5L3AA

Fragment-based discovery of 6-arylindazole jak inhibitors
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEFFKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Fragment-Based Discovery of 6-Arylindazole JAK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5l3aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5l3aA01
4YJOA 3DDQA 4ZMEA 4TWNA 4JR7A 4XV9A 5HICA 4EQCA 1IAHA 4A06A 1R0EA 3TN8A 5H8GA 5DRDA 4FTTA 3CLYA 4FV2A 4PPCA 1AGWA 5C8MA 4IW0A 4XG4A 3HV3A 5DR6A 1P4FA 3GU6A 3JVSA 3PRIA 1Q61A 4ZSGA 2R3KA 3LXLA 5ANOA 5K3YA 4EWHA 4EKKA 4J7BA 2VO6A 3DAEA 4W4VA 3TNIA 1GY3A 2R0IA 4EH3A 3G15A 4I93A 3ZH8A 4ENXA 3HUBA 2XNEA 4AXAA 1OUKA 1RDQE 4FG8A 3CXWA 5CU2A 4ACGA 4I5HA 3R8ZA 2I1MA 2IW6A 4TYJA 3G51A 1U4DA 2X4FA 3R2YA 3G9LX 4GVAA 4BKZA 4O81A 5C4LA 4M69B 4D1SA 3BWJA 3FC1X 1SVEA 3DB8A 1IAJA 3PG3A 3KVWA 4XLVA 4FYNA 4ZTRA 3LXPA 1JKKA 2CSNA 4AF3A 3MVHA 1ZARA 3CR0A 5HIEA 3WILA 4GKHA 4LFIA 4C57A 2XCKA 2PVYA 3A60A 4RMZA 4F0FA 4RIXA 3E93A 4FF8A 3V5PA 5HOAA 4APPA 2J6MA 3VUTA 4FZAB 5I9ZA 3U55A 1Y91A 3FLYA 5I0BA 5AFVA 4M67A 4MKCA 4QNAA 5CLPA 5LXMA 4Y95A 3NS9A 3V5LA 3R9HA 2IO6A 4F7SA 4DH8A 4D2VA 4AZEA 4YJNA 3F5GA 3QC9A 4EI4A 4FSZA 3A7GA 1OPKA 3W1FA 4ACMA 3R1SA 5CNNA 5BNJA 3S0OA 5HGIA 4U80A 2Y6OA 3EN5A 4NW6A 3CD3A 3IOPA 4ZSAA 2BDFA 2W9ZB 3KEXA 4W8DA 4AW0A 5J1WA 3K54A 4IX5A 2XNBA 3A7IA 3PA3A 4IB0A 2Z60A 4YPDA 3RCJA 4FEXA 4O7WA 3D7TA 5E8VA 3R9OA 4H36A 3DY7A 5KMJA 3ZEPA 5EM7A 5M56A 5M55A 2REIA 5CU3A 3AGLA 1YW2A 2XKDA 2O64A 3CJGA 1Z5MA 2VD5A 2YDJA 2J7TA 3LFSA 5CEOA 3NUAA 1V0BA 3Q96A 4K1BA 5AR7A 4RWJA 4EKLA 5FEEA 4H58A 4UN0C 2PWLA 4CVAA 3D14A 3SQQA 4D0XA 2OF4A 4XG3A 3BEAA 3Q4ZA 3RK9A 5J7BA 4WIHA 2YIWA 5LQFA 3VBQA 5IG1A 4DC2A 4KIPA 4UEUA 4UXLA 3R7UA 4F63A 2JC6A 2OSCA 2C69A 4U42A 4F6WA 2XJ1A 2R7IA 5A4CA 2E9PA 4CV8A 4B8MA 3CPCA 5GJFA 4FV7A 2BR1A 3QTUA 3UC4A 1Q24A 4E93A 2C30A 1KSWA 4MQ2A 5C4KA 3D5WA 1EH4A 1ZZLA 5HBEA 1J7IA 4YJTA 5CQWA 4C3FA 5HVKA 3QRJA 3UPZA 2J5FA 4E5BA 1YOJA 2C6KA 3REPA 4BZNA 1B6CB 3EQDA 4GG5A 4NCTA 2CHLA 3ORXA 3ULIA 4RJ6A 4CZUA 3A7JA 2CKQA 1WCCA 4B8LA 1DI8A 4WNPA 4FEQA 2WTKC 3E8DA 2VTPA 3B2TA 4RIXB 2W96B 1U5RA 3VBWA 4E5WA 3CSVA 2UVYA 4ITIA 4QMTA 4TNBA 3B2WA 4IAZA 4MD8E 4EOSA 3ZC5A 4EC9A 2HENA 1YKRA 3WE4A 4BCQA 4X2KA 2ACXA 3W2SA 5AAEA 4C0TA 5E8ZA 5DBXA 4PDPA 3QLGA 1F5QA 4GUEA 3C0IA 3RCDA 3WIKA 5FEDA 5DT4A 4I5PA 4FSYA 2YM8A 3CC6A 5A9UA 3P7AA 4EZ7A 5D9HA 3OP5A 1HCKA 1YWVA 2GS7A 2I0HA 4BBEA 5KKRB 1UNLA 1LP4A 4NM3A 3W2OA 4YZBA 3UGCA 4AN3A 4FTLA 4YUQA 2PU8A 3SLSA 4O7ZA 4DGGA 5M57A 3D7TB 1MRUA 3FL5A 3JPVA 3T3UA 3O7LD 3ZZEA 3RK5A 3N4VA 4Y5HA 4G9CA 4EOKA 4ZXTA 2PVLA 3NUYA 2VTAA 4EJNA 1YDSE 2C3IB 5BQ0A 5FXQA 3QKLA 4UMPA 4M68A 5DRBA 2BRNA 1JSVA 2ITYA 2OBJA 4G3EA 2XK8A 5A6OA 5L6OA 2XCHA 5E4HA 3ALNA 2NP8A 3MI9A 4PPAA 3ZSIA 4ZIMA 5ICPA 5DHJA 2VNYA 3PWDA 4BTKA 4N57A 4EUUA 5AEPA 5CEPA 2UZDA 2XP2A 5H3QA 2X2LA 4RX8A 5HTCA 4EK5A 5BVOA 3FSFA 1YI6A 5HESA 3ZFYA 2QOFA 3QWJA 4DTKA 1O6LA 4IQ6A 2WQOA 3VNTA 1BL7A 4FIFA 3HYHA 5E8WA 5AM6A 5DA3A 4MBLA 5KBQA 1Q8TA 2WZJA 4OTDA 1IG1A 3I5ZA 3PVBA 3SA0A 2Y7JA 2C6TA 4BC6A 4QMUA 2PVJA 5T6KA 4GU6A 3VBTA 3GQIA 2DUVA 4NKAA 3EHAA 4FV8A 3MESA 3A2CA 3OWKA 2YAAA 2QR7A 3R8MA 3I79A 2ZAZA 2OXDA 3ZDIA 3CD8A 4L3LA 4FNXA 4L01A 2UZTA 3RZBA 4FTRA 3WF7A 4BDGA 1JKSA 3C5UA 2EXCX 4QYGA 4GYIA 3UIBA 4EEVA 1J7UA 2UW0A 1H00A 3KCFA 1H1SA 5L6PA 4L43A 3GQLA 4O2PA 2W06A 3OEZA 3TJDA 5DT0A 4QP4A 4NKSA 1NY3A 4FV1A 4I5MA 3QUEA 4AX8A 2VTJA 4G5PA 3F2RA 2C6EA 3R04A 3QF9A 2QOHA 4YJQA 4U0IA 3LFDA 4QPAA 4QQTA 2BZKB 4U8ZA 4OTGA 5K4IA 2CN8A 2PE2A 4MBJA 1U46A 3NNWA 3V8WA 5DR9A 3BBWA 2VX1A 4XG7A 2XNPA 4BCJA 3RHXA 3E63A 3N9XA 4EONA 4XBRA 4FEVA 2V22A 3M1SA 3SDJA 3VN9A 1BYGA 4G3DA 4L00A 3FC2A 2DQ7X 1XH4A 4GIIA 4KRDA 4YU2A 3KRRA 4O2ZA 3WYXA 3KC3A 4Z55A 3PSBA 2OKRA 3UO5A 2PPQA 5C03A 4G6LA 4F70A 4I0RA 1UU7A 4ID7A 5IQCA 3LJ2A 3MA6A 2ZMDA 5AP7A 1PKGA 3G0FA 2QVSE 4Y46A 3R01A 2VGOA 2B0QA 4ZLYA 4K33A 2WHBA 5H9BA 4BR3A 4Y73A 1H07A 4PP9A 2YIQA 5FTQA 4P2KA 2P33A 5D7AA 4A9YA 4E5AX 4NK9A 2VTQA 1HOWA 4GK2A 5T68A 2OLCA 4FOCA 4I6BA 5HKMA 3KXZA 3CKWA 4N6YA 4QP1A 3KREA 3UZRA 2BFYA 2Y9QA 4FV0A 5CZIA 4ZTQA 2W4OA 3RM7A 3LHJA 3KRXA 4RJ8A 5KMKA 5H8EA 2XBAA 3KU2A 4WNOA 3QLFA 3Q4CA 4LM5A 4FICA 4HGTA 4YC8A 5JRSA 3R8PA 2OZAA 4BRXA 3ORZA 2QU6A 2OF2A 3DBCA 3LFCA 2VTNA 4RWKA 5DOSA 3VS7A 1OPJA 4TY1A 3Q6UA 3HV6A 1FMOE 3EIDA 2P2IA 3DKOA 5FG8A 3UODA 3C4FA 3I4BA 3RWQA 5LMBA 3LLAA 2XYUA 2XYNA 5LWNA 2CJMA 4Y85A 2BAJA 2HXLA 3QALE 4DITA 4DH5A 3OW3A 4CFWA 4LGDA 5LVNA 4N6ZA 3D2KA 3V6RA 3EN7A 4G31A 4WT6A 3SC1A 5DYJA 3FMLA 2B4SB 2QONA 2X8IA 5HHWA 4GL9A 3GCUA 3A99A 2EB2A 3OD6X 3R2BA 5EM6A 4DF3A 4D4VA 3ZUVA 1QPJA 4C02A 1REKA 4PWNA 4DTAA 3QQUA 3C1XA 2O2UA 3DAKA 3EB0A 2GU8A 4J52A 2RG6A 5ANDA 1PW2A 2BFXA 3OCBA 5BVFA 3IDCA 4RX7A 4S2ZA 3NAXA 2IZRA 2WTKB 4M14A 4K9YA 5HO7A 4YLLA 4M7IA 2RFNA 3OFMA 4HYHA 4YO6A 4C33A 4ZY4A 4OTQA 3COIA 3KULA 3NDMA 5JEBA 1QPCA 3U54A 4D2WA 3F5PA 1IA8A 3SXFA 4C35A 2YCRA 2HZNA 3BGZA 4HCUA 2UZOA 1IR3A 2IZUA 2WTCA 3AMYA 4HVSA 2P0CA 4U81A 4C58A 2UW3A 2UZWE 3KY2A 3PIXA 2PY3A 2RGPA 4M15A 4QNYA 2XF0A 4IZAA 3TDWA 4PUZA 4I6HA 3GU5A 1I44A 1J1BA 3NUXA 3R6XA 4NUSA 1ZYDA 1GOLA 3E88A 5DG5A 5HG8A 3TNWA 3SVVA 5DR2A 4FNZA 3IW4A 4CV9A 3Q53A 4E20A 3GNIB 3ORLA 4ZZNA 2XM9A 2PULA 3MW1A 1SNUA 3GC9A 2OG8A 3C4XA 5FDXA 3CTHA 2WMQA 2FSMX 4RIOA 1DM2A 1VYZA 1O9UA 4X3JA 4DAWA 4EBWA 4HVIA 3CGFA 5AJQA 3Q9WA 3UVRA 4Y5QA 4NFNA 1WZYA 3EL8A 3KXHA 2BMCA 3DTWA 5GJDA 5CAQA 3HKOA 2AC3A 2JFMA 2CN5A 2F49A 3F3VA 3H10A 4HOKA 2GCDA 2OZAB 5DNRA 2WEVA 4J8NA 3WF5A 2GQSA 5EQYA 3E8NA 1PXKA 4QYYA 2PMLX 5DVRA 4UWBA 2GNJA 3VS0A 4MXAA 3MBLA 3C9WA 3IDBA 4O0XA 4ZTMA 3MFTA 3V6SA 5EFQA 1T45A 3MFUA 4RG0A 3QBNA 4F1OA 2XB7A 3IW7A 5CAVA 5DMZA 3M2WA 1JQHA 4FT3A 5TOZA 2EXMA 3QTSA 2X4ZA 5HEZA 3BHTA 2ERKA 3QTWA 4YPSA 5AUUA 5C9CA 3Q2JA 4JDKA 3NYOA 4IXPA 3R9NA 3TWJA 3UJGA 2ONLC 3HMIA 3NR9A 3NVKI 5CZHA 4D2RA 2YM4A 5D41A 2WD1A 1BI7A 4J8MA 4FTOA 1JOWB 3Q4UA 3L8PA 1R3CA 4PPBA 4FOBA 5C1QB 5IPJA 1ZOEA 4TT7A 5A4TA 4MVFA 4AW2A 2HZIA 2GHGA 5FQDC 5C01A 4UMRA 2X6EA 5FXRA 4AOJA 4GJ2A 4AA4A 2IW9A 2A0CX 3VO3A 3BU6A 4PRJA 3NZ0A 3VQHA 4AFJA 5BYZA 4NWMA 1B38A 2J2IB 4IE9A 4Z7HA 4OTIA 2OIBA 5CSHA 2OJIA 2XIXA 1LEWA 3A4PA 4W9XA 2PE0A 3KULB 3KXXA 4IDVA 3E5AA 4C2VA 1PXLA 2C47A 1M2PA 4EH6A 2WU6A 4UMQA 2WOUA 5EDRA 3PWYA 4RJ4A 3QHRA 4NT4A 4BCIA 3QX4A 4LRJA 1VJYA 1TVOA 4EUTA 4JG7A 3O2MA 1R39A 3FHIA 1SVGA 4YZ9A 3FLQA 4FL1A 5A4QA 4W4YA 5IQFA 3ZDUA 3F82A 4QMNA 3N51A 2JDSA 4BF2A 3IONA 4BFMA 4FIEA 4F9YA 3QGYA 5D7VA 3PPJA 4KKHA 2BZJA 4DG3E 2HYYA 3LCDA 5BVNA 4ZY5A 2GFCA 4C4IA 3AC1A 3DJ7A 3TDVA 4Y72A 2AUHA 3VS3A 4YZCA 2ITNA 4X6RA 5JFSA 3FI2A 3FI4A 4JXFA 4MQ1A 1KV2A 2GTNA 4EHZA 4FA2A 4S30A 3R7OA 2VWUA 3SRVA 4EOLA 1XKKA 2UZVA 5J9ZA 3IPHA 4XG6A 5IUHA 3NUNA 1A9UA 2Y4IB 2O3PA 2W4KA 1Q8WA 1UVRA 5IMXA 3O17A 2RIOA 3FDNA 3HNGA 3FPMA 4CTBA 2EWAA 4AOTA 3TTJA 4Y8DA 5HVYA 3NEWA 4YHJA 3D7ZA 4CFNA 3QZHA 4BKJA 3FEGA 3UG2A 4FTQA 4GRBA 3FI8A 3GU7A 3IGOA 4QMSA 3V3VA 4I41A 1PY5A 5L2QA 2XNNA 1ZYJA 4EQUA 2IVTA 4QTBA 5EDQA 1E9HA 3P9JA 4WG5A 3UZPA 2Z7LA 2XIKA 2FGIA 3F66A 4IWQA 3BYUA 2X7FA 2J90A 2C1AA 1MRYA 1YDTE 2RFEA 3D5XA 2WQMA 3KF4A 3ORKA 4FC0A 3TUCA 4EZ5A 3FXXA 1OITA 2UW7A 4FV9A 4AW5A 4O82A 1S9JA 4ZJJA 3RZFA 1KOAA 1LR4A 2BTRA 2EVAA 2Q0BA 3FQSA 3L9LA 3UIXA 5J5SA 4FUXA 4JR3A 1G3NA 4HVHA 4FV5A 3IOKA 3E7OA 5C26A 3ODYX 2CMWA 5AX9A 5EI6A 3D4QA 4DFZE 2Z7SA 2B54A 4EHEA 5IA2A 4CNHA 5JQ5A 4FSQA 2XS0A 2ZMCA 2G2HA 3L8SA 4ZJVA 2E2BA 3RI1A 4YO4A 3D5UA 3OT8A 2PZYA 3PLSA 4LMNA 1V0OA 2W1CA 1XH7A 4JG8A 3GC8A 3KMMA 4RIWA 4O0YA 3HA8A 2HZ4A 3QTQA 4U44A 4UB7A 5FXSA 3R00A 4B9DA 3BX5A 1OKWA 1UA2A 4KWPA 4D0WA 1JBPE 3VRZA 2ITTA 2JEDA 5KHXA 5ETFA 3EKNA 2A27A 2XZSA 4QMZA 5AIKA 5L6WL 2C6LA 3RAIA 2F9GA 1OECA 1UKIA 3O8TA 5CXZA 2O63A 5AR4A 2HAKA 4JG6A 4LOQA 4JOAA 2CGXA 1HCLA 3F6XA 4O0VA 1OIUA 4ANQA 4DEIA 5BVDA 3EWHA 2ZV8A 1WVXA 5KNJA 3O0GA 2WTJA 5HG9A 4FKSA 2GNIA 3DPKA 3PPKA 2ZM1A 4IIRA 4YC6A 4I21A 5LJJA 3SRVB 3D0EA 3M11A 5IH5A 1T46A 4RVMA 4FX3A 3DJ6A 4S34A 3K5VA 4WG4A 3RM6A 3ZBXA 1UKHA 2UZEA 1JSTA 1Z9XA 2WIHA 3FJQE 1OZ1A 5IA0A 4WOVA 3FUPA 1ATPE 3BQCA 3VHKA 1WMKA 2PTKA 4BWKA 5FEQA 3OZ6A 3PE1A 4IZ7A 4AGDA 4HVGA 1ZYSA 3FZSA 4DEDA 2OZOA 2WTVA 3U87A 4NEUA 2W1HA 3QXOA 3SG9A 3NW6A 5F1ZA 2QI8A 4YBKA 1YDRE 4UALA 4MNFA 3R71A 2R2PA 4BCFA 2H96A 5I5ZA 3TACA 3N4TA 2QHMA 4FKTA 4K8AA 1UU3A 4PQNA 2X39A 1RJBA 3R22A 5F94A 5AUVA 5IA1A 2VTMA 2BDWA 5CU6A 5IKWA 3TZ9A 4USFA 3VAPA 2YFXA 4PX6A 4WBBB 4DFUA 2FB8A 1DAWA 3Q4TA 3P5KA 1R78A 2VN9A 3ZRLA 4IANA 2XK9A 4GFGA 3VF9A 1FQ1B 5JFWA 2YWPA 4YGAA 4ZS0A 4AQCA 3II5A 3M42A 1QCFA 2F7XE 2VGPA 4IWDA 3UDBA 2CNQA 3HRBA 2X7OA 4JQ8A 5J95A 2VTRA 2ZV9A 3PXFA 5D1JA 4O86A 4D2TA 3VVHA 2PMNX 4OTWA 5KKRC 2BIKB 4RIWB 2R3MA 4BCMA 1P14A 5I3RA 3ZHPC 5CAUA 4FK6A 1KOBA 5AUXA 2GDOA 5I9XA 4J71A 4XHKB 4FGRA 4O7SA 2PL0A 1W8CA 2G2IA 4TNDA 1WBWA 2PMIA 4QP9A 1CDKA 3FKOA 3MB6A 3ZFMA 3QCQA 2CGVA 3WIGA 5AP6A 1FGIA 2UUEA 3HV7A 4M66A 4NW5A 4RJ5A 2W1FA 3NW5A 2BIYA 3EFWA 4ZOGA 1IRKA 2HK5A 4FE2A 3BCEA 4M84A 4CFFA 3EFLA 5KO1A 2UW8A 2GS2A 3EQCA 4KUJA 4FT5A 4BYIA 4BVUA 2V7OA 5CX9A 4W4XA 4O96A 3D15A 3ZLYA 1J91A 3PJ2A 3W10A 3QFVA 4CFXA 4RC3A 2VRXA 4EOMA 3C50A 3WE8A 3G33A 3OY3A 4UX9A 2HWPA 1GZOA 1OL7A 3OTVA 3QRUA 4L3PA 2C5NA 4XP3A 4YZMA 2WQEA 2ITOA 2C6IA 4BCPA 4CMUA 3KK8A 4K11A 3ZRMA 2OO8X 3CKXA 3W2CA 4AA5A 3C5IA 1Q5KA 1UNHA 2XUUA 2G1TA 2JDOA 3HV4A 4HYUA 1PXMA 4FIHA 4NCTC 1XH5A 3EN4A 5F4NA 4F9AA 4TXCA 5BYYA 3JUHA 5AA9A 4EOOA 4JL9A 1I09A 3IG7A 2YDIA 4J1RA 4PDOA 4YHFA 3PJ3A 5HNBA 3FZPA 4OT5A 4WRGA 4RWIA 4FVRA 3UP7A 4YMJA 4ZK5A 3A7FA 4EH9A 4RZVA 1OGUA 4KSQA 1RQQA 3K5UA 4CFVA 2W1EA 4MYGA 3MH0A 5HX8A 4KD1A 4FT9A 2B7AA 4G3CA 4M0ZA 5DFPA 2FSTX 2GHMA 3NIEA 4FEUA 3FZOA 4IFCA 4O0WA 5EOBA 4BCOA 4IAAA 4QRCA 5EW8A 3R0TA 4CZTA 1KE8A 1ZAOA 2BRMA 3LCSA 4OAVB 2WNTA 3T8OA 5AMNA 1QPEA 1OL6A 4MF0A 4RRVA 4DG0E 4O7NA 4L53A 3AD6A 5CU4A 3TCPA 1MUOA 4GT3A 4A9RA 3FMEA 2DYLA 3H9OA 4FVPA 4GT4A 2XM8A 5CSPA 4DT9A 3CIKA 5IQIA 3BYSA 5GIOE 5HD4A 4PTCA 4PTEA 4YLKA 3CS9A 2JKMA 1Q8YA 4C4JA 2XKCA 4AW1A 3ETAA 3MV5A 3RAKA 4ZZOA 2IJMA 3EN9A 2PUIA 4ZTNA 3I60A 2EXEA 2JBOA 4RC2A 4BBFA 4JBQA 2BKZA 1JVPP 2J9MA 3DTCA 2XIZA 4NM0A 1VZOA 3VW8A 2C68A 2C5YA 4L7SA 4FSMA 4QTCA 4APCA 1OBGA 2PYWA 3LQ3A 5F9EA 4BWXA 4A9TA 3HAMA 1H26A 4FKWA 5EM8A 2GNFA 2F7EE 5AR2A 4U3ZA 2QOIA 4EYJA 4NU1A 3OBGA 4HYSA 1PHKA 4X7QA 2PK9A 3TI1A 4BDBA 3SX9A 1QL6A 3QQLA 2OFUA 3O50A 3ENMA 5AAFA 3SOCA 1Q41A 3T9TA 1A06A 2V7AA 4E8AA 1E1VA 4LOOA 3HDNA 1TQIA 2OWBA 1K3AA 3NIZA 5D12A 5KZ0A 3VS1A 4CYIA 3G9NA 3BU5A 5AUYA 3K3IA 2ZDTA 4V0GA 5LMAA 2Z02A 2BVAA 2WKMA 4EH5A 3PE2A 1YXVA 4YTCA 2W9FB 2ZVAA 3R7GA 4YZDA 4TYHA 3NNXA 3NUUA 3V5JA 3S95A 3A8XA 2YACA 3BV3A 3CBLA 4AZSA 4FSUA 4BCNA 3PA5A 3QQHA 5AUZA 4FT0A 4QTEA 5L8JA 3OUNB 5HCXA 2QCSA 5M09A 3PA4A 2YM7A 1K2PA 2ITZA 2R3LA 1YWNA 2OW3A 3NSZA 4FZDB 4IM0A 1Q4LA 1CTPE 3OHTA 4FK3A 4LRMA 4AA0A 2OI4X 5CEKA 3RNYA 1MRVA 3DXQA 3OBJA 4N70A 1H1PA 2XK6A 3GENA 1YXUA 4OW8A 3BU3A 1CSNA 5HIBA 3TIZA 4DFYA 4ZLZA 3BELA 1Y6BA 4U7ZA 1J3HA 3HRCA 2BRBA 3EQHA 4OLIA 5EYCA 4D4YA 2WB8A 2XKFA 4K2RA 3ORNA 4FKQA 3V5TA 5CSWA 4IWOA 4DFBA 4MNEA 5FBOA 3H30A 3EFJA 4C4FA 1Q8ZA 2PE1A 3I7CA 4ASDA 1VYWA 2C1BA 2Z8CA 1OIYA 5DH3A 2XIYA 4IVDA 4QPMA 2CGUA 4FR4A 2HW7A 3DBDA 4U3YA 3W18A 3A61A 3COMA 3P7BA 5K0XA 3ZFXA 4UXQA 3VUKA 2RKUA 3F9NA 4ASEA 5AP0A 1XBCA 2OU7A 5M4FA 3Q2MA 1OVEA 5DN3A 3QQGA 1IASA 3FMMA 2J4ZA 5KMMA 4XJ0A 4AE6A 4I0SA 2B55A 2NNWB 1PXIA 1V1KA 3OF0A 4F08A 1TQPA 2ZYBA 4FL3A 3PIZA 2OJ9A 2OXXA 4TWCA 4GH2A 4JQEA 4IVBA 4ANMA 4HYIA 4NH1A 4HGSA 5A6NA 2R3RA 3UBDA 3MVLA 1IA9A 4IHPA 4KRCA 2B9HA 3HZTA 3GBZA 3GXLA 3T3VA 2YWVA 1V0PA 5CF5A 3NW7A 2BZHB 4BDEA 5DEWA 2BHEA 4I1ZA 2YITA 3UP2A 4CLJA 4V0GB 4E4NA 3CQUA 3DV3A 4JBPA 4DT8A 3OCTA 1GIHA 4P5ZA 4HJOA 1DS5A 3G90X 3Q9XA 2QC6A 3QTXA 4TYHB 3CTJA 4IJ9A 2VWXA 4K0YA 4R1YA 3UNZA 3ZLXA 2GQRA 1XQZA 3LQ5A 4MWIA 5M44A 3CCNA 4WUNA 3IGGA 3MIAA 3QD3A 3TUBA 4RC4A 4FZFB 4PV0A 3QYWA 3WZDA 3ZS5A 2B52A 2RFSA 3TT0A 4DTBA 2OIDA 5IQAA 4CT2A 5AP1A 4AT4A 4MXXA 3AC3A 3OMVA 1BL6A 3AXWA 4BN1A 4AZWA 3V8SA 4AZFA 4TL0A 2YIYA 4JDIA 4ITJA 3LLTA 4C3RA 3MVJA 2WMSA 1Q99A 3SV0A 4WKQA 4I20A 4W9WA 3WYYA 3PG1A 3PXYA 5TE0A 1M14A 4DEEA 2WMTA 3GCVA 2X0GA 1H24A 3FQHA 3QU0A 4YTIA 3U51A 2ZB0A 3Q3BA 4O1PA 4MNEB 4KBAA 5E8UA 4DGMA 4QP7A 3HP2A 4NFMA 2H8HA 5AIRA 4NM5A 2X9EA 2IG7A 5ITAA 3GP0A 3TZMA 4C61A 5EQEA 3OWJA 3E92A 3P7CA 4G17A 5LOHA 3L9MA 4QMOA 4PMPA 2IVUA 1OPLA 1DI9A 3ZLWA 3DZOA 5CI7A 4QT1A 5KCVA 1GJOA 3QRKA 3EL7A 4DHFA 4F6SA 5HTBA 2Q83A 3HAVA 4CEGA 4ARKA 4R77A 3RINA 4G6OA 2C4GA 3OVVA 2C5XA 3DK6A 2HCKA 3ANQA 2RFDA 4HGEA 4I5CA 4OBQA 2GPHA 3G2FA 3C0GA 4JI9A 2CCHA 4YTFA 5FBNC 3TNHA 5TR6A 1UWHA 5M08A 3RHKA 4JNWA 2GNHA 4BY9E 4U79A 3TL8A 3PLAE 3QGWA 3QQKA 1H4LA 1Y57A 3UQGA 2C0IA 5CSVA 4MBIA 4A4LA 4F99A 2B9JA 4PTGA 5CEMA 2R3NA 1Q62A 4AP7A 1Z57A 3JVRA 4YZNA 2ERZE 2Y4IC 4GK4A 1JPAA 4QYHA 3VJOA 3H0ZA 1U59A 2JIVA 3LKMA 4ASXA 5IA4A 2B53A 3HVCA 3FY2A 3AC5A 5HE1A 5HX6A 3KK9A 1NVRA 4Q5HA 2CLQA 4BTJA 3ZCLA 1WFCA 4F4PA 2VX3A 1VEBA 5DWRA 2JGZA 1M7NA 1P5EA 4RWLA 5LCJA 4JRVA 1R1WA 3FI3A 1GAGA 5JSMA 3VF8A 4PP7A 4BL1A 2XA4A 4DG2E 1GIIA 1PMEA 2YCFA 4TWOA 1ZWSA 2HELA 5EW3A 5F20A 3ZU7A 4ALUA 3SG8A 2PSQA 2W1DA 3DT1A 4C4GA 4BIDA 4F0GA 4IMYA 1O6KA 3Q04A 2ITQA 3PJCA 3QUPA 4R5YA 5KMNA 2PUPA 4OBPA 4AG8A 5CF4A 1BI8A 3E87A 1PXJA 2BRHA 4FTCA 3HMPA 3F61A 3ORIA 3P79A 3F2NA 5EM5A 2QG7A 4CT1A 3LFQA 1X8BA 1WBNA 1UNGA 5FD2A 5ETAA 3R9DA 3VUHA 2XIRA 5CASA 3MY0A 3GU8A 2X2KA 2WTWA 3GUBA 4DCEA 4Z3VA 4YJSA 3P86A 5AA8A 4E4MA 2ITVA 3KB7A 5CNOA 4JAIA 5AP5A 3RNIA 5LVLA 4B7TA 4ENYA 1VR2A 3NCZA 3AT2A 3RGFA 1PMVA 2EU9A 2RG5A 4IAIA 3OY1A 4E7WA 4F9CA 3HGKA 3OROA 3F5UA 2XNMA 3BHYA 4FKVA 4RQKA 5CVGA 4EJ7A 2Y4PA 1ZOHA 1W7HA 3WBLA 4P5QA 3W32A 3AOXA 5LWMA 1ND4A 2JFLA 2WFYA 4IADA 4IVAA 1PYXA 4L45A 4UWCA 5HG7A 4AWIA 3K2LA 1W0XC 4MF1A 3F88A 4PNKA 2C0TA 2GFSA 3FE3A 3IO7A 5BVWA 3QCXA 4MD7E 4YR8A 1ERKA 2PVRA 5FM3A 3LFFA 4P4CA 4FUYA 1FVTA 4MH7A 3I6WA 3ZMMA 4FKIA 5JT2A 2VTHA 3FKNA 5AAGA 1G5SA 4RZWA 3W16A 3FZTA 4AGWA 4GK3A 4XS2A 1ZMWA 2P55A 1CKJA 1P2AA 4XCUA 4KIOA 4P90A 5KMLA 2FUMA 3AMBA 2QOOA 2WMRA 3AQVA 4ZSLA 4V04A 3JY9A 2W5HA 4PMSA 4QP8A 5C8NA 4PDYA 4HVDA 5AP2A 1H1WA 4DFNA 4BHZA 1WVYA 4UZDA 2W05A 5CY3A 3TZ8A 4DBXA 2ZOQA 4O38A 4IC7A 4JDJA 3ZO1A 3F2AA 3LFNA 4D4SA 4X3FA 2I0YA 4S31A 3ORTA 4BDDA 4DH7A 5IEVA 1SNXA 4CXAA 5IQHA 3FMJA 4UYAA 4ALVA 3TKHA 5BX0A 3DKFA 3ORMA 5J1VA 5E8TA 3IK3A 5B7VA 3OEFX 3BEGA 3R8VA 3DKCA 4FNWA 3GCQA 4RQVA 4EOPA 3UOJA 2E9VA 4QQCA 3PYYA 2PZ5A 3R73A 4CLIA 1O6YA 2GQGA 5ANEA 5JZNA 4O7TA 3R9RA 4E26A 1J1CA 4YSMA 5IDPA 5HQ0A 4XG9A 5HCZA 3HL7A 3FY0A 3BYMA 4KIKA 5K4JA 4LYNA 2B9IA 2XMYA 5FTGA 1Q8UA 1F0QA 2R3IA 3QD0A 3W8QA 5HBHA 1FINA 4E6CA 2W7XA 2WTDA 3FKLA 4G6NA 4BDAA 2OJJA 2BCJA 4XNEA 1FGKA 4L6QA 3QD4A 2QOCA 4PL3A 3Q5IA 4D9UA 3SW4A 5HVJA 3U6IA 1YRPA 2GSFA 3C0HA 2CKOA 4IX6A 3QTRA 3R1QA 2JKKA 4D9TA 2VNWA 4I23A 4D2SA 4ZJIA 2QO2A 1R0PA 4L9IA 3ZBFA 4USDA 4N0SA 4ANBA 3MH1A 5EI8A 5FRIA 4JBVA 4PNIA 5A4LA 3BHHA 4FSWA 4R6VA 5AV0A 3VS5A 3BE2A 3QHWA 4IM2A 4BTFA 3KMUA 5JGAA 4PMMA 5JQ8A 4C62A 2WAJA 3MH3A 4H3BA 4KS7A 4OUCA 5CENA 3DBQA 2OK1A 4D55A 2VAGA 3E7VA 1XJDA 2UVXA 4GVJA 4D5KA 4O0TA 1YQJA 3CP9A 4FKRA 4J97A 1XH9A 2YISA 1URCA 3HEGA 4HCTA 4ERKA 2YM5A 4E6AA 2Z2WA 4BI2A 2I40A 3DB6A 1ZMUA 3QCYA 3CQWA 4CKIA 3MY5A 3W33A 2VWYA 3DQXA 3W8LA 4RT7A 3UMXA 3T9IA 5CU0A 2C6DA 3FLSA 3KMWA 3UO6A 3UO4A 4F7NA 5ANKA 1J7LA 2PVFA 4FKGA 1WVWA 2VUWA 2J51A 1G8SA 3MFRA 4TN6A 4CG9A 3VUDA 3B8QA 4X3FB 1PXOA 4FKOA 3GC7A 2C6MA 5G6VA 3WZKA 2BZIB 1KE9A 2P3GX 5IQGA 1QMZA 4DINA 2QOLA 4EL9A 1KUTA 3KKVA 3MJ2A 4QQJA 4RFMA 3C4CA 5J8IA 2E9UA 1H27A 1JSUA 4MK0A 4EK3A 5IISA 3GFEA 3UOLA 3FAAA 3NNUA 2QLUA 4GFMA 4RGJA 4YTHA 4EOQA 2BTSA 4RLKA 5CEIA 3RALA 1URWA 1H1QA 4K77A 3ZSHA 3VS4A 3EQBA 4U9AA 5CVHA 2Y0AA 3FLZA 4F7JA 4USEA 2A19B 4KIKB 2OICA 3F69A 3MDYA 3RPSA 3VS6A 3JY0A 3NVMB 1W84A 2CNUA 3S3IA 3R02A 5L2TA 5HORA 4GS6A 3UQCA 5B2KA 4LMUA 4R3PA 3BKBA 3BRBA 4ANLA 3UIUA 2FYSA 5AUTA 4FZ7A 3ATSA 2BPMA 2OJFE 5AUWA 2WELA 5CYIA 4A4OA 1PMNA 2JDTA 4RX5A 5IQBA 1OL5A 5TT7A 2X9FA 1OUYA 2P4IA 3ALOA 2FH9A 1MQ4A 3NMUF 4NZWB 4KIQA 4YSJA 5EHOA 1WBSA 2WQNA 1M7QA 4N4SA 3MJ1A 4DH1A 5J87A 3FXZA 4NJ3A 2B9FA 4GW8A 3JYAA 1KE7A 3BLRA 4G5JA 3KVXA 4RVTA 2Q0NA 3DQWA 3LJ0A 3MA3A 3LCKA 3A62A 4NTTA 4EWQA 3Q5ZA 4ANOA 1XBAA 4IB3A 1XBBA 3TIYA 3GOKA 4NSTA 2QR8A 4JQ7A 5E9EA 2PMOX 3C51A 3RKBA 4G3FA 4QMPA 4MTAA 3TUDA 1YHVA 5HLWA 4TTHB 4M97A 2WGJA 2WMAA 2VWZA 3LCOA 1ZXEA 3MTFA 3Q9YA 2CNVA 4KKEA 3RAWA 4OBOA 4WD5A 4QQ5A 1YWRA 3CE3A 2W5AA 3MPAA 5FP6A 4NTSA 2YLEA 4QMVA 4DLJA 5DI1A 4GIHA 5M53A 4X2GA 4C34A 4FIJA 5E7RA 3VIDA 3UG1A 3RPYA 5L2IA 4CQEA 4JT3A 4ZS4A 5I4NA 3P78A 2ZV7A 1YXXA 4OGRA 4CKRA 2PZIA 4MXZA 4ITHA 2ITXA 5EDPA 4LUDA 5M07A 1BMKA 3DDPA 3V01A 3LMHA 3PDTA 3QKKA 4IJPA 3OW4A 4I24A 3OOMA 4FTNA 2XK3A 4L44A 5L3AA 3DBFA 4IX3A 4E4XA 2JLDA 4D5HA 3ERKA 4FL2A 3C13A 4L68A 5BUEA 5L2SA 2YEXA 2FO0A 4I4EA 5J7HA 5GIPE 1KV1A 3NYNA 5JH6A 2R7BA 3F3UA 4ZZMA 3PJ8A 3PVGA 4RJ3A 2PVNA 3PUPA 4D58A 3EQIA 2J0KA 4XV2A 3FV8A 4BDFA 5IA5A 4O84A 4X2FA 2ITUA 1XHAA 2J5EA 5BUJA 2J0LA 2VO0A 5TF9A 2X6DA 4EH2A 1GZKA 4GSBA 3CTQA 5CT0A 4G1WA 4WG3A 3WARA 1CM8A 3D5VA 4YC3A 2WOTA 5EW9A 3U4UA 2LAVA 4CSVA 4FVQA 1FVRA 3O23A 4EOIA 4O83A 4OTHA 2UZLA 3IKAA 2WXVA 2KTYA 3QA0A 3FMHA 4FKUA 5M4UA 5BYLA 3U6JA 5CF8A 2PVHA 1LEZA 1RE8A 2QU5A 3KQ7A 5ETIA 4AT3A 4O0RA 3VBYA 4R8QA 2XEZA 5CF6A 2V62A 4MXYA 3ZZWA 3V04A 1OM1A 2YM6A 4UMUA 4YP8A 4QYEA 3WF9A 2XRWA 4D2PA 3UE4A 4J98A 3FL4A 3EYHA 4KAOA 3DKGA 5E90A 3S2PA 4BDKA 3AT4A 4CD0A 4BI0A 1BLXA 2VWIA 4FBXA 5HO6A 3QZFA 4AN9A 4QTDA 3RPRA 2XBJA 4BWPA 1A48A 4KNBA 4F6UA 5HE3A 5BMMA 4WA9A 4MWHA 2NRYA 4L3JA 3KRJA 3BQRA 1UU8A 2R3OA 5FLFA 4G9RA 3F3ZA 4MAOA 3NRMA 4DLIA 5KMIA 2F4JA 4FKJA 2FSOX 2C5OA 3VULA 1FMKA 2JDRA 3OWPA 5EHLA 4EK4A 5GZ9A 3QKMA 1JKTA 4FMQA 4CCBA 5IMEA 3P4KA 4DCAA 4D1ZA 3ZOSA 3UMWA 2J0IA 3IW5A 4ACHA 5JFXA 4CMOA 3MWUA 3ZRKA 5JZJA 5E8XA 2C3JA 4W4WA 5H8BA 5IEYA 4EH4A 2WO6A 2G15A 3TJCA 5EH0A 3QL8A 3BE9A 4H3QA 5AR8A 5JGDA 2YZLA 2KULA 4FYOA 4D4RA 3QA8A 5CI6A 2GTMA 3OOGA 3NWWA 5AR3A 2JITA 4IB1A 2VTIA 2BUJA 2VTLA 3DS6A 3OWLA 4HNIA 5FM2A 3DK3A 3MVMA 4K18A 3TG1A 3ZEWA 3GEQA 4JRNA 3LCTA 3V51A 1H8FA 4X0MA 3AC2A 4GUBA 3W2QA 3LM0A 2P2HA 4AOIA 1YVJA 2ITWA 4PL5A 3BLHA 3AC8A 5LMKA 2E9NA 2VTTA 2BKKA 3HECA 4JVGA 3JR1A 1NXKA 1RW8A 3H3CA 5CT7A 4D28A 3FMDA 2VZ6A 2ZV2A 4NYEA 2F57A 3WZJA 2ETMA 4MD9E 2OXYA 5IUGA 3ULZA 3TXOA 2UV2A 2WEIA 2JKQA 2QD9A 3AG9A 4TYIA 4EK6A 1Q97A 2E9OA 3U6HA 4DGNA 1OL1A 2ZDUA 3LFEA 3OXTA 3LXKA 4NIFA 4XLIA 2WMUA 4C7TA 4O7LA 3ATTA 4QMLA 1H0VA 5J5TA 2BDJA 3EQPA 4RJ7A 1ZRZA 4R7HA 4BICA 5EOLA 2YIRA 3MN3A 2YCSA 2HOGA 2BAKA 3OG7A 3UQFA 3KGAA 4OAUC 5BMSA 2X1NA 5IZFA 4MXOA 3D83A 5HLNA 3QQJA 4KBCA 3AT3A 4NJDA 3ZSGA 5AP3A 2OIQA 3FMKA 3ET7A 5CWZA 4U6RA 3U9CA 3GU4A 2W5BA 3L8XA 4QOXA 2GNLA 5DGZA 4C4HA 1K9AA 2ETKA 4TYEA 3VBVA 3GT8A 5IF1A 1IEPA 4XUFA 3PY0A 3RPOA 4LOPA 4U40A 4NM7A 2J0JA 3UVPA 5JK3A 5GZAA 3MGYA 4FV4A 4YNOA 2G01A 2IZSA 3R8LA 2GS6A 4EC8A 5HE0A 4Z16A 4XOYA 3WOWA 4Q5EA 4FKLA 1H0WA 1XO2B 3I7BA 4G16A 4Z9LA 4MEDA 3IQ7A 3WZUA 2BROA 1Y6AA 5ANJA 3QWKA 3VUGA 5H2UA 2IZTA 3BWFA 1OMWA 4RX9A 4F0IA 4QMMA 3U8WA 4EYMA 3D9VA 2IW8A 4BDJA 4R5SA 1ZLTA 1H01A 3PSDA 3QTZA 5B2LA 4M12A 3DXNA 3R30A 3LJ1A 3ELJA 3FQEA 2HWOA 3RMFA 3VJNA 3EFKA 3S4QA 3UVQA 2VWWA 3QXPA 5IUIA 1OI9A 1YHSA 4L52A 2UW5A 4H05A 1BKXA 1FOTA 4RSSA 2PHKA 4RBLA 5I3OA 3C4EA 2FA2A 3C7QA 2GHLA 5I9YA 3CQEA 2UW9A 5E8YA 3UNKA 2I0VA 4JBOA 3ZONA 3UNJA 5LVPA 4V01A 4RVLA 4AT5A 4EHGA 1YHWA 2JAMA 5FGKA 1WAKA 4XMOA 3BGPA 4QP2A 4UMTA 4FZ6A 1H28A 2XNGA 4B6LA 5TKDA 4C36A 5KMOA 1YXSA 2VWBA 3WI6A 2A2AA 2R3JA 4NIFB 1PYEA 3CY3A 3DOGA 2UZNA 2VWVA 2QO9A 3VHEA 4ZMFA 4H1MA 4O7YA 3E3BX 5JFVA 3IECA 4FIIA 4OR5A 2OJGA 5E8SA 3EQFA 4KSPA 4R3RA 3A4OX 5CXHA 4RPVA 3W2RA 4HNFA 4DGOA 2R0UA 4JAJA 3F3TA 4L7FA 4BCHA 4F65A 3UC3A 2NPQA 3AMAA 5CEQA 2ZJWA 2QG5A 4DYMA 1JWHA 2WMWA 1Y8YA 3PVUA 4C59A 4IB5A 4M0YA 5LVMA 3ZM4A 4UV0A 5B0XA 3L1SA 3SXSA 1TQMA 4C4EA 3R1YA 3IW6A 1WBOA 3O51A 1YOLA 3BYVA 2XNOA 2W1GA 4R3CA 3QRTA 4HZRA 1MP8A 4BDHA 3HA6A 5EKNA 2J0MB 2CKPA 3FHRA 3PTGA 4BZOA 4R78A 1H08A 2YZAA 2W4JA 3RBWA 3TV6A 2R3HA 3OTUA 3HRFA 3S00A 3ZYAA 3R21A 5I9WA 4DEHA 2UVZA 3R7EA 1H25A 3ZO4A 1LUFA 5CSXA 3O71A 3OS3A 3DGKA 4U43A 4YBJA 3ZC6A 4GEOA 3QX2A 4GG7A 2BILB 3PIYA 4BZDA 4JIKA 3JS2A 4LV8A 3A8WA 1PKDA 5E1EA 2R9SA 3RAHA 1OBDA 3CEKA 4IZ5A 1L3RE 4YLJA 3V5WA 2W99B 4EH7A 3EKKA 4EOJA 3R7IA 4BBMA 3POOA 3HUCA 1WBVA 2RL5A 1KWPA 1TKIA 4QPSA 3RTPA 5IH4A 3R7YA 5IQDA 4FKPA 3KRLA 4B0GA 4CGAA 2NRUA 3TNQB 2IVSA 3DNDA 3FSKA 4TW9A 5IQEA 2EB3A 3MFSA 3FMNA 3Q32A 1OIRA 3ZTXA 4Q9ZA 2W1IA 4J53A 5HBJA 3MPTA 4WNMA 3LOKA 3VUMA 4EHVA 4E1ZA 4GT5A 1KE6A 2O8YA 3DA6A 4EK8A 4JX7A 3G5DA 4C37A 4XX9A 4ZLOA 5J9LA 4F9WA 3FLNC 5AR5A 3MH2A 3DCVA 3MTLA 1ZY5A 1NVQA 2XH5A 4BB4A 2H9VA 3AD4A 4DFXE 2Z7RA 4LL5A 1NVSA 1W83A 3OUKA 4L67A 4PDSA 3IS5A 3DLSA 4IBMA 3OT3A 5KX8A 3F7WA 4ERWA 4ZTSA 2G2FA 3BGQA 4WBOA 3CJFA 4IH8A 5FP5A 5C8KA 4IFGA 2A1AB 4ZTHA 4I3ZA 4CFMA 4D1XA 3BPRA 3IDPA 4PF4A 3LMIA 4ORKA 5DPVA 4JX3A 2X8EA 2GMXA 4Q2AA 4QMWA 4X3FC 4DEGA 2QQ7A 3B8RA 2AC5A 4TRLA 2G9XA 3L8VA 4YNEA 4B99A 2QO7A 4LI5A 1ZZ2A 5AP4A 3UOHA 4H1JA 4H39A 1SZMA 3HMNA 4CRSA 1GIJA 4F1TA 4LV5A 3H0YA 4O0SA 2CKEA 4HGLA 4PY1A 3RK7A 3U9NA 3E8CA 4CFUA 2Y6MA 2AYPA 2CDZA 4ZAUA 1OKZA 2JIIA 4A4XA 3QZGA 4J99A 4CRLA 4YURA 4LRKA 2ZB1A 2RF9A 3HMOA 3NLBA 2C6OA 5AV4A 4XEYA 4O91A 1DAYA 3HDMA 4DBNA 3PP0A 5B2MA 3GCSA 3LM5A 5AM7A 5HO8A 4ANNA 1SMHA 4X21A 3HMMA 3SXRA 3BHUA 4BIBA 1UWJA 4HCVA 2X2MA 4IACA 5HE2A 3PXZA 4MXCA 4XV1A 2GNGA 4O0UA 4BGQA 5BVEA 5BPYA 1M2RA 1YI4A 4GFOA 4O6EA 1JLUE 4FGBA 4W8EA 5EQPA 3BBTB 5AX3A 4YJPA 5CTPA 2HY81 3DNEA 3VW6A 4EH8A 2V5QA 2WTIA 3CY2A 3R28A 5FWKK 3DXPA 2VTSA 3BIZA 4XBUA 4RA5A 5JKGA 5K5NA 3SKCA 3DLZA 2JIUA 4I4FA 2Z7QA 4KKGA 5JRQA 4ACCA 2YHVA 4GV1A 3TKUA 3LE6A 4O6LA 4DGLC 3BV2A 3NAYA 4FSNA 4JS8A 2VX0A 3OXIA 4KABA 4FTIA 4C2WA 2DWBA 2I7QA 5FUTA 3TM0A 3I0QA 4C38A 4ONAA 1ZMVA 4KINA 5G1XA 3VC4A 4DN5A 3DU8A 5LVOA 5HIDA 4QP3A 4IWPA 4AZVA 3KF7A 4BI1A 4KS8A 3FYKX 5D11A 2CPKE 2O0UA 3C4WA 3EN6A 3HLLA 3EYGA 4AU8A 3OXZA 5A14A 4CCUA 1PXNA 1AD5A 3SD0A 3S1HA 1PRYA 2V0DA 3QAME 5LARA 3F3WA 4U97A 4AAAA 5AV3A 4BGGA 3FXWA 2VU3A 4K6ZA 3RVGA 4EORA 3KA0A 4C8BA 3GI3A 1XH8A 1U5QA 2CCIA 5KHWA 3G0EA 3O8PA 4OT6A 4O7RA 3NPCA 3CPBA 3E3PA 2I0EA 2QLQA 4IVCA 5HU9A 2F2CB 4NL0A 3EZRA 4ZTLA 2YM3A 4H3PA 1CMKE 3LIJA 4QMQA 4DH3A 1CKIA 3LZBA 3I5NA 5BUIA 3ZUUA 4AUAA 1NA7A 4MHAA 4WSQA 4WNKA 1Q3DA 3O8UA 4O27B 5ANIA 5EK7A 4DEBA 5LCKA 4EZ3A 2HW6A 1OKVA 2QURA 3MSSA 4QTAA 4XH6A 4CZYB 3MY1A 1GZ8A 3MIYA 2YLFA 3ACKA 4M8TA 4WSYA 2F7ZE 5CAOA 2EUFB 2UZUE 4ZY6A 2QKRA 3MPMA 4PL4A 1FVVA 3LMGA 5DIAA 4G2FA 2B1PA 4L42A 5HU3A 2VTOA 4TWPA 3UOKA 4F7LA 2C5VA 5GHVA 1OIQA 1JAMA 3LW0A 4FNYA 2RSVA 4RFYA 2IWIA 2QODA 4PMTA 2BALA 2YCQA 4UYNA 3GC0A 4GCJA 4FTKA 4JLCA 1XH6A 3EQRA 4ANSA 1NW1A 3P08A 4A9UA 5E91A 3LFBA 2FSLX 2XK4A 2ITPA 3COKA 4UBAA 3UPXA 3E64A 1GNGA 2IN6A 4G34A 2OH0E 3GGFA 1H1RA 3RP9A 4AGCA 4GKIA 5L4QA 3ENHA 3QD2B 5FDPA 1XWSA 4FODA 2X7GA 4I6QA 1MQBA 3AGMA 1ZOGA 2WMBA 4FSRA 4BGHA 3PSCA 5KUPA 4AGUA 4G3GA 4MX9A 5KBRA 4CYJA 4II5A 4AS0A 4Y83A 3ITZA 3UTOA 2QNJA 4Z7GA 1UV5A 4U45A 3OCGA 3R63A 4IAKA 2WQBA 4O21A 4LQMA 3F5XA 3LAUA 5F95A 1M17A 3Q52A 1REJA 2DS1A 3HP5A 1CKPA 4E6DA 1P4OA 2XEYA 3R83A 2R3PA 5JMSA 4ZSJA 4DFLA 3QCSA 2O65A 4U41A 4FTMA 3D94A 4XG2A 4AZTA 3NYVA 4BCGA 3MYGA 1OKYA 2WIPA 5ANGA 1OB3A 3EZVA 2PZPA 4S32A 5HG5A 1F3MC 3DK7A 2OFVA 3LPBA 3BZ3A 3NGAA 3Q9ZA 3PY3A 4FG9A 4A07A 4XP0A 1W82A 3PXRA 4LL0A 3TKIA 3E8EA 2W17A 2HXQA 2WU7A 3D2IA 4ASZA 2HZ0A 1U54A 4IAFA 3FZRA 5HLPA 2QOQA 3L9PA 4ZP5A 4RLLA 3VBXA 3GCPA 3NCGA 3OC1A 5A46A 3KXGA 4I22A 4GU9A 1XR1A 3SAYA 1WBTA 2XJ2A 3FZ1A 4BIEA 5IEXA 4KB8A 3ANRA 5GJGA 3ROCA 1PMUA 3VWAA 3LVPA 2R5TA 3P0MA 4M13A 4OTFA 4P7EA 4EQMA 5K0KA 4R7BA 3PPZA 3PZEA 3IW8A 4JDHA 3RWPA 3V8TA 5HZNA 1PJKA 1STCE 2C3KA 5JN2A 4IEBA 4YHTA 2IVVA 2OH4A 3PRFA 4BYJA 3ODZX 2PVMA 2VV9A 4X2NA 5E92A 4CMTA 1L8TA 4XRJA 1GZNA 1WBPA 1B39A 4FIGA 5AWMA 5ACKA 3VS2A 5A54A 5HNIX 3PXKA 3Q6WA 4V05A 4F09A 3DJ5A 1SM2A 5DT3A 5J79A 1ZY4A 3RPVA 4I92A 4TYGA 4CTCA 1PXPA 4ZEGA 5EG3A 3KXMA 5HI2A 3ORPA 5EKOA 2YJSA 3L9NA 1QPDA 2H34A 1BX6A 3MS9A 3H9RA 3HX4A 5AV2A 1LPUA 1BUHA 3DAJA 4YJRA 4RA4A 4FV6A 4UWYA 5CALA 2PUNA 4O7VA 2F2UA 2X81A 4S33A 2LGCA 3AD5A 3G6GA 3KL8A 4TPTA 3PVWA 3WF8A 4R1VA 5DLSA 4DEAA 2X8DA 3I0OA 4IZYA 5JGBA 1NT2A 4E3CA 2QOKA 3UZTA 5HCYA 4BHNA 2YABA 2ZM4A 4E4LA 4A7CA 3NNVA 3SGCA 2WMXA 3BLQA 3LQ8A 4UZHA 4HZSA 4KBKA 2I6LA 3U4WA 3BI6A 3TNPC 4F64A 3KCKA 1M2QA 2JDVA 5M4IA 2JKOA 1SVHA 4FEWA 3OCSA 1M52A 4FG7A 3LXNA 3SHEA 1OL2A 2YA9A 5J9YA 4DA5A 1APME 3KN5A 1ZYCA 4X6QC 4XG8A 2XRUA 1U54B 4XV3A 3GVUA 4HPUE 4LGHA 3UIMA 5K9IA 2PUUA 4TZRA 5D10A 4CKJA 5L2WA 3QYZA 2JBPA 4LG4A 3JXWA 3SW7A 3N4UA 4FT7A 4TKSA 4ACDA 3I1AA 3POZA 4QMXA 4CQGA 3R1NA 5CAPA 4QYFA 5AADA 3NUSA 4XYFA 3EQGA 2OGVA 2ONLA 4HW7A 2YERA 4I6FA 1W98A 4WHZA 5CS6A 3FBVA 4LGGA 3ZO2A 2R3FA 3TTIA 3NYXA 4I94A 2VO7A 5CANA 2YIXA 2BHHA 3FWQA 4BDCA 3SOAA 3FPQA 2R3QA 1YOMA 4RIYA 3RJCA 2HY0A 5EYKA 3P23A 3AC4A 5ACBC 2C3LA 3KN6A 3H9FA 4FV3A 3VQUA 5GZ8A 1UU9A 4QD6A 4GJ3A 4J95A 4FTAA 5LMKC 1Y8GA 2CLXA 3EH9A 3F7ZA 3GB2A 2VO3A 4O22A 5AV1A 5GNKA 3DFCB 3W55A 2ESMA 3NX8A 4HPTE 1Q3WA 3ZO3A 4BCKA 4YJVA 1AQ1A 3ACJA 1FPUA 2XJ0A 5L8LA 5DEYA 5A3XA 3WZEA 5EYDA 1E1XA 1KE5A 1FBNA 3THBA 3PP1A 5BVKA 5TO8A 4MCVA 3KRWA 2ZM3A 3ROYA 4R7IA 2HIWA 1YXTA 4I0TA 3EMGA 3UYTA 2WPAA 4RVKA 4XRLA 3WF6A 4FSTA 4AACA 4A9SA 4WRSA 3DFAA 4KA3A 4QMYA 5I9UA 3R7VA 2FVDA 4XP2A 1S9IA 4JJRA 4L46A 3Q60A 5A4EA 5M4CA 4IDTA 3BHVA 1ZYLA 2V55A 3COHA 3NUPA 3TV4A 5IH6A 5M51A 1JKLA 5GINE 3PJ1A 4QO9A 3VUIA 5IU2A 4YJUA 2XKEA 3TEIA 3ID6C 2BAQA 2YJRA 3I6UA 3W2PA 3GFWA 2XK7A 4EBVA 5EHYA 2R64A 2QKWB 1G8AA 4FTJA 3QRIA 4BKYA 2SRCA 3VRYA 3DZQA 3G6HA 3P1AA 4E6QA 2PZRA 3I81A 2YDKA 5C27A 4Q9SA 1JNKA 3V5QA 3PXQA 4JIAA 3MB7A 4IC8A 3GOPA 4LUEA 2Y8OA 4J96A 3CGOA 4M3QA 4WUAA 5HD7A 4AFEA 4E73A 5HTIA 4M69A 3PY1A 4O1OA 4C3PA 4QP6A 5CVFA 3KFAA 3E62A 2R3GA 3ZLSA 1PF8A 2C0OA 3FLWA 3ZUTA 4GYGA 4IM3A 3O7LB 3LFAA 2PVKA 3QUDA 5L8KA 5DE2A 4IAYA 2WMVA 4WO5A 5KZIA 3H4JA 5EYMA 1SYKA 5K5XA 4B4LA 5FTOA 2YN8A 4IX4A 5HNGA 5M06A 2JAVA 4GMYA 5CQUA 3QZIA 3HV5A 2YAKA 5T3QA 2ETRA 2QOBA 3PFQA 3EJ1A 3BYOA 3QTIA 4UY9A 4FTUA 2QHNA 4L8MA 2J50A 2W0JA 4AE9A 4RIYB 3FYJX 4RFZA 3ZM9A 2IPXA 3A7HA 3C4ZA 5IA3A 2BRGA 3UYSA 3ZXZA 4BTMA 4X2JA 4ZSEA 3QC4A 3TV7A 2CGWA 5E1SA 3PZHA 3QQFA 2XVDA 3R8UA 3TZ7A 4FI1A 4U5JA 5EI2A 5IDNA 3DBEA 2NO3A 4XOZA 4F1MA 2UW6A 4OTPA 4DE4A 5ETCA 4ALWA 3KXNA 3O96A 5KE0A 3ZXTA 4AN2A 2UW4A 4BDIA 2A4LA 2R4BA 4F9BA 4CG8A 2UZBA 2H6DA 3EOCA 4OTRA 2JD5A 2O5KA 5I9VA 2W1ZA 1YI3A 3K3JA
chains in the Genus database with same CATH superfamily
3O5AA 4YJOA 3DDQA 4ZMEA 4TWNA 4JR7A 4XV9A 5HICA 4EQCA 1IAHA 4A06A 1R0EA 3TN8A 5H8GA 5DRDA 4FTTA 3CLYA 4FV2A 4PPCA 1AGWA 5C8MA 4IW0A 4XG4A 3HV3A 5DR6A 2AEGA 1P4FA 3GU6A 3JVSA 3PRIA 1Q61A 4ZSGA 2R3KA 3LXLA 5ANOA 5K3YA 4EWHA 4EKKA 4J7BA 2VO6A 3DAEA 4W4VA 3TNIA 1GY3A 2R0IA 4EH3A 3G15A 4I93A 3ZH8A 4ENXA 3HUBA 2XNEA 4AXAA 1OUKA 1RDQE 4FG8A 3CXWA 5CU2A 4ACGA 4I5HA 3R8ZA 2I1MA 2IW6A 4TYJA 3G51A 1U4DA 2X4FA 3R2YA 3G9LX 4GVAA 4BKZA 4O81A 5C4LA 4M69B 4D1SA 3BWJA 3FC1X 1SVEA 3DB8A 1IAJA 3PG3A 3KVWA 4XLVA 3TYKA 4FYNA 4ZTRA 3LXPA 1JKKA 2CSNA 4AF3A 3MVHA 1ZARA 3CR0A 5HIEA 3WILA 4GKHA 4LFIA 4C57A 2XCKA 2PVYA 3A60A 4RMZA 4F0FA 4RIXA 3E93A 4FF8A 3V5PA 5HOAA 4APPA 4I6LA 2J6MA 3VUTA 4FZAB 5I9ZA 3U55A 1Y91A 3FLYA 5I0BA 5AFVA 4M67A 4MKCA 4QNAA 5CLPA 5LXMA 4Y95A 3NS9A 3V5LA 3R9HA 2IO6A 4F7SA 4AQKA 4DH8A 4D2VA 4AZEA 3NFFB 4YJNA 3F5GA 3QC9A 4EI4A 4FSZA 3A7GA 1OPKA 3W1FA 4ACMA 3R1SA 5CNNA 5BNJA 3S0OA 5HGIA 4U80A 2Y6OA 3EN5A 4NW6A 3CD3A 3IOPA 4ZSAA 2BDFA 2W9ZB 3KEXA 4W8DA 4AW0A 5J1WA 3K54A 4IX5A 2XNBA 3A7IA 3PA3A 4IB0A 2Z60A 4YPDA 3RCJA 4FEXA 4O7WA 3D7TA 5E8VA 3R9OA 4AXFA 4H36A 3DY7A 5KMJA 3ZEPA 5EM7A 5M56A 5M55A 2REIA 5CU3A 3AGLA 1YW2A 2XKDA 2O64A 3CJGA 1Z5MA 2AQXA 2VD5A 2J7TA 2YDJA 3LFSA 5CEOA 1V0BA 3Q96A 4K1BA 5AR7A 4RWJA 4EKLA 5FEEA 4H58A 4UN0C 2PWLA 4CVAA 3D14A 3SQQA 4D0XA 2OF4A 4XG3A 3BEAA 3Q4ZA 3RK9A 5J7BA 4WIHA 2YIWA 5LQFA 3VBQA 5IG1A 4DC2A 4KIPA 4UEUA 4UXLA 3R7UA 4F63A 2JC6A 2OSCA 2C69A 4U42A 4F6WA 2XJ1A 2R7IA 5A4CA 2E9PA 4CV8A 4B8MA 3CPCA 5GJFA 4FV7A 2BR1A 3QTUA 3UC4A 1Q24A 4E93A 2C30A 1KSWA 4MQ2A 5C4KA 3D5WA 1EH4A 1ZZLA 5HBEA 1J7IA 4YJTA 5CQWA 4C3FA 5HVKA 3QRJA 3UPZA 2J5FA 4E5BA 1YOJA 2C6KA 3REPA 4BZNA 1B6CB 3EQDA 4GG5A 4NCTA 2CHLA 3ORXA 3ULIA 4RJ6A 4CZUA 3A7JA 2CKQA 1WCCA 4B8LA 1DI8A 4WNPA 4FEQA 2WTKC 3E8DA 2VTPA 3B2TA 4RIXB 2W96B 1U5RA 3VBWA 4E5WA 3CSVA 2UVYA 4ITIA 4QMTA 4TNBA 3B2WA 4IAZA 4MD8E 4EOSA 3ZC5A 4EC9A 2HENA 1YKRA 3WE4A 4BCQA 4X2KA 2ACXA 3W2SA 5AAEA 4C0TA 5E8ZA 5DBXA 4PDPA 3QLGA 1F5QA 4GUEA 3C0IA 3RCDA 3WIKA 5FEDA 5DT4A 4I5PA 4FSYA 2YM8A 3CC6A 5A9UA 3P7AA 4EZ7A 5D9HA 3OP5A 1HCKA 1YWVA 2GS7A 2I0HA 4BBEA 5KKRB 1UNLA 1LP4A 4NM3A 3W2OA 4YZBA 3UGCA 4AN3A 4FTLA 4YUQA 2PU8A 3SLSA 4O7ZA 4DGGA 5M57A 3D7TB 1MRUA 3FL5A 3JPVA 3T3UA 3O7LD 3ZZEA 3RK5A 3N4VA 4Y5HA 4G9CA 4EOKA 4ZXTA 2PVLA 3NUYA 2VTAA 4EJNA 1YDSE 2C3IB 5BQ0A 5FXQA 3QKLA 4UMPA 4M68A 5DRBA 2BRNA 1JSVA 2ITYA 2OBJA 4G3EA 2XK8A 5A6OA 5L6OA 2XCHA 5E4HA 3ALNA 2NP8A 3MI9A 4PPAA 1ST0A 3ZSIA 4ZIMA 5ICPA 5DHJA 2VNYA 3PWDA 3VONA 4BTKA 4N57A 4EUUA 5AEPA 5CEPA 2UZDA 2XP2A 5H3QA 2X2LA 4RX8A 5HTCA 4EK5A 5BVOA 3FSFA 1YI6A 5HESA 3ZFYA 2QOFA 4QDVA 3QWJA 4DTKA 1O6LA 4IQ6A 2WQOA 3VNTA 1BL7A 4FIFA 3HYHA 5E8WA 5AM6A 2ZFYA 5DA3A 4MBLA 5KBQA 1Q8TA 2WZJA 4OTDA 1IG1A 3I5ZA 3PVBA 3SA0A 2Y7JA 2C6TA 4BC6A 4QMUA 2PVJA 5T6KA 4GU6A 3VBTA 3GQIA 2DUVA 4NKAA 3EHAA 4FV8A 3MESA 3A2CA 3OWKA 2YAAA 2QR7A 3R8MA 3I79A 2ZAZA 2OXDA 3ZDIA 3CD8A 4L3LA 4FNXA 4L01A 2UZTA 3RZBA 4FTRA 3WF7A 4BDGA 1JKSA 3C5UA 2EXCX 4QYGA 4GYIA 3UIBA 4EEVA 1J7UA 2UW0A 1H00A 3KCFA 1H1SA 5L6PA 4L43A 3GQLA 4O2PA 2W06A 3OEZA 3TJDA 5DT0A 4QP4A 4NKSA 1NY3A 4FV1A 4I5MA 3QUEA 4AX8A 2VTJA 4G5PA 3F2RA 2C6EA 3R04A 3QF9A 2QOHA 4YJQA 4U0IA 3LFDA 4QPAA 4QQTA 2BZKB 4U8ZA 4OTGA 5K4IA 2CN8A 2PE2A 4MBJA 1U46A 3NNWA 3V8WA 5DR9A 3BBWA 2VX1A 4XG7A 2XNPA 4BCJA 3RHXA 3E63A 3N9XA 4EONA 4XBRA 4FEVA 2V22A 3M1SA 3SDJA 3VN9A 1BYGA 4G3DA 4L00A 3FC2A 2DQ7X 1XH4A 4GIIA 4KRDA 4YU2A 3KRRA 4O2ZA 3WYXA 3KC3A 4Z55A 3PSBA 2OKRA 3UO5A 2PPQA 5C03A 4G6LA 4F70A 4I0RA 1UU7A 4ID7A 5IQCA 3LJ2A 3MA6A 2ZMDA 5AP7A 1PKGA 3G0FA 2QVSE 4Y46A 3R01A 2VGOA 2B0QA 4ZLYA 4K33A 2WHBA 5H9BA 4BR3A 4Y73A 1H07A 4PP9A 2YIQA 5FTQA 4P2KA 2P33A 5D7AA 4A9YA 4E5AX 4NK9A 2VTQA 1HOWA 4GK2A 5T68A 2OLCA 4FOCA 4I6BA 5HKMA 3KXZA 3CKWA 4N6YA 4QP1A 3KREA 3UZRA 2BFYA 2Y9QA 4FV0A 5CZIA 4ZTQA 2W4OA 3RM7A 3LHJA 3KRXA 4RJ8A 5KMKA 5H8EA 2XBAA 3KU2A 4WNOA 3QLFA 3Q4CA 4LM5A 4FICA 4HGTA 4YC8A 5JRSA 3R8PA 2OZAA 4BRXA 3ORZA 2QU6A 2OF2A 3DBCA 3LFCA 2VTNA 4RWKA 5DOSA 3VS7A 1OPJA 4TY1A 3Q6UA 3HV6A 1FMOE 3EIDA 2P2IA 3DKOA 5FG8A 3UODA 3C4FA 3I4BA 3RWQA 5LMBA 3LLAA 2XYUA 2XYNA 5LWNA 2CJMA 4Y85A 2BAJA 2HXLA 3QALE 4DITA 4DH5A 3OW3A 4CFWA 4LGDA 5LVNA 4N6ZA 3D2KA 3V6RA 3EN7A 4G31A 4WT6A 3SC1A 5DYJA 3FMLA 2B4SB 2QONA 2X8IA 5HHWA 4GL9A 3GCUA 3A99A 4FJVA 2EB2A 3OD6X 3R2BA 5EM6A 4DF3A 4D4VA 3ZUVA 1QPJA 4C02A 1REKA 4PWNA 4DTAA 3QQUA 3C1XA 2O2UA 3DAKA 3EB0A 2GU8A 4J52A 2RG6A 5ANDA 1PW2A 2BFXA 3OCBA 5BVFA 3IDCA 4RX7A 4S2ZA 3NAXA 2IZRA 2WTKB 4M14A 4K9YA 5HO7A 4YLLA 4M7IA 2RFNA 3OFMA 4HYHA 4YO6A 4C33A 4ZY4A 4OTQA 3COIA 3KULA 3NDMA 5JEBA 1QPCA 3U54A 4D2WA 3F5PA 1IA8A 3SXFA 4C35A 2YCRA 2HZNA 3BGZA 4HCUA 2UZOA 1IR3A 2IZUA 2WTCA 3AMYA 4HVSA 2P0CA 4U81A 4C58A 2UW3A 2UZWE 3KY2A 3PIXA 2PY3A 2RGPA 4M15A 4QNYA 2XF0A 4IZAA 3TDWA 4PUZA 4I6HA 3GU5A 1I44A 1J1BA 3NUXA 3R6XA 4NUSA 1ZYDA 1GOLA 3E88A 5DG5A 5HG8A 3TNWA 3SVVA 5DR2A 4FNZA 3IW4A 4CV9A 3Q53A 4E20A 3GNIB 3ORLA 4ZZNA 2XM9A 2PULA 3MW1A 1SNUA 3GC9A 2OG8A 3C4XA 5FDXA 2WMQA 3CTHA 2FSMX 4RIOA 1DM2A 1VYZA 1O9UA 4X3JA 4DAWA 4EBWA 4HVIA 3CGFA 5AJQA 3Q9WA 3UVRA 4Y5QA 4NFNA 1WZYA 3EL8A 3KXHA 2BMCA 3DTWA 5GJDA 5CAQA 3HKOA 2AC3A 2JFMA 2CN5A 2F49A 3F3VA 3H10A 4HOKA 2GCDA 2OZAB 5DNRA 2WEVA 4J8NA 3WF5A 2GQSA 5EQYA 3E8NA 1PXKA 4QYYA 2PMLX 5DVRA 4UWBA 2GNJA 3VS0A 4MXAA 3MBLA 3C9WA 3IDBA 4O0XA 4ZTMA 3MFTA 3V6SA 5EFQA 1T45A 3MFUA 4RG0A 3QBNA 4F1OA 2XB7A 3IW7A 5CAVA 5DMZA 3M2WA 1JQHA 4FT3A 5TOZA 2EXMA 3QTSA 1TFFA 2X4ZA 5HEZA 3BHTA 2ERKA 3QTWA 4YPSA 5AUUA 5C9CA 3Q2JA 4JDKA 3NYOA 4IXPA 3R9NA 3TWJA 3UJGA 2ONLC 3HMIA 3NR9A 3NVKI 5CZHA 4D2RA 2YM4A 5D41A 2WD1A 1BI7A 4J8MA 2XALA 4FTOA 1JOWB 3Q4UA 3L8PA 1R3CA 4PPBA 4FOBA 5C1QB 5IPJA 1ZOEA 4TT7A 5A4TA 4MVFA 4AW2A 2HZIA 2GHGA 5FQDC 5C01A 4UMRA 2X6EA 5FXRA 4AOJA 4GJ2A 4AA4A 2IW9A 2A0CX 3VO3A 3BU6A 4PRJA 3NZ0A 3VQHA 4AFJA 5BYZA 4NWMA 1B38A 2J2IB 4IE9A 4Z7HA 4OTIA 2OIBA 5CSHA 2OJIA 2XIXA 1LEWA 3A4PA 4W9XA 2PE0A 3KULB 3KXXA 4IDVA 3E5AA 4C2VA 1PXLA 2C47A 1M2PA 4EH6A 2WU6A 4UMQA 2WOUA 5EDRA 3PWYA 4RJ4A 3QHRA 4NT4A 4BCIA 3QX4A 4LRJA 1VJYA 1TVOA 4EUTA 4JG7A 3O2MA 1R39A 3FHIA 1SVGA 4YZ9A 3FLQA 4FL1A 5A4QA 4W4YA 5IQFA 3ZDUA 3F82A 4QMNA 3N51A 2JDSA 4BF2A 3IONA 4BFMA 4FIEA 4F9YA 3QGYA 5D7VA 3PPJA 4KKHA 2BZJA 4DG3E 2HYYA 3LCDA 5BVNA 4ZY5A 2GFCA 4C4IA 3AC1A 3DJ7A 3TDVA 4Y72A 2AUHA 3VS3A 4YZCA 2ITNA 4X6RA 5JFSA 3FI2A 3FI4A 4JXFA 4MQ1A 1KV2A 2GTNA 4EHZA 4FA2A 4S30A 3R7OA 2VWUA 3SRVA 4EOLA 1XKKA 4O4DA 2UZVA 5J9ZA 3IPHA 4XG6A 4F78A 5IUHA 3NUNA 1A9UA 2Y4IB 2O3PA 2W4KA 1Q8WA 1UVRA 5IMXA 3O17A 2RIOA 3FDNA 3HNGA 3FPMA 4CTBA 2EWAA 4AOTA 3TTJA 4Y8DA 5HVYA 3NEWA 4YHJA 3D7ZA 4CFNA 3QZHA 4BKJA 3FEGA 3UG2A 4FTQA 4GRBA 3FI8A 3GU7A 3IGOA 4QMSA 3V3VA 3BL9A 4I41A 1PY5A 5L2QA 2XNNA 1ZYJA 4EQUA 2IVTA 4QTBA 5EDQA 1E9HA 3P9JA 4WG5A 3UZPA 2Z7LA 2XIKA 2FGIA 3F66A 4IWQA 3BYUA 2X7FA 2J90A 2C1AA 1MRYA 1YDTE 2RFEA 3D5XA 2WQMA 3KF4A 3ORKA 4FC0A 3TUCA 4EZ5A 3FXXA 1OITA 2UW7A 4FV9A 4AW5A 4O82A 1S9JA 4ZJJA 3RZFA 1KOAA 1LR4A 2BTRA 2EVAA 2Q0BA 3FQSA 3L9LA 3UIXA 5J5SA 4FUXA 4JR3A 1G3NA 4HVHA 4FV5A 3IOKA 3E7OA 5C26A 3ODYX 2CMWA 5AX9A 5EI6A 3D4QA 4DFZE 2Z7SA 2B54A 4EHEA 5IA2A 3AKJA 4CNHA 5JQ5A 4FSQA 2XS0A 2ZMCA 2G2HA 3L8SA 4ZJVA 2E2BA 3RI1A 4YO4A 3D5UA 3OT8A 2PZYA 3PLSA 4LMNA 1V0OA 2W1CA 1XH7A 4JG8A 3GC8A 3KMMA 4RIWA 4O0YA 3HA8A 2HZ4A 3QTQA 4U44A 4UB7A 5FXSA 3R00A 4B9DA 3BX5A 1OKWA 1UA2A 2IF8A 4KWPA 1JBPE 4D0WA 4AXDA 3VRZA 2ITTA 2JEDA 5KHXA 2X0PA 5ETFA 3EKNA 2A27A 2XZSA 4QMZA 5AIKA 5L6WL 2C6LA 3RAIA 2F9GA 1OECA 1UKIA 3O8TA 5CXZA 2O63A 5AR4A 2HAKA 4JG6A 4LOQA 4JOAA 2CGXA 1HCLA 3F6XA 4O0VA 1OIUA 4ANQA 4DEIA 5BVDA 3EWHA 2ZV8A 1WVXA 5KNJA 3O0GA 2WTJA 5HG9A 4FKSA 2GNIA 3DPKA 3PPKA 2ZM1A 4IIRA 4YC6A 4I21A 5LJJA 3SRVB 3D0EA 3M11A 5IH5A 1T46A 4RVMA 4FX3A 3DJ6A 4S34A 3K5VA 4WG4A 3RM6A 3ZBXA 1UKHA 2UZEA 1JSTA 1Z9XA 2WIHA 3FJQE 1OZ1A 5IA0A 4WOVA 3FUPA 1ATPE 3BQCA 3VHKA 1WMKA 2PTKA 4BWKA 5FEQA 3OZ6A 3PE1A 4IZ7A 4AGDA 4HVGA 1ZYSA 3FZSA 4DEDA 2OZOA 2WTVA 3U87A 4NEUA 2W1HA 3QXOA 3SG9A 3NW6A 5F1ZA 2QI8A 4YBKA 1YDRE 4UALA 4MNFA 3R71A 2R2PA 4BCFA 2H96A 5I5ZA 3TACA 3N4TA 2QHMA 4FKTA 4K8AA 1UU3A 4PQNA 2X39A 1RJBA 3R22A 5F94A 5AUVA 5IA1A 2VTMA 2BDWA 5CU6A 5IKWA 3TZ9A 4USFA 3VAPA 2YFXA 4PX6A 4WBBB 4DFUA 2FB8A 4LDTA 1DAWA 3Q4TA 3P5KA 1R78A 2VN9A 3ZRLA 4IANA 2XK9A 4GFGA 3VF9A 1FQ1B 5JFWA 2YWPA 4YGAA 4ZS0A 4AQCA 3II5A 3M42A 1QCFA 2F7XE 2VGPA 4IWDA 3UDBA 2CNQA 3HRBA 2X7OA 4JQ8A 5J95A 2VTRA 2ZV9A 3PXFA 5D1JA 4O86A 4D2TA 3VVHA 2PMNX 4OTWA 5KKRC 2BIKB 4RIWB 2R3MA 4BCMA 1P14A 5I3RA 3ZHPC 5CAUA 4FK6A 1KOBA 5AUXA 2GDOA 5I9XA 4J71A 4XHKB 4FGRA 4O7SA 2PL0A 1W8CA 2G2IA 4TNDA 1WBWA 2PMIA 4QP9A 1CDKA 3FKOA 3MB6A 3ZFMA 3QCQA 2CGVA 3WIGA 5AP6A 1FGIA 2UUEA 3HV7A 4M66A 4NW5A 4RJ5A 2W1FA 3NW5A 4MUQA 2BIYA 3EFWA 4ZOGA 1IRKA 2HK5A 4FE2A 3BCEA 4M84A 4CFFA 3EFLA 5KO1A 2UW8A 2GS2A 3EQCA 4KUJA 4FT5A 4BYIA 4BVUA 2V7OA 5CX9A 4W4XA 4O96A 3D15A 3ZLYA 1J91A 3PJ2A 3W10A 3QFVA 4CFXA 4RC3A 2A98A 2VRXA 4EOMA 3C50A 3WE8A 3G33A 3OY3A 4UX9A 2HWPA 1GZOA 1OL7A 3OTVA 3QRUA 4L3PA 2C5NA 4XP3A 4YZMA 2WQEA 2ITOA 2C6IA 4BCPA 4CMUA 3KK8A 4K11A 3ZRMA 2OO8X 3CKXA 3W2CA 4AA5A 3C5IA 1Q5KA 1UNHA 2XUUA 2G1TA 2JDOA 3HV4A 4HYUA 1PXMA 4FIHA 4NCTC 1XH5A 3EN4A 5F4NA 4F9AA 4TXCA 5BYYA 3JUHA 5AA9A 4EOOA 4JL9A 1I09A 3IG7A 2YDIA 4J1RA 4PDOA 4YHFA 3PJ3A 5HNBA 3FZPA 4OT5A 4WRGA 4RWIA 4FVRA 3UP7A 4YMJA 4ZK5A 3A7FA 4EH9A 4RZVA 1OGUA 4KSQA 1RQQA 3K5UA 4CFVA 2W1EA 4MYGA 3MH0A 5HX8A 4KD1A 4FT9A 2B7AA 4G3CA 4M0ZA 5DFPA 2FSTX 2GHMA 3NIEA 4FEUA 3FZOA 4IFCA 4O0WA 5EOBA 4BCOA 4IAAA 4QRCA 5EW8A 3R0TA 4CZTA 1KE8A 1ZAOA 2BRMA 3LCSA 4OAVB 2WNTA 3T8OA 5AMNA 1QPEA 1OL6A 4MF0A 4RRVA 4DG0E 4O7NA 4DHIB 4L53A 3AD6A 5CU4A 3TCPA 1MUOA 4GT3A 4A9RA 3FMEA 2DYLA 3H9OA 4FVPA 4GT4A 2XM8A 5CSPA 4DT9A 3CIKA 5IQIA 3BYSA 5GIOE 5HD4A 4PTCA 4PTEA 4YLKA 3CS9A 2JKMA 1Q8YA 4C4JA 2XKCA 4AW1A 3ETAA 3MV5A 3RAKA 4ZZOA 3UDTA 2IJMA 3EN9A 2PUIA 4ZTNA 3I60A 2EXEA 2JBOA 4RC2A 4BBFA 4JBQA 2BKZA 1JVPP 3W0SA 2J9MA 3DTCA 2XIZA 4NM0A 1VZOA 3VW8A 2C68A 2C5YA 4L7SA 4FSMA 4QTCA 4APCA 1OBGA 2PYWA 3LQ3A 5F9EA 4BWXA 4A9TA 3HAMA 1H26A 4FKWA 5EM8A 3BL7A 2GNFA 2F7EE 5AR2A 4U3ZA 2QOIA 3UDZA 4EYJA 4NU1A 3OBGA 4HYSA 1PHKA 4X7QA 2PK9A 3TI1A 4BDBA 3SX9A 1QL6A 3QQLA 2OFUA 3O50A 3ENMA 5AAFA 3SOCA 1Q41A 3T9TA 1A06A 2V7AA 4E8AA 1E1VA 4LOOA 3HDNA 1TQIA 2OWBA 1K3AA 3NIZA 5D12A 5KZ0A 3VS1A 4CYIA 3G9NA 3BU5A 5AUYA 3K3IA 2ZDTA 4V0GA 5LMAA 2Z02A 2BVAA 2WKMA 4EH5A 3PE2A 1YXVA 4YTCA 2W9FB 2ZVAA 3R7GA 4YZDA 4TYHA 4O4FA 3NNXA 3NUUA 3V5JA 3S95A 3A8XA 2YACA 3BV3A 3CBLA 4AZSA 4FSUA 4BCNA 3PA5A 3QQHA 5AUZA 4FT0A 4QTEA 5L8JA 3OUNB 5HCXA 2QCSA 5M09A 3PA4A 2YM7A 1K2PA 2ITZA 2R3LA 1YWNA 2OW3A 3NSZA 4FZDB 4IM0A 1Q4LA 1CTPE 3OHTA 4FK3A 4LRMA 4AA0A 2OI4X 5CEKA 4LV7A 3RNYA 1MRVA 3DXQA 3OBJA 4N70A 1H1PA 2XK6A 3GENA 1YXUA 4OW8A 3BU3A 1CSNA 5HIBA 3TIZA 4DFYA 4ZLZA 3BELA 1Y6BA 4U7ZA 1J3HA 3HRCA 2BRBA 3EQHA 4OLIA 5EYCA 4D4YA 2WB8A 2XKFA 4K2RA 3ORNA 4FKQA 3V5TA 5CSWA 4IWOA 4DFBA 4MNEA 5FBOA 3H30A 3EFJA 4C4FA 1Q8ZA 2PE1A 3I7CA 4ASDA 1VYWA 2C1BA 2Z8CA 1OIYA 5DH3A 2XIYA 4IVDA 4QPMA 2CGUA 4FR4A 3ML1A 2HW7A 3DBDA 4U3YA 3W18A 3A61A 3COMA 3P7BA 5K0XA 3ZFXA 4QDEA 4UXQA 3VUKA 1G8JA 2RKUA 3F9NA 4ASEA 5AP0A 1XBCA 2OU7A 5M4FA 3PFYA 3Q2MA 1OVEA 5DN3A 3QQGA 1XMLA 1IASA 3FMMA 2J4ZA 5KMMA 4XJ0A 4AE6A 4I0SA 2B55A 2NNWB 1PXIA 1V1KA 3OF0A 4F08A 1TQPA 2ZYBA 4FL3A 3PIZA 2OJ9A 2OXXA 4TWCA 4GH2A 4JQEA 4IVBA 4ANMA 4HYIA 4NH1A 4HGSA 5A6NA 2R3RA 3UBDA 3MVLA 1IA9A 4IHPA 4KRCA 2B9HA 3HZTA 3GBZA 3GXLA 3T3VA 2YWVA 1V0PA 5CF5A 3NW7A 2BZHB 4BDEA 5DEWA 2BHEA 4I1ZA 2YITA 3UP2A 4CLJA 4V0GB 4E4NA 3CQUA 3DV3A 4JBPA 4DT8A 3OCTA 1GIHA 4P5ZA 4HJOA 1DS5A 3G90X 3Q9XA 2QC6A 3QTXA 4TYHB 3CTJA 4IJ9A 2VWXA 4K0YA 4R1YA 3UNZA 3ZLXA 2GQRA 1XQZA 3LQ5A 4MWIA 5M44A 3CCNA 4WUNA 3IGGA 3MIAA 3QD3A 3TUBA 4RC4A 4FZFB 4PV0A 3QYWA 3WZDA 3ZS5A 2B52A 2RFSA 3TT0A 4DTBA 2OIDA 4AXEA 5IQAA 4CT2A 5AP1A 4AT4A 4MXXA 3AC3A 3OMVA 1BL6A 3AXWA 4BN1A 4AZWA 3V8SA 4AZFA 4AAYA 4TL0A 2YIYA 4JDIA 4ITJA 3LLTA 4C3RA 3MVJA 2WMSA 1Q99A 3SV0A 4WKQA 4I20A 4W9WA 3WYYA 3PG1A 3PXYA 5TE0A 1M14A 4DEEA 2WMTA 3GCVA 2X0GA 1H24A 3FQHA 3QU0A 4YTIA 3U51A 2ZB0A 3Q3BA 4O1PA 4MNEB 4KBAA 5E8UA 4DGMA 4QP7A 3HP2A 4NFMA 2H8HA 5AIRA 4NM5A 2X9EA 2IG7A 5ITAA 3GP0A 3TZMA 4C61A 5EQEA 3OWJA 3E92A 3P7CA 4G17A 5LOHA 3L9MA 4QMOA 4PMPA 2IVUA 1OPLA 1DI9A 3ZLWA 3DZOA 5CI7A 4QT1A 5KCVA 1GJOA 3QRKA 3EL7A 4DHFA 4F6SA 5HTBA 2Q83A 3HAVA 4CEGA 4ARKA 4R77A 3RINA 4G6OA 2C4GA 3OVVA 2C5XA 3DK6A 2HCKA 3ANQA 2RFDA 4HGEA 4I5CA 2XAMA 4OBQA 2GPHA 3G2FA 3C0GA 4JI9A 2CCHA 4YTFA 5FBNC 3TNHA 1VLRA 5TR6A 1UWHA 5M08A 3RHKA 4JNWA 2GNHA 4BY9E 4U79A 3TL8A 3PLAE 3QGWA 3QQKA 1H4LA 1Y57A 3UQGA 2C0IA 5CSVA 4MBIA 4A4LA 4F99A 2B9JA 4PTGA 5CEMA 3AKKA 2R3NA 1Q62A 4AP7A 1Z57A 3JVRA 4YZNA 2ERZE 2Y4IC 3W0PA 4GK4A 1JPAA 4QYHA 3VJOA 3H0ZA 1U59A 2JIVA 3LKMA 4ASXA 5IA4A 2B53A 3HVCA 3FY2A 3AC5A 5HE1A 5HX6A 3KK9A 1NVRA 4Q5HA 2CLQA 4BTJA 3ZCLA 1WFCA 4F4PA 2VX3A 1VEBA 5DWRA 2JGZA 1M7NA 1P5EA 4RWLA 5LCJA 4JRVA 1R1WA 3FI3A 1GAGA 5JSMA 3VF8A 4PP7A 4BL1A 1G8KA 2XA4A 4DG2E 1GIIA 1PMEA 2YCFA 4TWOA 1ZWSA 2HELA 5EW3A 5F20A 3ZU7A 4ALUA 3SG8A 2PSQA 2W1DA 3DT1A 4C4GA 4BIDA 4F0GA 4IMYA 1O6KA 3W0NA 3Q04A 2ITQA 3PJCA 3QUPA 4R5YA 5KMNA 2PUPA 4OBPA 4AG8A 5CF4A 1BI8A 3E87A 1PXJA 2BRHA 4FTCA 3HMPA 3F61A 3ORIA 3P79A 3F2NA 5EM5A 2QG7A 4CT1A 3LFQA 1X8BA 1WBNA 1UNGA 5FD2A 5ETAA 3R9DA 3VUHA 2XIRA 5CASA 3MY0A 3GU8A 2X2KA 2WTWA 3GUBA 4DCEA 4Z3VA 2XARA 4YJSA 3P86A 5AA8A 4E4MA 2ITVA 3KB7A 5CNOA 4JAIA 5AP5A 3RNIA 5LVLA 1W2FA 4B7TA 4ENYA 3BLAA 1VR2A 3NCZA 1ST4A 3AT2A 3RGFA 1PMVA 2EU9A 2RG5A 4IAIA 3OY1A 4E7WA 4F9CA 3HGKA 3OROA 3F5UA 2XNMA 3BHYA 4FKVA 4RQKA 5CVGA 4EJ7A 2Y4PA 1ZOHA 1W7HA 3WBLA 4P5QA 3W32A 3AOXA 5LWMA 1ND4A 2JFLA 2WFYA 4IADA 4IVAA 1PYXA 4L45A 4UWCA