5L2MA

Structure of aldh1a1 in complex with buc11
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
494
structure length
493
Chain Sequence
DLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Aldehyde Dehydrogenase 1/2 Family by Psoralen and Coumarin Derivatives.
pubmed doi rcsb
molecule keywords Retinal dehydrogenase 1
molecule tags Oxidoreductase/oxidoreductase inihbitor
source organism Homo sapiens
total genus 186
structure length 493
sequence length 494
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 5l2mA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 5l2mA01
3RHOA 4I3VA 4QJEA 5L2NA 4NPIA 1AG8A 1BXSA 2J5NA 4FQFA 2EIIA 4CAZA 5KLKA 4I8QA 3JZ4A 4OHTA 5EUYA 4IDMA 3VZ2A 1O05A 4LIHA 4Q92A 4ZVYA 4ZWLA 4GHKA 3V9JA 5J78A 1KY8A 5EYUA 2W8QA 4I3UA 3RHRA 2D4EA 3QANA 4QYJA 2BJAA 4L2OA 4LH2A 4X0TA 1QI1A 4U3WA 5EZ4A 2BHQA 3R31A 4DALA 4QTOA 4H73A 3ZQAA 1EZ0A 5AC0A 5KLNA 1WNBA 4GO0A 4I26A 1ZUMA 2O2RA 4JDCA 4LH1A 5F2CA 3VZ3A 3V9KA 3V9GA 5J7IA 5DBVA 4PZ2A 4PXLB 4E3XA 2ID2A 4X4LA 4I3XA 4GNZA 3N83A 4MPBA 1CW3A 1O04A 3EFVA 3EK1A 4OU2A 2WOXA 4V3FC 4DNGA 1WNDA 1A4SA 3RH9A 4YWVA 1O00A 2ONMA 3N82A 2VLEA 4NU9A 2ILUA 2IY6A 4I1WA 4OE2A 2BHPA 3ROSA 3TY7A 1NZZA 1UXRA 2OPXA 4PXLA 4H7NA 5KF0A 2H5GA 4C3SA 5L13A 4I3WA 5AC1A 4IDSA 3RHPA 4LH3A 1UXQA 5KLLA 1UXUA 4ZZ7A 2BJKA 2EUHA 1UXPA 2HG2A 4ZUKA 1NZXA 4I9BA 4NEAA 4F3XA 4MPYA 1UXTA 2EITA 4KWGA 5EK6A 4E4GA 3N80A 5L2MA 3V9HA 1UXVA 3SZAA 1VLUA 1O02A 2WMEA 4LH0A 4ZVWA 4OGDA 4QETA 4O5HA 3VZ1A 3RHDA 1A4ZA 1AD3A 4GO4A 4NS3A 1QI6A 4A0MA 5L2OA 3R64A 5DRUA 4KWFA 4ITBA 4OE4A 4LEMA 3VZ0A 1UZBA 5A2DD 3V9LA 4OE5A 2EJLA 5JRYA 4ITAA 3K2WA 2W8PA 5KLMA 2EHUA 4K57A 4WP7A 4PXNA 1BPWA 4WB9A 3B4WA 4L1OA 3MY7A 4IT9A 2O2QA 4NMJA 2Y51A 4I25A 3RHHA 3PRLA 3RHMA 3K9DA 4GO2A 5A2DA 2W8RA 4H80A 4IHIA 4ZULA 4V37A 4WJ9A 2EJDA 2J40A 4WPNA 4I3TA 4ZXUA 4X0UA 3SZ9A 4NMKA 2Y5DA 3IWKA 3INLA 3N81A 3INJA 5J6BA 4JZ6A 4YWUA 4CBBA 2JG7A 2W8NA 5KJ5A 1O01A 4V3FA 4OE6A 4KNAA 4OUBA 2ONOA 4LGZA 2ONPA 1EUHA 4JBEA 3RHLA 3RHJA 4YWEA 5ABMA 2J6LA 2XDRA 5KLOA 2Y52A 5FHZA 4GO3A 4FR8A 4QF6A 1UXNA 2IMPA 5EKCA 3RJLA 3V4CA 1O20A 1NZWA 5DIBA 3PQAA 3JU8A 2EJ6A 3ETFA 2ONNA 4I2RA 3U4JA 2O2PA 4X2QA 5A2DC 2W8OA 4IYMA 2EHQA 4QJEB 3IWJA 4ZVXA 5EXFA 3V9IA 4I8PA 2VROA 3RHQA 2Y53A 2ESDA 2EIWA 1EYYA 4O6RA 3SZBA 5AC2A 1T90A 5EEBA 3I44A 2WMEC 4QGKA 4QN2A 1BI9A 1O9JA 2QE0A
chains in the Genus database with same CATH superfamily
3RHOA 4I3VA 4QJEA 5L2NA 4NPIA 1AG8A 1BXSA 2J5NA 4FQFA 2EIIA 4CAZA 5KLKA 4I8QA 3JZ4A 4OHTA 5EUYA 4IDMA 3VZ2A 1O05A 4LIHA 4Q92A 4ZVYA 4ZWLA 4GHKA 3V9JA 5J78A 1KY8A 5EYUA 2W8QA 4I3UA 3RHRA 2D4EA 3QANA 4QYJA 2BJAA 4L2OA 4LH2A 4X0TA 1QI1A 4U3WA 5EZ4A 2BHQA 3R31A 4DALA 4QTOA 4H73A 3ZQAA 1EZ0A 5AC0A 5KLNA 1WNBA 4GO0A 4I26A 1ZUMA 2O2RA 4JDCA 4LH1A 5F2CA 3VZ3A 3V9KA 3V9GA 5J7IA 5DBVA 4PZ2A 4PXLB 4E3XA 2ID2A 4X4LA 4I3XA 4GNZA 3N83A 4MPBA 1CW3A 1O04A 3EFVA 3EK1A 4OU2A 2WOXA 4V3FC 4DNGA 1WNDA 1A4SA 3RH9A 4YWVA 1O00A 2ONMA 3N82A 2VLEA 4NU9A 2ILUA 2IY6A 4I1WA 4OE2A 2BHPA 3ROSA 3TY7A 1NZZA 1UXRA 2OPXA 4PXLA 4H7NA 5KF0A 2H5GA 4C3SA 5L13A 4I3WA 5AC1A 4IDSA 3RHPA 4LH3A 1UXQA 5KLLA 1UXUA 4ZZ7A 2BJKA 2EUHA 1UXPA 2HG2A 4ZUKA 1NZXA 4I9BA 4NEAA 4F3XA 4MPYA 1UXTA 2EITA 4KWGA 5EK6A 4E4GA 3N80A 5L2MA 3V9HA 1UXVA 3SZAA 1VLUA 1O02A 2WMEA 4LH0A 4ZVWA 4OGDA 4QETA 4O5HA 3VZ1A 3RHDA 1A4ZA 1AD3A 4GO4A 4NS3A 1QI6A 4A0MA 5L2OA 3R64A 5DRUA 4KWFA 4ITBA 4OE4A 4LEMA 3VZ0A 1UZBA 5A2DD 3V9LA 4OE5A 2EJLA 5JRYA 4ITAA 3K2WA 2W8PA 5KLMA 2EHUA 4K57A 4WP7A 4PXNA 1BPWA 4WB9A 3B4WA 4L1OA 3MY7A 4IT9A 2O2QA 4NMJA 2Y51A 4I25A 3RHHA 3PRLA 3RHMA 3K9DA 4GO2A 5A2DA 2W8RA 4H80A 4IHIA 4ZULA 4V37A 4WJ9A 2EJDA 2J40A 4WPNA 4I3TA 4ZXUA 4X0UA 3SZ9A 4NMKA 2Y5DA 3IWKA 3INLA 3N81A 3INJA 5J6BA 4JZ6A 4YWUA 4CBBA 2JG7A 2W8NA 5KJ5A 1O01A 4V3FA 4OE6A 4KNAA 4OUBA 2ONOA 4LGZA 2ONPA 1EUHA 4JBEA 3RHLA 3RHJA 4YWEA 5ABMA 2J6LA 2XDRA 5KLOA 2Y52A 5FHZA 4GO3A 4FR8A 4QF6A 1UXNA 2IMPA 5EKCA 3RJLA 3V4CA 1O20A 1NZWA 5DIBA 3PQAA 3JU8A 2EJ6A 3ETFA 2ONNA 4I2RA 3U4JA 2O2PA 4X2QA 5A2DC 2W8OA 4IYMA 2EHQA 4QJEB 3IWJA 4ZVXA 5EXFA 3V9IA 4I8PA 2VROA 3RHQA 2Y53A 2ESDA 2EIWA 1EYYA 4O6RA 3SZBA 5AC2A 1T90A 5EEBA 3I44A 2WMEC 4QGKA 4QN2A 1BI9A 1O9JA 2QE0A
chains in the Genus database with same CATH topology
3RHOA 4I3VA 4QJEA 5L2NA 4NPIA 1AG8A 1BXSA 2J5NA 4FQFA 2EIIA 4CAZA 5KLKA 4I8QA 3JZ4A 4OHTA 5EUYA 4IDMA 3VZ2A 1O05A 4LIHA 4Q92A 4ZVYA 4ZWLA 4GHKA 3V9JA 5J78A 1KY8A 5EYUA 2W8QA 4I3UA 3RHRA 2D4EA 3QANA 4QYJA 2BJAA 4L2OA 4LH2A 4X0TA 1QI1A 4U3WA 5EZ4A 2BHQA 3R31A 4DALA 4QTOA 4H73A 3ZQAA 1EZ0A 5AC0A 5KLNA 1WNBA 4GO0A 4I26A 1ZUMA 2O2RA 4JDCA 4LH1A 5F2CA 3VZ3A 3V9KA 3V9GA 5J7IA 5DBVA 4PZ2A 4PXLB 4E3XA 2ID2A 4X4LA 4I3XA 4GNZA 3N83A 4MPBA 1CW3A 1O04A 3EFVA 3EK1A 4OU2A 2WOXA 4V3FC 4DNGA 1WNDA 1A4SA 3RH9A 4YWVA 1O00A 2ONMA 3N82A 2VLEA 4NU9A 2ILUA 2IY6A 4I1WA 4OE2A 2BHPA 3ROSA 3TY7A 1NZZA 1UXRA 2OPXA 4PXLA 4H7NA 5KF0A 2H5GA 4C3SA 5L13A 4I3WA 5AC1A 4IDSA 3RHPA 4LH3A 1UXQA 5KLLA 1UXUA 4ZZ7A 2BJKA 2EUHA 1UXPA 2HG2A 4ZUKA 1NZXA 4I9BA 4NEAA 4F3XA 4MPYA 1UXTA 2EITA 4KWGA 5EK6A 4E4GA 3N80A 5L2MA 3V9HA 1UXVA 3SZAA 1VLUA 1O02A 2WMEA 4LH0A 4ZVWA 4OGDA 4QETA 4O5HA 3VZ1A 3RHDA 1A4ZA 1AD3A 4GO4A 4NS3A 1QI6A 4A0MA 5L2OA 3R64A 5DRUA 4KWFA 4ITBA 4OE4A 4LEMA 3VZ0A 1UZBA 5A2DD 3V9LA 4OE5A 2EJLA 5JRYA 4ITAA 3K2WA 2W8PA 5KLMA 2EHUA 4K57A 4WP7A 4PXNA 1BPWA 4WB9A 3B4WA 4L1OA 3MY7A 4IT9A 2O2QA 4NMJA 2Y51A 4I25A 3RHHA 3PRLA 3RHMA 3K9DA 4GO2A 5A2DA 2W8RA 4H80A 4IHIA 4ZULA 4V37A 4WJ9A 2EJDA 2J40A 4WPNA 4I3TA 4ZXUA 4X0UA 3SZ9A 4NMKA 2Y5DA 3IWKA 3INLA 3N81A 3INJA 5J6BA 4JZ6A 4YWUA 4CBBA 2JG7A 2W8NA 5KJ5A 1O01A 4V3FA 4OE6A 4KNAA 4OUBA 2ONOA 4LGZA 2ONPA 1EUHA 4JBEA 3RHLA 3RHJA 4YWEA 5ABMA 2J6LA 2XDRA 5KLOA 2Y52A 5FHZA 4GO3A 4FR8A 4QF6A 1UXNA 2IMPA 5EKCA 3RJLA 3V4CA 1O20A 1NZWA 5DIBA 3PQAA 3JU8A 2EJ6A 3ETFA 2ONNA 4I2RA 3U4JA 2O2PA 4X2QA 5A2DC 2W8OA 4IYMA 2EHQA 4QJEB 3IWJA 4ZVXA 5EXFA 3V9IA 4I8PA 2VROA 3RHQA 2Y53A 2ESDA 2EIWA 1EYYA 4O6RA 3SZBA 5AC2A 1T90A 5EEBA 3I44A 2WMEC 4QGKA 4QN2A 1BI9A 1O9JA 2QE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RHO A;  4I3V A;  4QJE A;  5L2N A;  4NPI A;  1AG8 A;  1BXS A;  2J5N A;  4FQF A;  2EII A;  4CAZ A;  5KLK A;  4I8Q A;  3JZ4 A;  4OHT A;  5EUY A;  4IDM A;  3VZ2 A;  1O05 A;  4LIH A;  4Q92 A;  4ZVY A;  4ZWL A;  4GHK A;  3V9J A;  5J78 A;  1KY8 A;  5EYU A;  2W8Q A;  4I3U A;  3RHR A;  2D4E A;  3QAN A;  4QYJ A;  2BJA A;  4L2O A;  4LH2 A;  4X0T A;  1QI1 A;  4U3W A;  5EZ4 A;  2BHQ A;  3R31 A;  4DAL A;  4QTO A;  4H73 A;  3ZQA A;  1EZ0 A;  5AC0 A;  5KLN A;  1WNB A;  4GO0 A;  4I26 A;  1ZUM A;  2O2R A;  4JDC A;  4LH1 A;  5F2C A;  3VZ3 A;  3V9K A;  3V9G A;  5J7I A;  5DBV A;  4PZ2 A;  4PXL B;  4E3X A;  2ID2 A;  4X4L A;  4I3X A;  4GNZ A;  3N83 A;  4MPB A;  1CW3 A;  1O04 A;  3EFV A;  3EK1 A;  4OU2 A;  2WOX A;  4V3F C;  4DNG A;  1WND A;  1A4S A;  3RH9 A;  4YWV A;  1O00 A;  2ONM A;  3N82 A;  2VLE A;  4NU9 A;  2ILU A;  2IY6 A;  4I1W A;  4OE2 A;  2BHP A;  3ROS A;  3TY7 A;  1NZZ A;  1UXR A;  2OPX A;  4PXL A;  4H7N A;  5KF0 A;  2H5G A;  4C3S A;  5L13 A;  4I3W A;  5AC1 A;  4IDS A;  3RHP A;  4LH3 A;  1UXQ A;  5KLL A;  1UXU A;  4ZZ7 A;  2BJK A;  2EUH A;  1UXP A;  2HG2 A;  4ZUK A;  1NZX A;  4I9B A;  4NEA A;  4F3X A;  4MPY A;  1UXT A;  2EIT A;  4KWG A;  5EK6 A;  4E4G A;  3N80 A;  5L2M A;  3V9H A;  1UXV A;  3SZA A;  1VLU A;  1O02 A;  2WME A;  4LH0 A;  4ZVW A;  4OGD A;  4QET A;  4O5H A;  3VZ1 A;  3RHD A;  1A4Z A;  1AD3 A;  4GO4 A;  4NS3 A;  1QI6 A;  4A0M A;  5L2O A;  3R64 A;  5DRU A;  4KWF A;  4ITB A;  4OE4 A;  4LEM A;  3VZ0 A;  1UZB A;  5A2D D;  3V9L A;  4OE5 A;  2EJL A;  5JRY A;  4ITA A;  3K2W A;  2W8P A;  5KLM A;  2EHU A;  4K57 A;  4WP7 A;  4PXN A;  1BPW A;  4WB9 A;  3B4W A;  4L1O A;  3MY7 A;  4IT9 A;  2O2Q A;  4NMJ A;  2Y51 A;  4I25 A;  3RHH A;  3PRL A;  3RHM A;  3K9D A;  4GO2 A;  5A2D A;  2W8R A;  4H80 A;  4IHI A;  4ZUL A;  4V37 A;  4WJ9 A;  2EJD A;  2J40 A;  4WPN A;  4I3T A;  4ZXU A;  4X0U A;  3SZ9 A;  4NMK A;  2Y5D A;  3IWK A;  3INL A;  3N81 A;  3INJ A;  5J6B A;  4JZ6 A;  4YWU A;  4CBB A;  2JG7 A;  2W8N A;  5KJ5 A;  1O01 A;  4V3F A;  4OE6 A;  4KNA A;  4OUB A;  2ONO A;  4LGZ A;  2ONP A;  1EUH A;  4JBE A;  3RHL A;  3RHJ A;  4YWE A;  5ABM A;  2J6L A;  2XDR A;  5KLO A;  2Y52 A;  5FHZ A;  4GO3 A;  4FR8 A;  4QF6 A;  1UXN A;  2IMP A;  5EKC A;  3RJL A;  3V4C A;  1O20 A;  1NZW A;  5DIB A;  3PQA A;  3JU8 A;  2EJ6 A;  3ETF A;  2ONN A;  4I2R A;  3U4J A;  2O2P A;  4X2Q A;  5A2D C;  2W8O A;  4IYM A;  2EHQ A;  4QJE B;  3IWJ A;  4ZVX A;  5EXF A;  3V9I A;  4I8P A;  2VRO A;  3RHQ A;  2Y53 A;  2ESD A;  2EIW A;  1EYY A;  4O6R A;  3SZB A;  5AC2 A;  1T90 A;  5EEB A;  3I44 A;  2WME C;  4QGK A;  4QN2 A;  1BI9 A;  1O9J A;  2QE0 A; 
#chains in the Genus database with same CATH topology
 3RHO A;  4I3V A;  4QJE A;  5L2N A;  4NPI A;  1AG8 A;  1BXS A;  2J5N A;  4FQF A;  2EII A;  4CAZ A;  5KLK A;  4I8Q A;  3JZ4 A;  4OHT A;  5EUY A;  4IDM A;  3VZ2 A;  1O05 A;  4LIH A;  4Q92 A;  4ZVY A;  4ZWL A;  4GHK A;  3V9J A;  5J78 A;  1KY8 A;  5EYU A;  2W8Q A;  4I3U A;  3RHR A;  2D4E A;  3QAN A;  4QYJ A;  2BJA A;  4L2O A;  4LH2 A;  4X0T A;  1QI1 A;  4U3W A;  5EZ4 A;  2BHQ A;  3R31 A;  4DAL A;  4QTO A;  4H73 A;  3ZQA A;  1EZ0 A;  5AC0 A;  5KLN A;  1WNB A;  4GO0 A;  4I26 A;  1ZUM A;  2O2R A;  4JDC A;  4LH1 A;  5F2C A;  3VZ3 A;  3V9K A;  3V9G A;  5J7I A;  5DBV A;  4PZ2 A;  4PXL B;  4E3X A;  2ID2 A;  4X4L A;  4I3X A;  4GNZ A;  3N83 A;  4MPB A;  1CW3 A;  1O04 A;  3EFV A;  3EK1 A;  4OU2 A;  2WOX A;  4V3F C;  4DNG A;  1WND A;  1A4S A;  3RH9 A;  4YWV A;  1O00 A;  2ONM A;  3N82 A;  2VLE A;  4NU9 A;  2ILU A;  2IY6 A;  4I1W A;  4OE2 A;  2BHP A;  3ROS A;  3TY7 A;  1NZZ A;  1UXR A;  2OPX A;  4PXL A;  4H7N A;  5KF0 A;  2H5G A;  4C3S A;  5L13 A;  4I3W A;  5AC1 A;  4IDS A;  3RHP A;  4LH3 A;  1UXQ A;  5KLL A;  1UXU A;  4ZZ7 A;  2BJK A;  2EUH A;  1UXP A;  2HG2 A;  4ZUK A;  1NZX A;  4I9B A;  4NEA A;  4F3X A;  4MPY A;  1UXT A;  2EIT A;  4KWG A;  5EK6 A;  4E4G A;  3N80 A;  5L2M A;  3V9H A;  1UXV A;  3SZA A;  1VLU A;  1O02 A;  2WME A;  4LH0 A;  4ZVW A;  4OGD A;  4QET A;  4O5H A;  3VZ1 A;  3RHD A;  1A4Z A;  1AD3 A;  4GO4 A;  4NS3 A;  1QI6 A;  4A0M A;  5L2O A;  3R64 A;  5DRU A;  4KWF A;  4ITB A;  4OE4 A;  4LEM A;  3VZ0 A;  1UZB A;  5A2D D;  3V9L A;  4OE5 A;  2EJL A;  5JRY A;  4ITA A;  3K2W A;  2W8P A;  5KLM A;  2EHU A;  4K57 A;  4WP7 A;  4PXN A;  1BPW A;  4WB9 A;  3B4W A;  4L1O A;  3MY7 A;  4IT9 A;  2O2Q A;  4NMJ A;  2Y51 A;  4I25 A;  3RHH A;  3PRL A;  3RHM A;  3K9D A;  4GO2 A;  5A2D A;  2W8R A;  4H80 A;  4IHI A;  4ZUL A;  4V37 A;  4WJ9 A;  2EJD A;  2J40 A;  4WPN A;  4I3T A;  4ZXU A;  4X0U A;  3SZ9 A;  4NMK A;  2Y5D A;  3IWK A;  3INL A;  3N81 A;  3INJ A;  5J6B A;  4JZ6 A;  4YWU A;  4CBB A;  2JG7 A;  2W8N A;  5KJ5 A;  1O01 A;  4V3F A;  4OE6 A;  4KNA A;  4OUB A;  2ONO A;  4LGZ A;  2ONP A;  1EUH A;  4JBE A;  3RHL A;  3RHJ A;  4YWE A;  5ABM A;  2J6L A;  2XDR A;  5KLO A;  2Y52 A;  5FHZ A;  4GO3 A;  4FR8 A;  4QF6 A;  1UXN A;  2IMP A;  5EKC A;  3RJL A;  3V4C A;  1O20 A;  1NZW A;  5DIB A;  3PQA A;  3JU8 A;  2EJ6 A;  3ETF A;  2ONN A;  4I2R A;  3U4J A;  2O2P A;  4X2Q A;  5A2D C;  2W8O A;  4IYM A;  2EHQ A;  4QJE B;  3IWJ A;  4ZVX A;  5EXF A;  3V9I A;  4I8P A;  2VRO A;  3RHQ A;  2Y53 A;  2ESD A;  2EIW A;  1EYY A;  4O6R A;  3SZB A;  5AC2 A;  1T90 A;  5EEB A;  3I44 A;  2WME C;  4QGK A;  4QN2 A;  1BI9 A;  1O9J A;  2QE0 A; 
#chains in the Genus database with same CATH homology
 3RHO A;  4I3V A;  4QJE A;  5L2N A;  4NPI A;  1AG8 A;  1BXS A;  2J5N A;  4FQF A;  2EII A;  4CAZ A;  5KLK A;  4I8Q A;  3JZ4 A;  4OHT A;  5EUY A;  4IDM A;  3VZ2 A;  1O05 A;  4LIH A;  4Q92 A;  4ZVY A;  4ZWL A;  4GHK A;  3V9J A;  5J78 A;  1KY8 A;  5EYU A;  2W8Q A;  4I3U A;  3RHR A;  2D4E A;  3QAN A;  4QYJ A;  2BJA A;  4L2O A;  4LH2 A;  4X0T A;  1QI1 A;  4U3W A;  5EZ4 A;  2BHQ A;  3R31 A;  4DAL A;  4QTO A;  4H73 A;  3ZQA A;  1EZ0 A;  5AC0 A;  5KLN A;  1WNB A;  4GO0 A;  4I26 A;  1ZUM A;  2O2R A;  4JDC A;  4LH1 A;  5F2C A;  3VZ3 A;  3V9K A;  3V9G A;  5J7I A;  5DBV A;  4PZ2 A;  4PXL B;  4E3X A;  2ID2 A;  4X4L A;  4I3X A;  4GNZ A;  3N83 A;  4MPB A;  1CW3 A;  1O04 A;  3EFV A;  3EK1 A;  4OU2 A;  2WOX A;  4V3F C;  4DNG A;  1WND A;  1A4S A;  3RH9 A;  4YWV A;  1O00 A;  2ONM A;  3N82 A;  2VLE A;  4NU9 A;  2ILU A;  2IY6 A;  4I1W A;  4OE2 A;  2BHP A;  3ROS A;  3TY7 A;  1NZZ A;  1UXR A;  2OPX A;  4PXL A;  4H7N A;  5KF0 A;  2H5G A;  4C3S A;  5L13 A;  4I3W A;  5AC1 A;  4IDS A;  3RHP A;  4LH3 A;  1UXQ A;  5KLL A;  1UXU A;  4ZZ7 A;  2BJK A;  2EUH A;  1UXP A;  2HG2 A;  4ZUK A;  1NZX A;  4I9B A;  4NEA A;  4F3X A;  4MPY A;  1UXT A;  2EIT A;  4KWG A;  5EK6 A;  4E4G A;  3N80 A;  5L2M A;  3V9H A;  1UXV A;  3SZA A;  1VLU A;  1O02 A;  2WME A;  4LH0 A;  4ZVW A;  4OGD A;  4QET A;  4O5H A;  3VZ1 A;  3RHD A;  1A4Z A;  1AD3 A;  4GO4 A;  4NS3 A;  1QI6 A;  4A0M A;  5L2O A;  3R64 A;  5DRU A;  4KWF A;  4ITB A;  4OE4 A;  4LEM A;  3VZ0 A;  1UZB A;  5A2D D;  3V9L A;  4OE5 A;  2EJL A;  5JRY A;  4ITA A;  3K2W A;  2W8P A;  5KLM A;  2EHU A;  4K57 A;  4WP7 A;  4PXN A;  1BPW A;  4WB9 A;  3B4W A;  4L1O A;  3MY7 A;  4IT9 A;  2O2Q A;  4NMJ A;  2Y51 A;  4I25 A;  3RHH A;  3PRL A;  3RHM A;  3K9D A;  4GO2 A;  5A2D A;  2W8R A;  4H80 A;  4IHI A;  4ZUL A;  4V37 A;  4WJ9 A;  2EJD A;  2J40 A;  4WPN A;  4I3T A;  4ZXU A;  4X0U A;  3SZ9 A;  4NMK A;  2Y5D A;  3IWK A;  3INL A;  3N81 A;  3INJ A;  5J6B A;  4JZ6 A;  4YWU A;  4CBB A;  2JG7 A;  2W8N A;  5KJ5 A;  1O01 A;  4V3F A;  4OE6 A;  4KNA A;  4OUB A;  2ONO A;  4LGZ A;  2ONP A;  1EUH A;  4JBE A;  3RHL A;  3RHJ A;  4YWE A;  5ABM A;  2J6L A;  2XDR A;  5KLO A;  2Y52 A;  5FHZ A;  4GO3 A;  4FR8 A;  4QF6 A;  1UXN A;  2IMP A;  5EKC A;  3RJL A;  3V4C A;  1O20 A;  1NZW A;  5DIB A;  3PQA A;  3JU8 A;  2EJ6 A;  3ETF A;  2ONN A;  4I2R A;  3U4J A;  2O2P A;  4X2Q A;  5A2D C;  2W8O A;  4IYM A;  2EHQ A;  4QJE B;  3IWJ A;  4ZVX A;  5EXF A;  3V9I A;  4I8P A;  2VRO A;  3RHQ A;  2Y53 A;  2ESD A;  2EIW A;  1EYY A;  4O6R A;  3SZB A;  5AC2 A;  1T90 A;  5EEB A;  3I44 A;  2WME C;  4QGK A;  4QN2 A;  1BI9 A;  1O9J A;  2QE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...