5L2KE

Crystal structure of gem42 tcr-cd1b-gmm complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
b'AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSPRLAGDEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1b
publication title T cell receptor recognition of CD1b presenting a mycobacterial glycolipid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE02
3HC3L 1KJVA 5E2VH 1SYSB 5CUSH 3FQWB 5HXMA 4YZFF 4MD0B 3VFTA 4HMDA 5D7LD 5D96C 3LD8B 2IC2A 4ZQKB 1JPST 5IEHA 5IROA 3D85A 3V52L 4M48L 2ZP0T 1KIPA 2BC4A 2YOCA 5CSZA 1QFPA 1CGXA 4RAHA 3L3HA 2E7LC 1ZT7B 4M02A 4XCCH 2FIRT 1OVZA 4C56E 2BX5A 4YXLH 3O6KH 4WUUE 4XAKD 5LGHH 5HYEA 3B3IA 3QQ9C 1FZMB 2QSTA 5E00B 1AE6L 4HGWB 1WC7B 3H9YA 4MYWB 4FQIL 3VD3A 4N1EA 4GFTB 3HZMB 1MAMH 4AMKL 2GK0A 1MRFL 1X5GA 5GS0L 1PZ5A 5IB1A 2VXVL 3FJTA 3CC5A 2ATPA 4LSQH 1E4XL 5GS2H 1G9NC 3JZ7A 4E41D 1JF5A 4AIZB 3L5XL 3RNKB 3IRPX 1J8HB 1XR9B 4XBEL 3UC0L 1Z9LA 2D9QB 2BMKB 3ROLB 4AH2B 1UT9A 1MCQA 1YPZB 3OR7A 3T3MF 2Q8BH 2P5WD 3T1FB 5MERA 2BNRD 3V7MA 4L8CA 4YBQD 1U9KA 3QDJD 4LSVH 4YHOH 2FBJL 1FFNB 4JHWL 2VZ1A 2EXYD 5EOTB 1HSBA 5GZOC 3BD3A 1NBYB 1NKRA 1VFAB 4N8CH 2BP3A 3QIUB 2F53A 4X8JB 1BEYL 1CG9A 5JA9A 2PETA 4JFFD 2AW2A 2A0LD 1FO0A 5C9JA 1WLHA 4O2EA 1HHIB 3CVHA 1R5IB 3HNVH 1D6EA 4Q2ZA 4P59H 1I9JH 5HI5D 1H3UA 3BD4A 1I9RL 5ID1B 4RX4A 3FOMA 4IMLB 3HG1B 4P9MH 4P23B 3MR9B 1ROWA 1DANT 5D70L 1YY9C 2DI9A 3WDJA 1S5HA 4FP8H 4KVNH 4Y2DC 3VRIA 3CFBB 4WO4B 1ZV5A 1KELH 5DMGD 3SO3B 2QR0B 3FONB 3C5ZB 3VE0A 3RWDB 5ITBH 4YHMH 1NAKL 2D7PA 4I3SH 4G8FA 5C86A 1Q0YH 4KU1A 1U3YA 3CXHJ 3DXAD 4PJHE 5IT2L 5ACMA 2CIKA 4G5ZH 5JXAL 2VLJD 5KTEH 4LGRB 2EDQA 2YD3A 3PWLB 4LBEB 4JR9L 1KCVH 3MV9B 4M6ML 1FZOA 4OFDA 5E8DH 5JW3L 4P2QA 2PXYA 4ZTPL 1DEEA 4C4KT 4D9RE 5F1SA 2FH8A 3DROB 4OF5A 2GJ6D 3KS0J 3LOWA 2PNDA 4PB0H 1S7TB 3T0DA 5EZJA 1IAIH 1XCTA 1D5ZB 5E2JA 4R4BA 2R56H 4L3EA 1ETZA 5ESVB 4LARL 1ZA3B 4NJ9H 4OLZH 5FO9B 1GCFA 1XF2A 3BVNB 3CXDH 2P24B 5J06A 5CD5D 4WENB 1H8OA 4MSWA 1OTSC 2G5BA 1B4JL 4YXHH 3QUYB 4N8VG 5I1IH 5A2LH 3ZKMD 1QSFB 3W2DH 2NY6D 4QTIL 5SWZD 1MCWW 5BRZB 1AIFB 3ARFC 5F1IA 4DAGL 1RZKL 3P9LA 5IHUH 3FQTB 1RIUH 3T4AA 1INQB 4LU5L 4MJ6A 1KB5A 3UZVB 3RZWA 1QD0A 2XQBL 1BZ9B 2IPKA 2VDRH 4F7PA 4H1LG 3REVA 1VEOA 5B4MD 15C8H 1K8DB 1RZIB 3X3GH 4FQQA 2VDML 4O4YL 4LRIC 4I77L 3QISA 4U05A 4XBPB 3WLBA 5C08A 1RIHL 3TCLB 2R9HC 4XNYH 4PJAA 3UPCA 1PZUB 1A6WH 4GBXC 4KRMB 5D9SA 4NQTA 5GSVA 3F5WA 1G1YA 4ZO9A 1NMAL 3SKOA 3BPLC 1HN1A 5I2IA 1QFWL 1UEYA 1T0PB 1WT5A 3IDMB 3C09C 1JNLH 3BDYL 4L4TB 3MLPA 3U7WH 4FABL 4OI7A 5IMLB 2IAMA 4ALAH 3NCJL 5EBMB 1I3RA 2UZYB 4NQEA 2FX7H 3LH2L 1I1YB 3QO1B 3WS6A 4HCRH 4DZBA 3QDMD 1CN4A 3OSKA 3Q2CA 5J3HD 4NN7C 4TUKL 4ZS6D 1NGQH 1OLZA 3MRIA 1OGAA 1JF1B 4ZFFB 5E7BA 1U8IA 5TFSH 2NYYC 2D03L 3QDGB 1S9YA 2R0WL 1CD9B 2FATL 4ONFL 5E8EA 4PJBE 2G60L 1CT8A 4POYA 1IGTB 2P48B 3FO1B 4L9DA 1Q94A 5K33A 3U9PL 4RRPG 4O02L 1D5IH 1EH9A 4DKDC 3MRNB 1F3JA 2YZ1A 4P57B 5ETUB 3B9KD 1I1FB 2NY5H 1A0QL 1AGBB 2YUVA 4KVCH 4QHLB 3ZTJH 5ISZB 2QHRL 2ICWA 2R69H 1RIVL 4HV8A 4PLNC 1I1AB 4Z7VF 3EYOA 5I18L 4CVWA 1EFXB 3P77B 2P5EA 25C8L 3MRDA 4BZ1H 2X1XR 5IFHH 3MSPA 2XZQL 3IJYB 2NW2B 1BQSA 3VG0L 4L4VB 5CZVL 4N90E 2HTLC 4HW6A 2W65B 3MRKB 1DTUA 3LPWA 3P40A 2EH7L 2R0LL 3QXWA 3O2WL 4NO0A 2D0FA 1LNUB 2QQNL 4JQXA 5E24E 3BKCL 1BOGB 1ED3B 5K59F 3GO1H 4OZHF 2VH5L 4CUCA 3BT2L 3OL2A 4R0LB 4LASH 3ZHLA 4ELMA 2I26N 5F88A 2FB4H 4NM8H 3R0NA 3TP4A 1HEZB 4LPVA 4TVPD 3DRQA 2HLAB 3MLYL 1T4KB 4HZAA 4GRLB 1FL5B 4EUPG 3QB7C 5EU5B 3D6GA 5FIEA 3CSGA 2CXKA 4YWGH 2EECA 4IBLT 2WUBH 1AGEA 3RIFK 4P3DB 1QYGH 3TA3C 5EBLB 2A6JB 1NFDA 1FL6A 1GOFA 3PGFH 4ODTL 4OUOA 4BELD 3OTTA 4G3YL 3L3DB 3ECBA 5EO0B 5IQ7H 5FYJU 2HTKC 1J5OH 3KLDA 2XPGB 4LLQB 5FYKD 3SCMB 3MBED 2V9QA 1CD1A 1YNKH 3TJEH 3AS2A 4PJCB 3LEXA 2EIBA 43C9A 1T03L 3AS0A 2BOCB 1CQYA 3LN5B 3P0GB 3X13A 1MWAH 4G43B 5EC2A 5DD6B 4JRYD 3SJVB 2VXSL 1CE6A 3QQ3B 1LD9B 3QUKB 1FNEB 4JFOB 2DWEA 1PEZA 3NPSC 2BSRA 4OLWL 1PLGL 4MWFB 3TC9A 3RVVC 3P73A 1EJOH 2X4RA 3G5XB 4WHYH 1KOAA 1RZJH 1A4JB 1BGXH 1S5IH 4GKZA 3GSXB 3IFOB 4ZFGL 1AO7B 2BNQD 1KEGH 3UTTB 3DJ9A 3PIQB 1JYVA 4NZTH 1EERB 3OZ9H 1HHJA 3JWDC 5FGBA 4FG6C 3MJ8B 4N0CD 5BZDB 4OV6F 4ZSOA 5FYJD 5KJRH 5L88H 3T1WA 1G7IA 1U3HC 5D6CB 4UT7H 5CJQH 4PJ5B 5I17A 1ZLVK 1ZT1B 3BP4B 4ZFOL 2FR4B 1DBBL 3F12B 2EDDA 4M9PA 1BFOA 2HA1A 4OV5A 1IGMH 4LKXA 4QRTB 1A47A 3DUUA 2VDLL 2E8ZA 3MRHB 4OFYA 5DQDL 1RMFL 2SEBA 3LDBB 4IJ3C 1IM3A 3ZE2F 3PJSB 1SEBA 4JFDD 4WEMB 4FQLH 4Y16D 4YPGA 4UTAH 5I1DA 2CLVA 1L7TH 1D3CA 3WIHH 2MHAA 2Q6WB 5K9QG 1WUNT 4LKCB 3QIWB 3AMKA 2P8MA 3EO9H 1W8NA 5HHOB 2GCYB 3FCTB 4XNZB 2EDKA 1NFIA 3UBXG 4MCZB 4DUWA 3O6LL 4ZFZA 2JJTA 5BV7H 3MUGA 4HG4K 3S96A 1KCKA 4QXUH 1CFNA 2H6PA 3QPQD 1DQJA 1W0WB 5E2UL 2BVUA 1UJ3C 1CBVL 1R3JB 2VDOH 3LZFL 4OD3L 4BKLB 4Q97A 3IFLH 5I8KH 3F8UB 1P84J 2I9TB 1P7QA 4CMHB 5FFLA 5E6IB 5F7WC 1YNLL 4K3JH 4N9OB 1IKNA 2QQKL 3VG9B 4QF1A 4P2YA 3GMRB 1Q9OB 1CGSL 2YBRA 1NAMA 4Y4FC 4JY5H 1JL8A 4MA7L 3LRHA 3QZWB 1U8PB 1WFUA 3G5ZB 3LKPA 4NQXB 4XCFL 1BAFL 1BECA 2R0ZL 5ALBL 4C56A 4IRJD 2YD9A 5JZ7C 1KTDB 4LCCB 4OM0L 3D2UD 4LSSH 1JZ6A 3VWJC 2P5WB 5KVGH 4K3DH 4KDTA 2BNRB 2ZCLL 2JJSC 4FS0A 1JCKA 2DQTL 3QDJB 5C0AE 1IQWL 2JIXA 3DLQR 4G7YL 2H26B 5DRNB 2YKLH 3C8KA 5KSBE 4P48A 4MMXC 4A6YA 2I9LB 2O5XH 1E6OL 1HCFX 3MJ7A 4WY7H 4GLRI 2D4FA 3D85D 2R0KH 2XZCH 4WV1B 4ZPVB 2PW2B 4JFFB 3EAKA 4U1NA 1FNHA 3UEZA 4Z78B 5A40E 2EE3A 4LPTA 5FM5M 2Q7YA 3W39A 1VADA 5D8JL 3HE7B 3IDXH 4E5XB 3TT3H 3RRQA 4CMMB 3BP7A 1BBDH 5DA4A 3NACH 4C83B 3TBVB 3RAJH 4CU7A 2ERJC 5DHVA 2F9BT 5ICYA 4L4JA 3FQXB 1A5FL 4U6HA 1OCWL 1X4YA 2OZ4L 4NFBA 5D1XC 2PW1A 2D7QA 3PWPE 5T3XD 1OF2B 3GSWB 1VGEH 3VFGL 3OKEB 1Q8MA 2DYPB 3U4BL 5JIPA 1I8LA 5L0QC 5B3JE 2FEEL 4XWOD 4UOJA 4Z0XA 4JGMA 1FVEA 2A73A 2AKRB 2X4TA 3ESUF 1AJ7H 1IGYB 3SGEI 1SYVA 5FOBA 4U6YA 4XVJL 5I0ZA 1CE1H 1RAMA 4IOFD 5H35A 1PQZA 5L2KB 4E42A 1OP3K 5DJAB 2X4OB 3N1GC 1MFEH 2YRPA 5DC0A 4CGTA 2GJ6B 4Q9BA 1Z2KA 4NQSA 4LEOA 2F53D 3ZSTA 5I1CH 1YEKH 4A2MA 3HNSH 2NY4C 4XC1L 1FZKB 4U1JA 4M61A 4F7CA 3FTGB 1I8IA 5EB9A 1NGZA 4PJHA 1VKXB 4F9PC 2B5IB 4MDJA 4X6DE 4JKLA 4XX1E 4YDJB 5GGSA 4NN5B 5DEGB 4F7TA 2A1WL 4D8PA 2WBJC 1Y0LB 1KCRL 2HJKA 3MYJB 5DK3A 1LEKB 5FYKL 1UFUA 4OKVB 1FDLH 4ODVH 1BJ1J 4WCYH 5FV1L 3E3QC 1UB6B 2WLYA 4JGJA 4XNMA 2LE9A 4RX4D 2HYMA 1AGCB 3RVXD 3IDUA 3KJ4B 3QCUH 4ORGA 5D1ZC 4Z7UE 5IFJB 4JFZL 1OPGL 5DRXA 4AIOA 1S7XB 4DN3H 2KPNA 1H5BA 1RK1A 3DVNA 2X4QA 2EDJA 4OI9A 4FHBD 4JHAL 1N8ZB 5F9JB 5C2BH 5F89B 5DK2A 4PJAF 1FG2A 4ZUWB 35C8H 3O3AA 2NZ9D 3VGAB 2DF3A 4J6RL 4XCEA 2O61B 5IJKA 3EYQC 2GJJA 1R24A 4P2QD 2PXYD 3NGBB 5BOPA 4DQOH 2B1HH 4KUZH 1AQKL 3RIAK 3TWCH 4AZ8A 5I19L 4F7EB 1IC7L 4MAYD 5JR1H 5GGUA 3ZE0F 1BJMA 1D5MB 4UAOC 1TQBB 1EVUA 4L3ED 2P47B 4KUCF 2I5YL 5MEOA 3GMPB 3KPQB 1V7NL 3SDDB 4LOUD 5IF0B 3RWEA 4IRSA 3IAQA 1NGPH 1N4XL 1K5NA 2XA8L 5DUBA 1NJ9A 3MNWA 5IWLA 4GMTL 5E4EB 1H15B 3PG2A 2ITCB 1U41A 3VRLF 4RQQA 4ZXBA 3OJVC 5F96H 2J1KA 5INCA 4OD1L 5ANMA 4DCQA 3ZT5A 1WEJH 4I0KA 5BVPH 3S88L 5F9DC 1N7ML 3CH1B 3LPGA 5E08H 1NGWB 2HT4D 1W72L 1INDL 3LKOB 5ITFA 4D0CB 4MNQE 2CUIA 1KJ2A 1GHFH 4LLMA 5JOFA 1YMHA 1F6FB 4KK6D 2HT2D 1TPXB 2Y07H 4H26A 3B9KB 3HMWL 2DBLL 3NIDE 5C3LD 1CYGA 4PY7B 1II4E 4UB0L 1HH6B 2Y06L 2Z35B 4OGXH 3VXMB 4I3GA 2V9TA 3GIVB 4LAQH 4U1GB 4LF3B 5C0IA 4H25B 1K4DB 3WEXB 1CGYA 4WW2C 1I8MB 4IEFB 2CDGA 5JOEA 2Z92A 3ZDZE 5J13B 2FD6H 3GHEH 4H8WH 4FRWA 3RWIB 1ND0A 2UZXB 5EU6A 1BFVH 4JRXA 1U8NB 1RV6X 2CKBL 4FQXB 4LSDA 3EFDH 4PGZA 5D2NB 3WIFB 1YA5A 3LKQA 4DN4L 1AD0B 4TOYH 3MLSH 4NQED 4ONHB 3ZTJG 2F58H 4J4PA 2OMBA 3MA7B 1X9QA 3BGMA 5EUOB 3M8OH 5DRWA 5D7SH 5SX5H 1CFTA 5HHPA 1OGAD 4ELMF 1N0XH 4LFHG 3BN9C 1QBMH 1U8JB 4JDZB 5GGVH 1WFNA 3RGHA 1XF4A 1LK2A 3FO9B 1IFHH 3VD9A 3B6SA 5TQ2L 3MRMA 1J0HA 2DB8A 5D1QA 3LV3A 1QFOA 3TPUA 2YPVH 3BQUD 1D9KC 1J1XL 4BFIA 3ZTNH 4Z77A 3RDTB 5BS0B 3CAFA 3DHJA 3PHQB 1FAIL 3KPPB 5GS0C 1GYAA 5TQ0H 2NX5B 1CLZL 5IHBA 1AKJB 2J3SA 2WIIB 2XQYK 2V2TB 2HN7B 4MXVE 4M1GH 1BQUA 1NFDF 3BH8B 3PV6A 2X42A 4FXLA 1KACB 4L3AA 2WWMD 1IGCL 3KYOA 1KF9B 4Y5XA 3WFDH 3BPCA 4K7PX 2IMMA 3PXHA 4Y4KA 4P5TC 3WNOA 2C3HA 3VXTB 1DLHB 4U1HB 4U0RC 4XP9L 2P5ED 2ICWI 4NQCE 1XGRB 1KLFA 4GAYB 2H41A 4P2OB 3PQYE 4PIRF 4CVZA 3OKNA 1DP0A 4TUOA 1CVSC 3CFJA 3ZKXB 1IARB 3PNWA 3ISWA 2ZG3A 4OCNC 2V7NB 3ALPA 4H0HB 5LWYL 3LQAC 4D9QD 4OB5H 4K7FB 2PUQT 4N0RA 2MPAH 4NO0D 2F15A 1GC1L 2NY0C 3QDHA 2CUHA 4P4KA 3IVKB 4UDUA 2DM2A 2VJXA 1U3ZA 4OD2A 2UY6A 4G8EB 3PP3K 5DD3H 3B2VL 5HYQB 1SM3H 1MFDL 1JWUB 3DGCR 1ADQA 2OR9H 2C3VB 4M5ZH 4MMZC 2XNAB 3V6OE 3S36L 5I66A 3QR2A 5K9OB 4QKXB 1FFOA 3BPNB 3U4EA 3W0WE 5EO1A 2Z91B 4X7TA 3GKWH 3Q0HA 3THMH 2EC9U 5E2WL 2X4SB 1KENL 4BH8B 4LLDB 1T6WA 1YY8A 1DUYB 3DI3B 1WIPA 4JJ5B 5DLMH 3ORJA 4X9FA 3CX2A 5F7HA 4X9HA 1UKSA 1C16A 2IEPA 1AI1H 4GKSA 1VB9A 3FMGH 4KXZH 3A6BL 1WGOA 2B2XL 3H42H 3LEVH 1PG7L 2NTSP 1JPTH 2CDEA 4UILL 4NDMA 1DL7L 5CMAB 5IJVB 2KBGA 5ESQA 3QNXA 3Q5YA 4QTHB 4OAWA 2VWEE 4PS4H 5FK9B 5HHNA 5I74C 5MENB 3SDCA 1DDHB 5HGGS 1IC4H 2YWYA 5KVMC 4KJQC 1W0VA 5HI4D 1HZHL 3TBTA 4TVSa 1G0YR 4P9HH 1MRCH 3LN4B 4RFEA 1EJ6A 3GGWB 32C2A 3QAZC 4JPWH 5CGYD 4LHQB 1T3FB 4GKNA 1A7NL 5EUKA 4PJCF 5IBLD 3DGGA 1LEGA 4MQXD 4RISH 2OTWA 2PO6C 2KDGA 5IG7A 1F4HA 4Q0XH 4R8WH 2V7HB 3KNBA 1U8OA 3SDAB 3MX0A 4PRBA 4WU7B 1RZKC 5C07E 4ESKA 1RSFA 4UI2A 3RVWC 1BQLL 1CXFA 2ZKHH 3EOBA 3SQOH 4KGLA 3HC0A 3LEYL 4MA1C 3UBXI 3MNVB 5JDSA 5T3ZH 5C09E 3BEWA 2KL6A 4IRJB 4R7DA 5EU7E 4OF7A 2KQMA 4UBDC 1FE8H 4KK5C 4EBQH 3UAJC 4G7VL 3QFJE 3U0TB 3VGEA 3VJ6B 4OFYD 3ZHKA 4PJ8A 4DTGH 3OXRA 4ZAKC 1JGEB 1ZHKA 4FZ8L 1NBVH 2XI9A 3BZFB 4X6FB 2EKSA 4E0RB 1NDGA 4AJ0A 1C12A 5AYUL 1EMTH 4JFPA 4O9HH 3TO4A 1E6JL 3MGOA 3DV6B 1FYHB 1G7HB 2A74B 3OPZL 2PCPB 1QFUH 1XGUA 2BY0A 3Q6FB 1OAUL 2HFFA 2YD4A 1OGTA 4WU5B 5CSZB 2ZJSL 4U1LB 1L6ZA 5GS2D 3C6SA 4XMLL 3BESR 1LO4H 4S2SB 5CD3A 4YHZH 4PJIE 1TTUA 4OJFL 2J7LA 4G8IB 3G6AA 2V5YA 4EIGB 3CZFB 4XP4H 5DYOB 1HINH 3PDDA 3LS5L 5KSBA 2NR6D 4ZUVB 4BH7B 4FZEH 2RIKA 5HYJE 4FQ2L 2XIDA 3QRFM 1P7QD 4N9GB 4WHCA 3O4OC 4PREA 2R4SH 4LL9A 3H2WA 3GB7B 3UTPD 2Y23A 3G6DL 3HCVA 3RY6A 2WP3O 2YD5A 2YD8A 4ZOCA 1X5FA 4I3RL 5FA4B 1EAPB 1K3ZA 1ACYH 4KRLB 4C56D 4MAUH 4WUUD 5FDWA 3INUH 2ZNWA 4HQQL 4NO2A 5TDOA 4EXPX 1XGTA 3HI5H 1VENA 4YHIB 1CD8A 3HE6C 3TZVC 5CEYB 3QEQE 3PDOA 5AD0B 4S1DC 2JIXD 4KMLB 3FB6A 1ZWIA 4PLJC 1CL7H 1PGRB 3NIFF 1AP2A 3NFPA 1L7IL 3OG4B 5C71A 3QUMB 1HSBB 2EXWC 3LKRB 4FXKB 4G6KH 1U8MA 3U0WH 1JNJA 1UACH 2ZSWB 3D9AH 2J6EA 4HWNA 1YZZA 4Y19A 1YNTB 2FECI 4EI5A 3BAEL 4CL7A 3QHFL 4PJHF 1C1EL 1I9EA 4J8RA 4F3FB 3SQBA 3AU1B 1HH9A 4NM4H 5DQJA 3ULVF 3BHBA 3RWHB 4EEEA 5GJTL 4KK9D 4JM2D 3FO0L 3ULUL 1WISA 4U4BA 2VLMD 4FTVA 4L8DA 1LO0L 5GRZA 5AWNL 3WS3A 3HB3C 4JY6A 4Y5VC 2P44B 4JG0L 2PR4L 3FT3B 5T1DH 3WFBL 4M43L 5CEZE 4N8VB 4FXGB 4LMQI 1XZ0B 1D5XB 1MIEL 4NHUA 3VE0B 1D7FA 4X6DA 4XPTH 3HZKA 5CIPB 2Q1EA 5GRXG 5KSVA 1AGDB 2E6PA 4RGMB 5HGAA 4ENEC 2XZAL 3A0OA 4ERSL 3K81A 1Z9SA 1IAII 5IGXH 2YSSA 4H1LB 1IEAB 3OJ2C 4I18A 1R3KA 3V5HB 1U92B 4OLVL 3ZSSA 2C7UB 4MB4A 1YUHB 1A7PL 4Z8FL 4PBXA 4HWZA 3OKOB 2MQ0A 2EIZA 3QEHB 1AFVH 1S9VB 4LCYA 4MLIA 5SV3A 1RUAL 3STLB 4MAYB 1NDMB 1B9ZA 5E7FA 1XGPA 3O3EB 2VR4A 4YR6A 4GSDH 1XCTB 5CZKA 1DQQA 1QR4A 2I60L 1ETZB 1OD9A 1MFBL 4HWBA 4F7MB 2EE2A 3QIBC 5FO8A 3DMMA 2FCBA 1O0VA 2R4RH 4K23L 3GSUB 4OQ1A 5KANI 4J7RA 4ZG1A 4JREC 3RZCA 4HUUB 3MRBA 4F15B 4HPOL 5DDHA 2FBOJ 1J88A 5C6PB 1J87A 4QHUB 1CFVL 5GGQL 5MEPA 2Q87A 1N6QL 4D9RD 1XIWC 4LSRL 5CEZH 3DVFA 4GQ9H 5I1KL 3O2VH 3NA9L 1HXYA 1CLYL 2A6IA 3ARBC 1HYSD 4YDKH 1MHPH 1P2CB 4MZ3A 2XQYG 1GIGL 4RMQA 3VWKC 5TE6H 4DKEH 1VA9A 3TBWA 5GZNC 1NMBL 4PD4K 5CJXC 2HG5A 2PTTB 2BRRL 4N8PA 3QHZH 5HHME 2FGWL 5HYSA 4HDIB 4PJXA 4Z76A 1QO3A 2W92A 2ZCKL 4XCNB 5EFIB 1E4JA 3GIZL 1BWWA 5ENWB 5GJSL 3NAAL 2AEPH 5AEAA 3MUHL 4PRAB 1I7RB 2VDKH 5I8CA 4MNQA 4YIQB 2E7LA 5DXWA 4JPKL 2G75B 3MV01 3L3JA 5EPMA 3CK0L 4PRNA 4PBWD 2VLRB 4FFYL 4Y2DB 3HPJA 3CX5J 1I3RB 2ZUSA 1Q1JH 4XNXL 1QNZL 1K85A 4FQHB 1M7XA 4IRSD 5E5MA 4DZBB 1BZ7A 5I16B 4DGIH 1GGTA 1CDHA 4L9LC 1RULL 1JI2A 1WZLA 1U58A 3K4ZA 5JW4N 4LCWE 1JRHI 2JCCA 4ZXBD 1S9WA 3IDIA 4LGSB 5FO7A 1EK3A 4LLVB 2RHEA 1EUTA 4PJ7E 3HZVA 4YXKL 4OGZA 3O11B 5K9JH 1T1XB 4NRXB 5F3HB 4LHUG 3BQUB 5CBAA 4XWGH 3MRGB 2NMSA 4KI5E 3BP5A 4K9EC 5GS1A 5KVDH 5DI8A 2PKDA 1N2RA 4U3HA 3PWJA 2FX9L 4W4OA 5E1AA 2WANA 1NC2A 5DGQA 4JFEE 4YUEH 5F7DB 3FT2B 2YRZA 5IB4A 4CU8A 3S8WA 1JZ2A 2HLFC 1HQRB 4EUPB 1BBJB 4M6AA 3N1MC 1C8PA 4QRRB 2UUDK 3V5DB 3NABL 4LQ1A 4HIHA 4HS3B 3ARFB 3BKMH 4XZUA 4WVRA 4AEIH 3ILPA 1XH3A 4Z5RA 2X41A 4QOKB 3ARUA 1D6VH 5GHWL 2GTWA 5EU6D 1X5IA 4G8GE 3FT4A 2H2SD 4HPYL 3QT2A 1VACA 4IMKC 3IFPB 4HC1H 5A1AA 4J4PD 1BIHA 3S3PA 5IV2A 3BWUC 2HFEA 4XVSL 5IVXB 2APFA 1DR9A 5EZLA 3N85H 2P7TB 3H0TB 4KHTH 3H8NA 1HQ4A 4PJFE 4A6YL 3B9VA 4GBXB 1DSFL 3HPLA 4DJMA 2X7LA 3QEGH 4NQCA 1JHTB 1JHKL 3PQYA 5D1QD 4H88L 4R2GD 5GGRY 3BPLB 4ZTOL 4RWYL 1R0AL 2DTMH 1T1YB 3DSFH 4N90D 4X80H 3VH8A 1MCNA 2O26U 4MD4B 4K94C 1IL1B 1ZTXH 1UWEL 4OF6A 5C6WH 2ARJB 3OAUH 4PLKC 5C0CE 3P4LA 1HOCB 1NKOA 5DS8A 4L8SA 4Z7WE 2ADGA 5D7JC 5JUEH 3MUJA 3MXWL 1VFBB 2CGRL 4X7DC 5L2JA 3V2AR 4NOFA 1WBZA 1ZSDA 1QA9A 3FHAA 1KYOK 1H3GA 3H3PH 1GVIA 2FZ3A 1A6UL 4NPYB 3OMZA 4Y4KD 1RUQL 4JHBA 1G7PA 4LVNB 3QEUA 3O45B 4PJ9A 4NQDA 3BYTA 1OWRM 2EDTA 1F8TH 5IM7B 2F5BL 1KLUA 1CGVA 3GM0A 4UIKH 3MLVH 4KPHL 2Q86B 2AJXL 4C4KO 5I1HH 1CLOL 5DO2D 2G2RB 3C6LC 2H2PC 1DLFL 2E9BA 5DRZB 3T65A 1CLCA 1P7KB 4HIXL 4GG6E 4RFOH 3T09A 1N3NB 2G5RA 1IGJB 4XXDB 3VFSB 5JHDB 5MEQA 2ZOLB 4FQJH 4P4KD 1XGYL 4Y88A 5DVKA 4KKCC 4DUVA 2DL9A 4MCYA 2VDPL 3MO1B 4XNQA 1HHKB 3MLRL 2DQJL 4GG8B 3MCKB 3QWRA 2WINB 3QXDB 4YX2H 1PKQB 3RL1A 3PABB 5GQBA 3WFZA 1I3VA 1IC5H 1FNGB 3VFRB 4PRIB 4R4FL 2F54B 3ZE1E 4M93B 1MIMH 3UBXB 2A38A 1EBPA 3QUZC 1KLGB 2DOCA 4EI6A 5I1LA 4NNPL 5MI0C 3ULVL 1BQHA 5I1JH 2EZ0D 2LQRA 4K8RC 1CR9L 1BLNB 1ERNA 3VRJA 4P3CL 3MCG1 2ZG2A 3D87B 5TE7L 1WTGT 2N7BA 3ULSA 5FAAA 5CCKL 4RDQG 1DQML 2SEBB 4RFNB 1CGTA 5C0RL 5C07A 3VXRB 4WI3A 3LHPL 2DLGA 4NZJA 3HZYB 1G7JA 2ARWA 1A6VL 4ZUSA 1GAFL 4XAWL 2IFFL 2CLVB 3SDCD 3U0PA 4U2YA 4D94A 5C09A 2H32H 4YGVA 2ICES 2XN9A 2JK5A 2X40A 4FQCL 5C0JA 5I30H 3KLHC 3WHE1 1I8KA 1MHHA 3I75A 1QZ1A 4XHJC 2ATKB 1T20A 2Y25A 4FFVD 4PYHA 3RY4A 5ALCL 3MV8E 5DZNA 4U31A 1DQJB 3QH3A 4U6VH 2ZSVA 4HIJA 1F5WA 3L3GB 5DMIL 3CCHA 3PHSA 1OAKH 4U1MB 1SVZA 2Q3AA 3PGDA 1WQVT 4XP1H 4EOWL 4DOHB 2BVEA 3L5IA 1U2HA 3WDIA 2WUCL 4OSUH 4RA0C 3T2NH 3JBG7 3AS1A 1UWGH 2DKMA 7FABH 1RJLB 5HDQL 4Y1AE 1MCBA 4WUUB 3UTQB 1PD6A 1WCQA 1A1OA 3K2MC 4YHYC 4KQ4H 3UJTL 2Y36H 3P0VL 1VEMA 1YDPA 5HPMB 3V4PH 3O6FC 3GJFH 5T1MA 4GAJL 4YLQT 1NSNH 3V79C 3S35L 4QO1A 2DWDA 4HKXA 3KPLB 4OZ4B 5CBEB 4EIZC 1LE9B 4G6MH 2RR3A 4RGOH 2ESVE 1UYWH 5FM4A 3MJ7B 4ETQA 5E9DE 4XP5H 3G6JB 2EKJA 3QCVH 2HWZL 4EN3C 1U3HB 4P3WA 3S5LA 2YD2A 5HD8D 1G7MB 3ARDC 1HK6A 3SDXE 4X99A 5FECB 1U8HB 4X4YB 2ZCHH 2VQUA 5ECJE 4LPWA 1VADB 2AJSL 3HC3H 4GW1A 4BSWB 1DVFC 4JM2B 1JNHA 1RU9L 2DMKA 1K8IA 3JV0A 4OLEA 4D2NA 3PGCA 2FWOB 4M48H 2WQ8A 1JGVL 3C2SA 4AENB 4R3SB 3TA3A 3ZKND 3T0XA 3U4AA 1BVKA 4Y89A 3X11A 4HH9B 1PVHA 3QUXA 4JO2L 1NC4B 4WDIA 4QGYA 1KBGH 4DVRL 4TRPL 2XWTA 1QHPA 1J86A 3HR6A 1T66C 1AE6H 3WNPA 5IESH 1HI6B 3OAYK 4YQXL 1BZQK 3BE1L 4AMKH 4Z7NF 3H7LA 1FBIH 5FKAA 4HGKC 1C7SA 5HPOA 2D7MA 1BHGA 1CDBA 1E4XH 3I6KA 2IPTL 1MHEA 5EU3A 3PHOB 4UOW1 4UNTA 3L5XH 2UY7A 4OF3A 2W9DH 2AGJL 2GKIA 4Q6IB 4RGNE 4XBEH 4E9LA 4MNHB 1T2QL 4WWKB 1OTTC 1E4KC 4R97C 4LEOB 4WTZA 5DJ6A 4Y19D 3V0VA 4EI5D 3O2DA 5EU4B 3EYUH 1OSPL 3A67L 4M03A 2FBJH 4NFCA 4JHWH 2R29H 4MDJB 3GJFK 5GGSB 4OBSA 3DX9B 1UM6L 1J8KA 5EDXA 1Q9LB 3T0EE 1P1ZB 4P4RA 4I48A 3VWJB 3TH4T 4PY8I 4FTVD 5H2BB 4OCLC 1MREL 3NZHL 1WZ1L 3MLXL 4NCDA 2X05A 3TN0C 2R1YA 1RUMH 4Z7QE 5E8OB 3B8SA 4AK1A 4NNXB 4HUVA 3KR3L 5FGCE 1UGNA 4XNUH 1T0NA 3ESVF 3L6FB 4MNGE 4OZIA 1MJ7L 3E8UL 1P4LB 1I9RH 6FABL 2J5LC 4QHMA 4P0DA 2AK4A 1G7LB 1FG2B 4PJXF 3KPRB 3T77A 3O9WD 5D70H 4NO3A 5C0DA 1PDKA 1ZA6B 4OLUH 4G6AD 1IEBA 4OZFH 1B4RA 4FNLL 2AXHA 2EDHA 1TJHL 3IDJA 2ERJB 1NAKH 2LVEA 4KRPD 3GMMB 1UWXH 3CFDB 4TNWK 3GHBH 2V6HA 3B5TA 4ZNEE 1TDQA 1MHCA 5JXAH 4OCYL 1ORQB 3GMLA 2ZWLT 3D0LA 4ZPTB 2UWEA 4JR9H 1CXKA 5EWIL 1YN6A 5HHQB 4IRSB 1CICD 3DMMD 4M6MH 1UJ3A 2VZOA 3LMJL 1H3TA 1BVLA 1OAXL 3RZCD 4ZTPH 3OKMB 5MP6L 1NJ9B 5JPMA 1HKLH 2JCCF 1B90A 3VFWB 4XTRC 2R23B 1NCCL 1HDMA 1HWGB 1D5BB 4XPGL 2AJ3B 3RL2B 1I7UA 5F1NB 4P5KB 4RNRB 2PTVA 4WFFE 4TTDC 3S4SG 5F9OL 4XCYA 3SE4A 1T1WA 3HAEH 1NCDL 5H37H 4JANB 1B4JH 4QXGH 4NKOB 1G6RL 5C0NC 2NY4B 4LLMB 2JJSA 4MA3A 4PP1C 4XPBL 4PTUB 4QTIH 4TSAL 5B21A 1X4XA 3RPIA 4YPJA 2P45B 3WKNA 2O5YL 5HY9B 2EIEA 5C70A 4HKZB 3WD5H 2B0SH 1HHGB 3S37L 2XQBH 4HULB 3IXAA 5T5NF 1IMHC 1M7IA 1EXUB 2VDMH 4Y7MA 4I77H 1GXEA 4PJBB 2XV6B 4MNQD 1PSKH 2W07A 1GGUA 5E8PA 2FIKA 1ZT4A 4CNIA 2HH0L 3QXAA 2BVTA 1T7VA 1DJSA 2ZUTA 3FFCE 1E27B 3L1OH 3OG6B 2AK1L 1IRAY 3ZLQC 4S0SD 4JCMA 3LIZL 2L4OA 3UJJL 4JFEA 3QFDA 4YDVA 1J1PL 1NMAH 4QWWD 3V6BR 4YHPB 1IGIL 3MLWL 4PJDE 3BGMB 1T5XB 3CSBA 1QFWH 5IW1A 5F44A 1IAIM 2A6KB 2AV1B 5GGTL 1FJ1A 3BDYH 4WO4C 3DVIA 1LO5A 5E4IA 5GGRB 4FABH 3C5ZC 4ACPA 4NKQB 5D1XA 3NCJH 3TPUB 4E41E 4GAGL 1TCRA 3LH2H 2DLHA 4C57C 4G8GA 4DGVH 3EIFA 3RBSA 2NZIA 1MCEA 2Z8RA 4UAOB 3QWQB 1FZJA 1A6ZB 3LKNA 2UVEA 4U0QB 1YN7A 2OL3A 2AEIT 4U49A 2QSVA 4YO0A 1IM9A 3K2UH 1NC2D 3WHXA 4YHNB 2IQ9L 1DBJL 1MWAB 1KPVA 3GDBA 4PJFA 2HRPL 3T0BA 1V3KA 4BZYA 1JFQH 2AJZA 4HJ0D 3HRPA 2R0WH 2H1PL 5GZOD 4LLUB 4ONFH 4HZLB 4BZ2L 3KG5A 5JIHA 4YZFE 1OT2A 4PRPB 3WJJC 1VERA 2X9YA 4J1UA 1FRGH 4O02H 5FM8A 4B50A 1RJZB 4TSCH 2XYCA 4JZOA 4JVUA 1TVBB 4F9PA 3QPXH 2GUOB 3VCLB 1LWRA 1ONQA 4I5BA 3QUYC 4IOIB 2WBJA 2P43B 1NCUA 3ARGA 4LSPH 5TGBA 4DFHA 1KIQB 1U8QA 5J0BA 2QHRH 2X1WL 1RIVH 3UYRH 5BW7A 3JXAA 1MCPL 2V2XB 3TYFA 5I18H 5EIQA 3CXHK 25C8H 1XF5A 5I8OL 5D1ZA 3WLWC 3EKCA 4OM1H 4MQSB 5CZVH 3EBAA 4BSVA 4NQCD 3FB7A 1MF2L 3PQYD 5TE4H 3IJHB 2J6EL 2EH7H 2R0LH 4JPVL 3MXVH 3FQUB 2X9XA 3O2WH 4MVBC 3ULUC 2BCKB 2XG5A 3V4VL 2ZPKL 5D93B 4X0KB 3B2UD 4XMPL 2C5DC 2J2ZA 3DXAE 2RFXA 1RK0A 3T3ME 2VH5H 1R3LB 1ZS8B 1U8LB 5DJYA 2VLJE 2DN7A 4V1DA 5J9PB 3P4OB 4YE4L 4L29A 1I3UA 2HVKA 4G42A 4QCIB 4CDHA 1G84A 5IW6A 1YEDA 3MLYH 2IBGA 2F74B 4JGUA 1LHZA 3DBXB 1R3HB 4ZODA 4NZRL 4JAMA 3IRZA 4PJ9D 3P3YA 1ES0A 4NQDD 5LCVH 1AC6A 5BV7B 2XWBA 4N5ED 1WBYB 1BFSA 3F7YB 3MREB 4XVUC 3JWOL 5GRVK 1T22A 3W0WD 1D9KB 3VI4E 3QO0B 4ODTH 3BI9X 1XCQB 1CIDA 3H3KA 3EOAA 1HSAB 4Q9QL 5DT1L 3FL7A 3UPRB 3K8MA 5SWZE 1R5VA 4NNYB 3RGVB 4ODWB 4X7FC 1JIBA 3BXNA 1Q9WA 1S7SB 3QWRD 4GRMB 1CXLA 1T03H 2P8LB 3IB4A 5L7XH 1S8DB 4UDTB 3VD5A 1N59B 2VXSH 4W6YB 2XXCB 4LK4A 3VD7A 3FO2A 1PBYA 2R9HD 3RA7H 4APQD 1A1MA 4OLWH 3TIDA 1PLGH 1XF3A 3SY0B 3UTSB 1EEYA 3H7BA 5EORL 3WUWA 2KZWA 4DVBB 5D5MA 2V17L 3EO1A 3UP1A 4ZFGH 3EYFB 2VSDA 1AY1H 4NKDB 3FHQA 4WW2A 5B38G 2GI7A 2CLZA 1KUMA 3MV8A 1H3VA 1CFQA 1WK0A 5DEFA 3G04B 4CU6A 3QI9B 4GUPA 2VL5B 1JP5A 3JTTA 2ICCA 2W59A 4I2XB 2C1OA 2AXFA 1X3DA 5ICZA 5C07D 2AXGB 5FA3B 2EDXA 1PJ9A 4XRCB 3TBSB 3UO1L 1DBBH 2D7OA 3BUYB 5BXFA 1FVCA 1U8KB 3MGOB 4HKBB 4R0LC 4FFWD 2NW3A 2H8PB 4FQPA 5C09D 2CRYA 4OCMC 2VDLH 5E8NB 4PV9B 3TT1L 5DQDH 1RHHA 1RMFH 3BX7C 4PR5B 4XBGB 3SKMA 3LKSA 4G9FA 1HXMA 4M7JH 1MJUL 2VR9A 2Z93B 5A16A 2QQLL 4LPUA 4NFDA 2IANE 5C0AB 3DUSA 1UXSA 2D7TL 3NCMA 4HXBL 5C6TL 2GW5A 3U79A 1F2QA 3EJZC 1JZ8A 1CZ8L 3HMXL 1JJUA 4PREB 1A2YA 1KIRA 2R2BB 4EVNB 5I74B 5E99L 3I50L 2B4CC 3O6LH 4KKAC 4P2RB 2OI9B 5IQ9B 3NVQA 1F00I 3SDXA 3VXSA 3SBWC 1NGXB 2X4UB 1DFBL 3SCMC 2UYLB 4WNQB 1CBVH 1ZLSH 3DX8B 1G9NL 2LAGB 3QAZB 4OD3H 2X70B 4GXVL 3SGKC 3ZKSD 1EBAA 1G9MH 3KYKL 4KKLC 3N1FC 2QQKH 4I8DA 1KCSL 3KXFE 1MI5E 1MVFA 4MXQC 1CGSH 2AJVL 5A3IC 3EO0B 5HGDA 1BAFH 2GT9B 2R0ZH 2YXFA 4JO3H 1EUUA 5HDBE 2VE6B 3VXUA 4JKWA 4OM0H 2MQCA 2PN5A 3PWPB 5DTFB 5GSRB 3TF7C 2V2WA 1WTLA 1V8HA 4B5EA 3REWB 4MA1B 1IEHA 2ZCLH 2XTJC 2QSCL 1JPGA 2DQTH 1IQWH 4NCC1 3R8BB 1TXKA 1W0YT 4G7YH 2FDBP 3QEQD 3BHBB 3U36B 3VFVA 3DV4A 4JDTL 3K1DA 3B5HA 1PKOA 1MUJB 2KH2B 3KYMA 4PGEA 1E6OH 4ZAKB 4L8DB 4UIMB 3O8XB 4GAFB 2X89A 4CADA 3TA3D 1MJJA 4KK8C 1FNAA 5IB3B 1PFCA 5C8JB 1CF8L 3QUXD 4MA8L 3DYPA 4OZFA 4R4ND 1FYTA 4PGBA 2AJYL 3IU4L 2OSLA 1EV2E 3LDBC 1IGFL 1MCOH 5D8JH 1DCLA 4OZIF 4N0FA 5F1OB 4Z7VE 5AUMA 4ZUTB 4JQVC 4OCRH 5F7LB 3T0EA 4KTYA 4NT6A 5FYKE 5LAXA 2YSSB 1H8NA 3O9WB 3TYGL 1T0MB 4OGYL 1LE5B 2BY3A 3QNZB 3HA0A 3QIWC 5L6YL 4Z7UB 1MEXL 3L7EB 4JPIB 1ZVSB 3UZEA 3FQNA 1B0GB 4LCYB 2EYSA 3VFGH 4JRYE 2NY2D 3U4BH 2DQUH 1ZGLB 3RVVD 4JN1H 3ZL4L 1TQCB 2DQFA 3V7AE 1PYWA 2UWEF 4XVJH 3HAEA 1CICB 3GZKA 3RKDC 4EXKA 1M71A 2BNQE 3SDYL 4CMHC 1X5AA 4UU9A 4LIQL 5E6IC 5GRUL 3VG9C 2J8UE 3FQRA 4FG6D 3TZVB 3E2HB 3PP4L 5MEPB 3N1QC 2J88L 3U2SA 1B2WH 5FYJE 4TYUA 1FH5L 2VUYA 1MCFA 2FJGB 4XC1H 5J56B 4LCCC 4KTEL 1EDQA 2L7UA 2K7PA 2V5SA 5B8CA 2Y7QA 3O81A 1I1CA 4JKMA 4MJIA 1C5DB 4G6FD 4XC3H 1OW0A 1QRNE 1T7ZA 4YBQC 4PUBH 5FYKH 4YHKH 5L9DL 4M7LT 1QBBA 2EXYC 4GRWH 5DJ0B 3HRZB 5C0BE 1WIOA 4QHNB 2AK4D 5CS7A 4LHUB 3UCRA 2DMCA 1OPGH 3U1SH 2AV7B 3H9SE 5ERWA 2WAHA 1WBXB 4LPXA 1QP1A 2DQGL 3WYRA 4WV1C 4UQ3B 2UZIL 5H37G 3C8HA 4Y0GA 1Q9KA 4X6EA 1JGLL 1IZKA 4KI5F 1P84K 3N50A 3ARXA 4HK3J 5JO5B 3HE7C 3RIFF 5BJTA 5HI5C 5CP7A 2GQHA 3V5KA 5KAQF 2G9HB 4G9DA 2Y5TA 3BUTA 4M8QB 5HHMD 5IIEB 1J0YA 4J6RH 3BPOB 4JB9H 4JKKA 4N1HB 1JYXA 5FYJH 2HKHL 4QY8B 1GGYA 2OQJA 4P99A 1WICA 2GY5A 5I19H 4LPYA 5I71B 4M4PA 1IC7H 2VXQL 2ORBL 5DMGC 3IDIB 1J0ZA 1CFSA 5EC1B 2DD8L 2DQCL 1OP5H 4CJ1A 5T33L 3D3VE 3BP6B 4O5LH 3WSQL 1V7NH 5DURD 5FCUH 3RTQD 3BOVA 3BD5A 4NQVB 3HE6A 2XA8H 3MOQA 3IT8D 3QIBB 4OD1H 4PJFF 3BO8A 3ZE2E 3K8KA 4LCWD 1KC5H 2ARJQ 3S88H 4JY4A 1N7MH 3EYSL 1AHWB 4LEXL 3F6IA 1GOGA 1WWCA 2I24N 3WN5A 1XIWB 2B5IC 4XVTH 3R8QA 2E9JA 1BM3H 4NN5C 4KI5D 4ODHH 1UZ6E 1H8SA 1A9BB 2QKIA 1KG0B 1K4CA 3HMWH 2DBLH 2YPLE 1MOEA 1MFNA 1SJHB 2BXZA 3VWKB 4RZCB 3BMVA 2OP4L 5HHXL 4JFED 1A7QL 1KFAL 2Y06H 4R90H 4UB0H 4MD5A 4K3EL 3KJ4C 2E7HA 3WE6B 4PGDB 3DRTB 5CUSL 1F11B 2IPUK 2FHBA 3W9DB 2GITB 5EBWB 5F7KC 3FN9A 5B4MC 5KS9A 3HPLB 4NQCB 2CKBH 2X4NB 2YK1L 4X6CA 4ODXA 4DN4H 5DK0B 1JPSL 3OKDA 4G8GD 1PW3A 1P5VA 2EDWA 2OJEB 4GW5B 3VGAC 1ZEAH 3L3KB 1HILA 1P53A 4UMGA 4MB5A 5J6GA 2ADGB 4OT1H 1ZGLM 3E6FB 1IM9D 3W5MA 3NGBC 4X5WB 2Y6SC 5ABDE 1QA9B 2R8SL 4HS6A 1NEZA 5CJ5A 1J05A 4L9LB 1TQBC 4NIKB 3U30C 4ZD3L 3BN3B 4HX1B 2B8OT 2B20A 1P6AB 5D7KE 1ZHNB 5LGJA 1FAIH 1G9MC 1V3LA 2FHCA 5BVJA 1DE4A 1CLZH 1MCDA 5J3HC 3VI3E 3D18A 4ZS6C 3EDJA 3OGOE 3W0WB 3C9NB 3IF1B 4IRZL 2WBJD 4HFUL 3CDYA 2H9GA 5E4EC 4M3JA 3ARGD 1IGCH 2BVQA 2A6DB 5HGBB 1B0RA 5CWSA 3BWAB 3VU2A 3D69A 4OFIA 2IBZY 4XP9H 1CXEA 3P9MB 3X14A 4OTXH 1T04A 4MCYB 1NCBH 2MKLC 4JJHA 4PGCA 1UQSA 3RX8A 5CFHA 3ARBA 5EZOL 2ADFH 4WTXA 2ADJB 4U2ZA 4NUJB 5C0FA 1A3LH 3SGEH 2XFXA 3C5JA 2GAZB 5AZEH 4D0DB 1S7VB 3MGTA 5ESAA 1CD0A 1J1OL 3O2DL 2VLKA 4L3CA 5CJXA 3GBNL 3B9KC 1J18A 3CFKA 3P4NB 1KYOJ 5FKPB 3LQMA 1GC1H 5B39G 4APQB 5F70A 4RAVB 4XPHL 1BQHB 3U6RB 1JWSA 4V1DD 5J7CC 5D5MF 4IS6A 1F6LL 1AXSA 1VGKB 2WMPA 3B2VH 4JZNA 1BX2B 2BDNL 4P9ML 3VFMB 5J13C 4XH2A 4WW2F 5DMJB 3BGFB 3PWNA 1UC6A 4FP8L 4KVNL 4WW1B 4FQXC 4JZJC 2HJLB 4HXAL 1YPZE 1OQXA 5KSAB 2QV2A 4UV7L 3PF2A 1EAJA 1KN2H 5IMMB 1Q0YL 4MJ4A 5C07B 1FO0H 2DLFH 4K7PY 1G7JB 4G5ZL 5E2WH 5FYLL 1KENH 5DUMH 4BQCA 5DMYA 1FP5A 2K9UA 4GS7B 3RWCA 3LN9A 4JDVA 4F2MB 3CUPA 4JM4L 3DPBA 3DURB 3UXFA 3A6BH 3V9FA 1PG7H 3QFJB 4UILH 1S7QA 2ADIA 2E7BA 2QADD 3RUGB 4PB0L 4H0GA 1NUGA 3BJ91 4QRSA 3RDTC 2GJZA 2W1NA 2R56L 1FLRH 3WCYA 1O7SA 2MTPA 1LO2H 4NJ9L 3H9HB 1FGVL 2OYPA 2UV3A 4KDWA 1HZHH 3QWOB 3MV7A 3GMOB 5C08E 4LSTL 4HKJB 1BVZA 2J8OA 1X5XA 3HI1A 5IK3B 1LDPL 4TPRH 4PV8A 3MNZA 3NN8B 3TBYB 5I1IL 4M8VA 3W2DL 1QR1A 4PP2B 4ELKA 4PJAE 4MDIB 3GUTA 3IKCB 1WWBX 4KROD 3SDXF 4AIXA 1RIUL 3GSNA 4M7KL 4PJIB 4P2OC 3CDCA 4JCLA 1S9XB 3MBEC 5M7QA 2IANA 2VDRL 4JVPA 3ZKXC 3MV8D 4OQTA 2CK2A 2Y5EA 4PJEF 4R26L 5A2IH 1UENA 2W0KA 1A1NA 5DJ2A 3C60A 5I8EA 2NXYB 5HYJB 3KAAA 3LEYH 1Z6JT 1ZVHA 2PYEA 4XNYL 4HBCH 3FFDB 3OKLB 5JPNB 1JWMB 2DL2A 3QUZB 1W8OA 3BN9D 1KB5H 4Y1AD 3WHE0 1OGAE 4P46D 4G9FD 3D0VA 1JNLL 1JGDA 2I07B 3PWVB 4GOSA 3QEQB 3U7WL 3T2PA 5AYUH 3VXOA 3BPNC 1ZLWK 4ALAL 3VW3L 5KOMC 2RJMA 1E6JH 2BNUA 3KXFA 1MI5A 4NRYA 4NJAH 5GS0D 2FLRT 4HCRL 2F19L 1QSFE 4BQ8A 2ZJSH 3B83A 4F8TA 4QT5B 2BVOA 1PX3A 1BIIB 3CNKA 1P7HL 5FF6B 3VXQA 1NGQL 4Y5YA 5T1LA 2V5RA 1A9EB 2OZ4A 3TNNA 1PY4A 3FAWA 4NSKA 3U46A 3QG6B 3AM8C 5DHYB 4OJFH 1E4XI 1QBAA 4WDIB 3R06B 3FOLA 1A3QA 3VXSD 4X4MA 4BUGA 3LS5H 3AREA 3CD4A 4HJGA 1N26A 2P5EE 3WL9B 3AAZB 4U3CA 3ALXA 4FQ2H 1YJDC 4LVHC 1OAZH 3GMQB 5F93C 4ZOAA 3C6LA 2VQTA 3G6DH 4K3GA 3C5SA 1JNNL 2CIIA 4MZ2A 3OQ3B 4Z7QF 5HJ3A 3CZJA 4ISVA 3MBXH 2CJUL 4DZ8A 4NZDA 3KLAA 5J4MA 2NY0D 3VXUD 4HQQH 3GM8A 1RJCA 2R69L 2AI0L 3EYVA 1MCRA 3QPQC 4S0TD 5IVZB 4HSQA 3OR6A 5DJZB 4ELME 4MJ5B 4B53A 5C0GA 4BZ1L 4HUKB 1TZHA 2EO9A 3QULA 4PLOB 3UTZA 1N5AA 2YMXL 3EFFA 1ZANL 1PX4A 4P4RB 1JN6A 3TGXA 4RIRB 4Z0BL 1MCSA 3WFHA 2Z4QB 2X89D 4RGND 3BMWA 4IRJC 1OB1A 5DQ9B 4CVXB 5CSBA 2MMXA 2FSEB 3MRJB 2IADB 5IB2A 1NFDE 2ENYA 4LASL 4LLYB 3VFUB 4O51B 3QDGE 4J3WA 1MVUA 2FB4L 3CH8A 4NM8L 3BZ4A 5D7IA 2NY1D 5JXED 4AM0B 1TVHA 2DLIA 4HHAA 1NANH 2EIDA 3FO0H 1LO0H 5AWNH 3T0ED 2J8UA 3BKJL 4HFWB 3ARWA 1FFQA 5F6HJ 5ILTL 4JG0H 2PR4H 3O0RH 3HN3A 4UOW0 2WUBL 5C0DB 2E7CA 4YNYA 3S4SB 1AD9B 5BZWA 1QYGL 2DQDH 5IMOA 3DX6A 1ZAGA 1N64H 1HHHA 1TETL 2YPKA 3HLAB 3IDJB 1DN0A 1IAOA 1QRNA 3QJHB 5C0EB 5TDNA 2R1XB 4PRHB 2DIJA 2VXUH 1CTOA 5IQ7L 1YMMB 5JNYA 4ERSH 4KZEL 2VL4A 1J5OL 4GW4A 3D0LB 4L4VE 5C0BA 3LQZB 3VGDA 1T21A 5K93A 4OLVH 2PYFA 3DECA 2IH1A 5D2LA 3OHXB 3MOAH 3EJJX 3VFPA 2BVPA 1RUAH 3MRPB 2H3NB 1ZLUH 3RVWD 5CHNB 3FB8A 2I60H 1W72A 3KYNB 2XA3A 1MFBH 1FGNL 1RZ8A 1Y6NR 3OXSB 3BIKA 4MJID 5DJ8A 2DIAA 4LVOB 4K23H 3RTQB 3NBNA 2ICEB 1RZJL 4KK5D 3BYYA 4H5SA 1IJ9A 4R97B 3T8XA 5HGHB 4HPOH 1KEGL 3O6FA 4HIEA 4UINL 1BFTA 2I25N 1JK8A 1F6AB 2DKUA 3CLEH 1N6QH 1FN4A 2A9NL 1KJMB 4UUJA 5F3BA 3K8LA 2Z8WC 1ZMYA 4LCWB 6CGTA 5I1KH 4ONOA 1C08A 3MFFA 1CLYH 2JTDA 4PJ7B 3SPVA 4X5XB 4CKVX 2EC9T 5I6XC 4F37F 4EN3A 2CK0L 1QFWI 5SWQA 4OUUA 4WFFD 4OZGA 1EHNA 2CKBA 2BRRH 3MLTB 3PWUB 1KPUB 1WAAE 3T2QA 1WWWX 3U9UB 1RJYB 3DIFB 1YC7A 2ZCKH 4EQ2A 4PJCE 1DVFA 1QVOB 5J1AB 3GIZH 4YDVB 1I7TA 4NGHL 5E6ZA 5GJSH 4FQLL 2V5TA 4J3TA 4QXTB 1VFOA 3QDAA 3OKKA 4BUHA 2J5LB 1L7TL 1M7DB 3IGAB 5DD5L 5KS9F 3QXVA 3BRFA 1AXTL 2VXTH 2IALB 1JHLL 3GBML 3FRUB 3QA3A 2HKFH 4X6CF 2YUXA 3UTPE 3I6LE 3KPMA 3CDFA 2VAJA 4JKPL 4XNXH 5CINL 4L8BB 3I02A 4RGMC 3TIEA 3DO7A 1XGQA 2ZOKA 4G8GB 4X7CC 1NBZA 3FFCD 4HT1L 4DEPC 2YPLA 1QSZA 2NZ9C 2NY3B 3HE6D 5EOCJ 1A7RL 2AJUL 4FA8A 2PXYC 3MRLB 4DKFL 1B6UA 1E28A 1S7WB 5E70A 2VABB 2JB6B 2FYYA 4YXKH 3QNYB 4K3JL 5DUPL 5L8KB 4MAYC 1QLRB 1I85C 2R1WA 4TUJA 1NEUA 5KG9A 4LVEA 5INDA 3S97C 3CSYA 2P49B 3JTSB 3L7FB 4LOUC 1MLBA 1JYNA 2W9LA 2FX9H 1UCTA 1LO3L 5C0CB 1VCAA 4F15C 5KVGL 1KT2A 4Z7WB 4D0BA 5I1AA 3TJHD 5IBTL 3KPNA 1QBLH 2BFVL 2FJFA 3TYFB 2VB5A 3NABH 2VLME 1QKZL 3AXLA 1EPFA 3LQAL 1NAMH 3TN0A 4WY7L 5FCSH 1AGFB 5HHOE 3IKKA 3TVMB 3BZEB 2B1AH 4LMQE 4NO5A 1Y6KR 4JFYA 1MQKL 2XZCL 1BD2E 1LILA 3VXPB 4QYOA 1LMKA 2XG4A 4AEHH 3L3IB 3VI4F 4KK6C 2A83A 2VISA 3O6ML 2VZ3A 4XVSH 1QQDB 1K2DB 1SYSA 4M00A 1RK0B 3TPKA 3FQWA 2A9MH 3PL6B 4RBPH 4GG6B 4MD0A 1WZMA 1BBDL 4A6YH 4ZQKA 3B43A 4L29B 1DSFH 3RAJL 3TH3T 1WT5C 2H32B 1JHKH 3RP1A 4H88H 1X7QB 2OXHA 4RWYH 1ZT7A 1R0AH 3NIFE 2A2QT 1A4KB 1KNOB 1NH6A 1YEJL 1UWEH 1FZMA 4XI5C 1VGEL 3X12B 4HGWA 1WC7A 1SBSH 3MRCA 1FNLA 3HZMA 2YWZA 2NXZD 1AJ7L 5B38B 4KZDL 1IVLA 1FPTL 3ULVE 1RZFL 4EJ1C 1N5YL 4LPCA 4KKNA 1A6UH 1R5WB 1VDGA 4BYHA 2OXGA 1MELA 5DHVH 1RUQH 2EDEA 4AIZA 3RNKA 2VOTA 1J8HA 1XR9A 2BMKA 2K7QA 3BQUC 3ROLA 2DJ4A 4IHOB 4AH2A 1YPZA 2XKUA 1EA9C 3V8CA 4KPHH 3ARBD 5I1CL 2OCFD 2AJXH 5TF1L 3ROOB 2IWGA 1DLFH 3MFGB 4RDQF 4U3XA 5EO9B 1FFNA 1F3DH 3GJFB 1A6TB 1OARL 4X6BB 2ZUWA 2WWMC 5EOTA 1A1MB 1FDLL 3ZYZA 4WCYL 2C3XA 1NBYA 1VFAA 4QRQB 2VDPH 3BISA 3CX5K 1OQOA 3MLRH 3QIUA 4X8JA 2DQJH 3QCUL 3CGTA 4M7ZC 4DN3L 4XGZB 5DD0H 4R4FH 4ORZC 3RNQA 5IEKB 4XXCC 2YUZA 1HHIA 5FDYA 1R5IA 3ULVH 5C2BL 1EO7A 3IXTB 5ID1A 2CD0A 3MROB 1CR9H 3HG1A 4L1DA 4P23A 3TNMB 3MR9A 1CK0H 4P3CH 5IMKB 5TE7H 3G5VB 3HUJB 5K9KB 3CFBA 4WO4A 4Y1AB 4I0PB 5CCKH 3M1BB 4KUZL 1DQMH 4P46B 2QR0A 3FONA 3C5ZA 3RWDA 3EOYG 5ANME 3IAPA 1IQDA 3LHPH 3DUSB 3T3PF 3O3DB 3OJDB 1GAFH 3DX7B 2IFFH 3OGCB 4XAWH 3S9DB 3CFCH 3V6ZB 4LBEA 2ESVB 5IB5A 3MV7D 1X5KA 5HDBF 3B8YA 3L5HA 3RWJB 2VQ1B 4BQ9A 5E9DB 3G5YB 5TDPB 1NLDH 1NL0L 3DROA 1U0QA 2HLFD 5IBUG 4LVNC 1S7TA 3F65A 5FGRA 5ALCH 4F33B 1D5ZA 4OIIH 4JLRB 4RAUB 2AABL 1WEJL 1YEIH 4MXWL 5ESVA 3WJJA 1ZA3A 2IAND 2DM3A 2L7JA 5FO9A 3CSPA 2NNAB 5E94A 5DMIH 3MTRA 3BVNA 2P24A 3CPLB 4Q6YA 3C60D 3F7QA 4BFGA 1GHFL 1Q38A 3QUYA 4OCWL 5EU6E 3V0WL 4EOWH 5HI4C 1QSFA 4JRXE 3EZ8A 3UDWA 1JRHH 3GRWA 5BRZA 1AIFA 2W60B 1MCIA 1GGBH 2VDNL 3GK8H 5HGDB 3FQTA 3R0MA 7CGTA 1INQA 2VUOA 5HDQH 3L5WB 4FFZL 4WEBH 1QPPA 1BZ9A 3MMEB 4MX7B 5IBLC 5I9QB 4MQXC 3WFCH 3UJTH 1YECL 1FFPB 1K6QL 3TESA 1BF8A 1LP9B 1K8DA 1RZIA 2X1QA 3IDNB 2ZUQB 4QXWA 3S35H 5B3NA 2DRUA 3R1GL 4XBPA 2QQQA 1MFAL 4PRDB 5FGBC 4M93C 4ZYKA 1KJ2H 2Y9RT 4QRPB 4TOYL 2RBLA 2Z8VC 3MLSL 3KXFD 1MI5D 2HAZA 3BEVB 4BK5A 3NCFB 1SY6A 1MFCL 1N6UA 1A21A 5KN5B 4UT9H 5T1LD 3M8OL 1A7BA 3BIAX 3IETB 1UA6L 4TSBL 1YQ2A 5D7SL 4Y4HB 5FYKU 5D71H 3IDMA 2OK0L 3CMOH 4L4TA 4BJLA 5D7IF 3TM6A 3KPSB 1P4IL 5IMLA 4RFNC 5J1SC 4UQ2B 4JFXB 3IU3A 1Z0NA 1SVCP 5EBMA 3ARED 1I1YA 3QO1A 2A77L 3BSZL 2J8UF 3T0EB 1U93B 2FEEI 3ZTNL 1JGVH 4PTTB 4A2LA 1UM4H 4FMKA 4MQTB 2QL1A 3C6LD 2H2PD 4HK0B 1JF1A 4KC3B 4ZFFA 4JO2H 5D6DC 4DVRH 4TRPH 4EDXB 3QDGA 3GMNB 3WFDL 4YQXH 3BE1H 1YEEL 3MLZH 4MNGB 1UH2A 2QSQA 1IGTA 1PYWB 3FO1A 2CSPA 4AYFA 3IDYC 4M9OA 2CMRH 2R2EB 5D2NE 2AXJA 3CLFL 5D2LF 4HAGA 1IKNC 4P57A 5EN2B 1HNFA 5ETUA 2AGJH 1EO8L 1F4WL 2YC1B 43CAB 1I1FA 1T2QH 4ZO8A 3A6OA 5DVMA 1AGBA 5EUOE 4QHLA 1PEWA 5ISZA 2JELH 3FZUC 4Y2OA 1I1AA 5ID0B 2YD6A 3QJFB 4Q7DA 1TFHA 4J3VA 3RKPA 1EFXA 3P77A 1OSPH 3A67H 2PF6A 3IJYA 3MACL 2NW2A 3VGBA 1MCJA 2BSTB 4KDTC 2OLDA 4L4VA 2BSED 2W65A 3MRKA 1Q72H 2FRGP 4M5ZL 2XTJB 2Z31B 5DFTA 3NZHH 4IIQB 2BSSB 1LNUA 1ZHBB 1OHQA 3P0YL 1BOGA 1ED3A 3T0WA 5C9KA 5KBNC 1Z5LB 4R0LA 3KR3H 5E1HB 1YYMH 3GKWL 2XTLA 5I76B 1KJ3H 3JV4B 1FQ9C 2BOBB 1HEZA 4U1SB 2HLAA 1CFBA 1T4KA 4OZGF 1QRND 4GRLA 1MJ7H 1FL5A 3E8UH 2ENSA 4PJGB 5F7EH 3SE3C 3GI8L 6FABH 4OCXH 5EU5A 2X44D 3P9WB 4JM2C 3QXTA 1ADQH 3V5KB 5JHLH 3H42L 3LEVL 4O58L 4NWTL 5C0BD 3S3SA 1JPTL 2CXGA 4P3DA 2M26A 5D72H 5JW5B 5EBLA 2A6JA 1OM3L 1G7QB 3OX8B 1GGIH 1F42A 3H9SD 3I6GB 4WI4A 1UM5L 5DR5L 1TJHH 3U83A 5E56A 3U7YH 3VMPA 3F7VB 5D7LB 3AGVA 3L3DA 1CFSB 4P9HL 1KN4L 5EO0A 4OCYH 1UZ6F 1I8LC 4JPWL 4MB3A 4LLQA 2D3VA 3SBWA 5EWIH 1WAAA 3SCMA 4LCUB 3FFCB 3LMJH 3WJLC 2XKNB 4ZS7H 1OAXH 3NZ8B 1SMOA 4RISL 4PJCA 3SGKA 3ALWA 3O6FD 1UZ8A 2BOCA 1MLCB 2DDQL 3LN5A 3K0WA 5F7UA 3OBAA 2E9WA 4G43A 3C08H 4PJDB 5DD6A 5HVGB 3QG7H 3SJVA 3GSRB 4Q6IC 4K9EL 1NCCH 3BO8B 3QQ3A 1LD9A 3QUKA 1FNEA 4JFOA 5CZXD 4WWKC 1I4FB 2VZUA 4MWFA 4XPGH 2AP2A 3GFUA 5EOQH 3FN0H 3B4NA 3D3VD 3G5XA 4E41B 1A4JA 5F9OH 5T3ZL 3WMSA 4EN3D 3IFOA 3WKMH 3WN5B 1AO7A 4KQ3L 3L95B 4RMVA 1G6RH 3UTTA 1FE8L 3ARYA 3PIQA 4HIIB 4XPBH 5CSGA 4KHXL 5F9WB 4EBQL 3GSNL 2DICA 4XMKL 3MODL 2O5YH 5HVWA 1U95B 4DTGL 3G08B 3MJ8A 3FRPA 5BZDA 4OQTL 2VLLA 5MENE 4O2FB 5D6CA 4BSJA 3RHWK 4PJ5A 1ZT1A 3BP4A 1EMTL 2FR4A 5IKCB 3F12A 4O9HL 1MSPA 1KGCD 4QRTA 2M2DA 3MRQB 3SOBL 2HJFB 4AT6B 3K7UA 4B0MM 3MRHA 1LO4L 1TTFA 3VI3F 4X4XB 1I7ZB 4YHZL 3MZTA 1T66D 3UJJH 1J1PH 1QLEL 2YPLD 1IGIH 3PJSA 4XP4L 4JQVA 4MQ7B 3MLWH 3FAXA 3OKYA 1L0QA 2DJSA 4O2CB 1SMAA 5DD1H 1CVRA 2Q6WA 4X83A 4K94L 2LU3A 4LKCA 1FL3B 3QIWA 1H3XA 5HHOA 2GCYA 4GAGH 3FCTA 2RGSA 1SJEA 5B39B 1BD2A 1OTTD 5J6HB 2LVCA 4RMSA 4KKBD 3INUL 1W0WA 4IRSC 1CQKA 2Y72A 4Y19E 5BVJB 5E2TH 1R3JA 3VFNB 3HI5L 5EIIB 2VIRB 1T1ZB 3DXAB 2DLTA 4BKLA 2IQ9H 3EDKA 1QEWB 2NXZB 3KPOB 2FO4B 3S6CA 2I9TA 2VLJB 2HRPH 5E6IA 1I9IL 2RQ8A 4NC1E 4ZXBC 1CDGA 1DQDH 3GMRA 2FH6A 2NY5C 1Q9OA 1CL7L 4BZ2H 2CLRB 4FMFA 2MQ3A 4WGWB 3QZWA 1U8PA 1F90H 3G5ZA 4FTVE 4NQXA 5CJOH 5KW9L 4X4ZA 3TN0D 3U0WL 1KTDA 4LCCA 1YPZF 1GRWA 5HVHB 4Q9CA 5D7KD 2P5WA 2EEDA 3C5JB 3IAGC 1MY7A 1QFWM 2H26A 3Q3GB 1MCPH 2VAAB 3WIIL 4B41A 4ZFOB 5I8OH 3T4YB 4Z7NE 2W0LA 4JFQB 2NY6B 4IS6B 1NMCB 5TH2B 4HH8A 5SWZB 3ZZ1A 1MF2H 3SKNB 2BVYA 4WV1A 4ZPVA 2J6EH 2PW2A 5T1DL 3LS4L 4Z78A 3M17A 1A8JH 4K8RL 3OAZH 4WFED 3V4VH 5FB8B 1JV5B 4QLRA 4XMPH 3HE7A 3NFNB 4E5XA 3LSOB 3BW9A 1NCAH 4CMMA 3VFOB 4YE4H 4KH2A 4C83A 3NA4A 3TBVA 4NKIL 5E5RB 1AQDA 3FQXA 5BQ7B 4YHLL 8FABA 5KANG 3D25B 5DFVD 4NZRH 5D1QC 4XTRD 4R2GC 1I75A 3GJEB 4WI2A 1AFVL 4PG9B 1OF2A 1J8HD 3GSWA 3AVEA 5ICXB 1P5UA 3OKEA 2DYPA 2ITDB 1LEIB 2ED9A 3RJQB 1NCWH 3JWOH 2AKRA 2YA2A 4TTDD 2DQHH 1B0WA 1IGYA 4S1RL 3U30B 5IOPB 2J12B 4M5YL 1UVQB 3EGSB 4WUKL 2R4RL 2ZUVA 4PP1D 4Q9QH 3QDMB 5DT1H 5L2KA 3KLSA 5JQHC 5KVFL 5DJAA 2X4OA 3V4UL 1T7WA 3STZB 2PTUA 4ZUUB 5F97E 3RVTC 4PJXE 5KSUB 1WFOA 4JEGB 3QIUD 3WDHA 2ZNXA 1RZJC 5F6IC 1FZKA 3FTGA 5F9AC 4U1KB 1T5WB 2FHFA 2M1KA 1VKXA 1EEZB 3S34H 2DAVA 4N0UE 1MHPL 1X5ZA 4YDJA 1FNSL 5I1GL 5DEGA 4HWBH 4YFLF 1Y0LA 4C58B 2EYTB 3MYJA 3C60B 5I8EB 5TE6L 4DKEL 1MJ8L 1LEKA 3SKJL 1HWHB 4P2CG 4TNVK 4OKVA 4V2BA 3C2AL 4KV5F 3MRRA 1UXWB 4HUNB 3ZYOA 5C08D 1UB6A 3T2OA 5HYIA 3HG1D 1MQ8A 1AGCA 4P23D 1DQTA 2IQAB 5IFJA 2OTUB 5E6YA 1TZIB 1S7XA 4WJ5B 1KSRA 3MLUH 1DN2A 1PY9A 4WO4D 2NTFB 3GSOB 2AEPL 5FHAL 1A3RL 2JCCE 3C5ZD 5JOPE 3BDXA 3BH9B 1N8ZA 1F4AA 1AR1D 5F9JA 4OI8A 5JORB 5D93C 4Z7OF 5F89A 1KV3A 5EULV 3ULUF 3NIGF 2IBZX 3UO1H 4ODSH 5IHZB 2W38A 2IAMD 4ZUWA 4EKXA 3B9AA 2GSIB 4JZJB 5I15L 4NRZB 2EZ0C 4KUCD 1KTLA 1QTYT 4AQ1B 2ZUXA 5T1LB 1P4BL 5I1EH 2X6MA 4TNWF 1MJUH 4F7EA 4YGAB 3TV3H 4DUXA 3V6FB 3RJDA 5GRJH 1D5MA 2P8PB 1F2XK 5BV7C 2D7TH 4HXBH 5C6TH 3GMPA 3KPQA 2YEZB 3AREB 3MOBL 5LVEA 3SDDA 5IF0A 4KAQH 1CZ8H 2NLJB 3HMXH 5KVDL 1F13A 2R2HB 3QUYD 3RX7A 1GZPB 4R7NB 3MZGB 1QSFD 1XR8B 1H15A 2Z9TA 2CIIB 2ITCA 5BRZD 4YFLI 1KXTB 3RGVC 1DFBH 4JG1L 2N1KA 3D48R 1HNGA 3CH1A 4OFKA 1G9NH 1NGWA 4JQIH 5E5UB 3LKOA 4WFHE 4D0CA 4GXVH 1A6AB 3P30H 1UB5B 3KYKH 4Z7VB 4AEIL 4X98B 3ILQD 3UTZB 3MBEB 5DSCA 4WHTB 4MVBD 4PB9L 2DQEL 4GRWB 1KPRB 5CEXB 3ULUD 1BMGA 3TO2B 4HC1L 3NCYP 2IMNA 3L5JA 2XRAL 3ELAT 1NANI 3KWWB 4PY7A 1HH6A 2Z35A 3VXMA 1S7UA 3CFEB 2MCG1 3GIVA 2R39A 1I3GL 4JRYB 4LF3A 2JB5L 4R9HA 4H25A 1K4DA 2QSCH 3WEXA 1I8MA 4KHTL 1NGYB 4OZHB 4L4TD 2K1MA 4JN2B 2EDFA 1F97A 4MJ2A 3QI9C 3GNML 3QEGL 3RWIA 4HUWB 1U8NA 3VXNB 4FQXA 5D2NA 4TQEL 1TVHB 2BNQB 4W6XB 4PG2C 1S7RA 4J3OC 4ONHA 4NQDE 5CILL 3KDMA 4M1DL 4LIQE 1ZTXL 3MA7A 5ACZB 5EUOA 1U91B 5DC4B 5BZWB 3QBTB 5JQ6H 3O3UN 1CF8H 5JUEL 1WCBB 1U8JA 4JDZA 4WHYG 4CRPA 3FO9A 1JPFB 1OSZB 5SX5K 2AJYH 3IU4H 3V95A 1FIGL 4YDLB 3QDGD 4R96B 4ODUB 2EYRB 4KJYB 1YEFH 4CBPA 5GS3A 4QOKE 3RDTA 5BS0A 3WNNA 3PHQA 1F8TL 3KPPA 3PDGA 2NX5A 3O41B 4NKMB 4OGYH 3QQ4B 5HHVL 2WBKA 3WO3B 4MS8D 1AKJA 2WIIA 3MLVL 2V2TA 5TPWL 2HN7A 1MCCA 5L6YH 1H0DB 5DJCB 1FV1B 1ORSB 4NYLB 3BH8A 4JFDB 4YBLB 3CVIL 1DEDA 2AQ2A 2QBWA 4Y16B 3H9SB 4OLYH 1ZHLB 4LVHB 5IVXE 2MNUA 3MJ9L 1QLFA 2OI9C 5I75C 5ISZD 4I9WD 4RFOL 1I1AD 3VXTA 3ZL4H 1DLHA 2APTA 3NH7L 3E6HA 4U1HA 1EFXD 2IH3B 3SO5A 3U7AA 1WAAF 1XGRA 4GAYA 4P2OA 4I4WB 3OB0H 2YD1A 2DLEA 5GPRA 3W9EB 1G6RA 4L4VD 3WXVH 5ADPL 4LIQH 4CN6A 4HUXB 1M05B 4NC0B 4HIEB 2GSGB 2VC2H 1JK8B 3PP4H 3ES6A 4K7FA 4LLAA 2J88H 1J0KA 4OGAD 1MIML 4U6XB 1RZGB 3RWFB 4YAQB 3IVKA 2RCSH 3CFIC 5DGRA 5I1JL 4G8EA 3D3VB 3VGFA 5HYQA 1RZ7H 2D31B 1P9MA 5L9DH 4JO4H 4GRLD 1JWUA 2QLVB 2APWA 2XN9E 2C3VA 2Q8AL 4OIBA 2XNAA 3D2UB 4D9LH 5GIRB 3MRFA 2XY1A 5K9OA 3HR5B 3O8XC 5IR1B 3T04D 2Z91A 4JO1L 3GSVB 1L9MA 2DQGH 4RMRA 1CDYA 5GGTA 2UZIH 1KJVB 2X4SA 3Q6GH 4LLDA 4BH8A 1DUYA 3Q5TA 1S3KH 3AC0A 5AZ2H 4PJGF 3VFTB 1KXQE 2ZZUT 4JJ5A 1YEGL 3HI6H 1G1CA 5IEHB 3AM8A 3QA3B 3D85B 1KIPB 2BC4B 2APBA 1WJ3A 3L3HB 1RUPH 5I30L 1PKQE 4HMCA 3SCMD 1FHGA 3DO7B 5CMAA 4K7PL 4QTHA 3O9WC 5FK9A 2HKHH 3B3IB 4PRIE 2IJ0C 2F54E 5MENA 3D5OF 5EA0L 1DDHA 2ICWJ 4HS8L 1E28B 2VXQH 4G6AC 1EHLL 2GK0B 2DD8H 2FX8H 2DQCH 5A3ID 3LN4A 1PZ5B 4NCC2 5IB1B 2J4WL 3GGWA 4XP1L 3CC5B 5CP3A 2ATPB 1NCNA 1T3FA 3I6LD 4QRUA 4OSUL 1TQCC 5INDB 5TJWK 4POZD 3RVUD 1FSKB 1UWGL 7FABL 1E4WH 1AO7D 3TFKD 4LSUL 3UTTD 1CICC 3DMMC 3BKYH 2V7HA 3OR7B 3SDAA 1UKQA 4M6OL 1TCMA 2YUWA 3E2HC 4OLXL 4WU7A 4X7SL 5MERB 1NSNL 4L8CB 3EYSH 4PJ5D 2XXMB 4G6ML 3MNVA 4UZGA 4XP6L 4RGOL 3AMLA 1UYWL 3F58H 4IRJA 3OJMB 3GRWL 2VNCA 4OF8A 4X9IA 4HWEL 1VESA 3GI9L 3EHBD 4H8WC 3U0TA 2F53B 3MPCA 3VJ6A 1CG9B 5FUZL 1JGEA 3ZYJA 5IFAL 3BZFA 4X6FA 5I6XB 3JVGC 2OP4H 5HHXH 4E0RA 2ZCHL 1A7QH 1KFAH 5IHLB 4K3EH 2C4FT 1FO0B 5C9JB 2ZUYA 4O2EB 3CVHB 5J8OA 3DV6A 1G7HA 1D6EB 2A74A 4Q2ZB 3JSSA 3DWTA 1DBMH 2PCPA 1T83C 4ZMAT 3Q6FA 4Z9KB 4DOHE 3FOMB 4WU5A 3QIWD 1VSCA 4U1LA 4S10A 2YK1H 4WI9A 1SY6L 1MNUH 5HHOD 4S2SA 3AY4A 2J8HA 1DBAH 1JPSH 4GJTB 1J10A 1BD2D 4G8IA 1S5HB 1KBGL 3VRIB 3CZFA 5DYOA 5LBSH 3BPOC 5IESL 3DI2B 4QWWC 4G8FB 3MRCB 2QHLA 1T89C 4X5LA 4ZUVA 2WNGA 2XACC 3EOTH 4BH7A 4N5UA 3RKDD 2HFGH 1FBIL 2CIKB 4N9GA 5E6ID 3VA2C 1NUNB 4DEPB 1JE6A 5I71C 2R8SH 4KJWC 3GB7A 2CUMA 1FZOB 4ZD3H 4P2QB 2PXYB 2OS7A 3G6JE 2W9DL 5FA4A 3MCLL 1EAPA 1DEEB 1F4YH 5EG6C 1OLLA 5IVNA 5FHBH 4QNPE 1DBKL 5GS1C 4YHIA 5EZJB 5JA8B 4R4BB 5CEYA 4IRZH 5AD0A 3EYUL 4HFUH 4L3EB 4W4OC 2F8OA 2R29L 1XF2B 3UJIL 1LGVA 2VRAA 4OZIE 3ULVD 5FYLE 3QUMA 3ARRA 4MSWB 4HJ0C 2G5BB 3LKRA 2GFBA 4LRNL 4FXKA 5AAMA 1AHWC 5GGSY 2AK4E 2BJMH 2ZSWA 5EZOH 5F1IB 4XX1G 3P9LB 5EOCL 1YNTA 1JUFA 4NUGH 2F8VA 1RUML 3T4AB 4MJ6B 1KB5B 4F3FA 4UV4H 3AU1A 4UTBL 2IPKB 1J1OH 4XNUL 4F7PB 3O2DH 1KEML 3MJGX 3RNQB 3GBNH 3REVB 2EH8H 2EO1A 3RWHA 4M62L 5IBUB 4BFBD 3HE7D 4NBXB 4FQQB 1TLKA 3MA9L 3BDBA 4XPHH 3WLBB 5C08B 3JWDH 2UWEE 2BDNH 4PJAB 4XPFL 3FT3A 4P5MA 5HVFB 5D9SB 5GSVB 3F5WB 4N8VA 4HXAH 4FXGA 3SKOB 1XZ0A 4OLUL 1D5XA 5I2IB 2APXA 4UV7H 4N0UA 1VHPA 2DYPD 5CIPA 1FORH 3GHBL 1AGDA 1IQDB 3B2UC 3N06B 5FYLH 2IAMB 4L8SC 4F58L 4H1LA 4Z95H 1IEAA 4NQEB 3HMXA 3V5HA 1U92A 2C7UA 3I9GH 1YUHA 3ZMRA 5IB5B 3LCYA 5DWUH 5L2KD 3OKOA 1F58L 4P9HC 5GISL 4JM4H 1R3IL 3QEHA 5CAYB 1S9VA 1INEH 3HFML 1HKLL 1YEHL 3MRIB 5FM5O 3BGAA 3STLA 1OGAB 4MAYA 1NDMA 4Z18A 1I85A 1U8IB 4PJ9C 3O3EA 1DUZA 4ONGH 4N5EC 3V6OC 4GMSH 2OR7A 5CLTA 1S9YB 4F7MA 5HYSG 1FGVH 12E8L 5E94B 2B4CL 2VDQL 4JHZA 5E8EB 3GSUA 1SEQL 1KCUH 1CT8B 3K46A 4HUUA 4LSTH 4U33A 1Q94B 4QXGL 1LDPH 4WRLA 4QHUA 3KPRE 3MJ6A 4C54A 1F3JB 4M7KH 3RI5K 5CKGA 5HI3D 4N0YL 3WD5L 5J12B 3ZT6A 2B0SL 1M6OA 1WWAX 2ICWB 3NTCL 1P2CA 4HV8B 4R26H 3T08A 2O5ZL 4ZOBA 3EYOB 2VWEC 1FVDA 2P5EB 4F57L 1TNMA 3MRDB 1PSKL 4ZDHA 2PTTA 4ZYKB 3GSQA 3DYMA 4M7ZB 4APQC 3L1OL 3ETBF 2HT3D 4JRXD 5LJYH 4HDIA 1OD7A 1MPAL 2OJZL 4XCNA 5EFIA 1ZKAA 1Z3GL 5IVOA 5ENWA 4NO0B 3ZDYE 4RRPA 1MCLA 1GOHA 4PRAA 2Q7NA 1I7RA 3BGFC 3WNMA 2Y6SD 2CH8A 4KTDH 4YIQA 1YYLL 1F3DJ 4ELMB 2G75A 5F88B 5KSAC 4TTGA 3DYOA 2VLRA 4Y2DA 3VW3H 3DRQB 1RFDL 3IU3B 4LHJB 4G80A 2VERN 4FQHA 3SDDD 4DGVL 2F19H 2LABA 2WM0A 1NFKA 4GXUM 5E0QA 5J11B 3LB6C 4FFWC 4S1QL 2YN3A 5EUOF 5I16A 1NLBL 1FC2D 5GRVL 4GS7C 1AGEB 5T5NG 3MYZA 5EU7C 3K2UL 4LLVA 1NFDB 1FL6B 1JFQL 3O11A 3E3QE 1T1XA 4NRXA 5F3HA 3BQUA 4JFHD 1K3IA 5KOVC 3ECBB 3MRGA 4DGYL 4RWHA 5GXBB 1FRGL 2VITA 1ODAA 1EGJL 5T5FL 4TSCL 2CR6A 2AEQH 1JNNH 3QPXL 1CD1B 3V8OA 5SWSE 5F7DA 3FT2A 3S3JA 2OL3H 2CJUH 3LEXB 43C9B 4W4NA 4LSPL 1HQRA 4EUPA 2EDLA 5C7XL 1BBJA 4DKAA 3X13B 5EC2B 1IBGL 2AI0H 3VXMD 3UYRL 2HMIC 4QRRA 3V5DA 1CE6B 3VH8G 4V1DE 2Q3ZA 4HS3A 2DWEB 2QEJA 3ARFA 4KWUA 2BSRB 4YK4B 3DUHA 3P73B 4QOKA 4GRWF 4OM1L 2X4RB 2YMXH 4NHCH 1ZANH 4GKZB 2NXYC 4FQXD 4Z6AT 5TE4L 4XXCA 4IDJL 3IFPA 4Z0BH 3MXVL 1C5BH 4LRIA 1HHJB 2C9AA 3I2CH 5IVXA 3LY6A 1ZLVH 4ZSOB 2P7TA 3H0TA 1G7IB 4FQ1H 5I17B 4ZO7A 4GBXA 3NFSL 2Q76A 3IS0X 1JHTA 1BFOB 4PRPE 1HIMH 4OV5B 4LKXB 1T1YA 3DUUB 2GTZA 3CDGA 4MD4A 2W0PA 4K2UL 1IL1A 3DETD 3BKJH 3RDTD 5LCVL 5BS0D 2ARJA 5ILTH 3F7RA 1HOCA 2NX5D 5IW3A 1IM3B 1AKJD 1VFBA 1SEBB 5J57B 4ODBD 4YPGB 1TETH 4BA8A 1NQBA 5I1DB 1EVTC 3QUXC 2NQCA 4R4NC 2MHAB 4Q9RH 4NPYA 1V7ML 3JV6A 4KZEH 3O45A 2P8MB 4MHHG 5D5ME 4P2OD 4KRNA 3VD4A 4KGJA 1NFIB 5LXGL 5IM7A 1S78D 3W11D 1Q0XL 3HC4L 2Q86A 4ZFZB 5J1TC 3RY5A 4BM7A 4BQ6A 3MUGB 4LQFH 5DF0A 3UYPA 3S96B 1BQHG 2G2RA 1CFNB 2H6PB 4OCSL 5JLZA 5DRZA 5L7XL 1UZ8B 1C5CL 5FXCH 3IDYB 1TJGL 1P7KA 1N3NA 4YEEA 2EDRA 1IGJA 4XXDA 3RQ3A 3VFSA 5JHDA 2NY2C 1CGUA 2ZOLA 1RY7B 3H9ZA 1P7QB 3RA7L 1PAMA 1FGNH 4QF1B 2VKWA 3FB5A 2YBRB 3MO1A 1NAMB 1HHKA 3U48A 4GG8A 3MCKA 3QXDA 2WINA 1PKQA 3LKPB 2EICA 3PABA 4C56B 1AY1L 4UINH 5LGKA 1FNGA 3BFOA 3VFRA 4PRIA 4G9FE 2F54A 5F7YC 2A9NH 4PFEA 3UBXA 4PJ8D 5DC9B 1KLGA 2VLLB 5AG8A 2EDBA 5BMFL 2JIXB 3ZHDA 2BERA 2F5AH 3JWNC 4IOSD 3C8KB 1BLNA 4A6YB