3U6RA 1ZGLP 2OK0H 3OBAA 1B0RB 4BSVB 5T1LD 2APBA 3KNBB 2R69H 1G7JB 2P8LB 3ARDB 3KPMA 2UVEA 3EYQC 5SV4A 1P7QB 1HQ4B 4F9LA 2IWGA 4S1SL 1MRCL 4PV8B 2Z8VC 4RIRB 1XCQB 4UT6L 3JWOH 2FIKB 3BRGC 5J06A 1KTDB 3FQTA 4B53A 1OAZH 1ZEAL 3GMQA 4KKCC 1NQBA 3RA7H 4UTAH 4Y4HC 4Z76A 4U2YA 2X2YA 1BQHG 3MV9B 3QXUA 4W6YB 1NDMA 4UI2A 3QUZC 5I19L 5C9JB 1VADB 4PLJD 2Q8BL 3V8CA 1S9XA 3BEVA 4U1JA 1NGYA 5FOJA 1PKQB 4HGMA 3K2UH 4JRYB 3FQUA 1CFSA 2QR0B 4QTIL 3ZLQC 4M7ZB 4XMKH 3W11D 3T0DA 2BNQE 3GMRA 4BQCA 3UBXA 2YXFA 5DD6A 4I48A 1U8LB 4QXTB 5E2VL 4MXVE 3GSNB 4OM1H 1LK3H 4LHUG 4UOW1 4YR6B 1E6JH 3F7VB 5J1SC 5C0CB 5KVMC 1UH3A 3G5XA 1O0VA 1KB5L 2GCYA 2VUYA 5IF0A 2X1WL 4HKBA 2X4QA 2LTQB 3NIDF 1JF1A 4L8DA 1NL0H 3FT2B 4QT5B 1K6QL 4JFFD 2V17H 4HCRH 4MDIB 4Q97A 1U8JB 3TEUA 3UPRA 2NQCA 4PV9B 3L9RB 2JB6A 4O51B 3INUH 1YPZE 1KCRL 2EYSB 4HMEA 1CICA 3MC0A 1Y6NR 4UNVA 4FQQA 5GS2D 1ZVSA 5T1DL 1IEBA 1DANT 1FIEA 2WNGA 4LDEB 5I1LB 1IM3A 1MVFA 4HS6B 4ZG1A 4FQ1L 3I02B 3MLZH 1G1YA 1HNFA 1G0XA 1XR8A 5DC4B 4PLJC 4OLYH 4U1MB 2PW1A 3Q3GA 2R0KL 3QYCA 3DX7B 1ADQL 4QRUB 4JCLA 5J6HA 3NCCB 2AJYL 3IDGA 4R9HA 2W65B 5HPMB 5GIRA 4MJIB 1DN2A 1T21B 4EDXA 5ERWB 5EOCJ 5KVFH 1JNHB 3QFJA 2FIRT 5E6IB 4FABH 4G6FB 3GEWB 3RUGF 1CK0L 3MLYH 1AI1H 2A38A 2GSIB 4WNQA 1T22A 2Q87A 2RFXB 4OIBA 3GMOB 2YMXH 3GSWA 1Q9WA 4L5FL 4WI5A 5CLTA 2C9AA 3RGVB 4JN2B 4KHXH 4U1GC 4UTBL 3LRHA 3BYTA 2IAMA 5DHVA 2R15A 5DK0B 4S2SB 5ACMA 3QAZB 4AIZB 3GIZH 4HD9A 4MQ7B 4X6FA 4OT1L 3GMNA 5MP6L 4HXAH 3GSUA 3CFJA 3NMEA 3C60D 4I18A 4M9PA 1X6NA 3G6DH 4KRMB 4OI7A 2FWOB 4K8RD 3LKPB 3RL1A 4P3WA 3W39B 2GIYA 1A14L 1JHKL 1Q94B 1RD6A 3GI9H 5MI0C 4FNLH 2CUMA 2FJFA 1W0VA 3Q6GH 3WIFA 3MV8A 3T77B 1U8NB 5IOPA 3O2DH 4ODXA 2OL3B 1H5BC 4V2BA 1NGQL 1X5IA 1JZ3A 3JV4A 3FB6A 1UM6H 3MNZB 1SJHB 3NABL 1GOGA 1IAOB 2B0SL 2R0LH 3EYOB 4JFPA 5TE7H 4OZIB 1WZKA 5J11B 3QQ4B 2EKJA 5F72S 5C09A 2XN9D 3VFTB 4JPVH 4N0UB 2H8PA 1GZQB 4LSVH 1R5VA 1WBYB 3KXFE 1OWWA 4UINL 4QNPF 4LP5A 3OAUH 3FFDA 3GSNL 5KSBA 1T4KA 2Z8SA 1NGPL 4P4KD 3VFWA 5SX5H 4OLVL 5TPWL 2A83B 2BDNL 3GMPB 3C60C 3QO0A 4ETQB 1WFTA 1MHEA 5C6WH 3O8XA 4K8RC 5CLWA 3BH8B 2N7BA 2XA3A 4U1KA 5HJ3B 2H2SC 4MA1B 1RI8A 1NC4D 2BVOA 3GFUA 4JPKL 3U2SA 3KLHC 4TVPE 3VJ6B 4WTZG 4OCXH 2PW2A 4NZUH 4GBXB 2F54A 1T1XB 3VFSA 1RUML 1GZPB 3TPUB 4NKMB 4HUVA 1FLRH 5DI8B 3UDWA 1EGJH 5IQ7L 4P9HC 3HS0B 1OAKH 2ZSWB 1AGFA 1HOCB 3BPNC 4G42B 4PJ8A 3L5WB 1PDKA 4I4WB 4MXWL 5I16A 4KGJA 2AEIT 4L3CB 2YWYA 3QIBD 3NH7H 5F6HJ 1L0XA 1VFOA 3OG4B 2DQTL 1YUHB 1QFWI 3AU1B 2DM3A 3D48R 3PWUA 4X8JB 4OSUH 5FGCB 3TFKD 4HT1L 1IM9A 4P4KC 3HE6D 2VLRA 4GQ9L 5KOMC 3QDJA 4XPGH 3ROOB 5IFAH 4WTXA 4OIAA 3PWJA 4LQFL 4NQEE 4X4ZA 4X9IA 4WEMB 1FVDA 3LZFH 5C0AD 1FNHA 3WL9B 5DQDL 1DVFD 1MCOH 4PJFE 2Q6WA 5F7NC 5CKAA 4U0QB 1AHWC 1QFWM 3QG7H 2ZCKH 3KPOB 3K81A 5HHPA 4NZTH 5FYJH 1JK8B 4LPTA 1CS6A 1CD9B 3GIVB 5I1GL 1J7VR 1F6AA 3TIEB 2LAGB 2HTKD 4G6MH 2DLEA 3OXRA 1ZHBB 1CD1B 2D7MA 4LCIL 4TULL 3GUTB 4IDJH 4NQCE 5D6CA 3QUMH 2OL3L 3HA0A 3NA4A 5KSUA 5AYQA 3F62A 4JFQA 1W0WB 2GQHA 5EIIB 3NCFB 2MKWA 1XF1A 3OJDA 3QIBC 1JL8A 4FZEH 4NQUA 3BVNB 3MNWA 2FGWL 3TGXA 3T2NL 4XXDA 3JXAA 1RAMA 5HHOE 3TFKC 4JY6A 3HE6C 2A73A 4ZFGH 2NY7L 3E3QC 3C6LA 4G9DA 1IFHH 2HN7A 3H0TB 3FB8B 4PRHB 3C5SA 1T1YB 1A7QL 5DUBB 1NUDA 1RQ5A 3IS1X 1S9YB 3LV3B 4Z77A 5DK2B 3WKML 4URTB 1AXIB 1LE9B 4K3HA 3L3GA 5E5RB 4NFCA 1U95A 5D7LD 5B22A 2IANB 4K3JH 1UJ3B 3ZDXF 1CBVL 3BGMA 4H1LG 1XAUA 4EI5B 5ICZA 4IBLT 3B3IA 2C3WA 3FRUA 4P2RB 3PP4L 5GISH 2EO9A 2HMID 4LVOC 2AXHA 2YUZA 1N64H 5TGBA 2NR6C 5HYJE 3RPKA 5DC0A 2HTKC 1MUJA 3VWJA 4FP8L 4DKEH 3CIQA 2B8OT 1FJ1A 4AQ1B 1AFVL 3SGDH 3VWKB 1BLNB 1TETL 5KVEH 3HCVB 4L8BA 5DQ9A 5SWSB 2NY1B 2AV1A 3IS0X 1ERNA 5FKPA 5BZDB 1PG7H 2DI7A 4KUZH 2CO6B 4UIKL 1SJEA 2HWZH 5ALCH 3IXAB 2LE9A 4XNYL 5E99L 2GJZA 1KIPB 1YNKL 1J11A 1WEJH 2OJZL 5FA3A 2B4CL 3ET9F 4XPAL 3QBTB 3VFNB 2QSTA 2YD2A 2DQEL 1F2XK 3FFCE 1A1NB 4PG9B 1KNOB 3P4LA 4Y5VB 3CZJA 3IFLH 3RVTC 3BXNB 3KYKL 2ITDB 2WIIA 4K23H 5EUOB 5F7LB 4LDLB 3R8QA 2QQNL 3MRPA 1MJUH 5ISZE 1F4YL 3RWGA 1SYSA 1F58H 3CZFB 5DMYA 4OCSH 4YC2C 4AM0B 1QFWL 4OGYL 5H2BB 2X09A 2RCSH 9CGTA 2E7HA 3T0VA 5DJ8A 3QI9D 5E1AA 1TZHA 3PWPE 2DQCH 1FIGH 3QUKA 1V3JA 4DOHB 2QEJA 3B2UD 5B3NA 1MCHA 1D6VL 4YHZL 2Y36H 5LGJA 2X1PA 4ZPVB 2B1HL 3SE9H 1CGXA 3OTTA 3ZE1F 1S9VB 1F4XH 2OR9H 3EOBA 4HJGA 3NCEB 1YMMA 1YQ2A 1AGDB 1I85A 1R6VA 5FYLD 5JHLL 2F8XC 3Q6FB 5TQ2H 2YEZA 3BUYA 2HG5A 1SBSL 4IOFD 3DTXB 3N1FC 3MRQB 5KZCB 3JWDH 2HRPL 4RGNB 2QJDA 1IT9H 3LKQA 4JFZH 1PX4A 5AZ2H 1DBKL 3ZTJH 4PTTA 5KTEL 4LSTL 4NM8H 4GG6B 2VL4A 2DM7A 2CKBH 1OLZA 1OCWL 4NKOB 1ZWIA 4Z95H 3R1GH 4KK5D 5C08A 5TF1H 2DL9A 4PJ9D 4DZBB 3HAEB 3MNVA 1JGLL 3MLTB 1C08B 1W8OA 1AP2B 4MHHI 4C56A 3MGAA 3QI9C 1NBQA 1U2HA 3RWEB 2IEPA 3OZ9H 4O58H 3GM0A 3QG6B 5DJ6B 4WEUD 2ZUUA 1QNZH 4HPOL 1B88A 4PJHB 2YK1L 3B2UC 3STLA 4JG1H 4Y4FB 2P5EB 1BVLB 1JPGA 1VEOA 3CMOL 4RAVB 4WVRA 1U8OA 2P45B 4OZIF 4Y4KD 1FZKB 4ZMAT 2VXQH 1FCCA 4PJXA 2X9WA 4V1DE 4PJGB 4PJ5D 1IC4L 1CFNB 3MGOA 4IRZH 5LG1A 4R90H 4HC1L 3VRLF 1FYTA 5ENWA 3HMWL 4F3FB 4IOFC 4JKMA 2WMPA 2YRLA 3WV0A 1LO5B 1G7HA 2V5MA 5DR5H 5DVKA 2EDNA 2C1OB 3N50A 4AEIL 1WBXB 1FL6A 2VL5B 3TVMD 3IDIB 3VXSB 1EFXA 4KUCF 1HQRB 3NFSH 3SGJC 1NEZG 5EZOL 5JHDB 1AXSB 2BVPA 4JQXC 2BRRL 4KK5C 4AEHL 3MZGB 2APFA 4PJ9C 4CN1A 5A40E 1NH6A 2Z31A 3VXTA 5BXFA 4HWZB 1T7XA 4HQQL 2FECI 4JQVC 2MCPL 4K9EH 1XGYL 1I3GH 4WHDA 1DDHB 1VFUA 4UV7L 4PIRF 3QWRA 3ZHKA 4CRPA 2V2TB 2ZJSL 2XKSA 4Y0GA 1FFNB 2NY6B 2GITA 5DRWB 1JPTL 1KN2H 4PGDA 4LVEA 4RWYL 2H1PH 4Y4KC 1VKXB 2DQHH 3BP7B 2XYCA 2DM2A 2EYTB 2R2CA 1CVRA 5IB2B 1WV7T 4MA3A 1BWWA 2AV7B 3MMEA 4HK0A 2LAAA 3MBXL 5F1KC 1I7RB 4X80L 3QEUB 4Y19E 3CPLB 3N1QC 2IFFH 3RY5A 3S96A 4S1DD 3RBSA 4BK5A 1URLA 4LHUD 3HUJA 2AEQH 3IDJA 1UXWB 1DP0A 4OM0L 2EC8A 4UMGA 5CBAB 4FZ8H 2HJLB 3TVMC 5D2NA 1R0AL 1AIFB 4RFOH 3GMLA 3OX8A 5D9SA 2VDOH 1GPOH 1Y0LA 4KQ4L 2RIKA 1OQXA 3FO2A 2XWJA 1PEZA 1QLFB 5EDXA 1TLKA 3BD4A 3QZWG 4WU5B 1X5YA 5E7BA 1JI2A 3W9EB 2NY5L 1SEBA 4F7MA 2W07A 3L3IA 4JO3L 1IBGH 2CRYA 1FH5H 2AAVA 5ICYB 5JORA 3LDBB 1XZ0B 4L4TD 2OJEB 4NKDB 5CP3H 1VCAA 3NZHL 4EI6B 3VH8B 2ESVA 2WLYA 5MHSE 4LCYA 4RRPG 2X5PA 5ALBL 3BUTA 1MAMH 1D5XB 4GUPB 1EEUA 4K3DH 2VXUL 3ROLB 4M7KH 4S1DC 4JHWH 3JSSA 5EO0A 3C5ZB 1F3DJ 4TNVK 4YEEA 1ROWA 4PRPA 2WIMA 2XPGA 1OOAA 5D2LA 1GGBL 4HKJB 3ULUD 2FATL 3MV01 3VXUD 3D39B 5IQ9A 2VLKD 5JA9A 4M1GH 3DV6B 1V3KA 2A6JB 2IH3A 4HHAB 1MHHA 4NCC1 4ZUVB 4LEXH 3FB7A 4CMMB 1QSFB 4I1NB 3PDDA 2AABH 4ZD3L 3I6LD 4Z7UB 3ELAT 4G6JH 4TSBL 2GKIA 4M48H 5E8EA 1KELL 1FE8L 4U1NA 4GQPH 4X6CB 3ZE0E 4HPYH 1ZGLA 4QRRA 3KPRB 5ANMB 3WXVH 5JOPE 3NPZB 5LCVH 5ADOH 4WUUA 1OHQA 1PZUB 3PWLB 1PY9A 3ME0A 3UYPA 1S9WB 1SBBA 4F58L 4ZFFA 6FABH 4AENB 5E6YA 4RBPH 1LP9E 2CR6A 1KCUL 2AJVL 1DFBL 3V4VL 2BNUA 5T3XH 1RZ7H 1U3JA 3S8WA 3T4YB 4ONOA 4XBEH 1YMHA 5ELIA 2JELH 5B38A 5MEOA 3MROB 3HZVB 4PY7A 2DYPA 4RSVA 5EBLB 3MLRH 3L3DA 3MPCA 1EPFA 2ADJB 2JE8A 4DGIL 1BPVA 3VFPB 1LEGB 2QHRL 4OD2B 4TQEH 5ESVA 2VLME 1YEHL 4MCZA 3QO1A 4GW1B 4XC3H 3ZKND 1LDPH 4OGZA 1CGTA 5D1ZD 3WKNA 1TJIH 4Z7VB 5I8CB 4QY8B 4PLNC 3V4PL 3ULUC 1BBDH 3RJDA 5HDBE 2I9LA 2R0WL 3O81A 1S7RB 4Z78B 4F7PB 1T0MA 2VZTA 3N1MC 3QWOB 4HIJA 4J4PD 1BD2E 2QADB 1IEHA 5FECB 4JN1L 2NXYD 4DUVA 3UTSE 5EUOF 5F1NA 4KROB 4Y5XA 2BHZA 5I17A 4KH2A 4YGAB 5EU7E 4NQDD 2E9JA 3BQUA 2AXFB 3ZKQD 1SHMA 2CH8A 1RPQA 1RUKH 4H88L 3QXTA 3VXRA 3WD5H 3KHQA 5JR1L 3P73B 4BK4A 4N8PA 5FV2A 2MTPA 3LQAC 2NMSA 4IHOB 4DUXA 1S7WA 4LCWB 3RTQA 1BREA 1UACH 5C8JB 3V5DA 4P2QA 1YEGL 2OZ4L 2FD6L 1WBZB 4HV8B 3I84A 3PHSA 5LWYL 1LK2A 1DQMH 3ARQA 2F53D 3HE7A 1IAKA 3ZKNC 3TBYB 5I66B 2B5IB 5D1ZC 5HHMB 4GKZB 1CL7H 3PIQB 1CIUA 3FL7A 5MENB 3OKNB 2N4IA 1GXEA 3F6LA 1G1CA 3L3KB 43C9B 1QVOA 1UWEL 3PXJA 5LAXA 2J8UE 1T5WB 3QRGL 5I1AA 3RWJB 4J4PC 3WEXA 1NCWL 1D9KA 2NXYC 1H3GA 3O3EA 4GG6F 1EEZA 2J1KA 1NMBL 1Q0YH 1RZKC 4ZPTA 1A4KA 3CH1A 4D0DA 1K2DB 4U6XA 4LSQH 3HLAB 3ARPA 2EDDA 3EOTL 5IVXE 5GZND 4PYHA 2RBLA 5T1KD 1F4WH 3UJTH 5C2BH 1T03H 2VR5A 3I6GA 3IGAB 3OG6B 5EU6A 3RY6A 3LCYA 3T65B 1RZGB 2CMRL 4PJHF 5IJVA 2UWEA 2UUDK 2Q7NA 1HE7A 2R56L 3L7FB 5CEXB 4QWWD 3MACH 1MFAH 5JW5B 5I76B 4DVRL 3O9WA 3VRJB 2RQ8A 1RUQL 3WS3A 3BKCL 4PJGF 3MRDA 5D7SH 3SDDB 2F58L 4WWKA 4NO0D 4DTGL 3BN9D 1HH6A 4IRJC 3L7EB 1NCNA 1WSST 3BMWA 2FZ3B 2GK0B 4OGXL 4Q74A 1UZ6F 1TZIB 4XCCH 4JB9H 5L2JA 3WFBH 2FBJH 2ITCA 1TQCB 4B0MM 2HFFA 4WHTA 4NN7C 1U42A 2PO6A 3X17A 4CW1A 3E8UL 3TO4B 1A47A 2DIBA 4JFHE 3X14A 4XBGB 2BNRD 1MVUB 3TWCH 3IB4A 5GZNC 3GSRB 4NZJA 4YDVB 1KTLB 1ZHLA 4PRIB 5ETUA 4LCUA 1EHXA 2EKSA 2NXZC 4HEPG 4XPFL 5JOFA 1HDMA 1UCBH 3HG1E 3RZCD 2Q76A 12E8L 4LPCA 4QWWC 1IARB 4PR5B 1FDLH 3EYFA 3CFDB 1WK0A 4JDTH 4E0RA 4GW5A 2X9YA 3L6FA 1NLBH 3MRNA 2BY3A 1A4JB 4JJ5A 2J6EL 1UJTA 4Y8AA 4JR9H 4FXGB 3ARBC 5DJXA 4ZUUB 1KJMA 3RVUC 3TBSB 5HYEA 4I2XB 4K7PH 5F7DA 1OP3H 3BW9B 4ZUWA 3S4SA 5HHQB 1GC1L 2ID5A 3B9KA 1FVEA 2L7UA 2V9TA 3MLSL 2W1NA 3O4LD 5C6TH 3SCMD 3EJYD 4KI5F 2XZAH 4Z7WA 3IETB 3QJHA 4R4BA 1XIWD 1KGCE 4XXCC 3TBTA 1Q9KA 1A7OH 3T0BA 4P2YA 4RMTA 3L3HA 3T0EC 5EWIL 3CLFH 5GGSA 3RZCC 3TJHD 3LS5H 5E9DD 3RY4A 1JNLH 3IAPA 2OXGA 5BZWA 4HFWA 2BSSA 2RAMA 1RULH 1ZK9A 5FDWA 3L5JA 4YPJA 1EUUA 3LMJH 1IGFL 4G8IA 3O3DB 1GIGH 5C7XH 4KAQL 4AT6A 1D5MA 3VXOB 2AI0H 5FYKU 3LH2L 3UBXI 4HZAA 2GAZB 3FHAA 5BW7C 3K4AA 1N8ZB 1ORSB 3EJYC 1OSPL 4NN6C 4EDWL 2IBZX 1CU4L 2NY4B 1C12B 5FFLA 4L4VE 4JFEB 1PGRB 2I25N 1XIWC 4Z7UF 5HI3C 5E08L 2VZUA 4NN5C 1UM4H 1MEXH 4K07A 5GS2H 4X6CF 2FEEL 3PJSB 3N9GH 3KPPA 1RURL 4LF3B 4QOKE 5ITBL 5HYSG 1YEIH 2EE6A 4L8DB 3RQ3A 3TJHC 3Q1SH 3QNYA 2VDMH 5HPOA 4NO2A 5F7UA 3KPSB 1MPAL 4IMKC 4P49A 4ZTPH 3BOVA 5I1IH 2GSGA 3CUPA 3MV7E 2VAAB 1U91B 5BRZB 1MI5B 3UYOD 3SDYL 3OR7A 1BQLL 1IQDB 5KANG 2H41A 4I8DA 2O5YL 3HKFA 4NQSB 5EBGA 4Y4HA 2PXYB 4FFYH 5DJAB 3V5HB 1P4IL 4LIQH 4F37K 5GS1C 3QUZA 3RI5K 5I1JL 4Z7VF 5E8PB 4O02H 2R1WB 2NZIA 3MCKA 3Q3GB 3QPXH 4Y2DC 1VENA 1ZSDA 3ARZA 2AJUH 1KPRB 4Q9QH 2VABA 4OFYA 3HPLA 2EDEA 4J8RB 4N8VB 1CI5A 3P40A 5EPMA 2X4OA 3NFNB 1F2QA 1JFQH 4XNXH 4PRAA 1C5BL 3TT1L 2X4PB 3FO9A 4E41B 4ZUSB 4GAGH 4P2OD 5JUEL 4MNHA 4X4ME 1DSFL 3G08A 3OL2A 4K8RH 5E56A 5I1EL 2M26A 2GJ6B 2RJMA 4P5TB 3UC0H 4S1QH 4WI9A 4RFNC 5IKCA 1HSAA 1T66D 3WFCL 5LKNA 4N1EA 5DHVB 1F45A 1J8HD 2X4UA 5FOBB 3O6ML 2DTMH 5MEQA 2IQAB 4ZAKD 5TE6H 4BH8A 4RFEA 3C08H 3MUHL 4P23D 1CVSC 3D87B 1YJDC 4RZCA 3NOIA 2JK5B 3PQYD 4KK8D 4KXZH 3VG9B 1JE6A 3U30B 5KAQF 1ONQB 1QFHA 4NCC2 4HS3A 2NNAB 2XWBA 2CIKB 2D7QA 3GBMH 4U05A 4LKXB 1LO2H 4ODXB 1R24B 1BX2B 2VDQH 3MRLB 4ODWA 4G9FE 1Z2KA 1EUTA 2A6KB 2ZG2A 4UB0L 4MNQD 4YGVA 1QTYT 3Q5OA 1CFTB 3ULVD 4H25A 2I26N 4JKPL 3NIDE 5F9OL 5HHVH 3P0VL 2JKXA 4BZ2H 1VPOL 1YYLH 2MQ0A 4M93B 4O2FB 4P2OC 3JTTB 1DUZA 1EX0A 4KV5F 1AR2A 3UTTE 2YOCA 3AS3A 4PYGA 3I75B 2OCFD 5KS9A 1CLYL 3U4AA 3FFDB 2BFVH 3TV3H 3JTSB 4XI5D 5EOCH 5L88H 4IM8A 4ZAKC 1G7IB 5GRUL 1H15A 4O9HL 1F6FB 2BK8A 1FSKC 5FA4A 5I8EB 3HI1B 3RVWD 4EVNA 5BVPL 3P77B 3HZYB 3QO0B 3TIDB 4NZDA 4P23C 5L2KB 3DVFA 2CDFA 2GI7A 4ONFL 3OF6A 4KK8C 4H0IA 3BYYA 1VGKA 4BZ1L 4QRQA 1H5BA 2WAHA 1I3RB 1VERA 4RX4A 5EZIH 1E28A 3RWHA 2MFNA 3RUGE 4HUWA 5EA0L 2V2WB 4P46D 3WNNA 2KQNA 2FX8L 1KN4L 4OD1H 3P0YH 1AGFB 4NQVA 4X4XA 3ZYOA 1JBJA 3PV7A 3MLUL 4PJBB 3CFCL 4HBCL 5D7IB 4KQ3L 4OLWH 1H3PH 1JF5A 4PJEA 5MEPA 3QEQB 1KXQE 3FAWA 2WM0A 2XTJD 3DSFH 1RV6X 3DXAB 1KG0A 1DQDH 2E6QA 4Z7QF 4XI5C 3IFNL 2VLJD 1FVCA 5J56B 3RPIA 3V6ZB 1YNTA 1DN0B 5IFHH 2ILLA 1KSRA 3H9HA 4J6RH 3RVWC 3SKUD 1F90L 3IAQA 4GXVH 5INDA 2XWTA 4EXPX 4OLXH 3LD8C 3TCXA 2ICWJ 4JZNB 4HS8L 2V5SA 1K8DB 3AMLA 3VCLA 1MFDH 4POYA 4JRXE 4U1SA 4G8GE 3G9VA 2VDNH 2Q86A 5I8OL 1U92A 4OF7A 4RMWA 4YHIB 3BIKA 2WINB 4FQLH 4FTVD 5B8CC 2OK0L 2Z35A 3HR5B 4BM7A 1HYRC 2R69L 4P46C 3BP6A 3N0PB 3PGDB 5DJDB 2WBJB 5DRXB 1DTUA 2WBKA 3MQIA 3FZUC 3UBXG 5KVDH 3FQNA 2Z9TA 2JCCF 5D6CB 1HEZA 3OHXA 1KC5H 5JLZB 4MMXC 4HJJH 2VQ1A 4HGWB 1OAZL 3EIFA 4N0FA 3GMMB 3REVA 3OJDB 5ITFA 2DWDA 3QR2A 3RA7L 4UTAL 3LN4A 5T5NF 1AO7A 2DD8H 2WANA 3WDHA 5F9WB 4J7RA 2ORBL 5K9QG 4JM2D 1FN4B 1ZTXH 5F7EH 5DLMH 1WZMA 3K2UL 1JHLH 1Q72H 3QH3A 4ZFOA 4WFFE 2HFTA 4XMKL 3X3GH 5IEKA 4ZFZB 1RZJL 4Z77B 2LQRA 1ZLUK 4M1DH 3VI4F 4OM1L 1LK3L 1IZJA 1E6JL 4WENB 4U1HA 1YC7A 3RWDB 1P7KB 4L1HA 3HB3D 3BMVA 3BGMB 5CMAA 5CUSH 2X1QA 1H0DB 3CVHH 3C87A 3DYPA 5I2IB 2FCBA 4HCRL 2SEBB 1BAFL 2R39A 3WDIA 3INUL 1TQBB 2PYEE 5EZLB 3TNMA 3VD9A 5H35B 5CEZD 2FJHA 4LSRH 1MCDA 1J0YA 5EU7C 1LILA 3ES6B 2CO7B 1HXYB 3CDFA 3TT3H 1DUYB 3GSVB 1MRFH 4Q2ZB 3S35X 3BH9A 1NUGA 1G7PA 3LPWA 3OR6B 1NANH 2DQUH 3SJVB 3H7BA 5ID1A 1FZMA 4JM2C 1X5XA 2I5YH 2VE6B 1C16B 5I0ZA 5IJKA 4LBEA 1QPXA 1LEIB 3WIIH 2X4RA 3K1DA 5D6DC 1NJ9A 3S3JA 4E42B 3ISWA 1UVQB 5KVFL 1HILB 1UB6A 1A6AB 1OQOA 3UPCA 4NNXB 1MLCB 4FABL 2P49B 3HB3C 4YHOL 3MLYL 1AI1L 4JO2H 3SO3B 3LEXB 1FG2B 3L95A 3I2CH 1ZHNB 2D9QB 2JJSC 2YMXL 3ARGA 4D0CB 3D2UB 5DJ8B 3U4EA 2WP3T 1W72B 4OKVA 3BD3A 4KHXL 5FYLH 5FGBC 2BERA 3RNKB 4NHUB 2WWKT 1FYHB 3GIZL 3OKKA 4H5SB 4HXAL 3M8OH 5JDJA 3H9SD 2GTWB 3DYMA 4BFIB 4G7VH 5H94A 5IMMA 3BZEB 1QEWA 3GI9L 4FNLL 4F7TA 5BV7B 1TFHA 2R1XB 1N5AA 1DBJH 3MJ9H 4Y16C 3O2DL 2J12B 3QUMB 1XT5A 3FQRA 1YC8A 4LEOB 3I3BA 1UM6L 2OSLB 2O93L 3ZDXE 2R0LL 4PTTB 4R4FH 4N1HB 5FK9B 4DGVH 5TE7L 2XZQH 3SY0A 1SEQH 3DI3B 1PKQE 3BZFA 5DRNA 1A1OA 4JRYE 4JPVL 3DV4B 3DX9B 3ZYIA 5LJYH 1YN7B 2WUBH 4NRXB 1J87A 1AC6A 1QYGH 4OI8A 4XCYA 5B4MD 4ZO6A 1CDYA 4JY5H 1AKJA 2WK2A 5C0CE 1OGAD 1SQ2N 3JWNC 2CK2A 1P4LA 1WCBB 3DIFB 1ZLVK 2LU7A 3WS6A 1T89A 3T8XA 2Z4QB 4R6UA 5CEYA 3G6JE 4YFEA 3CFEB 2V2XA 3KYMB 4P57B 5C0FA 1WZLA 4WW2C 4X7TA 5I75C 5J1AA 3QHFH 4AG4H 4G6KL 3V6OA 2O61A 1CXKA 4OCXL 1KCSH 1U8QB 4NZUL 1F3JB 3ARFA 3RNQA 4R3SB 4OB5L 2BNQB 3O6FA 2LU4A 1CTOA 1EGJL 1HYSD 3D0LB 4HF5H 4J3UA 5E70A 4L1DA 5GGRA 4U7KA 2H32H 3MJ6A 3PWVB 3DBXA 1UQSB 1N59A 2CDGA 2KKQA 5BXFB 1S7VB 3QI9A 4LSPH 4MJIE 3NH7L 3KLAB 5C0BD 1I1YB 2XFXA 4I0PD 3ZHDA 2LVEA 4YO0A 4XHJD 3G5YA 3O0RH 3ZE1E 4M02A 4OSUL 5DTFA 4QRPB 1QRNA 1RK1A 2YWZA 3DVNB 1HHJA 4NP4H 4XPGL 5AUMA 4PGDB 5IFAL 4DN4H 1NFIA 3RDTB 4XTRD 1QQDB 1U8IA 2OTUB 2QQKH 4PJBF 3ZDZF 3LZFL 1IEAA 4APQB 5D7IF 3T1FB 4ZUTA 1ZLSH 1MCOL 5FO7B 3K3QA 1WIPA 4HWNA 4F7EB 4I3SH 1ACZA 3QG7L 3D85B 3B6SB 3EZJB 3DX8A 1RJYB 4NZTL 5FYJL 4LSSH 4DKFH 4KJPD 2OTPA 4Y1AB 3RU8H 3BHBA 1HYSC 1S8DB 4G6ML 5A1AA 1DEEB 4PB0H 3SGJA 4L29A 4MD5B 1VGEH 3TN0A 3LKOA 4IDJL 5D9SB 1C5DB 3UCRA 3QUML 4MNGA 3FO2B 2XWJB 4JQVA 4FZEL 4EBQL 4I0PC 5HVGB 4OZIE 4XHJC 2CKBB 5JW4N 4WHYG 4F7MB 3ESUF 2P8PB 2XQBH 5TDOA 5KSAB 1JHTA 4N0UE 3BDYH 4RNRA 4ZFGL 2FL5B 1IFHL 3K1KC 2NTFA 4XTRC 3RWCA 3VD5A 5L0QB 2XT1B 3VRLE 3ULUH 4GMTH 4PJ5A 4Z5RA 1I8KA 2HTLD 1JZ8A 4X5WA 4JVWA 2EIDA 3SDCB 3BIBX 4ZOEA 3DGGB 3ZSSA 1PBYA 1KIRB 4K3JL 1QFOA 5EO0B 4GAJL 4KJPC 1GL4B 1ZA6A 1E4KC 3H6JA 5GISL 4YIQA 2OQJB 1N64L 3MUGA 3TVMA 4PREB 1PJ9A 3VD7A 1GGIH 4DKEL 4KU1A 4WJ5A 1T6WA 5SX4I 2X41A 15C8L 3GKZA 4GXUM 4GRLD 3X13B 3VXQA 3FB7B 5KVEL 4Q6YA 4M7JH 5M7QA 1D6EA 4LSUH 5B39B 4Q9RH 3NTCH 4U1LA 5E8EB 5F93C 1PG7L 4QHNB 3QIUA 4U1NB 4KUZL 1BFSA 1QBBA 5IB1B 5ALCL 4QRRB 2W60B 4X6DA 1WEJL 2P44B 2QKIA 2VXVH 3DOSA 1TPXC 3VMNA 2DOCA 1GH7A 3OKMA 2YBRA 1X44A 4X5XB 4U3CA 4L8SC 4N5UA 3IFLL 2HTLC 4K23L 5B38B 2W92A 5MEOB 3VDBA 5FGCE 2PTTB 5BS0B 4PRNB 2H26B 3WN5B 5ESVB 2DMKA 4N90E 1F58L 4C54A 1OAUH 4LLYA 5EZJA 1RZKH 4OCSL 5IEHA 3STZA 1YPZA 3U82B 1U8HA 4ODTH 2RCSL 4IRSC 3WHE0 2DQCL 2Z91B 3PABA 4BUGA 1FIGL 4JFDB 1U6AH 5HGGS 4QHMA 1ZLWH 3HRZA 3HNTH 3MRHA 4HDIA 4GRLC 3MXVH 3S36H 2YPLD 1JTPA 2Y36L 1EVTC 1QKZH 4LPWA 5IFJA 4Y5XB 3SE9L 2VISB 1HKLH 3BWAA 3OKEA 5F21B 5EFIB 3GGWB 1R5IB 1F4XL 2OR9L 3KDMA 5JNYB 4NC2B 2NX5D 2AK4D 4JJHA 4PFEA 5TQ2L 1I8MB 3WXWH 2GTZA 4JM4H 3DUSA 2J2ZA 4NQEB 2XQYG 1Z9SA 1KLUA 3JWDL 3Q2CA 2I27N 4MQXD 4JFZL 3S37H 4MNQE 4NM8L 2HVJA 1J12A 4H20H 4FQJH 5KN5B 4ZO9A 2CKBL 4PJFB 1NCAH 3DO7A 4Z95L 3R1GL 5TF1L 2HFEB 3FCTA 2ZUQB 3FT3B 4LL9A 2ZKHH 5C07D 2XY1A 4KDWA 3G5VA 3SPVA 4AEFA 4PRHE 1RVFH 1BJMA 3AC0A 4HH8A 1KT2A 3VXUA 5TH2A 1S78C 3OZ9L 4O58L 2APVA 3L3OB 5IROA 2ADGB 3HMXA 1I9EA 1MLBA 2DTSA 2IH1B 3U1SH 5HYQB 1T0NB 3H3BC 1IGMH 1QNZL 3LB6D 3WEXB 4JG1L 5SV3A 4MWFA 2DIAA 2DQGL 2H9GA 3WUWB 3GJFH 4F8TA 2E7CA 3BFOA 2VLLB 3NZ8B 5KW9H 2VXQL 3QUYD 1A4KB 3OGCA 5JPMB 3QQ3B 4KJWD 4D0DB 3RL2A 2LVCA 4UILL 3DNKA 4IRZL 4R90L 5HHOB 2DLHA 4YUEH 3LKNB 4YHNA 3MRBA 3S97C 5SWSE 1A3RH 1P6AB 3D3VD 3NFPA 4TRPH 2DICA 4MQXC 3BEWB 5DR5L 5L7XH 1ZT4A 3RGHA 4HUKB 3JV6A 5GXBB 5K9OA 3IDNB 1T20A 2CUIA 2ZCLH 5H8DA 4LLMB 3NFSL 1F00I 1ZVYA 3PE9A 1NAMH 1E6OH 3KXFA 3BP4A 4PJXF 3H42H 1H3TA 3WS3B 3MRDB 5D1ZA 5CILH 3IDYB 4OF5A 2W0LA 5I30H 3TBVA 4HK3N 4M61A 4B5EA 5IMLA 1NBVH 4V2CB 4K9EL 5EUOE 3U0TB 1I3GL 3WSQH 1HHHA 2JJVA 4J4PA 1XEDA 3LB6C 4RAUB 1KN2L 4NZRH 5D1XA 3RWFA 2H1PL 4R7DB 2H2PD 2DQHL 2EC9U 4JFOA 3QUYC 1OVZA 4KJWC 1PY4A 2FNBA 1MCSA 1NGZA 3LHPH 3L5IA 4GKOA 4F9LC 4DOHE 1CICD 1O7VA 3ZTJG 4GAFB 1HHIA 4YDLC 3MUY1 1A9EA 5ESQA 4FTVE 3FFCB 5CIPH 3MLXH 1P2CB 1T1ZB 2M2DA 1RHHB 1K9TA 1U8MA 5JOFB 1RJZA 2AEQL 3V0WH 1WC7A 1FQ9C 1A22B 2EH7H 1I7UB 4FZ8L 3VFMA 4ZQKB 3AM8A 5ISZB 5L9DH 4HLJA 2OS7A 3H3PH 4RFOL 2F53A 2VDOL 4GW5B 3PL6D 5DURB 1HZHH 3WFZA 5IB5A 4JJ5B 3JBG7 4GG6E 3NIFF 3IJYB 3W2DH 4IRJA 1XGUA 3QFJD 5F7DB 5IVOA 5F3HA 4D9RD 3S4SB 1BFTA 1ULVA 3QDAA 1IBGL 4JCMA 1FH5L 1ZVHA 4QRSA 1ACYH 5DDHA 3IDUA 2H2PC 2C1PA 4KWUA 1CGUA 4PGCB 5HHNB 3ABZA 5I6XC 3QXDA 2P5WE 5T33H 3DRTB 2V5YA 3QJHB 4R4BB 3QDGD 3W0WD 1CICC 2IAMD 4PJHE 3GK8H 3LKSB 1MAML 3OKYA 2P5EE 1NDGA 4I9WD 4K3DL 1N3NA 4YH6A 1Q9LA 2AKRA 4M7KL 4JHWL 1MIEH 3GJFA 2XQYK 3ZO0A 1Q8MA 2NZ9C 1OF2A 3WNPA 4NQCA 4HWEH 3U0WH 2VMFA 4L9LB 3LQZB 1DQLL 1KBGH 3ARYA 2VO5A 4OFKA 3SDAB 3MV8D 4LEXL 4XRCA 2AABL 3FJTA 3PL6C 1JP5A 4G6JL 4YBQD 4YDJA 4M48L 3ARBA 1P7QD 2EDTA 2HT4D 5F88B 1VFBB 4LHQB 4G8IB 1UZ6E 3VXSE 3WXVL 5C0GA 1D5MB 3MBEB 5EU3A 3P9WB 5JHDE 4YHLH 4JDZB 5LCVL 3P4MB 5C09D 1J9CT 3V8OA 2ADIB 1EO7A 6FABL 5J13C 1JWUA 1X9QA 1C8PA 5T3XL 1R3HA 1RZ7L 3EO9H 3MV9D 4EUPA 5HXMA 2K3TA 4V1DB 4XBEL 2JELL 3QULB 3IFPB 4QHLB 4LKCB 5IMKA 4XXCA 3MLRL 2IAMC 4GRWH 4OUOA 5HY9B 2VXTL 2X4NA 3FO1A 3T0EA 3G6AA 5HYJA 3T3PF 4XC3L 1LDPL 5F1IB 1DBAH 3RZCA 4OCLC 1TJIL 3GO1H 4JPIB 2P8MA 2FR4A 1YJDH 3O8XD 1XGPA 1BBDL 5IIEB 4IIQA 5DA4A 1LNUA 1J18A 4IMLA 5GRVL 1G9ML 4U6YB 3TC9A 1E4XI 1ZA3A 4X4YB 3MOQA 2BHYA 3VFUB 3VRIB 4GO6B 2F54D 4YBQC 4DKDC 4MJ6A 4ZYKB 5FO9B 2HT4C 4EEEA 1SM3H 1GJIA 5J6GB 1HH9B 1KJ2B 1RUKL 2DDQH 1WAAA 4X6BB 3EYSL 1K4CA 4OUUB 1QSEB 3WD5L 4KI5E 3MJ8B 3GHEH 5BW7A 2VWEC 1EAJA 5IB4A 3KPQA 3O4LA 4LP4A 2H45A 3ZKXB 4AH2A 3MOAH 1YECH 4ODUA 5JQ6H 1I3VA 1UACL 4JKLA 4MD0A 3SGEI 3UTZB 1KLFA 4CNIA 4NUJB 1I9JH 1IM9D 1J1XH 3SDXB 3QDJD 1DQML 4JO1H 5T1LB 2W38A 4UNUA 4HLZG 4H8WC 1CL7L 3KYNB 5FUOH 3SGKC 1KJVA 4FQIH 5CZVH 5E9DA 2EDYA 1OAQH 4L3EA 4HSQA 5FF6A 4HZLB 1CE6A 1G7MB 5IKCB 2LTQC 4GKSB 1KCLA 4MCYB 3ARVA 4P99A 4XPBH 1XF2B 1B0WA 2CRIA 4PLKD 3V7AG 4YNYB 4PJFF 3AVEA 3RGVD 1Q0YL 2RGSA 2APWA 2EECA 3ULVH 3MREA 1XH3B 3C6SA 3T0WA 2CIIA 4LSQL 5SWZE 4Q9BA 5HBBA 4NQXB 1JWMA 5GRWA 1QSFE 4HS3B 3EYVB 4Y2DA 4KC3B 1F4WL 3UJTL 4MLSA 1QR1B 5C2BL 3HC0B 1T03L 5EU5B 1QZ1A 3VFRB 1PW3A 3E6HB 3JUZA 4YGVB 3KPRE 5ANME 2A1WH 2COQA 2W9LA 3MACL 1MFAL 1FL5A 3K4ZA 4X7CC 1NSNH 5E1HB 5D7KD 3C6LD 5D7SL 4OZGB 3UJIH 4YEFA 2KH2B 3KR3H 5E6IC 4JFFB 3MRIB 4C4KT 5IUSA 4G3YH 4U1GB 5EU4A 4J3SA 3KLDA 2R9HD 3W81A 3O3AA 2UUDH 4PD4J 1KPUA 4XCCL 4IOIB 4JB9L 4N9OB 4PJDB 3WFBL 3RGVC 2FBJL 4D0BA 3TZVD 1A5FL 4XNQA 3BAEH 1EMTH 4QHUB 1W2KT 1AD0A 2XZCH 5GS3A 2ENYA 3VWJD 4JHAH 4U6VH 2Y06H 3FO0H 3QAZC 5MI0B 2FO4B 4BKLA 3P4OA 5IW6B 4LLQB 3TWCL 5HVHB 5JZ7D 1CQYA 3U9UB 2OR8A 4LLDA 2C4FU 3MRMA 1UCBL 5GSRB 3B9AA 1M7DA 1U0QA 1FDLL 1B0GA 4RISH 2CDEB 4G8FA 4JDTL 4AL8H 5HGDA 1IL1B 1SMAA 1M1SA 2ARJB 1NLBL 4Q6IA 2MCG1 4LCWE 1ZS8B 4PJ7B 4OZ4B 1QBAA 5GGTA 5MEPB 5F7WC 3IDXH 1NCBH 1KB9J 4JR9L 4OKDA 5FGSA 4K7PL 1JF6A 1A6ZA 2VQTA 2G75A 1BD2B 5HSFA 2R9HC 1A64A 4OZFA 3UTSB 3UZVB 3KJ4C 2G5RA 4JLRA 4M4RA 4ZAKA 4CU8A 4WW1B 4GAYB 5C86A 4XNZB 5HHME 1Q38A 3QDME 3TZVC 4NKIH 5C6TL 3C60B 1IGJB 2XZAL 2CLZA 3V5KB 3VWJC 3GHBH 2Z92A 1BGXH 5F7YC 4KVCH 5J3HD 4W68A 4UQ3A 5JZ7C 3G5ZB 4EOWH 1U41A 1A7OL 2E9BA 3KYOA 3GB7B 4KXZI 4MAYB 1AGEA 1BF2A 4G6AD 1NEUA 5FUCC 3CLFL 2AQ1A 3BSZL 2Q3ZA 1IC5H 3FONB 1N6VA 3LS5L 2XKNA 5FAAA 5ILTL 4FG6D 3RHWF 1JNLL 4MD4A 3I6KA 4KV5E 1TTUA 1XR9B 5E4EB 2YC1B 2XN9B 4W4NA 2LV4A 2FB4H 3PNWA 1NGWB 1RULL 3U9PH 4W81A 3LMJL 4A6YH 2X4SB 4P4RB 8FABB 3MJ7B 5A2KH 1GIGL 5DMKA 5C7XL 5BVJB 2J8UB 3RVXC 3FHQA 2AI0L 5DO2D 3O2VH 1BVKB 3QZWA 1QACA 4P4KB 1F97A 4G43A 5C08D 4RDQF 4J2XA 4HIHB 4LPVA 5AZEH 5I71B 2F5BL 3I3DA 2VIRB 2DKSA 4C56D 4RBPK 4NT6B 1I8IA 4ONHA 4ELMA 4OGAD 5J3HC 5CEZH 5IVXB 1UM4L 1MEXL 1NC4B 4FQ2H 3M45A 1AHWB 5B8CA 4XH2B 3N9GL 3IKKA 3WFHA 4G6AC 3N1GC 5E94A 4HXBH 1YEIL 3O11A 1HSBA 4ZNEE 2YN3A 1C1EH 3Q1SL 1FZJA 4JZJB 2VDML 2PYFA 4ZTPL 1CT8A 4FG6C 2IAND 1I85C 4M6OH 5I1IL 3IXTA 4P2RD 2ZG3A 4PRIE 4NBZB 4HUMB 3VGDA 1OT1A 2VH5H 3FQWB 4X0KB 5IMOA 2BCKB 1IGIH 1TVDA 4CMHB 4Z7QE 4KI1A 4HWBL 4OI9A 3QIBB 2C7UB 5C71A 4LVHC 4FFYL 2DQFB 1YEEH 5E8NA 2R2EA 5JXAL 3HPJA 4TOYL 1LP9A 4LIQL 5TQ0H 1EFXD 5DO2C 1VFAB 2VLJA 2NY1D 4JRWA 4Q0XH 3HE6B 2WUCH 3IJSB 1B4RA 1RJLB 4O02L 2DMCA 4GG8A 3QPXL 4PRBB 3RRQA 3OXSA 4AIOA 2AJUL 2AXGA 2DM4A 4Q9QL 2IPTH 3K7UA 4O2EB 4I2XE 5C0AB 5DJYA 3O2WH 4OGAC 1DVFB 1JFQL 4XNXL 5F7MC 1QLRA 2Q7YB 4BSWA 2HFGH 2ICEA 3B5HA 1UZ8A 2BVQB 2ZUSA 3VFOA 5HGAB 3HG1B 2DQJH 4WFGD 4N68A 4ODBD 4EXKA 3TA3A 2JCCE 3VXPB 1FL3A 1XGTB 1GGTA 4K8RL 4YHKL 3RHWK 3M1BA 3F7QA 1UJ3C 4P48A 1KPVA 2WQ8A 3EOAB 4S1QL 3UC0L 4PG2C 4EI5C 3P9MB 1SYVB 2HKFH 4FFZH 5KSVA 3MV11 4OAWB 1DBMH 1S7XA 2DQIH 3U7YH 5TE6L 3E0GA 4E5XB 2PNDA 4JFYB 3C08L 3SDXF 4YFDB 3N85H 4JGJA 1JUFA 4K94H 2NLJA 1U93B 4WY7H 3AREB 4CU7A 4QRTA 2NY1C 3MX0A 1F42A 1T5XA 4JM2A 3BZ4A 3GBML 1HINH 1LO2L 3VI4E 3DRQA 4OZHB 2VDQL 2NY0D 1WLHA 5DF0A 1X4XA 4A6YA 1EAPA 4YZFE 4JDVB 4POZD 1OGTA 5IB3B 3VU2A 5HHVL 1DBBH 1EXUA 1U8PB 5KZCD 1FO0B 4MJ5B 4BZ2L 4X99A 5D7LB 5KJRH 4RGND 5F89B 4P2CG 4Y5VC 5F6HI 3CX5K 1YYLL 1A1OB 1UA6H 2FSEA 1EH9A 3QXAB 4KKLD 2JJSA 3BT2H 1LGVA 2X05A 5IR1A 1AC0A 1T04B 2NPLX 1V7MH 4JFEE 1N4XH 3UTQA 1P1ZA 2BFVL 3TV3L 5EOCL 4MSWB 3R06A 5L88L 1OTTD 3F7YA 4GS7B 3CVHB 4HKZA 1FRGH 1UH2A 3ZHLA 3S35L 4CDHA 1MAJA 5IG7A 1AE6H 1EO8H 2VDKH 1H8NA 2AJSH 5D2NC 5AYUH 2GT9A 2P7TA 3VE0A 4OZGF 5JW4R 4HMDA 5BQ7A 5BRZE 1KLGB 4Y16A 1MCPH 3QJFA 1U36A 3C2SA 1OD9A 5EZIL 1YYMH 1QPPA 2NY0C 4ORGB 4POZC 2FJGA 4L4VB 5DD1H 1FGVH 4PGBB 4OD1L 4PJDF 2WWMD 2A2QT 1EEYB 4ONGH 1QRKA 4S1RH 4WUUD 4RGNC 5EBWA 3DVGA 1CR9H 2CJUH 2FHFA 4KKLC 1FZOA 4OLWL 3GSOB 1H3PL 3V95A 3QHTC 4JEGB 5E8OA 4HBQA 1XF5A 3DSFL 2EIZA 1M05B 4YO0B 1BFOA 1DQDL 4BH7A 1OTTC 5GRJH 1PYWA 5IFHL 1OP3K 1UKTA 5DSCA 5AUMB 1TITA 4X98B 5C0EA 1QA9A 2OI9C 4J6RL 1G7QA 3H9SA 1BHGA 1DLHA 2GFBA 4GXVL 4F15C 4XCNA 4OLXL 4Y4FC 3NN8A 3THMH 1MFDL 4PJ7F 4U49A 2XI9A 4MX7B 4ZUTB 1R3JB 2VDNL 1QR4A 3V6FA 5HGHA 4FQLL 32C2A 2ZUWA 1TZGH 4RAHA 2VITA 3BQUD 4DW2H 3NAAH 5L6YH 1S5HB 2IPKA 3VXRD 2WWMC 4ELKA 2V7HA 4XPHL 5KVDL 2NW2A 4DEPC 4PJ9B 3HZKB 2AJ3B 4OFPA 5DJCA 5DEFA 1KC5L 1MH5B 1R3IH 3RTQD 3CC5B 4LHJB 1G9NH 4NIKB 4P2QD 5JDSB 2JTDA 1S7TA 1YN6B 2ICES 2DD8L 1OGAA 4ALAH 1S7QB 1FO0L 4R8WH 2DKUA 1BP3B 1JRHH 2VAJA 5F7HA 3HE7D 3DWTA 1ZTXL 5F7EL 5DLML 4Y4KB 1JZ4A 1JHLL 1Q72L 4Y7MA 4Z7NF 3RWCB 3MRJB 3X3GL 4KMTH 5AG9A 3QUXA 5JPNA 3GRWA 1ED3A 5A2IH 5KSBE 3OSKA 3O6KH 5DHYA 1A6TA 2ZP0T 1D9KD 1L7TH 1SY6H 3SKOB 3F7PC 1MY5A 3X11B 1NMCB 1A7PH 2J8UF 4RQQB 3CVHL 4OTXH 5BMFH 4DZ8A 5CAYB 3SKNB 3BQUC 2E7MA 3ZKSD 3T2OA 1HXMA 4KHTL 4I13B 5DZNA 4M6MH 1MHPH 3HC3H 1M7IA 1CG9A 1NAKH 1X4ZA 3CSYB 2AW2A 1ZLUH 3GSQB 1P5UA 3I85A 2F54E 2VC2H 3O4OC 5EU6D 1T3FA 3MYJA 3MFFB 3D39D 5IVXF 4ODSH 3RTQC 3TT3L 3UTTB 5I1CH 5C0BA 2BSRA 1N7ML 4I0PA 2F74A 5IK3A 2BC4A 2EEAA 4M8QB 1Q9OB 4MJ4A 3O9WD 1XGQA 1X5JA 2H32B 1WJ3A 1S7UA 4PJBE 3SQOH 3ZDZE 3HE7C 2I5YL 1BQHB 5D7IE 1A2YA 5K9JH 2QBWA 3QEQE 4WWKD 3WIIL 5DGQA 1BOGA 4YXHH 4D3CL 3O45B 5D96B 3P9LA 2DJUA 3SKMB 3LDBC 3E6FA 1Y18B 4QOKA 3ZE2F 1D9KC 1U8KB 2V9QA 2X7LA 2VLRE 3U79A 3V0VA 3A0OA 4YPGA 1A7BA 4LHUB 2R0ZH 3ZT6A 2YPKB 3CX5J 1H3UA 3MV7A 3CLEH 3I2CL 5HHXL 3ECBA 3U0PA 2ZNXA 2PO6D 1JNJA 4LNRA 5FYLL 4AIXA 4QHMB 1XF4A 1A7NH 5CBEA 1U3YA 4OF0A 1ZE3C 5IBUG 1E27A 4IJ3C 4ZSOA 2G9HB 4HX1A 3M8OL 3BWAB 4PP2A 8CGTA 3JZ7A 2KUTA 2QADD 5DRZA 4CADB 3MRFB 3BPCA 2XRAH 4J23A 5DS8A 1CCZA 4KROD 3SQBA 1X5KA 3O9WC 3M07A 2BMKB 2X4TB 2A74B 1MWAH 4OCWH 1KCVL 5GGUA 1DBJL 3MJ9L 4GRMA 4L4TB 1QO3A 3MSPA 1DEDA 2HRLA 4L8SA 2XV6B 3BP5B 3DURA 1CLOH 2A6IB 2R2HB 5CINH 4YHPB 4R4FL 4DGVL 1CD8A 4F7CA 2XZQL 1QHOA 4NJAH 4JANA 4QLRA 5CJQH 1UXSB 3B9KD 4S0TD 4JHBA 3EDEA 3REWB 3LN5B 4XNUH 2WUBL 4IRSA 1D5ZB 1QYGL 3C5JA 3GBLA 2A0LD 3FB5A 2VLKB 4OZHF 5FGRA 4JY5L 4F33A 4HH9A 3KPLB 5D5MA 5EBMA 5MEND 4LLVB 1IRAY 5F3BB 4ETYA 1YY8A 3E2HB 2QADC 1A21A 1KIQB 3QIWD 2C3HA 1MCQA 3KGRA 1MHCB 4YFLI 2CUHA 3FTGB 4KROC 1S7SA 1X6LA 5C0JB 3QHFL 4AG4L 1ZEAH 4LLUA 4UNTA 1OP9A 1TJGH 3MRBB 1DE4A 5I1DB 1Z5LA 3U36B 1KCSL 4BZYA 4I3RH 3WJJC 2I9TA 1FNEA 2HLAA 3TP4A 2OP4H 1N6QH 4HF5L 3DSNA 2Q20A 3EO1A 3SJVE 4ZDHB 2CXGA 5DMIH 3DX6A 1Z0NA 4PJCB 5I1HH 1G6RH 4HFUH 2Q3AA 5C3TA 4M61B 4WDIB 4LSPL 1KB5H 5DJZB 2A0LC 5DD0H 4DVBB 4FFVD 4R0LB 3B9EA 1BF8A 3O0RL 2GJJA 2B5IC 4POUB 2E7LC 2NXYB 43CAB 4DFIA 3VGFA 1G7LB 2PCPA 4NP4L 1GVIA 4QTHA 4XCEB 4G80A 2DAVA 3MA7A 5I15H 3PGFH 3IDMA 4NQDB 1JYNA 4J1UB 3VMPA 2ZPKH 4LRIA 5FO8A 2WP3O 3QIWC 2NX5A 4P5MA 1MJ7H 3OPZL 1ZLSL 3RUGA 1KXVC 3EDJA 1DANU 4I3SL 1M6OB 5E00B 1T0PB 1F6LL 3AFLA 5EUKA 2X6MA 5FYJE 4D9QD 4KKCD 4LSSL 3EGSB 4DKFL 2Z93A 4BA8A 3RU8L 1RK0B 4Y4HD 2IALB 4XAKD 1T7WA 1T7ZA 3BPLC 1YMME 2BVYA 1YEDA 3CNKA 1VGEL 2D0HA 1NGXA 2HT2D 5DJ2A 4NO5A 4XVJH 3DUUB 3NGBC 1I7ZB 2A6DA 2XTLA 5IB5B 1AGCA 1JPST 5SWQA 1OSZB 3D69B 1KEMH 3P11H 4FFVC 5EN2A 4WFEE 3RP1A 4IS6B 4DQOH 4BUHA 3T3MF 2IBBA 4UDUA 1H9VA 1WITA 2XQBL 3CFBA 1EV2E 4AMKH 2E27H 4PGEA 3LRSA 2W91A 2HVKA 2Z0BA 4EN3A 3QUYA 5E2UL 4LCCB 5F9JA 4JRXA 1JN6B 1V8HA 4GMTL 3IFOA 4G8GA 3ULUL 4PUBH 4NSKA 2Y5TA 3A6CH 2HJFA 3S5LA 5DJ0A 4IOSD 5T1KB 1TQCC 3X12B 1A7RH 4Y2OA 1NDGB 4NDMA 4WFHE 5DZLA 1Q9LB 3D3VA 4WO4A 4N8CL 2NCMA 2BZDA 3EJZD 3TO4C 1J5OH 1AXTH 1A14H 4U6HA 4HKXA 4PJXE 3HNSH 1FFOB 4W4OA 1RHFA 3CCHB 1YDPA 1GGIL 4HIEA 3MGTA 2N1KA 3PV6B 1F4AA 3EHBD 4YK4C 2HT2C 3BKMH 1FYTE 1ZHKA 4K7FA 3TCLA 1MJJB 4M7JL 1NCCH 4TUJB 4YWGH 4LSUL 4Q9RL 2J4WH 3NTCL 1II4E 3PDOB 4NO0B 4FOMA 4R96A 3PHQB 2G2RB 1CD0A 1NAMB 1CGVA 4OFIA 3GJEA 4FQXD 4UINH 2FBOJ 2VXVL 4LMQI 3G6JB 1AJ7H 4H8WH 1G6RA 3ZL4H 1XCTB 4QKXB 3TO2A 2EDQA 3BD5A 1PSKH 1KB5A 4JY4A 1ND0A 2M1KA 1GRWA 2BNRB 1I7TB 2R1YB 4TUOA 4QRPE 1XGRB 1EJOH 3I3EA 3OJMB 5D7JD 4XT1C 1TNNA 3EJZC 2NY4D 1OAUL 1RZKL 1T2QH 4WFGE 2AJZA 2PYEA 4ODTL 4X6DF 2P8MB 3EO0B 2XZZA 3MRCA 4HIIB 4H1LB 1J0ZA 3OF6D 4K3EH 3PGCB 4UU9B 1MFBH 3EHBC 3HNTL 3MXVL 3NIFE 4LPYA 3LKRB 3PL6A 5GJTH 1R5WB 4RX4D 1QKZL 5CIPB 3KPSD 1TXKA 3PWNB 3BO8A 1HKLL 2BVTA 4Y1AE 4QF1A 5FM5M 1UM5H 3L3JA 4XMPH 4CVWA 5IHLB 1MI5D 3MR9B 1NBYA 3AB0C 3QNXA 1ADQA 1TMCB 3IU4H 1KEGH 1I4FB 2ERJB 4FQXC 3OMZA 3WXWL 3VW3H 4JM4L 4YAQA 5IB4B 3SCMB 4D8PA 3C9NB 4ISVA 1FNGA 1RUPH 4NPYB 2HH0H 1XIWB 3QDGA 4FQJL 5AEAA 3W0WA 2FYYA 4NN5B 1MY7A 4DGYH 1NCAL 2YUVA 1CLZH 3PF2A 1L7IH 4G8EB 5ID0A 4JZOA 5D7JC 3TBWA 3QCUH 2NY4C 4H26B 2ZKHL 1FG9C 3Q0HA 3IKCA 2C5DC 1T1WB 4XGZA 2D7TH 4L8CB 1RVFL 2ESVE 3F5WB 5K93A 3S98A 1B0RA 4BSVA 4D2NA 2PTVA 3U1SL 2H2SD 4DCQB 3KNBA 3KLHD 1IGML 3RWIB 4ZS6D 3VGAC 1KF9B 2LU3A 1G7JA 3T0AA 2P8LA 3ARDA 1PZ5B 4JGMA 2XNAB 2GJ6D 1P7QA 1HQ4A 4M7LT 5KW9L 4PRPE 2GUOB 3K8KA 1X7QB 4PV8A 4RIRA 1XCQA 1L9NA 3C6SB 5GS1B 2FIKA 1KTDA 2DWEB 4Y5YB 4YUEL 3C8HA 1JGUH 1A0QH 4JG0H 3ULUF 3WLBB 1A3RL 2P24B 2PXYC 3MV9A 4I5BB 5JIHA 3D9AH 4TRPL 5C9JA 3VXMD 1AGBB 1VADA 2EXWD 5L7XL 1PKQA 3T3PE 1R3LB 2YD3A 4QRRE 4EQ3A 3BESR 3GM8A 1AO7D 4JRYA 1KJ3H 2NY7H 2QR0A 2ZCLL 4NJ9H 1TJHH 4EZMA 1NAML 4KMQA 1E6OL 2BOCB 2WW8A 1C5CH 4XNMB 3V7MA 1U8LA 3H42L 4QXTA 3C8KB 3MO1B 3IVKB 5CILL 3GSNA 4WHYH 4YR6A 5I30L 3F7VA 5H37G 3SGKA 5C0CA 1NBVL 2VYRE 5JW3H 3T2QA 4XVUD 3WSQL 2MHAB 5D1QB 5DD3H 3DMMB 4WV1B 5BS0E 4GRWB 1NCTA 4ZS6C 4OV5B 2EC9T 3FT2A 4QT5A 5FKAB 4MA7H 4MDIA 3FN3A 1U8JA 4NZRL 1LE5B 1ZT1B 4PV9A 3ARTA 3L9RA 4O51A 4GW4B 1QFUH 2EYSA 4WUKH 5HTSA 1LMKA 2ZWLT 4PJCF 3WJLA 3R8BB 4JFDE 3W9DB 3LHPL 3V52H 5I1LA 4KJQD 5I73C 4FMKA 3KVQA 4HS6A 5EOQH 3I02A 1N2RB 5L2KD 1F8TH 3MLXL 1EHAA 4U1IB 3VD3A 2QTEA 2EXWC 4R97C 3U30C 3V0WL 3LEYH 2EH7L 2E6JA 3DX7A 4P59H 4QRUA 5CJBA 1K3IA 1WF5A 2DI8A 1B0GB 2FX7H 3KPNB 4G8FB 4CVZB 3H3PL 2W65A 2DLFH 2FDBP 5HPMA 4MJIA 1T21A 5JOEA 3IJHB 4P2OB 1WWWX 1HZHL 1BZ9B 5ACZB 1JNHA 1NEZB 5E6IA 1JGDB 4YXLH 5DEGB 1INQB 4ZODA 2GSIA 3DPBA 2UZYB 3MLVH 3T4AA 3W2DL 4Z6AT 4XVUC 3QEHA 2PKDA 4M93C 2CRZA 2RFXA 4OIIH 3AMKA 4ZXBB 3GMOA 2CLVB 2QHLA 1CYGA 1J8HB 3VGEA 1ACYL 1L0QA 1RZJC 1FSKB 3RGVA 4JN2A 4UZGA 2PF6A 1CQKA 4R2GB 2F8OA 2NR6D 4P23B 5DK0A 3ARGD 2CLZB 4S2SA 5GGQH 3PQYB 4AIZA 2CKNA 4KJQC 2EDXA 4H0GA 2CK0H 3GK8L 4PGZA 3VI3E 5ESAB 3VFGH 1DQQB 2FWOA 4LARH 5DVOA 5DYOB 4WHCA 2V7NB 3W39A 1MIEL 1Q94A 4MNQB 1HN1A 4ZO8A 3T77A 1U8NA 5FM4A 2VN4A 3U0WL 2OL3A 5DQJB 4EUPG 2D4DA 1KBGL 2APTA 2X70B 1VHPA 3CK0H 3MNZA 1SJHA 1J05B 1IAOA 1MF2H 2PETA 3EYOA 5IJKC 2CPCA 4OZIA 2AGJH 5INCA 4MB3A 3QQ4A 2X1OA 3RVTD 5T1MB 3VFTA 3AS2A 4N0UA 1GZQA 3QFDB 3P4NB 1WBYA 4YHLL 4UOW0 3QZWB 4N9GB 3TH2T 5IHZB 4QCIB 4GKNB 2J5LC 3TZVA 5T3XE 2O5XH 3EO9L 3ARGC 4XWGH 3LD8B 5JIKA 4DFHA 3D25B 2A83A 4TUKH 2OYPA 4ONHB 1RZ8B 1AKJD 3GMPA 3MRGB 1Y6KR 4ETQA 4FA8A 5JXEA 5B8CB 3BH8A 1F11B 3OKOB 4L4JA 4NRZB 5TDPB 5HJ3A 1DBAL 4HC1H 3EFFB 3GO1L 4P46B 1YJDL 3VJ6A 4JREB 1OPGH 1U3HB 3G6JF 1T1XA 1INDL 1FV1B 1GZPA 4NKMA 3TPUA 5DI8A 4X5LA 3HS0A 5CWSB 3ARFD 1ZLWK 2ZSWA 1YEJH 3HZMB 1HOCA 1J1PL 3O6FD 2WZPD 2ATKB 4G42A 2WBJC 3L5WA 1SM3L 2XTJB 4I4WA 2CGRH 3HR6A 2DDQL 3NACL 4O5LH 1IC1A 4L3CA 3KWWB 3GHEL 2I07B 3D0VB 5EOTB 5EG6C 2VDPH 1YUHA 3AU1A 3MOAL 1GAFH 1YECL 4UV7H 4X8JA 1X5GA 3M17B 3RIFF 5JQ6L 3TJEH 1N5YH 4M43H 1IGYB 5FYKD 3ROOA 4C55A 3FN0H 4U7SA 1BZ7B 3ILPB 4I3GA 1QRND 1I9JL 1J1XL 4ODHH 4FTVB 3WS6C 1T89C 4JO1L 1WWBX 1WAAF 5T3ZD 1UB5B 5IHUH 5FUOL 3A6OA 4FQIL 4P3DB 4Z7WE 5CZVL 3CDGB 3FT4B 2YRZA 2QLVB 1OAQL 3KPOA 1T2JA 1JK8A 1P4BL 1LHZA 3GIVA 1PQZB 3V6OC 3TIEA 2DMBA 3DVIA 5CP7B 1U58B 2YSSB 3WMSA 3D2UD 3ARFC 1BVZA 4KKAD 1ZHBA 1TVHB 3O6FC 1CD1A 1TQBC 3ZDYE 1OAYH 3ULVL 4UT7H 3GJFK 3GKWH 1JUFB 4XZUB 4YHYC 2QV2A 1W0WA 5EIIA 3TN0D 5EB9A 5C0DB 4LLAA 3BVNA 5JQHC 1NC2D 1R3KB 2R23B 3CDYA 4WCYH 2P5WB 4A6YB 2VXSL 4TSAH 3T0XA 2A1WL 3H7LA 1JGEB 3GSXB 3H0TA 4PJIB 3FB8A 4PRHA 1MCLA 4C83B 1K5NB 1T1YA 5DUBA 4NYLB 3HRPA 4ZOBA 1S9YA 3LV3A 4HAFA 1QFPA 3FOMB 5DK2A 5BCAA 5FXCH 1RZFH 2E6PA 3UJIL 5CSZB 5ALBH 3KR3L 3KJ6H 2IPUG 2RB8A 1K8IB 2IANA 3CXDH 1UJ3A 3JUYA 1UFUA 4PG2A 3SO3C 4EI5A 4G3YL 4MYWB 4P2RA 3FRPG 4JQIH 3HTLX 1T83C 2ZZUT 1ORQB 1X5AA 2VNCA 2ICWI 4KKAC 3QNZB 3UXFA 4TNVF 4OJFH 4HC1A 4OF6A 1LEKB 5SX4H 3BAEL 1EMTL 3VGGA 3VWKA 2XZCL 1GOFA 1BLNA 1JYVA 1AQDB 1MCKA 2B1AH 4Z0XB 3HCVA 3KAAA 4BQ9A 5SWSA 1E0OB 4JHAL 4U6VL 2Y06L 3BE1L 3FO0L 2P7TB 4TSBH 2ICWB 3TN0C 5BZDA 2C4FT 3ULSB 2CQVA 1N26A 3IXAA 1CXFA 1PG7X 4LLWB 3RIFK 4FQHB 1KIPA 4GRWF 4OZFG 3O3BB 3QIUD 1TCRB 2ARJQ 4JAMB 5BV7C 3MZTA 3FOLB 3VFNA 2KBGA 5D8JH 5A16B 5HDQH 1QSEE 1A1NA 4PG9A 4BFGA 1KNOA 5GJSH 2BNQD 4Y5VA 3PHOB 5GRZA 4AL8L 3BXNA 2ITDA 5EUOA 1JV5B 5EO9B 4UDTB 1WTGT 3IDXL 1NCBL 3UTPE 4UT9H 3CZFA 5E5MB 4AM0A 5CSGA 5H2BA 4M4PA 3SDXE 5JO5B 1NCDH 2J3SA 3CJJA 1PYWB 1WFNA 3AROA 4NKIL 1CDCA 3V9FA 5EC2B 2R29H 4YJZL 5L8KB 4WW2B 3GHBL 4W6WB 4ZPVA 4UUJB 5I75B 5ICXA 3VXNB 3F58H 3RDTD 1Z3GH 1S9VA 4EOWL 2FX9H 3V6FB 4UAOC 1CDJA 2CLRB 1AGDA 2IQ9H 3QIUC 3Q6FA 4PBXA 1IC5L 3DTXA 3PUCA 3MRQA 1HWGB 5CD3B 4J12A 3GNMH 2NW2B 2X1XR 4BQBA 2FB4L 5DJCB 4GG6A 5DA0B 3U9PL 1OWRM 5DEFB 5AWNL 2R4RH 2XXMB 2OZ4H 4A6YL 4NKOA 4UV4H 5LWYH 1QBLH 4DZBA 4MLIA 2NYYD 3ZKMC 3HAEA 1EJ6A 3IT8D 1C08A 1NFDB 2DBLH 3ARWA 3O2VL 1AP2A 4YBLC 3RWEA 3ULVF 1LO4H 5AZEL 1I1CA 2LFGA 5D93C 1JWSB 4OZGE 1BFVH 3QG6A 4BQ8A 5DJ6A 3QRGH 4JFFE 4PJHA 5CKGA 1ZT7B 4AY0A 1QOKA 1DLFH 3EDDA 4M1CD 1BVLA 4Y4FA 5KS9E 2CXKA 4RAVA 5SWZB 2VKXA 4HLZH 1FZKA 3RDTC 3F12B 4UQ2B 4FQ2L 1FFQA 5CCKH 1KYOK 1FAKT 4PJGA 2W0KA 1JMZA 4PJDE 5C2UB 3VFVB 4JFXB 4APQC 4HXBL 1C1EL 1DQJB 1GGCH 5IESH 5DK3A 1IAIH 4F3FA 2JJTC 3RKPA 4M6OL 3K4DA 1LO5A 1HHKB 1I1AB 2VZ1A 4KPHH 2C1OA 1CG9B 1WBXA 2VH5L 2VL5A 3BGFB 3RIAK 3IDIA 3VXSA 4ELMF 1HQRA 3U4BH 4B7IA 1CLCA 1AXSA 3DROB 5JHDA 1FHGA 1BBJB 2F74B 2IPUK 3QEGH 1YEEL 2NYYC 4LIQE 5TQ0L 2DLGA 2AXJA 4HWZA 4MAUH 4CVXB 4X9FA 3KLSA 3KXFD 2CD0A 2FECL 1XGQB 2WUCL 5I9QB 1WIUA 3OAZH 3DETD 4PJ7E 1DDHA 2V2TA 1FFNA 4M1CC 2VN7A 5DRWA 5IROC 1CXEA 3O2WL 1VKXA 2IGFH 3QDHA 3BP7A 3GI8H 2EYTA 5L0QC 2HFGL 3WIHL 3V0VB 5D1XD 4YPGB 1I7RA 3QEUA 4X8XA 2DQJL 5C1MB 3CPLA 2YA2A 4CU6A 3SDCC 4X6EB 3QCVH 5EULV 4TVPD 1PD6A 4KTEH 5HYSB 1NPUA 1UXWA 2HKFL 2MPAH 4FFZL 5KANI 1LQSR 1DBML 2Y72A 2D31B 4O00A 3TYGH 2HJLA 5CBAA 5IBLD 2DQIL 4FFWC 3U7YL 5D4QA 2XY2A 1AIFA 35C8H 4NNYB 1Y6MR 2OMNA 1SVCP 4K94L 4Z7NE 3RX5A 4WY7L 2MOVA 1CXIA 1INEH 1QLFA 2XN9E 1QUNA 1AD9B 4WU5A 1QBMH 3TYFA 4KJYB 1M71B 1N0XL 3D6GA 4FS0A 3W9EA 4OF3A 1HINL 3DETC 3QDMB 4GH7B 2UY6A 1JRHI 3WO4B 2OZ4A 1U9KA 5IHBA 1Z0MA 5IVZA 4IRJD 5ICYA 1XZ0A 3W82A 4WGWB 2NW3B 2YD7A 4NKDA 4NQED 2K1MA 4EI6A 1DBBL 3VH8A 2BOBB 5KJRL 5D1XC 4KZDH 4KRPD 4K9EC 1EEQA 1UA6L 1GGUA 2OTWB 4X7DC 3H3KA 5IW1B 1D5XA 2EYRB 3FAXA 3BT2L 4GUPA 1PEWA 3WN5C 1V7ML 1N4XL 1IGTB 2C3VB 2NY2B 3WO3B 5A2FA 3C5ZA 4MXQD 4GRLB 4DKAA 4BJLA 5IBLC 2NXZD 1HK6A 3C09C 1VB9A 3D39A 3AXLB 1FRGL 3DV6A 2A6JA 4PJIF 4HHAA 2QQLL 4ZUVA 3CFKB 4NQCD 1AE6L 1EO8L 1QSFA 2VDKL 5E2WH 4CMMA 4ERSL 2AJSL 4Z7UA 5AYUL 4F9PC 3AM8C 1A6VH 4X6CA 3QB7C 1RMFH 1MCPL 1GSMA 4RGMC 3KPRA 5ANMA 1B6DA 5A43C 1YYML 3ZE2E 1K4DB 3LH2H 3MRRB 3ARBD 2I9TB 2HYMA 1CGSH 4X9HA 3PWLA 5HHOD 3CMGA 3RVUD 1S9WA 1UEMA 4X9GA 4AENA 1JZ2A 5DD1L 1FGVL 4QGYA 1B4JH 1T80A 3QQ9D 4XC1H 1D5BB 4ONGL 1OSPH 4S1RL 3FQXB 4QXWA 5GGSY 3IF1B 3MROA 3HZVA 4KRPC 1CR9L 2CJUL 1LD9B 5EBLA 5TE4L 1SVZA 5IWLC 5E24E 3WDJA 1CFQB 3VFPA 1LEGA 4OD2A 5C0AE 1YEFH 1RURH 5EO1B 4KRNA 4HIXH 4MXQC 2HJKB 4Z7VA 6CGTA 5I8CA 3L1OH 4QY8A 2YPLB 4PJAB 4PPTA 5GRJL 3T0ED 3TESA 5HYJD 3WHXB 5M94B 4RA3A 3MA9L 1S7RA 4Z78A 5BJTA 4F7PA 1E4XH 3QWOA 2EDWA 4PTUB 5FECA 2O26U 4OCYH 3S6CA 3THML 2CSPA 2AK4B 1Q0XH 3UTOA 3IYLW 2HT3D 2M8XA 4FXKB 1NMAH 2AXFA 2JJUA 2PN5A 4NO3A 3WJJA 1YQVH 2BSTB 1KYOJ 4GOSA 1TZGL 3P73A 2Z93B 3WE6B 3NAAL 4F37F 2W9EH 3QQ9C 2G5BB 4IHOA 1FNLA 3FFCD 1A8JH 4LCWA 3RI5F 2J6EA 4XBPB 1MWAB 2BHUA 5F71A 2H3NB 2V5TA 5C07B 1VACB 4OZHE 3K80A 4WW2F 3SGEH 3SO5A 2W0FB 3TNNB 5F96H 1PG7W 1R3IL 2JCCB 3G04B 4HV8A 5ISZD 1G9NL 4M6NH 4PLOB 5HI3D 3EW3B 1XF3B 3TBYA 5I66A 5BO1L 4WI8A 4ALAL 2E7LA 1FNAA 1BJ8A 3PIQA 4R7NB 4GFTB 4R8WL 5D7LE 4QXGH 1JRHL 3MXWH 3U6RB 5MENA 3OKNA 5I1EH 3PWPD 3L3KA 4PGEB 43C9A 2HVKB 1T5WA 3QUYB 5FCUL 3LRGA 3RWJA 4KMTL 3LY6A 3KPMB 3QIWA 4IIQC 4L3ED 1WCQA 4XP6H 3O6KL 5DJ0B 2ATPA 2HT3C 4RGOH 1L7TL 1K2DA 3K0WA 1SY6L 3D3VB 1A7PL 3FQTB 2D9CA 4OTXL 3LOWA 5BMFL 3ZSTA 3GMQB 1RFDH 4EIZC 1NFDF 1G9MC 4K7PY 4Z76B 4H0HB 3DHMA 1NDMB 3WFDH 3IGAA 4M6ML 1MHPL 1S9XB 3BEVB 1RZGA 4U1JB 4YLQT 3HC3L 1NGYB 4ZTOH 3T65A 5JMOC 1NAKL 4Y2DD 1ZHKB 3L7FA 5CEXA 3FQUB 1CFSB 5JW5A 2VC2L 5F9OH 5I76A 3GMRB 5I1CL 3UBXB 4ODSL 5DD6B 3VRJA 4I48B 1MCIA 3SDAD 3X3FH 4R96B 3SDDA 2ZSVA 3U7WH 4MZ2A 5K9QI 3G5XB 3RZWA 1O5DT 2GCYB 5IF0B 2ED8A 1PLGH 3GJEB 3SQOL 4HKBB 1RIUH 2X4QB 1JF1B 1SMOA 5E95B 1G6RB 2B2XL 2JB5H 2K7PA 4DWHA 5I6XB 1QSVA 2FZ3A 2D7NA 4YXHL 3UPRB 2GK0A 2JB6B 1TZIA 4RMQA 2P42B 1CICB 4DAGH 5FYJU 4FQQB 1QRNE 1ZVSB 1MCRA 2HLFD 2AK1H 2YHGA 1IEBB 2ZCHH 4XHQA 3SE3C 3TO4A 4ONFH 4Y88A 4XBGA 1IM3B 2P4AB 2R0ZL 5L8JB 1MVUA 2R4SH 3GSRA 1D5IH 3CLEL 4YDVA 1KTLA 3F7RA 4XX1E 1XR8B 2YD9A 5FYLE 2HAZA 1ZV5A 2PW1B 5E8DH 1A7NL 5J6HB 5GQBA 1BIIA 4PR5A 3IDGB 1TENA 3CFDA 1VDGA 3T3ME 5GIRB 3N06B 3SDAC 4EDXB 1U2CA 4XP9H 5J0BA 4HEME 3QFJB 4U31A 1KACB 2XRAL 1A4JA 4N0YH 4FXGA 1MWAL 4OCWL 4ZUUA 3TBSA 4MNGE 4WNQB 1CE1L 1T22B 4I2XA 1ZOXA 5HHQA 3GSWB 1CLOL 1Q9WB 3BZDA 3NA9H 4K7PX 5CINL 3W0WB 2AEWA 2OM5A 2IAMB 2FYYB 2VJXA 2HLFC 5CJQL 1D7FA 2FHBA 4NHCH 4X6FB 3IETA 3GMNB 4P9HH 3GSUB 3CFJB 4Y19D 4I18B 3WYRA 4XNUL 4LQ1A 4PB9H 4L9DA 4PJ5E 3RL1B 2FJFB 1W0VB 1KIUA 3WIFB 3MV8B 5IOPB 3G9AB 3UZQA 3EFDH 3BIAX 3BJLA 2EE3A 3JV4B 3FB6B 4NUGL 1MRDL