5L2KE

Crystal structure of gem42 tcr-cd1b-gmm complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
242
structure length
242
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSPRLAGDEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1b
publication title T cell receptor recognition of CD1b presenting a mycobacterial glycolipid.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l2kE02
2DLHA 4XGZA 5DUPL 2Y23A 2CD0A 2NY0B 1LO0L 4K3JH 2I9TB 1KENL 1I9JL 4UNVA 5GHWL 1D5MB 3P4NA 1X6LA 1REIA 5EU6D 1UB6A 1DBAH 2B0SL 3CFIC 3MRIA 5F93C 1R0AH 2VIRA 4XI5D 1SM3L 4APQB 2ICES 4DZBB 4DCQA 3EAKA 3QUML 4JQXC 3VXQA 3ARGC 2CUHA 4BZ1H 1CFNA 1HZHH 2VDOL 4L8BA 3RKPA 5IBLD 3IU3A 4P3DA 4XC3L 4KRPC 5DK3A 5DZOA 2AXGA 3LEYH 3CJJA 4K7PH 5CLTA 1AHWA 2HRPH 1KCLA 2ARJB 3IDIB 2WQRA 1XZ0A 5L7XL 3I3EA 5TPWL 4M1GH 2CLRA 3GHBL 3WLWC 1T1WB 5EFIA 1N2RB 4HFUH 1TITA 3D9AH 3D18B 1MUJB 1JI2A 4JZOA 2BVOB 1XR9B 1F8TH 1FHGA 4DVRH 3MA9L 4X6BB 1N7MH 5FYLH 1L7IL 1RZKC 3EYQC 4XPTL 3MLRL 4OCYH 1T03L 4N5UA 3W39A 4OQTA 4L8CA 1Q9KA 2CJUL 1KSRA 2YC1A 5DEFA 4HIIA 4Q7DA 4U1MB 3RVWC 1LE5A 5D71H 5ERWA 4ZMAT 4DN3H 4QRRE 3NGBC 3V4UL 2EDBA 1NGPH 2OJZL 4LGPB 5EZOH 3ULUC 1MCHA 2GSIA 3PHOB 3QNXA 2HLAB 4GAFB 4CL7A 2BOCB 2R23A 1ACYL 1JK8B 1MLCA 2R1XB 4ZAKD 3NIFE 1DUYA 4NBZB 3ARPA 5FYJD 3QUXA 4QHUA 4FQJL 4MA3B 4WW2C 3S37H 4UT9L 2MHAB 4OIBA 4EUPB 5DRWA 3OXSA 5FGBA 4HUVA 4Q2ZA 2NY4B 2P43B 2WINB 4NZRL 1CZ8L 5E2TH 4LHUG 4TUKH 3KPLB 4DEPC 1I4FA 4X4YB 1DQDL 2ITDB 3O3DB 2DYPD 5DFVD 4P46C 1NC4A 3VJ6B 5F9WC 1JHLL 2X4UA 3D0LA 4HLZG 4R0LC 2WWKO 4X0KB 1CFQB 1ZHBB 4D3CH 5I8OH 1AGDA 3HE6A 2FSEB 4LNVA 2QQNH 5TF1H 1UM5H 2P46B 3G6DL 5D8JH 5HYSB 2BNUA 4R3SA 5TQ0L 5FGRA 4NNXA 5DT1L 4IOIB 4V1DE 4NYLB 5F7EL 3IDXL 3LKQB 4G6AD 4DGIH 1E6JH 2L4OA 1SEBA 4DK3A 5B39G 2N7BA 2YXMA 3BZ4B 3HZVB 3QIUD 5T1DH 4PYHA 4YHLL 1NBVL 3WIFA 4Q97A 2QQQA 3OGCA 4M6OL 2Z8RA 4OQTH 4NM4L 4ZXBC 2ZNWA 1Y0LB 1CGWA 1WZ1H 4HUWB 1MCLA 3SDXE 2NY5L 3C60D 4LCCA 4BFIB 2VZVA 3RL1B 3GRWL 2A74A 3VFNB 1CDCA 2GK2A 1NEZB 4K9EH 3Q0HA 3CSYB 1CFVL 3LSOA 1A6AA 1PZ5A 4JFQB 4R90H 1MCCA 3SE8L 3BHBA 1ETZA 3ARYA 3IRZA 5H2BB 4GH7B 2HFFB 2Y25A 1SEQL 1HILB 4WI2A 5F7NC 3KYMB 1OHQA 2VQ1A 4HF5L 12E8L 1XGTA 1X6NA 3MV11 1XGPA 1W0WB 4PRDA 1AFVH 1S7VA 1MIEL 1EAJA 3BQUD 1WC7A 4YE4L 5IFHL 2P7TA 2EDOA 1A7RL 2NY1C 4QWWD 3GKWH 4Y2DA 4IRSB 2X4TA 4KI5F 4U0RC 1A6UH 3UJJH 1V3JA 3EO1A 4YZFE 4NQED 5C0BB 3FOLB 1OSPH 2UWEA 4GQPH 3I02A 3WNNA 1AKJB 1J87A 4UT7H 4IS6A 4AIXA 1N6VA 2FEDC 4F37F 4JFEE 3K4AA 5T1MA 1QFHA 3QHZH 3OKMB 4HIXL 4O2FB 4QEGA 2DQIH 3SE4A 1FFNB 2OTPA 3AB0C 3QH3A 4UT6H 5FUCE 4H1LB 3EJYD 3DX7B 3RNQB 3PWJA 3WFHA 3IFLL 4YHZL 2AK4A 3CU1A 2HAZA 4JFEB 2Z8WC 3VRIA 3TP4A 2NXYD 1J88A 1K4CA 5IMMA 3PP3K 5KSUA 4WV1A 1FE8H 5F7WC 2A6IB 4ZOCA 4BH7A 3GI8H 1ZANL 4ETYA 2XZZA 2O26U 4RFOL 2Z93A 1UT9A 1JYXA 32C2B 4JPVH 4TNWF 1QFPA 4JDZB 1IGJA 3AC0A 1G7IA 3STLB 1F3JA 1QRKA 2AEQH 2FZ3B 2BSRB 5TE7H 3IS1X 4MAYB 2WW8A 5EBLA 4Q9QL 4LSRH 4YX2H 5B4MC 2X70A 4OZHF 3WL9A 4J7RA 4QHKJ 1H3PL 5J11C 3Q5OA 5IV2A 4PJAA 1E4XI 2FGWL 1FL3A 4XMLH 1I1AD 4X9FA 2LAAA 1I7ZA 3PWLB 3QSKB 3IJYA 2C1OB 3WXWH 2MWCA 3MJGX 1IL1B 3VWKA 3CC5B 2VE6A 2XZQH 4WY7L 4OZIF 5J13B 4WEBL 5DWUL 5EU6E 1CD0A 4PJBB 3TV3H 5GZND 3P11H 4L3AA 4JY6B 5D7JA 3EJZD 4NQXB 1SYSB 1M05A 3H42H 4JKPH 4NC1C 4YQXL 4HS8L 1S9VB 3GJFA 4MJID 2D03L 1LILA 2HVJA 3GJFK 5AD0A 4M1DH 1LEKB 3QRGH 4RGOL 5A43C 2PCPB 4ELMB 3HMXL 3U36B 2KBGA 3SDXA 3LN5B 5I71C 1NL0L 3A6CH 5C86A 1DVFC 3V0WL 4KTYA 1BWWA 3L1OH 4PLKD 2VDKL 3MRPB 1KT2A 1AQKL 1M7XA 2AEIT 2AEPH 4K94L 2XZAL 3O6FA 4JFYB 4KHXH 4LPCA 5DTFB 5HHMB 3ZSSA 5BRZB 1HEZA 3ARBC 4JPIB 4U1JA 2BCKA 1BF8A 2VN7A 3DYMA 4M8VA 3PP3H 4S1QL 5F21B 3DUUA 2JCCB 3L3DB 3QPXH 4JM2F 5DQJA 3RWFA 1QQDB 4LSUL 3TO4A 1PW3A 1IQDA 2VC2L 3O8XA 3TVMB 4TUOB 2NLJB 1FO0L 2YRZA 4KI1A 2VTFA 1RURL 3QQNA 2VKWA 3ZT5A 2GJZB 5KVDL 5GIRB 1U9KA 1CICD 4EN3B 5ITFB 1N5YL 4X5XB 1S9WA 3DMMC 1FGNH 4FFVD 4WHDA 1JF5A 4GRLA 4M43L 5EO0B 3BRDA 1F2QA 2R39A 1JV5A 1P4LA 3SKNB 3U7YH 4QTIL 4JN2A 5FYJE 4XPBL 3VFVA 5IVZB 1PZUB 4JZJC 2FIKA 5GRZA 1CF8L 1A9BA 4LSDA 3O3EA 4KK8D 3E3QE 1BQLL 1R3LA 4P5KA 1KBGL 2OTUA 4NQDA 5EA0H 5TQ2L 2PF6A 3GUTB 1RUML 3ARQA 1RU9L 3GHEH 4G7VL 5EZIH 1A0QH 2ATPB 2QQLL 4ZAKB 3KYOA 5T1LB 4JN1L 1EERB 2A9MH 4PGDB 5CIPA 1F6LL 2ZUQC 3W9EA 4KJPC 4HEPG 5DS8A 4N9GA 4JHWL 5DD3L 1IC5L 1A7OL 4JG1H 5DRXB 1EPFA 4NQTA 4AL8H 3GJFH 4U1NB 3GSNL 5C6WH 4B7LA 1E4JA 3KPSA 1FDLH 3E2HC 2B4CC 4FQCH 4UOW0 4KVCH 3TH4T 4YDIL 3MLXH 2R69L 3TN0D 5F71A 1C16A 4N8CH 3U9PH 5EUKA 3D0VA 2DKUA 4RISL 3SKOB 4NWTH 4U1IA 2MTPA 4H0IA 4JM4L 4HH9A 4X9BA 3U2SB 3C8KB 3BWAB 5DGRA 3NCJL 5HHVL 3BW9A 1MF2L 1RFDH 5ESAA 5J57B 3S4SA 2A77H 1KPRB 3BGMB 3C5SA 2YA1A 3FQXB 3P0GB 3O4LD 5DJZB 2VDLL 1S8DA 2N7AA 2AJ3B 1FNEB 3OB8A 2I9LB 1BIIA 4M7LL 3M17B 2NTSP 2J6EA 1NMCB 2LQRA 3NBNA 3DUSB 5INDA 5IROA 4ZOBA 5E2WL 1G6RB 2Z0BA 4N0UB 3MOBL 3MODL 1HOCA 2LVEA 5C0CD 4I2XA 5IESH 3TJHD 3TA3D 5DZNA 4P9ML 3GSUB 3IDYB 3RGVD 3E1F1 4S1RL 3OR6B 4Y7MA 2Q1EA 2QR0A 1EJOH 1YNLL 1DUZA 4JAMB 1KGCD 1AY1H 3S5LB 2H41A 2R4SL 1G7HB 3NH7H 5GQBA 4ZUUB 4NO3B 3T1FB 1N6QL 4L4TD 2IAMD 4OGAD 5CIPH 4LPXA 2JJSA 1MFEL 1WVZA 4JO2L 2V2WB 4NQEE 3HRZB 1FV1A 2P1YA 4XX1G 2IFFL 2X9WA 2O5XH 3AS1A 3RL2B 2OI9C 2HMID 4N0YH 2XKNA 2HFEA 4G8FB 3A6OA 3INUL 3V6ZB 1A7PL 1YMHB 4AMKL 4NJAH 4WCYH 5DVNA 1AE6L 3REVA 2ESVA 2FNBA 5T3ZH 4KXZH 1JPTH 5BW7C 3NZHL 4WNQA 3QISA 4EJ1C 5DC9B 3MRCB 1EO8L 1FVEB 4K2UL 1ND0A 3QXTA 3DVIA 4FQHB 4N8VA 2GJ6D 3FFCA 5KVGH 3HAEB 4HAGA 2QV2A 1I3RA 5FV2A 4FMFA 4FQ2H 1CDIA 2AK1H 1CDUA 2CXGA 5C0ND 1GZPB 3ET9F 1OTTD 4Z7WA 5K9OB 3W5MA 2EKJA 4CN4A 3BN9D 4MAUH 2AJUL 4NN5C 3V5KB 1JNLL 2BRRH 1BM3L 2GSGB 2DYPA 1XF2A 2DQTL 1KJMA 4OF6A 1F4YH 3IKCB 4PP2B 2C26A 3GO1H 5IHZA 2VLKA 4WFED 4KPHH 2J6EH 1HHGA 3ARZA 3LZFL 5TDOB 3WFBL 5EU4A 5KW9L 4PRHB 1G7PA 5FM8A 1KNOB 3WO4C 1RJYB 1FZJB 5A3IC 1HXYB 3RNKA 3U4EA 5H37H 3VGAB 3OBAA 5IJVB 3UP1A 3ZO0A 5FOBB 2DBJA 3U1SL 3ULVL 5MEQB 4HD9A 3SDDA 5C0IA 4Y1AB 3T0EB 3QIUA 3OKDB 1JPST 1VFBA 5F7DB 1QR1B 4OFDA 5I1AB 1KCUH 2XWJA 4MJIE 3LEXB 4KWUA 3TPKA 4JE4B 4G6KH 5CSBA 3ZYOA 4LOUC 3RTQB 5CSZA 2CKNA 5DYOB 1FFOB 3RPIA 3QQ9C 2RFXA 4QRUA 3CFCH 2CH8A 3K46A 5I6XC 4HUUB 3L7FA 3WDHA 4M93B 1LD9A 3BDBA 4JFDA 5JHDD 2NY6C 4QOKA 1TVBA 4AQ1B 1RJZB 2PETA 5GGSY 4I0PB 3QDMB 4OCWH 3VRJB 2V5RA 4ODTH 3VD5A 4QRSB 4F7TB 4OM0H 3FQWB 2DQEH 5F1SA 1HIML 4RGMC 4UINH 2IMMA 5HI4C 2W59A 4UAOB 3FHQA 3OWEA 5DVLA 4LAJH 4ZUTB 1A1MA 5A16B 1YQVH 2EKSB 1YJDC 4XCFH 3Q5TA 2V2TB 3WV0A 4NQVA 2DQJH 1S7SB 3KNBB 3BQUA 3DGGA 3RWJA 3O2DA 1MH5B 4YHOH 4KROD 5CP7A 5HVHB 5DDHA 3TIDB 2L0DA 3L5XL 3DX6A 3CVHB 4C4KT 5AZ2H 3ROLA 2CSPA 4FA8A 1OCWL 4NQEA 4M03A 4KGLA 1IAOA 4LLAA 1CLYL 5D93C 3GIVB 3UTTD 3CU7A 5I1IH 4X4MA 3MRFB 1CTOA 3CFBB 5D7LB 5DRZB 4IDLA 2CMRL 2VDNH 1ES0B 4NOBA 3QWRA 4K55A 5IF0B 5JNYA 3FT4B 4JVWA 1KACB 5I18H 3MOAH 4FQXB 3W9DA 4F7EA 1OAKL 3SO5A 4LL9A 2AJXH 1PVHA 4FTVB 3D85B 4JHAH 3L6FA 2J8UE 1JNHA 2AJYH 5LWYH 4YEFA 4N8PA 5IG7B 3NCEB 2WBJA 3MXVL 3MO1B 3VGDA 4FQIH 1T7WA 1XR8A 3C8DA 1GZQA 5IB5B 3BIAX 4P23A 5IKCA 3VMOA 3LAFA 1KFAH 5GZOC 1PSKL 3JVGA 4HDIB 5FK9B 3VH8A 4OZFA 1W0VA 4BSWB 4M62H 2HFGL 1BVLB 3SCMC 2G5RA 4PB9H 4UQ3B 2NXZB 3EOAA 3GSRA 4KY1L 3CDYA 3CFJA 1NC2B 4NPYB 2F58L 4U1LB 3WFDL 4EI5B 1N59B 5L0QB 5AYQA 3HCVA 3TIEB 4IHOB 3RZCB 1I1AA 3BKJH 1PX4A 4OKVA 4G5ZH 1MCPL 1UXSB 4DVBA 1IC4H 2OYPA 1VGKA 4WW1B 1NJ9A 3MPCA 4YDJA 1T1XB 4OFKA 3JSSA 5JPMA 5L8LB 1F42A 3CZFB 1OAXL 1QSFD 2ICWA 3O4LE 1IGIH 5M95B 1CN4A 2VDMH 3RPKA 5F7UA 1NSNL 3O2DH 1PLGL 5CJ5A 4A6YB 1Y18A 4L4VA 1LEGB 4DOHE 1XGRB 1B3JA 5JDSA 1I1FB 1LEIB 2BMKA 4PG9A 4WI5A 1RUKL 4MXQC 5L2KD 5BXFB 4P4KC 1NDMA 2D9QB 1U3YA 3OG4B 2G5BA 5C0CE 4GQ9H 3EDDA 3HC0B 1RUAL 2Z8VC 5F7KC 3OR7A 3IJSB 2DF3A 3MV8D 4KKAD 1WFNA 2Z31A 1RI8A 2HJFA 1T4KA 4HWNA 2LU3A 1KGCE 5C7XL 3TT3L 4PD4K 4WGVB 1DBBL 1M6OB 4ZS7H 5HI5C 1DQQB 3RVUD 4M1CD 4L4TE 2E7MA 4G42A 4I18C 5C0CB 1T89A 2WZPD 3QNYB 1BQUA 1WIPA 3S3SA 2W0PA 5IW1A 3IF1A 3KPPB 2VAAB 1IT9H 1FAIL 2CRMA 1UACL 2APVA 1D5ZB 2FRGP 3EO0A 1A6ZA 3UTSB 4F7MA 4K9EC 1LNUB 5BV7C 5JW3L 1T6VN 4Z7QF 3ZT7A 3HZMB 3HI1B 1CICA 4OZFH 5DMGC 5JA9A 1LK3L 3FOMA 5HGHB 4GG8A 3G5YA 3QRFM 3QEHB 4Z7UA 2I07B 3MNVB 4XP5L 2BRQA 2XTJB 5FGBC 2GJ6E 1ITCA 3PWPB 1ZLUK 5GGVL 2D0HA 3DXAD 4M61B 4CVZB 5GGUA 4JO3H 2EDEA 1WEJL 4R96B 3FCTA 1A1OB 4IJ3C 4XP1L 1E4WL 3FB7A 3QO0B 3QEQD 1SY6A 3UMTA 3ZSTA 1CFBA 5LAXA 3BZFA 2GJ6B 3FO1A 4C56E 3LKRB 2G9HB 3O9WA 3T0WA 1EFXB 4MLSA 4IOFD 3FQNA 1NFKA 2QSVA 1AI1L 1ED3B 4WFEE 4UU9B 3ESUF 5HYQB 1QNZL 3TYFB 4AM0B 4LCWA 4C56B 3LKPB 4ETQA 5IOPA 2J12B 5ETUB 2Q76B 1CD9B 4PJCF 3T2NH 1T21B 4LKXA 4F33A 1FIGL 2LTQB 1JJUA 1KIQA 3VGFA 3NACH 3MYJB 1MCIA 1S7UB 4X5WA 4AENA 4LSTH 5DC0A 1NGXB 1QKZL 1MEXL 4Z77B 2GITA 4WDIB 1BBDL 2F5BH 3MRLA 4P4RA 2R29L 1E6OH 3Q1SL 4LSVH 5ADPH 1XAUA 3VXSD 4LCCC 4JR9L 1Q72H 1U8LB 1DQJB 3WLBA 1S7WA 2FJFA 3MROB 4Z5RA 2P48B 4JRXB 4XPGL 3QP3A 1CXFA 5JR1H 2WP3T 4GMSL 4I5BA 3FONA 1J8HD 4M7JH 5JHDE 1QFWL 4POZC 1IBGH 3NFNA 4HJGB 5JW5A 1V05A 3ME0A 3NFPA 1KLFA 2OMNA 2VXQH 3K1KC 3BP6B 5B3JE 3ARED 4NJ9H 3TA3A 1DN0A 3VFUB 3IGAB 1IGCL 2FLBT 2YKLH 4XCNB 1HQRB 1MPAH 1IAMA 1KG0B 4Y2DC 1C1EL 1MY5A 5ENWA 3THMH 4H25A 3QDHA 1HCFX 1KPUB 4I8DA 1J5OH 3Q6FB 2FYYA 4GW1A 4OUUA 4GRWB 1SY6H 1KLGA 3EYSH 3TPUB 2X89A 4XT1C 5EOTA 3VFGH 4L4TA 43C9B 2HVKB 5I30L 1AH1A 3QCTH 5H35B 2H3NB 4IRZH 5IFJA 3MLYH 2G2RA 4Z7VB 1IZKA 2GFBA 2HT4D 2ORBH 3UTTE 3UZQA 4YHPA 5I66A 1F3DJ 1U95A 2OR9L 1KOAA 4U1HB 4D9LH 2X4RA 1SBSH 4LBEB 3MRMB 3HC4H 5IBTL 4XPFH 1P5VA 4X6DA 4P57A 1CU4H 2XKSA 3QG7H 2OZ4L 1TTFA 4TVPL 1NLBL 3EFDL 4JB9L 1KIPA 3SJVB 3D3VA 1D6VH 1ZHKA 5E2VH 4UOW1 5EBWB 4JKWA 3EOYG 2Q6WA 2DOCA 3B5HA 1G9EA 2J4WH 1Z0MA 1ZTXL 3ZTNL 2X10A 3EKCA 1A6WL 4P5TA 2WLZA 4Y5XC 3QT2A 2RJMA 4RWYL 3WKNA 3T0BA 3RVVD 4PJIA 2OX5A 2PW1B 5D2LE 2ZSWB 4ZSOA 3TNMB 3MJ8B 3OF6D 3MGTB 1MVUA 1S78D 3ZLQC 3EOTL 1KCRL 4NRYA 3S36X 1T1YA 5T1KB 4M6NL 2GUOB 2GT9B 3ULUF 2EIZA 3PWNB 4OUOA 1IM9D 5D7JC 5IMOB 1AR1C 3DYOA 1T5XA 3J8F7 4KKBD 1QSFE 4NKDB 3NA9L 5B8CB 3LV3A 5DQ9B 4Y4HD 4LIQL 3MA7B 1K2DA 1X5LA 3CXDL 4FXKA 4JDVA 4WWKA 5BVJB 4X9IA 1VPOH 1EIBA 5L2KE 1YMMD 2ZZUT 4DQOL 1J1PL 1U6AH 1GOHA 4PJ9B 1OQOA 1KJ2A 4RZCA 3BJ91 3MV8E 1UM4H 5D70L 3DOSA 3QIWA 3BZEB 3O6FC 1A02N 4Z7OE 2P5WD 5FUOL 3UTQA 3PGCA 4ACPA 2F54D 1C7SA 2VAJA 1U8HB 5JHDA 5E4IA 4GG6A 4ZFGL 1YY9D 2EDFA 4PV8B 4XPAH 3FB6A 5EORH 5I8EA 3UJTH 4J8RB 4QCIB 2VL5A 1I3UA 2E7CA 3O8XC 1DTUA 5E08L 5I0ZA 5SX4I 3DROA 2GI7A 3V5HA 4MNHA 2NYYC 4RNRA 2VSCA 4MA1C 4GRLC 3T3PE 4ALAH 2AGJH 5C0AB 3BKCH 1E27A 1UB5B 3S35L 3LD8B 5CJXA 4HIEB 4O9HL 4HXAH 4OTXL 2NNAB 5DUBB 1NCDH 4F80A 3P73A 3N9GL 1JCKA 2E9WA 1ZHNA 1P2CB 5D9SB 5J1AA 3UTTA 5GGQH 1D7FA 3DXAE 5CEXB 1YEDA 3HPLA 3L3IB 1Q9OA 3ECBA 5FUCC 3CFKA 3F65A 2BFVH 4YAQA 1D9KB 4HKXA 3W11C 4DUVA 3QEQE 4HJJH 2CXKA 5E7FA 4U1GB 3HE7A 5E6ZA 1L0QA 1BVKB 4PLOB 4H8WL 5EOQL 5KVMC 3PDGA 1F45A 1HHJB 1JTPA 4DW2L 5DQDH 4EBQL 3ARFB 3H9SB 1G84A 2B5IB 1ZSDB 2IEPA 4R9HA 2DQUH 3OKNA 3QEQB 4NBXB 2N1KA 5JXAH 3KLHD 1CFSA 4J4PD 3QJHA 4Y5VB 1A14L 2XPGB 1KJ3L 4OLVL 5IB2A 3WNLA 2GY5A 3BPCB 3N0PB 4ZPVA 1LE9B 1KJ2H 4GMTL 1J7VR 2QADD 4TOYH 1VADA 3QIBD 1XGYL 2XWBB 2ED7A 1YYML 5E2UH 3HC3H 2Z91B 5EU5A 2IBZX 5D2LA 3P2TA 1N64H 5HYJD 4HWBL 4QT5B 1FL5B 3FT2B 1QRND 3PQYA 1FYTA 3CDGA 5CEYA 1VSCA 3SOBH 4BSVB 3VXSE 5FM5M 5TDPA 4MCYA 5KS9F 1CGYA 4HKJA 5D7IA 4MQ7B 5FF6A 4XI5C 3ARVA 4WI4A 2EXWC 1U3HB 4K3GA 1U8MA 1LO5B 2H6PA 4G8EB 5IBLC 5E1HB 5HJ3B 1J8HE 3QFJB 2JLLA 1NCCL 5IROC 2XXCB 2AXJA 4DZ8B 2BNRA 1JHTB 1S5HA 3EOBA 3UTZB 4WHCA 1P6FA 4F58H 2R2CA 4RFNB 4S1SL 4R26H 3KYNB 4W68A 1WF5A 3DWTA 1Z2KA 3C09C 3UPRA 2NX5B 5AG8A 2R2HB 3S4SG 1F2XK 1BP3B 5F3HA 4F57L 1F6FB 3ZKXC 1DEEA 1PAMA 1I9IL 3CPLA 4P2QD 4KJQC 1U92A 4HK3N 5DA0B 1U3ZA 4PJ5A 4UDUA 4E42A 1G1CA 2JJSC 3UC0H 1HSAA 3MLTA 4XPHH 3HNVL 1TNMA 4EIGB 1FN4A 1OGAA 1QFWI 2IANB 5CZXD 3O6ML 3GB7B 3LEYL 3QQ4B 1XF4A 4YK4C 2HRPL 5ECJE 5H37G 1RUPH 4YXLL 3FN0L 5IM7B 1C7TA 4OZHB 4JVUA 3QDJD 1H0DB 1F8TL 4APQA 4DVRL 4U6VH 4LDEB 3QUZB 5FYLL 4OCYL 1P69B 4RAUB 5KOVC 2KL6A 1JGVL 2ZOLA 2A6KB 3E3QC 4TTGA 4OZIB 5GJTL 4J3OC 3B2VH 3IDIA 3TBWA 3AXLB 2F53D 5JW4Q 4KMLB 1T1WA 1CGSL 3D25B 3V6FB 5DFVC 1AGCB 1MUJA 3CX5J 2BVOA 1XR9A 3IXTB 1J10A 4MMXC 4X6BA 1F90L 4H26A 3NABL 4LLQB 4RRPA 4ZNCD 4N8VG 3KPMB 4ONGL 3S37L 1OLZA 1DBML 5GISH 4WO4A 1T3FB 4U1MA 5IVXF 4NZTH 3K4DA 4KMTH 3V4PH 4GW4B 4RQQA 4M48L 2R2EA 2F15A 3VFSA 5L2JB 1MRDH 5CKAA 5HDQH 2AV1B 4OJFL 3PHOA 1R3KB 4HK0B 4G6AC 1IGMH 2HLAA 2BOCA 2VLMD 1JK8A 2BERA 1TDQA 4JM2B 1LP9E 4XWGH 1MCKA 3C5JA 3QIUC 2Y9RT 1WITA 5T33H 4OLXL 2QSCH 4Z78A 1CT8B 4MA3A 1KLUB 5JIPA 1HH9B 2MHAA 3TJEH 2IQ9H 2QQNL 5DVOA 4EUPA 1KF9B 5D8JL 2IQAB 1IM9B 1TPXC 2BSTB 3GIZL 2HFTA 2WINA 3C60C 4GJTB 1YMME 1LP9B 1JGEA 3UZVB 5ESVB 5SV3A 3KPLA 2E7LC 4QY8A 1IQWH 4X4YA 2ITDA 1E6JL 4JFFB 4XCYB 3ZYIA 4IBLT 3PHQB 5LVEA 5EIIB 2P5WE 4XB7A 4BQ9A 5I73B 4KQ4H 5HI3D 1N5AB 4QHNB 5FXCH 2F54E 3OGOE 4X0KA 2Y5TA 2O5YH 1NDGB 2EO9A 1ZHBA 1TJIL 2JJTA 3WJLC 4LNRB 4OQTL 4YHIB 5AUMB 2FSEA 2BNQB 4ENEC 2BVQB 1Q94B 5E8DL 1ZVSA 5TH2B 3S34H 1RUQL 1X44A 5HYSA 1U8NB 5ISZD 3BQUC 4H20H 1INDH 4QWWC 4NGHL 3RWGB 4YDLB 3WIIL 1NUDA 2CRZA 1JN6A 1R5WA 1QP1A 3CMOL 4WHTB 5J0BA 4HIHB 3B43A 3S36H 4YIQB 3HZVA 4R90L 1C8PA 4YDKH 5DMKA 2D4DA 5EUOF 4X8JA 4X8XA 2OTWB 5ICYB 4NCC2 3DSFH 4U31A 1Y0LA 4CMMA 3SDAB 4HUWA 5DVKA 3BSZH 4BFIA 2IH1A 3EJYC 5IW6A 2XXMB 3RL1A 2DKMA 3VFNA 1A64A 4HCRH 2A0LD 1RAMA 1A7NH 3WCYA 1G9MH 1NEZA 4KKNA 1A6UL 4LCYB 3MLZH 1NMAL 4R7NB 3CSYA 1JGDA 3L3JB 3QA3B 2CDGA 4OBSA 1A2YB 1MOEA 2D7TL 5D6CB 1D6EA 2BHYA 4JFQA 4P0DA 4UT7L 5ALBL 3I6GB 4LAQH 5GGTL 5H2BA 4IDJH 2WK2A 3LS4H 4LLMB 4JGJA 1HILA 1FGVH 1ZHLA 1KXTB 3JVGC 5HHXH 2ARJQ 1NBZB 2PXYD 4EUPH 1W0WA 3BESR 1J0HA 2P8MA 4UV4L 1FLRL 4Y0GA 4Z6AT 1BD2B 3V7AE 4PREA 4NKMA 4ODVH 4IRSA 3U6RB 3O41A 1E28A 1OT1A 4RAHA 5HSFA 5D6DC 4KK5D 4LKCB 1KTLB 4QNPE 3WKML 1I1AC 2DQHL 5IIEB 4AEIL 1AKJA 3IDGB 5HYJE 4K8RH 1MAKA 4YBLB 3OF6A 1QRNE 1EGJA 1BLNB 4O2FA 5IBUB 3W5NA 2AEQL 3VH8G 4OZFG 4J1UB 5TE7L 1VCAA 3LEVH 1JPGB 4CDHA 3QIBB 5C0RH 5GZNC 4H1LA 3RNQA 4ZD3H 3EJZC 3I3DA 4L4JA 5C3LD 5LQBH 1OWWA 4KTEH 1O7SA 1OSZA 5IB4A 2A6IA 5JOPD 1VESA 5IT2H 2VR4A 1Q9LB 2B7DT 4FZ8L 4IIQB 32C2A 2FHCA 4JDZA 3WXWL 4LGRB 2UY7A 1YMMA 2APFA 3STLA 1DFBH 3ZE1F 4MD5B 2Z31C 5I8CA 1OQXA 3P4LA 3D39D 4PLKC 1JTOA 4P2QE 5FO9B 4NZJA 3LPGA 4TNVK 1KTKE 5E4EB 2CIKB 2OSLB 4X9HA 1MFCH 1T89C 3ROOA 3DVNA 3FRUA 3BH8B 5I1EH 3U4BH 4ELKB 1Q0XH 4Z0XB 4HPOH 3RWHB 3R0MA 4F7CB 5HPMB 5EIVA 3ZE0E 4EVNB 3A6CL 5C8JA 3G6JE 2GYSA 4HEME 1IL1A 2H2PC 3CC5A 3QDGD 4YDVB 1LO4H 1ZA3B 1CICC 1RSFA 1TZIB 3QDJE 2X9XA 2LU7A 4FFVC 2OP4L 1GVIA 2QSTA 1KIRB 4C54A 1NGZB 2ZOKA 5DMYA 1O5DT 3VI4F 1I75A 2XFXB 1S9VA 3AVEA 4X83A 1E4XH 4MS8D 4KK8C 5HGBB 1G0DA 1LEKA 4HMEA 1V7MH 3M45A 4A2MA 4ELMA 2K3TA 3H8NA 4OD2A 4OF7A 3R1GH 1EGJH 2F53E 1K9TA 3T2PA 1ZEAL 5JPNB 2ILLA 2BXYA 4CAGA 3QWOA 5K9JL 3REWA 1JGLH 4WUUB 3MRPA 3LOWA 5C08D 4H1LH 1ZGLM 3BYYA 5E9DB 2YPLB 3MRRB 4AG4H 5FO8B 4CRPA 2JCCA 3VFOB 4LF3B 1OM3H 2WUBH 2CLZB 1G7LB 2NZ9D 3LKNB 5KSAD 5DUPH 3V0VB 1GC1C 4TUOA 1AC0A 1LO0H 5E6ID 4M6MH 1R3JB 5GJSH 1KENH 1A0QL 5GHWH 1DP0A 2GJZA 1A3RL 5GIRA 3TBYA 2B0SH 4NKQB 2A9ML 4QHMA 2HLFC 3OQ3B 4Z76A 3TN0C 3GSVB 2VLME 7FABL 4TUJB 2QHRL 3PIQB 3BD3A 1QOKA 3ALXA 1VEOA 3SKNA 2F8VA 3CIQA 43CAA 3IFNH 3MX0A 4S11A 5HYJA 3VXUB 3MJ9L 4JY4A 2F19L 4XRCA 4AL8L 3SDYL 1QRNA 2VXVL 3MQIA 4YHYB 2XY1A 1H8OA 5DJDB 1A6TB 1D5IL 3UJIL 2DMKA 3DV6A 4OGZA 5L7XH 5HVGB 5E8NB 1D5BB 5JLZA 5TPWH 1FDLL 4BH8A 2V7NA 3GHBH 4OD3H 4OCRL 1I8KB 2ATPA 3BWUC 1HXMB 2C3XA 4FQCL 3ULVD 4KUZL 3MLXL 5DXWA 2WP3O 3I6KB 1DANU 3CXHJ 4Y4FD 4P2RB 3MA9H 4QXTA 3MV9B 1QPPA 1RV6X 1L7IH 2A83B 1T03H 4XPTH 3MLRH 3MRDB 1EHLH 2XRAL 4BQ8A 4CBPA 1Z5LA 2HP4A 3ES6B 3SPVA 5DRXA 2CJUH 4KRPD 3UTOA 3TJHC 3TA3C 3RGVC 4U1NA 1JNNL 4IRJD 3V4UH 2A77L 2OJZH 3GRWA 5ISZE 3C5ZB 4P2QA 2W38A 2AEWA 4R4BB 1FVCB 1T0MB 2P5EB 5I75B 3MNWA 3ILPB 4OGAC 1ACYH 1VFOA 4Y4KD 1WAAF 3SO3C 3SKOA 4D0DB 1OP5K 2R0ZL 2YPVL 4UT9H 2HMIC 4HK3J 3T2QA 4QO1A 3BWAA 5TDNA 3SGDH 4F9LA 2X7LB 3HUJE 4NZRH 1CZ8H 3T3ME 4B7IA 3HN3A 2VYRE 1BPVA 3EDKA 3ARSA 1DANT 1AY1L 2JELL 4MSWB 3T1WA 3TT1L 4BKLB 3EW3B 5LJYH 2I9LA 1JUFB 1KYOJ 1JHLH 1I7UA 4K3HA 4WHYH 3X13B 5EOCL 3NA4A 2W0FA 4AJ0A 4J3XA 1G6RA 4N0UA 3OKLB 2JK5B 4AIOA 5C0NC 1A8JH 5F89B 3T65B 1OTTC 3GSUA 3U7WL 1WCBA 1II4E 3OR6A 3ARDA 5LXGH 1I85C 3BN9C 2NQCA 4WCYL 5DT1H 5T3ZL 1JPTL 1CXLA 1FP5A 2ZUVA 5IVNA 4M5ZH 4MNGE 3FMGL 5F7EH 1G7HA 1J11A 3IDXH 2ID5A 4ZUUA 3QUKB 3T1FA 2DIAA 2Y36L 3RAJL 2J5LC 4YHLH 2V2WA 1NBVH 4RX4A 4KK9D 3K81A 4M6OH 2Z4QA 2VXTL 2DIJA 2XG4A 3DJ9A 4CVWA 4OF0A 3MREA 1WTGT 2BY1A 3ULUL 4NM4H 5DUML 2EE3A 4G8FA 3P9LA 2NY5H 4MAUL 1YMHA 5FHAH 3VGEA 3FTGA 3QXDB 2BRRL 3AFLA 4UMGA 4Z7QE 3RX5A 3GRWH 2DBLH 2D2OA 1WLHA 1F4YL 1ZLSH 3VFRB 3MRCA 4OSUL 3NZ8B 5I1CH 4V2CB 4W6XB 1MWAL 3SE8H 5JOPE 4G6JL 5HDBE 1KV3A 1FAKT 1OP5H 2L7JA 4ISVB 2VZSA 3X3GL 4HF5H 4ZXBD 1QO3B 5K9OA 3RWCA 4PJGF 3TO2A 1RVFL 4PTTA 1MIEH 2FJHB 3EYOB 5IFHH 4YE4H 3D39E 1A7RH 3BN3B 5MEND 4BA8A 3VG9B 3IKCA 4HX1B 2Z8SA 3VDBA 4NQCD 1UJTA 3S9DB 1KCUL 4G6KL 3KHOA 5TDOA 5C07B 4RMQA 4PRHA 1CLOH 1G6RH 3O3BB 3OL2A 3WNOA 1EV2E 1FZJA 4HIXH 1HXYA 1SHMA 3AS2A 4QXGL 3QDGE 2YRLA 1JWUB 3L95B 1UZ6F 1B9ZA 4KROC 3L5HA 5IJVA 2X4SB 4JO1H 5CJXC 3IFLH 4YHZH 3BP7B 3ELAT 1SVCP 4K23L 1FNFA 3G08B 3NIDE 4Y1AA 3PV6A 3T0EA 4RGNB 3OKDA 3V95A 4RMVA 4UINL 5F7DA 2FL5B 3V6OE 1QR1A 5EN2A 5I1JH 1YUHA 1ZANH 3SDCB 4ONHA 3RTQA 1FO0A 5FECB 3HUJA 1VKXB 5I19H 1FFOA 1MNUL 5E24E 3P30L 1HSBB 1F3DH 4OZ4B 2WANA 1PYWA 4FQPA 4HUUA 4OZGE 3AS0A 4AH2B 1UKSA 2OQJB 4CJ0A 5GS1B 4Q9QH 2I24N 4PRIA 5I1DA 1AGFA 5C08E 1RJZA 3W81A 5FDYA 4WU7B 3QDMA 1UFUA 1URLA 2EIBA 1J1XL 3QZWB 4UUJB 3MR9A 3FQWA 5I1IL 5KSVB 4Y5YB 4OZGB 1CCZA 4N9OB 3MBEB 2VDNL 4ZUTA 4MXWL 5FM4A 5C08B 2PXYA 1CD1B 3WXVL 4NDMA 4OM1L 4WY7H 2P44B 3G04B 3KNBA 3VI3F 2HH0H 4LRIA 4OCNC 5K33A 3QWQB 1TZHB 3KG5A 1MH5A 3M1BB 4I77L 4YFDB 4HG4J 2AJXL 3RWEA 3TIDA 2B20A 3MRNB 4C83B 4JHAL 3IAPA 4YQXH 2AJYL 4HS8H 1I9RL 1UC6A 5LWYL 4XNMA 3VFTB 2B2XL 3HNTL 2D03H 3GSNA 4CJ1A 3KGRA 3MRFA 2VLLB 5D7LA 5DRZA 2VLJD 4YC2B 1ES0A 1NL0H 4JZNB 3FT4A 3C6LB 2P42B 2ZCKH 3H9HB 3V0WH 3ULVE 1PD6A 2VDKH 4K94H 2XZAH 3NIFF 1A7QL 3VXRB 4RMRA 3WN5B 4HULB 4MDJB 1KTDB 1IGFL 1S9XA 4FTVA 4UDTA 1ZA6A 2BDNL 3BE1H 4G8GB 3GMRB 3KAAA 2H45A 5CZKA 3BKJL 3STZB 4G5ZL 3VMNA 3MO1A 4XVJH 5FV1L 4NCC1 4LSUH 4YUEH 3RHWF 3UPCA 2PW2B 5CUSL 2NTFA 5IB5A 2V9TA 3OAYK 4HDIA 1FO0H 4KKAC 3TZVB 3ARGB 3L3KB 1AD0B 5GPRA 2EEAA 3P3YA 4RIRB 4ZTPH 5KVDH 1DVFD 4F9PA 3V0AC 1BVLA 5KTEH 1GHFL 3SGJA 1C08B 4MD4B 3RVUC 4M1CC 3BPLC 4KRPB 5I17B 4JCMA 4QRPB 3MRKB 4LFHD 1NC2A 4NPYA 3TNNB 4EI5A 1N59A 2R1WB 3MLSL 2VABB 2R1YA 4QTIH 1RZFH 4XPBH 1AGBB 3RZCA 1DBKL 1Q9WB 1U2CA 3LQAC 1XIWD 1CF8H 4Z95L 5BZDB 1BQLH 1KBGH 4WW1A 3SE9L 3K2UH 1RU9H 1T1XA 1P6AB 4G7VH 1UQSA 4FMKA 4PBVC 3SGKA 1C5DB 4OI8A 4JN1H 3CZFA 1MCQA 2Q87A 1EEQA 2K7PA 3PV7A 1VFUA 4A6YA 1IEBB 1LEGA 2A1WL 4JHWH 5DD3H 3V6OA 1CR9L 1IC5H 1A7OH 3NGBB 4LHUB 1I1FA 1LEIA 3WMSA 1IT9L 4LLUB 5BXFA 1ZKAA 3HNSH 3SDXF 3GSNH 1IGTA 5CINL 3T4AB 1FG2B 5H94A 2HN7A 3KYKL 4S1DC 4U33A 2UZIL 5J8OA 1M6OA 4YDIH 5GS2D 4DAGL 2R69H 5C2UB 5FEBA 4IOFC 1MWAB 1WBXB 2GKIA 2AI0L 3NCBB 2WWMD 4TVPD 4KZDH 4WO4C 3QNYA 3ZDYE 4OAWB 4RISH 1RJLB 4QGYA 4NKOB 4OFYA 1JFQL 4R97C 4JM4H 1W72B 2VAAA 2VQUA 4JO3L 1R3HB 4DEPB 4WU5B 2XYCA 2VRAA 1G9MC 2JIXB 3NCJH 3HMWH 5HHVH 3UTSA 1MF2H 4P46B 1LNUA 4KV5E 3RIFF 5F9WB 5B39B 1SVZA 4R0LB 3JV5A 4XNYL 3HI1A 1CLCA 2FHFA 4KXZI 4PJ8D 5SWSD 4U3HA 1YEEL 3VFMB 1OB1B 7CGTA 4M7LH 4RRPG 1XF3B 3QEHA 4YZFF 3WNMA 4FNLL 2I07A 1GCFA 3MNVA 2VO5A 3I9GL 2FB4L 1UCTA 1NFIB 1ORQB 5IGXL 5GRXG 1VA9A 2APBA 2AP2A 2HT3D 3MOBH 4CVZA 3MODH 4OIIL 5E2JA 1HH6A 4P9MH 4R96A 2Z35B 4XMPL 5GS0L 2SEBB 4S1RH 3QO0A 4XBGB 5AG9A 1A6PA 1NAMB 1Z0NA 1YNLH 5HXMA 3BO8B 2R4SH 1UWGH 4TN9A 5MENE 3LKRA 4D2NA 5BMFL 4K8RC 2G9HA 4Y4FA 1N6QH 2JJTC 4LU5L 4NQCE 1KB5L 1KB9K 2OMBA 1EFXA 5DGQA 1MFEH 3LN4B 3FT3A 2EYRB 2MNUA 1HHIA 2F5BL 1PGRB 4JO2H 1VACB 1OARL 4ZXBB 4A6YH 4UU9A 5FHBL 5HYQA 4AM0A 2ZNXA 4IRJA 4DKDC 3QXAB 1AXTL 5ETUA 2CDEA 2Q76A 5JR1L 5KSBE 2Z9TA 1NFDE 1AE6H 1XF5B 1T21A 3DI3B 4NNYB 3NZHH 2IMNA 3H7LA 4Y4KA 2RAMA 1EO8H 3MYJA 2XOTA 1OF2B 2HT4C 2XA3A 2VXQL 4HUKB 1UEYA 4CADA 2R2BB 4NJ9L 1WCQA 4QTHB 2BVUA 1UWXH 1MPAL 4U6XB 1U8LA 2NY1B 3N85L 5FYJU 2X4OB 3MROA 4U0RB 3FB5B 3F7YA 1J5OL 2AJUH 1T22B 4QLRA 4ZS6C 1JNLH 4KFZC 3S3JA 1BM3H 1FH5L 1WT5A 5MEOB 4J12A 4WI8A 4X7EC 1T20B 1N8ZB 5GRVK 4HJGA 2Q86B 1XMWA 3FN3A 3C87A 1QTYT 4NSKB 5KS9B 3LZFH 5J4MA 3WFBH 5K93A 2PTTB 3AB0B 4XCNA 2XQYG 1HQRA 4PG2A 3RQ3A 2GHWB 3KXFB 1MELA 4XCCH 4GLRI 4UTAL 1LK2B 3V4VL 1FNLA 2CKBL 3Q6FA 1ONQB 1ZWIB 4P99A 3HC4L 3TPUA 3ULVH 5BS0D 4NUGL 4Z7NE 43C9A 2HVKA 2YD1A 1ZOXA 2H3NA 1MRFL 1J1OH 1JYNA 4O4YH 4Z7VA 4KDTC 2IFGA 3F7RA 1I8LA 1S78C 3GJEA 2AW2A 4GKNB 4WFGD 4Y19B 1U3JA 2JB6A 2C7UB 2VLJE 2I60H 3NMEA 35C8L 1XGQB 1F5WA 1K8DB 2D31B 5D2NE 2HTLD 4CU8A 5IJKA 4KKBC 5J11B 4PPTA 4NP4L 4U1HA 3E0GA 5JMRA 3IETB 1P7QD 4HV8B 4LBEA 4RAVB 4FFZL 1MCWM 4Y4HC 4AK1A 4GBXD 3KPRB 1UENA 4CKVX 3GZKA 2CK0L 4NC1E 3VFWA 3ABZA 2QQKH 1O7VA 1TFHA 3U9UB 1EZVY 5D7KD 4JRYE 4LP4A 1OGTB 3NCFB 4Z8FH 3SJVA 1KCKA 5I1HL 5BQ7B 5EBWA 4U7MA 5EULV 2DI7A 3T8XB 4DTGL 4WI7A 4LK4A 1U8PA 3E6FA 1TLKA 3ULSA 4KJWC 4L3EB 4JRYB 4LLDB 3L5XH 4W4OC 2GK0B 1MLBB 1CK0L 3EJJX 2N56A 4PY7B 1MQKH 5DSCB 2PW1A 1OCWH 2NY2D 2ZSWA 3FRPA 4YBQD 5I71B 5CGMA 1CLYH 1RULL 3UXFA 4HH8A 2OM5A 5IR1B 3TBSA 2CMRH 4S0TD 3VD4A 4V2BA 4YHNB 5GSRB 3ARBB 1RZ8B 2VERN 3X11B 1TVHB 5HHQB 1R5IB 2W07A 5FGSA 1OAKH 5JORB 1BEYH 5IVXB 5B8CA 3BIKB 5EORL 5DQ9A 3C9NB 4GRWH 3OKOB 2RGSA 3EO9H 2F74A 3V79C 3MXVH 1JWMB 3MACL 5GGRY 1VHPA 3G5VA 1YN7B 4PJ9A 1DDHB 3DMMB 1PSKH 1AO7B 2W9EL 5FGCE 1YEJL 5FYLD 5ID1A 1TETH 3BZEA 1UH3A 2HFGH 2V7HA 1TJGL 5B22A 2AGJL 3RUGE 1F4XL 4JZJB 1U8IB 3H3BC 3HZKB 2DN7A 1QFOA 3WFDH 4NUJB 4QCIA 4TVPE 1FZKB 1G0YR 2W91A 2J8OA 1M7IB 2YXFA 1A3LL 3L5WB 2WAHA 5FKAB 5GGQL 4AEHL 3ZYZA 1MCPH 4J4PC 3RUGB 2EYTB 2DQDH 2VLRB 4F15C 4X5LA 2XN9B 3V8CA 2WUCL 2QADC 3D2UD 5SWSE 4JFOB 1OAXH 5ANME 3WO3B 1UB5A 1IKNA 4HIEA 3KDMA 1UKQA 1PLGH 4KVNL 1QA9B 3OZ9L 2NNAA 5DUBA 4HJ0D 5EUOE 3L5JA 3RWIA 5SX4H 1RUKH 2EYSA 5JXAL 4ZUWB 1EK3A 2ZUWA 5CEXA 2PYEB 5SWSB 5ANMB 4PRNB 1RUAH 1BF2A 3WIHA 1KCVH 3JTSA 5D2NA 3V7AG 2DJ4A 2ERJC 4X6EB 4WHYG 1KJ2L 4LLYA 3P0VL 1HQ4A 4HKBA 2Z92B 5EUOB 5F3BB 3TT3H 1BVKA 2Q7YA 4YO0B 1NGYA 2C1PB 4LIQE 1J0ZA 3QQ3A 3H9SA 3MXWL 3C2SA 5HVWA 2Q3ZA 5A1AA 2ATKB 2NY5C 1FNGA 4KJYB 4OD1H 3MRHA 4U05A 1L6XA 1UACH 4L8DB 5F7LB 5HBBA 5I8KL 5DF0A 3F12B 2YA2A 5JW3H 4Y5VA 5CD5D 2DMCA 1LE9A 1NCWL 3ALWA 5FA4B 1LK3H 3EYFB 4TULL 5CZXC 2XWBA 2FX8L 2E8YA 2WBKA 5EOCJ 4KK6D 5C6PB 1WZKA 4XP5H 4FFYL 4F58L 1D3CA 1FL5A 4TTDD 3G5XA 5IB3B 1XIWA 1SYVB 5GGVH 3R0NA 1MFBL 5KN5A 3JWNC 4BSVA 3QNZB 1EJ6A 1WEJH 4CU6A 3DVFA 5FB8B 2UY6A 3L7EB 3BDYH 4XP1H 4HFWB 1A5FL 4MQ7A 1E4WH 5JIHA 4X6CE 5HGDA 5DJ6A 2VSDA 3CXHK 3UC0L 1B4JL 1EUTA 2G75B 4G8EA 1LO5A 5DMGD 2XQBH 4G43A 5HJ3A 4LCUA 1JHKL 3QFJA 4F37K 1S9YB 2NW2B 1MI5B 2DD8L 3QUXD 5A40E 4DZ8A 1AI1H 4NHUB 4PV9B 4XXDB 3KWWB 1RUPL 1QNZH 1T0NA 3GSOA 5I1LB 4FP8L 3ARDC 1NCUA 2EC9U 2NX5A 3BKML 3KJ6L 5BJTA 1X5FA 2HRLA 5FCSH 2PO6D 4M5YH 1NC4D 1UA6L 3U48A 4PBXA 3H0TA 5A2FA 4FFWD 5CJOL 5FA3A 1TJHH 3OMZA 5BS0E 5ILTH 4TNWK 1I8MA 2IANA 1A4JB 1WK0A 5DK0B 3CCHA 3GB7A 3QQ4A 3HE6D 1QKZH 3QI9A 2IPUG 1BBDH 4DN4L 1EEZA 2R29H 4YBHA 1B0RB 3OKEB 3BP5A 1D5XB 4NN5B 4WFGE 3BEWB 3RP1A 3MSPA 2AV7A 5DD6B 5FUZL 3VD7A 5I16A 3GMQA 2DWDB 2PNDA 3JWDH 3T09A 5BVPL 1CGXA 3QUZA 4GMSH 3LH2L 5I76A 4POYA 3EGSA 1V3MA 4RAUA 1AJ7L 5IHLB 1INEL 5HYFA 3L9RB 1IRAY 3QDAA 2EC9T 3EYVB 2H9GB 3WO4B 3HB3D 4D8PB 4OZIA 1JZ3A 5D7KE 5DI8B 1EMTH 2R0WL 3AXLA 4L29A 1IGCH 4JGUA 4ZUSB 3VCLB 2V2XA 3V6FA 1C1EH 2XIDA 3T0VA 2ICCA 1ACZA 1AGCA 3IXTA 4ODUB 5HI3C 5EPMB 2E6QA 4FRWA 4WFFD 5HDLA 3NTCL 3EFFB 5T33L 2A6JB 1XH3B 2J8UF 5I30H 3KPMA 1T3FA 2F8OA 4GW5B 4UIKL 2IPKA 1MHHB 3FO0L 5I6XB 3QUYD 1MQ8A 3SBWA 1LWRA 4MCZA 1SJEB 1IQWL 4NC0B 1LDPH 4PJDE 2AV1A 3R06A 2NY6B 2OR9H 1IAIM 1JF1B 4FZEL 1T7VA 2P24A 3PP4L 4KQ4L 4NQSB 2UVFA 4BELD 1JWSB 1RIHH 4RGMB 5IBTH 5JXEA 1NBQA 2PUQT 5GS2H 1KLUA 5IQ7L 3LKOB 1WBZB 1B4RA 4TVPH 1BJ8A 1NLBH 3EFDH 4I4WB 5J12C 3S3PA 1MJUL 1T7ZA 3BKYH 2BSTA 2ZSVB 1N26A 2YD5A 1L9MA 1X7QB 5E8EA 3NN8B 1Z9LA 3MNZB 2AAVA 2DM4A 4XCYA 4JFFA 2AK4D 5FYLE 5K59E 5M7QA 4ZO9A 8CGTA 1A6WH 1N5AA 2MJWA 5D93B 4RWYH 4MDIB 4QRQB 1GSMA 1P53A 5C09B 4LNRA 5AUMA 4YHIA 1SMAA 5FFLA 2BVQA 1Q94A 1XCTA 5FYKU 2PXYC 2I25N 1U8NA 3BSZL 3RJDA 1KCRH 4M6NH 3OJDA 4Y2OA 1DJSA 3VG0L 3IB4A 4CGTA 1BX2B 4KGJA 2I5YL 5IEKB 4KK5C 4BQCA 1YYLH 3ZKSD 3NA9H 3EDEA 1CIDA 4LAQL 4LIQH 5C9JB 3CXDH 2CRYA 3U0TB 5D5ME 2V5MA 3DARA 2OTWA 3VWJD 3QXUA 1PBYA 2UVEA 4E9LA 5HHXL 3ZDZE 2IH3A 3IYLW 3D2UB 4ODHL 3VWKD 3ZL4L 5CZVH 1J1PH 4FQ1L 3SCMB 2YR3A 1HK6A 4Y16D 3CFEB 2W60A 2E9BA 4U2ZA 4XP4L 4R7NA 4KH2A 1P7QA 4GUPB 2RQ8A 5FUOH 3L3JA 2E9JA 4KRMB 4NO5A 1A2YA 4GBXA 4HWBA 4ZFGH 3RVTD 5JW4N 3P4NB 4DJMA 2P45B 5JUEL 4TYUA 4WVRA 5E5RB 3IVKB 1UB6B 5E08H 1X5YA 4LLMA 5C0FA 2VIRB 3TWCH 4DCQB 3WHE0 1NGWB 1CFNB 3LEVL 5C0RL 1A4KB 6CGTA 4F9PC 2OR7A 4C58B 4GAYB 3IU3B 3SGJC 1EAPB 4P3DB 2CGRH 3VXNB 1JL8A 2EH7L 4LLVA 2CPCA 4QHKI 1B88A 3S35H 3DRQB 1XZ0B 4P4KB 5D1ZA 4LKCA 1KTLA 1LVEA 4O9HH 5B38G 1FG9C 2CLRB 5IT2L 5IIEA 5I1GL 5EFIB 3TO4D 4HC1L 3N9GH 3O8XD 2M8XA 2AABL 2J1KA 4JZOB 1TCRB 1BLNA 2FX7L 1DFBL 5CMAB 2EIDA 2ZUTA 3SGKC 3PL6D 1JPGA 3DETC 1GIGH 1QSZA 4L8CB 3MV7D 4I18B 3WUWA 5DEFB 4HIIB 5JHLL 4NRZB 4JKMA 4BSJA 3LN9A 3U4BL 1ADQL 4P49A 4PRBB 5EOQH 2PR4L 1QSEB 3V6OC 5DK2B 5DFWH 2X42A 5GGSB 1PG7L 2RHEA 4EBQH 1Q9LA 2GSIB 4IIQA 2ZCHH 5BV7B 3FQRB 4NQDD 3IDJB 5F88B 2FH8A 1WWBX 4G6FB 2R23B 1S7TB 5E6YA 4I0KA 2AQ1A 4MD5A 1C5CL 4JKKA 1TNNA 3KYAA 1GGBL 1A14H 1FCCA 1KJ3H 4OLVH 5KAQG 1GYAA 1M7DB 4PGCA 4J3VA 1YC8A 4QHUB 2CIKA 2B1HL 3TGXA 4ZOAA 4HUVB 4Q2ZB 3BH8A 3KPTA 4D9QD 3SKMB 1XGYH 4CW1A 1YYMH 4ELKA 2NZ9C 4WGWB 4Z0XA 3ZE2E 3IU4H 5KSAC 1IEAA 1I4FB 4HWBH 4IJ3B 5B3JF 5E6IC 5HPMA 1EUUA 4EVNA 4JY5L 3R1GL 3BUTA 5T3ZD 3C08L 2X4UB 3KPSD 3D0LB 2BSED 3S6CA 3SHSA 3DGCR 1TZIA 3X17A 4JG0H 4HS6A 3RKDC 1NGZA 4NN7C 3QEUA 4PD4J 1X5IA 5TE6L 4AG4L 4PP1D 1NCCH 2XFXA 5D96C 5ICXB 4KTDL 2DM3A 2BNUB 4D9RD 4R3SB 2V5SA 3NCMA 4R7DB 2H26A 4NIKB 4ODSH 4S1SH 4M6ML 5GJSL 3V8OA 3I84A 2EXYD 3B6SA 4I3RL 2EDNA 4X6FB 2X4NB 4F57H 3ULVC 5JPNA 3MJ7B 1I9IH 4HS3A 3WIFB 3CAFA 3OGCB 1FL6B 4Y4FC 4ZPTA 2EXWD 5C0EA 1B6DA 3IFOA 5E9DA 5L88L 3VXTB 4WFFE 3MRRA 3CLFL 1YPZE 3HNVH 3IFNL 4EOWL 3O6MH 4LCCB 4EIZC 2CLZA 3LRSB 5EZJA 5J6GA 4IRJC 2J88H 3P40A 4KDVA 4YXLH 1R3JA 3FN0H 4OD3L 1MSPA 1ZVHA 3RJQB 3LSOB 2PTUA 4UV7L 3VI3E 4KJQD 3MV01 1QFUL 3GSVA 4Y4KC 4M7KL 4TUJA 3PIQA 1EHLL 2VQ1B 3T2OA 2KH2B 3EBAA 5B21A 5D2LF 3N1PC 5SWZA 1O0VA 5CJ8A 2UWEE 2QLVB 5HD8C 1JGVH 4PRDB 1A6VH 1S7VB 3VXUA 1WC7B 4G9DA 1U41A 3FHAA 2P7TB 5GJTH 5BZWA 3BAEL 4Y2DB 1A6TA 2MQCA 3GBLA 1DBJL 3I2CL 5E8NA 5IQ9A 2YPKA 3BDXA 5D7IF 4OFIA 5E1AA 1X5JA 3EO1B 2ESVD 2I27N 1CGSH 1KN2L 2AK4E 4M02A 1MRCL 2R4RL 3VFPB 4P2RA 1F90H 4QRRB 2BSSA 3NABH 1MJJB 4X7DC 2OXGA 1RZJH 4MMZC 3FFCD 4RMWA 4X98B 4ONGH 1DBMH 1NKRA 4FXLA 3PWJB 1WWWX 2YMXL 3GGWA 3QEGL 4PYGA 5A2KH 5JDJA 3OV6A 3ZKND 3VRIB 4M48H 1EVUA 4HKZA 4R4NC 1K4CB 4NM8L 3O2VL 3N1GC 3C5ZA 2PO6A 1RHHB 4Z7OF 4OJFH 2WSKA 4R4BA 5CD3A 2P5EA 1TQBC 3P4MB 1RY7B 3ILPA 1OP3K 3T08A 4KUCD 2OL3L 2W9DL 2XA8L 3PWUB 4PTUA 1QD0A 4PFEA 5E5UB 5FM5O 3H6JA 5GGTA 2VLKD 2D3VA 4KK9C 4PJAE 5L6YL 3DTXA 1CIUA 4OLXH 1F3JB 4D0DA 5D1QD 3VXMD 3ARXA 4Q6IA 1AD9B 2EH8H 2X70B 2X7LA 4OB5L 5LXGL 3GIZH 4K7FB 2RBLA 3B3IA 3BGFC 3ORJA 5ACZA 5IJKC 1OL0A 2ARWA 4Y5XB 3RZWA 4M5ZL 4MB4A 4MSWA 4PJAB 2FD6L 1NMBL 3TBTA 3T3PF 4A2LA 4PUBH 4L1DA 5B3NA 4GS7C 3PUCA 4P9HH 3SDDD 5FYJL 1YQ2A 1JUFA 5D72L 4D0BA 3GSXB 3IJYB 1A9EB 4LVNC 2GTWA 2VE6B 5T5NG 1TJIH 4R2GD 5D1XD 4V1DB 3I3BA 1ZLWK 2AJSL 3OKLA 5E8DH 1OVZA 3HG1D 2NW3A 4OGXL 4PLJD 3I85A 4EEEA 1RUQH 3OHXB 5D7JB 4O5LL 1VB9A 5FHAL 3UYOD 4WEUD 5T3XL 1MHEA 1H3VA 2DBLL 4NGHH 2YUWA 4JFDD 1EVTC 3WIIH 3GJFB 4HBQA 1ZLSL 2HVJB 1YEGH 1L7TL 4QOKD 5AD0B 4LASL 3CMOH 4RMUA 5EWIL 3U30C 5I1CL 1YPZA 3SDXB 1KPVB 4NO0B 2BVYA 3PNWB 4MNQD 2E6JA 4Q6YA 3K8MA 3RFZC 4ENED 1KT2B 3R4DA 3O6FB 2M1KA 2X9YA 3QUYA 1R3IL 3PHSA 5D7SL 5EO1A 8FABB 2BCKB 4HPYH 1FRGL 4WI6A 1DE4B 3QXDA 4Y8AA 2CQVA 5FKPA 1NLDL 3DUUB 3O3AA 4DGYL 3MV7E 2ICEB 3RWFB 1NMAH 4LVHC 1OP3H 1W0YT 2H32A 3O8XB 1QZ1A 1M71B 2D7TH 3EDFA 5I74C 5ALBH 1SBBA 3L3HB 5GGTH 1CLOL 4MJ6B 1G6RL 4NQDE 4MA1B 4GRLB 3QWRD 1YNTB 1QO3A 4G7YL 1JV5B 1ZLVK 1BQSA 5JTWA 4L3CA 5CEZH 4UV4H 1FLRH 1G9NL 3EYOA 5DJYA 4JO1L 3VFVB 2J3SA 1F11B 1T2XA 5LBSL 1J8KA 2FATL 3O3EB 4EZMA 1R3LB 4K3EH 4P5KB 5ICZB 1A3QA 3MLUL 3ZMRA 4D9QE 2Q8AL 1B2WL 3WKMH 5I1JL 2DQHH 2WBJD 4AEIH 4J3WA 3KYOB 4WTZA 3KLDA 5I19L 1GGIH 5CIPB 1ZLWH 4P23D 3OAZK 3ZT6A 2X4PA 3MCKB 4MZ2A 3W9EB 3S96B 5T3ZE 3KPSE 5DURD 3OKKA 1QFWM 4N9GB 4P2OB 3CH8A 1IKNC 1V3KA 3U46A 3BP7A 5F7HA 2COQA 3GMMB 4PRPA 3G08A 4XWOC 2FL5A 4D9RE 3RU8L 2DLGA 1WSST 4FZ8H 4AIZB 4PJCA 3VWJA 2BC4A 5FECA 1AP2A 1VKXA 2IBBA 5D2NC 4OZ4A 2HH0L 2VJXA 4LPWA 3FJTA 5EUKB 4Y16A 1NAKL 3DHJA 2OQJA 4N0CC 5E8OA 3X12B 3N1QC 1BECA 4HH9B 1I7TA 2CLVA 4L4VD 4QF1A 5ESAB 1YEFH 1QHPA 3MJ9A 1JYVA 1RK0B 3VD9A 2H32H 3S4SB 4UUJA 3FQTB 3PJSA 3WDIA 4WUKL 4LHQB 5EU6B 4NWUL 4I2XE 3OSKA 1HHKB 2GTZA 3SY0A 1T83C 5LGJB 3VE0B 1CD1A 2HG5A 2ZCKL 1DQML 2MCPH 2Z31D 5E0QA 2IGFL 1ZLVH 2ADFH 3SN6N 2P8PB 5INDB 3M1BA 1ORSA 1FPTL 2OP4H 1ULVA 4XAKD 4L8SA 3UBXG 1G7QA 1HOCB 2AQ3A 3MRNA 4I2XB 3VRLE 4BZYA 3V5DA 3BE1L 4WIQA 3C09B 3VFTA 1XIWC 3IS0X 4NT6B 2VH5L 2GAZB 4XVJL 4YUEL 1DUZB 1T5WB 1MVFA 3ZKXB 4JFHD 3GI9H 4O02H 2C9AA 5BCAA 5DEGA 1CXIA 2Y7QA 3OAZH 5DJXB 4JZNA 4ZTPL 2H2PD 3PL6A 1ZEAH 1U91B 5K9JH 4WEMB 4DFIA 5KTEL 2ESVE 2OL3B 3MV7A 1LP9F 3RBSA 3H9YA 1T2QL 4YK4B 4KMQA 4MDJA 1FZOB 1KTDA 4LFHG 3MRGB 2XKNB 1RZFL 2HFEB 2ZG2A 4G8GA 5F44A 3FFCE 5JZ7D 1A1NB 3F6LA 4JLRB 2PW2A 3K2UL 4Z7WE 5E95B 3SKJL 5DHYA 3TZVA 3ARGA 3L3KA 1CE6B 1ND0B 4PJEE 3W0WD 4PR5B 1A3RH 4OF8A 4N8VB 2C4FU 4PGJA 4IMLA 3NIGE 4MD4A 3O9WD 7FABH 2QHRH 3K1DA 2WWMC 1I3RB 4O58H 5I17A 4QRPA 3TNNA 5J1TC 3QI9C 3QCVL 2R1WA 3CVHL 2VABA 2VLKE 3R8QA 2UUDK 5EDXA 1AGBA 4G9FD 3AGVA 1Z9SA 3HNSL 3MJ9H 2F19H 4OCXL 3SGDI 3VXME 3SDYH 2VXVH 2XKUA 2GEEA 2DYPB 4LCWD 1H8SA 1D5IH 3UJIH 1JF6A 4HWZB 3BH9A 3CUPA 1E0OB 4PJ8C 5DMJB 4OCRH 5IHUL 4W4NA 2E7BA 1G7JA 3DBXA 1WFTA 3QUZC 5IHZB 1JZ2A 1C5DA 4KUZH 4X4ZA 3D69A 2FCBA 2ADIA 2HLFD 1V3LA 1AXIB 2EO1A 4KZDL 1IEBA 4HIJA 3MRJB 3NPSC 5JOFB 2XRAH 3WHE1 1C5BL 4U6YA 1L6ZA 4LLUA 2HT3C 4HZLA 3F5WB 3P77A 1BREA 4XB8A 3HG1E 3HMWL 5HGAA 1JNNH 2JB5L 2C4FT 1E4KC 1FG2A 2AVGA 5C0IB 4UZGA 5C0GA 3QIUB 1VFBB 4JFDE 1JE6A 4QOKE 2FBJH 3PXJA 1ZT1B 1MAJA 2BX5A 5CSZB 1MWAA 1WBXA 1VFAB 2WIMA 4Q0XH 1KCSL 1TPXB 2EIEA 3C60B 4OAWA 1IMHC 2R0ZH 2YPVH 4MNQE 1W72A 3IJHA 1X4XA 2HWZH 4JFDB 2WWKT 4K7PY 4IM8A 4P46A 4GXUN 4R0LA 3LMJH 2JELH 1UWGL 2DI8A 1GXEA 3TT1H 1BBJB 3AU1B 2BHZA 1F58L 1FFPB 2X89D 1F02I 3VFMA 1I1YB 1OB1A 3ISWA 4CN1A 3TM6A 3MFFA 1XF3A 4QNPF 1S3KL 4B0MM 1QBML 5EOCH 2VZTA 4A6YL 1NFIA 1ORQA 4I0CC 5DVMA 3BQUB 4X4ME 5IW3A 3DGGB 4U7KA 4MJ4A 5HVFB 3U7WH 5DDHB 2SEBA 3DX6B 4XBGA 1NAMA 1WGOA 4NQEB 4XVUC 1QBLL 4UILL 5DJ2B 3BO8A 3WS6C 3FMGH 2CO6B 1BJ1J 4XH2B 3D6GA 3OTTA 2DRUA 2Y36H 3MLVL 2JKXA 3RAJH 3WHXB 2EYRA 4E41D 2ZJSL 2EE2A 5JNYB 5MERA 3D3VD 2VXTH 4JFPA 2FJGA 4DKFL 3ULUH 4JQVC 4W70A 5DUMH 4EI6B 3EDJA 3QXAA 2NXYB 3WEXB 2DQCL 5J9PB 1RMFL 4H8WC 4PJEA 4TSCL 4UBDD 3PXHA 1XF5A 4P5TD 4HLZH 4G80A 2LV4A 4I13B 5CFHA 2DLIA 1XR8B 4OSUH 4F3FB 3QBTB 1QLEL 3VH8B 5CGTA 4OZFB 1W0VB 1MWAH 3AROA 4G6JH 4OV5A 3ZE0F 5D1QA 1BQHA 3FO9A 4RBPK 3VXMA 2R2BA 3VDAA 2VZOA 3G6JF 4PJHA 3HFMH 4QTHA 4M8QA 3X3GH 3GSRB 3EOAB 2YD2A 2HTLC 2X4OA 3CFJB 3GMOB 4XCCL 2B1AL 1RVFH 1T22A 3N1FC 1I1AB 1CDJA 4ZTOL 4GBXC 1NCBH 4OKVB 1T20A 5CJQH 2HKHH 1VGKB 4L4VE 1NJ9B 1J1OL 2MKWA 4O4YL 4WWKD 3AUVA 3CFDA 2JF1A 2X1QA 5D1XA 5JPMB 2PTTA 4XNZC 3HG1A 2I60L 2ICWB 2CR6A 2Y5EA 2ZPKL 2FO4A 3QIWD 1Y18B 4QXGH 5CWSA 5FYKL 3KXFA 3D87B 5C0JB 1LK2A 5JDSB 4MJIB 1ONQA 1ZWIA 2BMKB 4PG9B 1NAMH 3BPNC 2VISA 1HNFA 5D1ZC 5F7FA 4XAKE 1UJ3A 4K23H 2G5BB 2NY2C 25C8H 2QQKL 3RDTD 4YBLC 4YBQC 1N4XL 4DKEL 4MNQA 4Z8FL 9CGTA 1IILE 2Z31B 4YEEA 4AT6A 3QHFL 4JFHE 4K71B 5HHPB 3KPQA 1QG3A 2WM0A 1MNUH 1XGQA 3P4OA 3P30H 3GMNA 1K8DA 5DHVA 2D31A 4G42B 1DSFH 5M94B 1FZMA 4QXWA 2QEJA 3RY4A 1MFDH 4GLRH 1PKQE 3IETA 5EBMA 3IF1B 4HV8A 4RAVA 4E0RB 5SV4A 3IT8D 1MJ7L 3KPRA 4Z7UE 1RPQA 1MQKL 1WJ3A 5GRVL 1A6ZB 1J1XH 4IIQC 1VEPA 1JMZA 5CSGA 5IK3A 1H3XA 1IAKB 3U9UA 1OGTA 1CICB 2FEEL 5BQ7A 3K7UA 2GY7B 4MXWH 3FOMB 1J86A 2G60H 3T8XA 3WXVH 4OLYH 4OM1H 1RK1B 4MX7A 4DGVL 3W0WE 3BEVA 3HE7D 1KEML 3WUWG 5TFSL 4I77H 1BEYL 2KPNA 4JGMA 4LLDA 5J89A 3EO9L 4PY7A 3QFDA 5DSCA 2YSSB 1I9RH 3FB7B 2B2XH 3HNTH 4G9FE 4LSQL 5AAMA 3FFDA 5IMLB 5KZCD 3QCUL 5LAXB 3BZFB 4PB0H 4LCWE 4ZQKB 2IWGA 2WIIA 5HDOA 4EDXA 1FNSL 1TETL 3VXPB 3ARTA 3T0AA 3ARBA 1RZ8A 3LS5L 2J8UB 3GMPB 1CGTA 3X11A 1FCGA 4HT1L 2FX9L 4FXGA 1A7QH 5IVXA 4KZEL 1YEKL 2DLTA 1OWRM 3C9NA 3OKOA 4HJ0C 1IGFH 2BDNH 3LQZA 1ZAGA 3PQYD 4AYFA 3H9ZA 1FYTD 3T4YA 1EHNA 4GAGL 3HUJF 4U1SA 4OT1L 5CUSH 3B9KD 3T3MF 3P0YL 1M1SA 4Z0BL 2DQDL 1KIQB 3TN0B 3B83A 1AO7A 4PJ7A 3RWDA 4X7SL 2GITB 5DHVH 1GHFH 3MGOA 4JZJA 2WNGA 1JZ5A 2BNRD 3HZKA 4LGSB 1OTSD 3CNKA 1AHWC 5EU3B 3MLSH 1M7IA 4PJXE 3WLBB 5FKAA 1DBKH 1BGXL 2PKDA 1PX3A 4P2CG 4Z95H 3O4LB 1LDSA 2GW5A 4I5BB 4OCLC 2EYTA 1KCVL 1MJ8L 1HYSC 1UG9A 5CD5C 3SE9H 5HHOD 2V17L 1AXSA 2VLRA 1QPXA 4DOHB 2XICA 3QULB 3AMKA 4PJ5D 4HBCL 4YXKL 5JW5B 2AJZA 1ZGLB 2P4AB 1KXVC 1EX0A 1KB5A 4Q58C 1OGAD 4KK6C 3TA3B 4NBYB 3G9AB 1QA9A 3RGVB 5AWNL 4TTDC 2A1WH 1C12B 1CR9H 2APWA 4YHYC 2ADGA 2YWZA 3D48R 4OD1L 1F6AB 2NY0D 1TZGH 4ZUWA 2PYEA 4OUUB 3ZKMC 1KLGB 4AZ8A 5CINH 4L4TB 2ITCB 2IAMB 4YGVA 5F8QC 4APQD 1PKQA 3KYKH 5IFJB 3SO3B 2G2RB 2GFBB 3TC9A 4M7LT 3Q6GH 2W65B 2UZIH 3QUXC 2C1PA 1JPFA 3PABB 4X6DE 5F6IC 3WFEL 4DAGH 2AI0H 4YHPB 5HDBF 5I66B 1U95B 2WLYA 4E41E 2ATKA 3AMLA 3NCYS 1JFQH 3L3OA 3D3VE 5HYEA 4L8DA 2X4RB 1HN1A 3BDYL 2PO6C 3GFUA 1R5VB 1EEUA 2O61B 5JO5A 2VITB 3W0WA 4XNYH 4FFWC 4S1DD 1P7HL 3ZDXE 2XQBL 4X99A 5FA4A 1XCQB 1YEEH 2EECA 1KIPB 3BISA 3EYFA 4PS4L 3D3VB 4X4XB 3U4AA 1ZHKB 3HE6C 4PJIE 4FNLH 1X5XA 3UZEA 4WO4D 2DIBA 1TENA 4ZSOE 1JZ7A 3I9GH 2FB4H 4GXVL 4Q6IC 4G9FA 3DX9A 3RI5F 5IB3A 2IC2A 1SYVA 5IGXH 5DJAB 5TGBB 4OIIH 3QNZA 3HPJB 4M5YL 1H5BB 5FB8A 3L7EA 3HS0B 4XMPH 5GS0H 1MHPL 3GBML 4HFWA 2CKBA 3WIHL 5CCKL 5KAQF 1KC5H 4O2CA 3C6SA 2ZUSA 5ESQB 2J5LB 4L5FL 4CN6A 2G75A 1RZGB 1TJHL 3NIDF 5ILTL 5BMFH 1MVUB 1S9YA 3UDWA 4LU5H 3HB3C 1KB5H 1T1YB 2MOVA 2DWEB 4J23A 5GRUH 2FHBA 2DMBA 4NHUA 1OARH 4PV9A 4XXDA 2YD4A 5FHBH 2NY4D 1RIVL 3Q48A 4L9LA 4OF3A 3LV3B 4OZGF 1AXTH 5E99H 3JWDL 5CHNB 2Y1VA 4PGBA 1MHCA 4JDVB 3O3UN 4MWFA 1X5HA 4UB0H 1ZV5A 5K9KB 3E6HA 1OAYL 4K8RD 4GG6E 1ERNA 4OGYH 2AJVL 1A4JA 3CSPA 5L8JB 4O51B 4PJXA 4LPVA 1MCDA 5FDWA 4PRAA 1EMTL 1XT5A 4OV6F 3QUYC 1ZLUH 1B0RA 3RBGA 3BEWA 2VDPL 3UTQB 3PGCB 5JHDB 3N85H 3U0WL 3HZYB 2VL5B 2F5AL 3U0PB 4ZUVB 4OBRA 4MQTB 4PLNC 2QKIA 1FH5H 3DROB 3GBNL 3V5HB 4XP6L 4XBPA 1P1ZA 4RNRB 3FQUB 1K5NA 4LSPL 3EYVA 2H9GA 4K3DL 3QPQD 1Z6JT 1U8OA 4D8PA 2XACC 5DI8A 5MEPA 2ADJB 4UI2A 2HJKA 3SE4C 4GSDH 4KROB 3DO7A 1LDPL 4LSSH 4ZUSA 3ULVF 4MZ3A 4LVOC 3WS3A 2FWOB 4UTAH 5CJBA 3V4VH 4ZS6D 3EHBD 2DLFL 2CKBH 4WV1C 3O11B 1B0WA 1RIHL 3UTTB 2X05A 4NUGH 3HPLB 1G6VK 2A6JA 1XH3A 3FO2A 1Q9OB 3CFKB 3DPBA 4E41A 3S98A 1MRFH 1F97A 4HKXB 3BKYL 2EDLA 5EO9B 1MHHA 3Q2CA 2FEEI 1Q8MA 1CGUA 4U49A 2YD7A 4XCEA 1K4DB 1SJEA 35C8H 1FLTX 5MP6H 4MA8L 1JF1A 1WFUA 4IRSD 1P84J 1CXKA 4NP4H 1CLZL 1KJVA 4C57C 5DJ0B 4XNQA 4FFZH 4P3WA 5C0BD 1LO2L 1HINL 1UCBL 4U6HB 5J3HD 1AKJD 5E94B 2CK0H 3QJHB 3ZYJA 3VWJC 3LKOA 3G5ZA 4WTZG 4PJFE 5SWQB 3PQYE 1FYTE 4ZPVB 3VWKC 2ZSVA 3GK8L 5I1HH 3GSQB 1V8HA 5BO1H 4Y16C 4HUXB 5D7IE 3MNZA 4XC1L 4DTGH 1N6UA 5D2LB 4JFED 3LIZH 1KEGL 5KVEL 1MCNA 3BVNB 1YYLL 4FQLL 3CDGB 3RVTC 3QR2A 2UYLA 5CEYB 1CK0H 2BNRE 4X7TB 4MDIA 4MCYB 3CLEH 5C09A 4HKJB 5D7IB 5FF6B 3LDBC 4WW2F 1OTUD 1RULH 2YBRA 4YFLF 5CZVL 5F9JA 1QSFB 2R0KL 1U8MB 2NY7H 1S7RA 3JV4A 2N4IA 1X3DA 4MAYD 5HHOE 3P9WB 4L8SC 4WTWA 4PJ5E 3C8HA 1BX2A 4OLEA 2FO1A 1FBIH 5L2KB 1PQZB 4KJWD 3MZGB 2IPTL 1MIML 1OGAE 3ZDYF 3TO4C 1RJCA 1P7KA 2ED9A 4RCAA 5C9JA 3RDTA 1DEEB 5T5NF 3MV8B 1JTTA 4BUHA 1U42A 1IFHL 3TWCL 4ORGA 2GJJA 3MACH 1FIEA 4UDUB 4GKSB 2BXZA 1INQB 4KV5F 3H7BB 3PL6C 1EEYA 1QLRA 3MLTB 4P5MA 2APXA 4GAJH 2F8XC 2CGRL 3BPLB 1WAAA 2UZXB 1RZIB 2W9EH 3CFEA 1YEJH 1XF4B 1TJGH 1ZT7A 2V9RA 5LGHL 5FCUL 2BK8A 1F4XH 1JIBA 4ERSL 2IG2H 3B9AA 1UVQA 3PG2A 1YEHL 3IAQA 1T04B 3QJFB 3IVKA 3PE9A 4NRXB 1A3LH 4LLWA 1LO3H 3A6BL 4AEHH 3IDMB 1YJDH 3TZVC 1NGWA 1A4KA 2FDBP 1GIGL 1OAUL 1WBYB 4GAYA 2VXUH 4NZUL 4P3CL 1EAPA 2ZOLB 3UEZA 3VXNA 5HHMD 2WUCH 5BRZD 3Q3GA 4WWID 3WD5H 3DXAB 3LVEA 1DLHA 3TBWB 2IF7A 3DRQA 3O45A 4P4KA 4XZUB 5L8KB 4KVNH 3OZ9H 1LGVA 2ZCHL 4ZFOB 5EZLA 3TVMD 1YECL 3ALPA 1TCRA 3JZ7A 4KQ3L 1VGEL 5CMAA 1T66D 3BXNB 4H26B 1S7XB 1P9MA 5KSBF 4JJ5B 1NFDF 4EN3D 1PG7X 2AKRA 3D1MC 4XAWH 3GSWA 4I18A 3P0VH 3FN9A 4NHCL 4HHAA 4WO4B 2ZP0T 4NRZA 1H15B 4PP1C 3VXOA 2W92A 3A0OA 4XMKH 2Q20A 4R97B 4PRBA 1QSEA 4F7PA 4RQQB 4WFHD 5DK2A 2IALA 2R2EB 4MB3A 3VFSB 4ZFZA 3IU4L 5DC4B 5GGSA 5J6HA 5DRNA 2CIIA 3MXWH 4PJFA 4MJ5B 3FQRA 1CWVA 2EXYC 3IDJA 5F88A 1S7TA 4B53A 3B9KA 3C5JB 5I8KH 1J12A 1NH6A 3ARRA 2Q8BH 3QAZC 4M9OA 5T1LD 4JG0L 1FC1A 2NY3C 4D94A 1M7DA 4Z78B 1OPGL 1H3WM 1MCOL 1NCWH 2YOCA 4WJ5B 1JRHL 4LQFH 4TULH 3VXSB 3SKMA 5IP4A 1CDBA 2FX8H 1JGEB 3CH1B 3RIAF 4PJGA 4QY8B 1YNKL 4FFYH 4ODSL 3HA0A 4YR6B 3HLAA 4LEOB 1KN4L 4S0SD 1MFBH 2EDKA 5T3XD 3WFZA 2EEDA 1J8HB 2YRPA 2X4QB 5HHOA 5IEHB 2Y5TB 1A5FH 3B8YA 3UYRH 3S97C 2DM2A 1B4JH 1U58B 4Z7NF 1ZVSB 1FQ9C 4XNXH 5J7CC 3HRPA 1JHKH 1ZT4B 3BMWA 5ICXA 3AREB 2DD8H 3NCCB 3PGFH 2FECL 1PY4A 4NFDA 5GSVA 5CBEB 4NZDA 2A9NL 2J88L 4R7DA 1JN6B 2I9TA 1R5WB 4FP8H 1D5MA 3KJ6H 3BKMH 1F4WH 4NN6C 1HI6B 5I9QC 4X6FA 2X4NA 2C3GA 3MJ7A 1UYWL 3BPOB 5DMKB 4LCIL 4DZBA 1UA6H 1FL6A 2AERT 2JJUA 2XY2A 3EYUL 4LP5A 1CYGA 4X8JB 1Z9OA 4CMHC 1QVOB 1I8IB 3VXTA 5CJOH 4CMMB 1A6VL 2IH1B 4YFEA 2Y07L 4C59B 5IW6B 3LRSA 4N5EC 2ARJA 4DN4H 3ZKNC 1RD6A 3DNKA 3ARDD 5BV7H 1JGDB 1N2RA 2CDGB 5FUZH 1D6EB 1JZ8A 3RA7H 3D18A 4PGEB 3KJ4C 4UQ2B 5BVPH 3DURB 1TVDA 3LH2H 1ZHLB 5GS3A 1J0IA 5CKGA 2Y06L 1RZJL 2IADB 1AJ7H 4RX4D 5C0BE 1INEH 1KB9J 1T2JA 5D1QC 1CGVA 2P8MB 5HGGS 2LFGA 5E8PB 3NFSL 2Y6SD 4PREB 4MD0B 4NKMB 4UIMB 4GKOA 2VKXA 2R0WH 3O41B 1E28B 2CO7B 2YA0A 3SDDC 4W81A 2R1XA 3U83A 1NANI 3VFPA 3NTCH 4QRRA 1MJJA 4OFPA 2MPAL 1IGYB 4R2GC 5D1XC 1MCSA 4X98A 4WRLA 3KHQA 1BQHG 3HI5L 4PLJC 2EH8L 3TYGL 4UIKH 2KQNA 3FO0H 3WNKA 1UZ8B 3OPZL 1OSZB 5IB4B 1MREL 1RHHA 4PUBL 3O3DA 4Y4HB 1JPSL 4P9HL 4FZEH 1UJ3C 3BUYB 1V7NH 3P4MA 3PP4H 3RUGF 3VJ6A 2FR4B 2ZCLL 2RCSH 5F9DC 5C70A 4JPWL 3PWUA 3SKUD 1AQDB 3G9VA 3RHWK 1CFQA 1YMMB 5CILL 4L1HA 5I8CB 5IQ7H 3QUMB 4QYOB 4PRHD 1X5ZA 4BYHA 1MJUH 1AD9A 2P5WB 4K7FA 4JVPA 3ROOB 2F54B 3DVNB 1DLFH 3FRUB 4IOIA 4Y5XA 1YA5A 3JWOL 2R9HD 2VWEE 4NYLA 4PJBE 4TSAL 3LKQA 1YEGL 2IBGA 4HXBH 2VDRH 1H9VA 4YHKL 4Y1AD 3BZ4A 3T0ED 3GSXA 1A9EA 2BVTA 5C8JB 4C4KO 4HC1A 3SQOL 3J7HA 4ODXB 4V1DA 1U8QB 3RTQD 4ELME 1WZMA 3WSQL 5DD1L 4NOFA 2ZOKB 3OHXA 2VN4A 3F7PC 4O2EB 4HPYL 2ZKHL 5KVFL 4PRID 5HHME 1ADQA 1BJ1H 3VG0H 4JREC 5BRZE 4I0PD 3QDMD 5DHXB 2I5YH 1S5IL 2WBJC 4OD2B 1KPVA 1G7MB 2JCCE 4NO0A 3PNWA 3QB7C 2HFFA 3QWOB 3KYMA 3REWB 4P23C 4HMCA 2K1MA 2QTEA 3N1MC 4ODHH 5CEZL 8FABA 3ZL4H 4FQ1H 1DE4A 3B2UD 3BIBX 3HI6H 1RIUL 2ICEA 2E27L 4J6RL 4XP4H 4K3EL 3QYCA 1M71A 4GFTB 3SEPA 1FSKC 5C0BA 3FOLA 4WFHE 3QG6B 5JUEH 3L3HA 3RIFK 3QO1B 3TBYB 5D7LD 1GGIL 4MJ6A 4MVBD 4QHMB 4F15B 2DQGL 2LVCA 4Z76B 3OKMA 2QADB 1YNTA 1FFNA 3O6LL 4X6CF 2RR3A 4JFZL 1NUNB 3DX7A 4FQXD 43CAB 1F11A 3ARWA 1Q0YL 5HYJB 4EQ3A 4JFEA 4JY4B 4HWEL 2EH7H 4XRCB 1FORH 1QRNB 3DVGB 5C2BH 5ICZA 4FTVD 2FGZA 3D85D 3VGHA 3MBXL 3DV6B 5HY9B 5IUSA 1TIUA 5JLZB 4BH8B 2V7NB 4OKDA 4TQEL 5I1GH 2DQFB 3IXAB 3LRHA 5GS0C 4KKLC 5K9QI 1JP5A 1TTUA 4HC1H 3LKSB 5F96L 2WV3A 4UTBH 2AABH 2ERJB 2FX7H 4CVUA 3MCKA 5T3XE 3BX7C 4QXTB 3S96A 2FZ3A 4IEFB 3NAAL 2BSRA 1BFTA 1KTRL 4MAYA 5F1OB 1IAIL 1Z5LB 3SPVB 5DD0H 4P2OA 1BFOB 5AYUL 2NXZD 5CGYD 2D7QA 5JHLH 3GMMA 1NC2D 4EI5D 1JRHI 1UGNA 1YEFL 1ADQH 2PR4H 3CK0L 3RZCD 3TH3T 1PG7H 2XTLA 4LRNH 4QXUH 3RX8A 4P2QB 3PWLA 4AIZA 2P8LB 5CS7A 4TRPL 2C1OA 3MNWB 4YPGB 1QBBA 5I1KH 2MCPL 4BK4A 1C5CH 3O2WL 2ADFL 3DETD 4PJBA 2YN3A 1GGBH 4JY6A 2YUZA 2K7QA 3X12A 2B1HH 4NQXA 1SYSA 1Q1JL 1ROWA 2X1OA 5TDNB 3G6JB 2YN5A 3RX7A 5F1NB 3CZJA 1RK0A 3FQTA 5JZ7C 2EEBA 2FECI 5EU6A 3QDJB 2PCPA <