5L3QA

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
265
Chain Sequence
NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 90
structure length 265
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3qA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qA02
1SVSA 3VR6A 3LWNA 4P4SA 1W47A 2WIAA 5CIQA 4JYCA 3TNFA 2AL7A 1J2JA 1FOEB 1E1RA 1EXMA 3KXLA 3LO5A 1XBTA 1R0YA 2WWFA 4NU0A 3QQ5A 1Z6YA 3R7WB 1HUQA 1BH2A 2IYZA 2ZSAA 3UATA 4LHZA 3RWOA 1WQ1R 1PUJA 3AKCA 4LV8B 3ADDA 4P3YA 1E9DA 3DZDA 1YU9A 2BMEA 1FX0A 3QNUA 2ODWA 5K8UA 1E2MA 1FP7A 2V7QA 1DADA 1JJVA 2H8KA 3CPHA 3D3QA 1RC8A 1T5IA 4JYBA 1DBSA 2W2VA 5KOYA 1NI3A 1QHIA 4HZIA 4LHYA 3NKVA 1CR0A 2ONKA 5HE9A 1HEIA 1J8MF 1ZNYA 3AVOA 3LQQA 2AX4A 1E98A 1FNNA 4NPHA 1E2EA 1G18A 2HF8A 4YMUA 2XNSA 2WKPA 5JHGB 4YLGA 3GLGB 1A1VA 2W0SA 5UKDA 4QKQA 4PC1A 1XZPA 3ZVLA 5CK4A 4R71A 4GOKA 5M04A 2J45A 4F91B 2QP3A 3RAPR 1A82A 2O8DB 1YZKA 1QHHA 3GJXC 3WYAA 3VFDA 2GKSA 2VP6A 4RD3A 5FTNA 1LB1B 3ASZA 1NG1A 1CS4C 2EFGA 4TQ9A 4OK5A 5FOVA 1LF5A 3BFXA 4FMBB 4DUGA 3QOFA 5JSZB 4MGKR 4G5GA 3T1VA 3CRVA 3AVVA 5JRZA 3BORA 2JAQA 421PA 2BMFA 3OFND 2QA5A 4P4UA 2GF9A 4KODA 2F3TA 3TQFA 3EPLA 2XEXA 3VR3A 3IHLA 2GBLC 4QHYA 1OH5A 3DL0A 1E2QA 3VHLB 4N0EA 2WWGA 1S8FA 2ZYUX 4BZPA 2J1LA 1ZC4A 2VTKA 1QRAA 1VMAA 3GLFB 3DDCA 4KXFB 4DSTA 2R6DA 3O8CA 4U5XA 3CKLA 1CJKC 2BCJQ 4TLAA 3PEYA 4LBZA 3ND9A 4Q7LA 3SFVA 4BPBA 3HU3A 5EJEA 4GOJA 4BZXA 4EJSB 1W0JA 1Z08A 3Q85A 1TU4A 2DFNA 1NBMA 5FOXA 5KTYA 3VU9A 3N70A 3TAHA 2J0UA 2P2LA 3ZGXA 1FPMA 4P33A 3W6OA 3ZQJA 3K0CA 2BVNA 4BUJA 1XTRA 2JLUA 4B3XA 3TVDA 5C1BA 2WSMA 4A9AA 1QZXA 2OCAA 1AZTA 5LDDC 1Z0KA 3CH4B 2BEJA 2GNOA 2DFKB 2EWWA 2IS4A 1XTKA 3P4YA 4IDOA 5FUYA 1OIWA 5EXTA 5B2ZA 5AUPB 2Z83A 5E3HA 4GMDA 1W2GA 5J47A 1OLOA 1R6BX 2XNDA 1WXQA 1U9IC 3W6NA 2RGAA 1A4RA 2CHGA 5JJLA 1W4RA 2BJWA 2C77A 4B44A 3NC1C 3S1AB 4AG6A 4QM7A 1W44A 2GK6A 4DLXA 2OSBA 1N6PA 2GCOA 3Q5EA 4L15A 1MT0A 2OCYC 4JBYA 3SDZA 1Z22A 3K9NA 4B33A 1PLLA 2A9KA 2VSFA 4JL6A 3CX7A 2RKOA 4FWTA 5KNCA 3DPUA 3BH6A 2QBYB 3X1ZA 2Z4RA 1KO4A 4A0HA 2REBA 4ESHA 1QG2A 4C0AC 2H92A 4YDHB 2QE7D 3BE4A 3RS7A 2JLWA 1US8A 3TH5A 5F9HA 2IYSA 5EXSA 3GFTA 1GTVA 2FFQA 4Q7MB 1AQUA 4PPGA 3T06B 4PFSA 4LJ9A 2NO1A 4RCYA 4E09A 1C1YA 4EDHA 2CJWB 3CUEF 2RGNA 4NYIQ 3OEEA 4PTLA 5FOTA 5A5GA 5FH9A 2CVFA 4QG7A 3R8CA 1TUEA 2W6JA 4XD7A 1IM2A 1VPLA 2YOHA 3GD7A 3GLIE 3QEJA 5IHPA 4EQ6B 1VYTA 3C14C 3EARA 3KDSE 1KK1A 4Q01A 4KVGA 1N25A 4TZ6A 1NIJA 1Q3HA 3M6AA 1GVNB 4HSEA 5DE3A 5B58C 3TVTA 1YRAA 4IOKA 2LCFA 4F93B 2OBNA 2QGNA 4M1OA 3SJBA 1R5BA 2CNWA 2ZI4A 4IEEA 2OFOA 3GEHA 4MKGA 3WBJA 3AF1A 2OEPA 5KSZA 1XWIA 2GEVA 1KGDA 4RFSB 2QRNA 1HQYE 1G21E 1A2KC 3Q7QA 3TKLA 2CL7X 1G41A 4KCGA 4QM6A 1GNQA 3GJ4A 3WNCA 3K0AA 3PENA 3K70B 1DAFA 1OH8A 2V1UA 2QSYA 2YINC 5H1YA 2X2FA 3LBIA 4UNRA 3AVUA 1AS0A 2QZ4A 1TUIA 2VHTA 5FI1B 4EPRA 3U7FB 4TL6A 3R8FA 1SXJB 2ZI6A 2F7SA 1YR8A 2ATVA 4XTRA 5L3QB 2HJGA 1KSHA 1NF3A 4DCNA 3EZ9A 1OXVA 5DI9A 4HDOB 1LVGA 1T3SA 2J3EA 3GJ0A 1OH7A 3BAFA 1G8HA 3UWOA 4E07A 1SULA 2A2ZA 3SJZA 3IBYA 1KI8A 1G7TA 3JZAA 3IQWA 4JT4A 521PA 3WP1B 4R2IA 3ZIAA 3U61B 2VEDA 1XU4A 3ETLA 1Q22A 4PC7A 2Q6TA 1O3YA 4B76A 4GNKA 2FN4A 1QVAA 1A2BA 2HUPA 2PCLA 1ZBDA 5AJYA 5HR5A 3QPVA 5KPJA 1W46A 4TLDA 4JLMA 4DSUA 3QPUA 2NQ2C 3J81k 1ZIPA 2IWHA 2ZXUA 4B43A 4D80A 4QNMA 2QQ0A 5SZJA 1S1CA 4UNPA 3NEJA 3CPEA 3V9PA 3B13B 4ZCMA 3R9XA 4URYR 2Z6VA 1Q44A 1OKKA 1R0XA 2F9MA 1NP6A 4Q4JB 4WA7A 3NH6A 3CR8A 4CEIB 1EFHA 4KYUA 2ODNA 2P6UA 2X8AA 2HLDA 3AB3A 4FCVA 2ORWA 2UKDA 4MKFA 1N6RA 4UNNA 2B6HA 1GILA 1E0KA 4LJ8A 1G7RA 4LY6A 4TLEA 1OFHA 2OUKA 4TTRA 5KSPA 4U00A 4UKDA 5CYPA 5C18A 2DB3A 4ITRC 3QI2A 1ZM7A 1YVDA 2OLKA 3F0TA 1XXHA 3T12A 4QGAA 1KI6B 1G16A 2QM7A 4DVGA 3IIKA 3AKDA 1Z6XA 3CW2A 1TF5A 1XD9A 4D6PA 4WIAA 4LV6A 1N0VC 1WF3A 4LJYA 5FBLB 5FUWA 2WJVA 4LJ7A 4TMXA 1ZJ6A 3Q9LA 4EIWA 1G4AE 3CM0A 4ZPXA 5E7JA 2Q3FA 3FDIA 1COWD 2ZIAA 4PC3A 3SNHA 5FL7A 1KK0A 1N5JA 2GJ8A 4PO8A 5IDVA 2JJ1D 3CX6A 1G8FA 5JJIA 4MGIR 3GEEA 5EE3A 1CU1A 1ZMXA 2G77B 5TXGA 2YJTD 2OV2A 1H65A 4LPKA 3VX3A 3BIFA 4BFYA 4MYUA 5EXPA 1GKYA 4IFEA 1Z5ZA 2GCNA 3F8TA 5CB8A 1KZ7B 1IN6A 1H8ED 3H2YA 5JS7A 3G0HA 4C9BA 1R0WA 4MDFA 4NL4H 2ERXA 4Q00A 4AYTA 1G3UA 4KI0A 1Z07A 2VHQA 1N6IA 1KO1A 4TMZA 2CK3D 2JLQA 3K53A 4Q4AA 4US1R 4DB4A 4AY2A 1JQLB 3T5DA 2Q21A 2ZJOA 2IC5A 3IDQA 4HAXA 2DWOA 4DRZA 3FKSD 4JVLA 1E96A 1E0AA 3KTAA 1W4CA 5KSOA 1GL6A 1PLJA 4ACBA 1LY1A 4A8JB 1JQJC 3FMIA 3SS8A 4TTPA 1OH6A 2PJZA 2JJ2A 3QKRA 5CDFA 2VSOA 5E4FA 3L0IB 5FR2A 3A8TA 4F4CA 4L8GA 1WBDA 1RYFA 5E7MA 2V6JA 5JWRA 2ZSDA 3GLGE 1SVIA 4TSFA 3FWYA 1G8GA 2IYXA 3PVSA 2PT5A 4YMSA 4D0LB 1OSNA 3ZDQA 3V4FA 3K70C 1W36B 3MUFA 2AN9A 2WJJA 2WIBA 2XX3A 3JVUA 2AFIE 3FHOA 3K09C 2K5UA 2EFDB 2FA9A 1YQTA 2HV8A 2F1JA 1IN4A 3W34A 4AI6A 4JLKA 2D62A 3L2OB 1T0JB 3V00A 5C2JB 1BYIA 2HCBA 4YXWD 1NY6A 4ARZB 1D9ZA 3SHFA 1CULC 2C03A 1N3BA 2B92A 4CEJB 2A5FA 3THWB 5A0FA 4C7OA 3KKNA 5CLLA 2WSSA 3RS0A 4HB4A 2DY1A 2QENA 3PJRA 1LNZA 2GJKA 3GFOA 1BMFD 2ZR7A 1JR3A 4RKEA 1NVWQ 4BFZA 1T3LA 2O8FB 2FEMA 1EFUA 3AF4A 3QF4A 4POAA 3GLFE 4C2UA 3EPJA 3KQNA 1BO6A 1DVRA 2QPAA 2XJ4A 2YOFA 2WKRA 2JGNA 1W2HA 4P32A 3T15A 2IEZA 3LBNA 3FHCB 2QAGB 5DH9A 1FNMA 3U2QA 3QIAA 1GRQA 2V1XA 1GP2A 1RE0A 1KKLA 4LYFA 3OAAD 3HU1A 2NGRA 4D26A 2ZS7A 4Q9KA 2W6ID 4R7ZA 5CB6A 2QSZA 2Z0MA 2Q0HA 1KYIA 3K70D 2X77A 4MDEA 1I4DD 1SXJC 1IN7A 1UKEA 4D0NA 4LHWA 1J70A 2WPDD 4FMCB 2CLSA 4HB0A 1SXJD 1Z06A 2R6CA 4HZUA 4ON9A 4YDSA 3BK7A 4HDQB 3EZFA 1DO2A 1TQ6A 4E03A 3I5YA 2CHVA 2ZI3A 5FTLA 1DAEA 1M7GA 4TQAA 3T35A 2QT0A 3WRYC 4ABYA 1E2KA 2QN6A 4Q1AA 1TF7A 4DZZA 5H68A 3KFXA 4KBGA 2ZETA 4ILEA 2YV5A 3CPJB 3H4MA 5FUXA 3RSOA 3FVQA 4LWZA 2QGZA 5AJVB 1HH4A 4M0LA 4OI1A 3QVVA 1F2UA 3HR7A 1DAMA 4RD0A 1XZQA 2IHYA 4DSOA 3EPHA 3U6BA 3PUYA 1KJZA 3CF0A 5FPTA 1AKYA 3IPYA 2AD5A 2NMVA 2F1HA 2E9SA 5DIFA 4TTQA 5BYKA 1ZNXA 1VG0B 3PITA 2CXXA 3TR0A 1EFTA 5GVSA 4AK9A 1KO8A 2I1VB 3MAAC 4GRAA 4AKIA 1CXZA 4BLSA 3KFVA 4IDQA 5BN4A 1E9FA 5L3SA 3OFNA 1VCOA 4FMCF 3IEUA 3GMTA 2C95A 4KFUA 4NZYA 1TF2A 1XP8A 2KBFA 1TQ4A 3K9GA 2HDNB 1OFIA 2FPLA 2BDTA 2C2HA 3TSWA 3GLHB 4QFMA 4DEYA 3K8YA 4B35A 4RZ3A 1SVWA 2ZVQX 2AKYA 1EK0A 2D74A 3MG9A 1FFHA 2REXB 5EZ5A 2ZUCA 1CF4A 3KQKA 2FZ4A 4A4DA 1RIFA 1Z2CA 1XCPA 3IO5A 4OHVA 2XXAA 3SFZA 1DG1G 2D2FA 1ZAKA 1WCV1 3TK1A 1MV5A 1FW6A 1UM8A 3CBQA 3GJ6A 3LH5A 2OO7A 3CZQA 1LTQA 2B7CA 2CCKA 4A1FA 3ZVRA 2O8BA 2G88A 1XJQA 1F2TB 4I4LA 1QHSA 3ZVMA 1E99A 1IN8A 1OJLA 4Q7JB 4LYHA 4B47A 1B23P 3A4NA 4MYHA 4JLNA 3WBKA 2IUTA 2GRJA 5AJWA 5KO2A 3ZLJA 3FPAA 3IO3A 4U7DA 3OESA 4Q1DA 2F43A 3W8NA 3MD0A 1W0KA 4M21A 4DLTA 4A2WA 5K8IA 2FE4A 1KY3A 1SXJE 2PH1A 3CB4A 4Q48A 1DO0A 4AKEA 4B2LA 5K8LA 5JLJA 1KAGA 3KJGA 3BH0A 1N6KA 1HV8A 3WP0A 3QKUA 1S3GA 4EPVA 2VHCA 5IF9A 3EPKA 3WYGA 2I3BA 3SYLA 3CO5A 2G1KA 4PAMA 1HT2E 2PZEA 5A4JA 2VP9A 1HE8B 4JVSB 1HTWA 2PLRA 3W6PA 4EFLA 2VF8A 2WWIA 4A0GA 3E2IA 3TSOA 1XCMA 2OCBA 3OE7D 4HAZA 4B71A 1G3MA 2C9CA 2DFLA 5CJPA 5SZHB 1OB5A 2ZQ5A 4D0GA 4DHEA 3FYHA 2Q9CA 1P6XA 1VHTA 2F6RA 2ZVPX 4YC7A 3SI7A 3UWKA 2OHFA 1U8AA 4I81A 1SZPA 2D2EA 2H18A 3VTKA 1OXXK 1CJUC 1KMHA 5FBQB 5LB4A 1YZNA 4RSGA 2BBOA 2ZE8A 4GSYA 2BV3A 4DIEA 1W36D 4TYWA 5IRCD 1ZRHA 2WKQA 4KFSA 2R2AA 4JS0A 4TMVA 1YZUA 2J59A 2GJSA 3W5JA 4MQBA 2ZJBA 1NMXA 4BFUA 1D8TA 8OHMA 5FTMA 3RRNA 1RJ9A 1JAHA 1ZCBA 3K0SA 3X1WA 2ZE6A 4QGFA 2ZJYA 2VYFA 3ZZTA 5J4KA 1HT1E 4NCNA 1PVOA 1GITA 3AP3A 4YONB 3BJIC 1ESMA 2JASA 2REOA 4QBFA 3H84A 4OBEA 3REFA 4Z51A 3B7GA 1W7AA 4NYJR 3IGFA 2ZEJA 3FB4A 1D6JA 2G6BA 4PQFA 4Z54A 3FMPB 3VNVA 1OFUX 4PHHA 3MFYA 4OKSA 1Z83A 4P4SB 4OHZA 3ONWA 4OQNA 1G17A 2H7VA 3B1ZA 4HLUC 5EP4A 4GZLA 1KDPA 4V0OA 5ELXA 1GL9B 2O0JA 5D3MA 3E5HA 4CDGA 4Q9JA 3RRZA 1Q1BA 4I99A 3RRMA 4QNRA 4LJ6A 2YOGA 1AJEA 1E9SA 3KKQA 3MCAA 2GWHA 4W7SA 6Q21A 1NJGA 2H57A 2WOJA 3SYKA 5J4HA 2ZUDA 2TMKA 1FX0B 3SJAA 2QAGC 3VR5A 1ZUIA 1UKVY 1TX4B 1ZU4A 4M9ZA 3AGQA 4F92B 5JS8A 1XJCA 3MWYW 4OJKA 1SVLA 2QPTA 2WV9A 3U3KA 1WRBA 5F9FA 2OFWA 3WRXC 3KJEA 3KQHA 5JEDA 4IRUB 1XX6A 2RB4A 721PA 3AUYA 4NHOA 5SZKB 3EA5A 5B57C 4HUTA 3TRFA 3B9PA 3ICEA 1QVRA 3CRQA 2O8CA 4EAQA 4YMVA 2ZI9A 1B0UA 3GPLA 4M1YA 2C9YA 3VX4A 1RRCA 1OV4A 2WZQA 2V6IA 3ZD7A 4FINA 3HPRA 3KUDA 2WWXA 1G20E 2X2EA 4MYTA 4M8NE 5EZ6B 2QMOA 2J7PD 1QHHB 1G3QA 1MO6A 2OBLA 3PUWA 1KSGA 1ELOA 4QGHA 2IYWA 3GLGA 2BKEA 4DXAA 5FI0B 4BWYA 5KPDA 4LC0A 5LD2B 2O8EA 4Q1BA 1N5KA 4D25A 1Z8FA 1DAGA 2QMUA 3LXRA 4B74A 1L4YA 1Q12A 2F55A 3NIBA 5GJCA 1OYYA 3C5HA 1EFRD 4W5JA 4HB2A 1R5OA 3M0EA 2EW1A 3QXXA 2PX0A 1KHTA 2GVZC 1E9RA 1XJ0A 4DLUA 1ESNA 1KDTA 1VYUA 3TMKA 2OILA 2FPMA 4Q02A 4PO9A 4TYYA 2P6NA 4AYWA 2P6RA 4ZDJA 1UKYA 3QKSB 4DCUA 4BLTA 4JKIA 4GZMA 4RY2A 2YC4C 3A1UA 1W4AA 2HT6A 1CRPA 4I1OA 3I5XA 3E1SA 1I4TD 4XSHA 3RYTC 4A2PA 3I3SR 3R9IA 1S0UA 2R44A 4CZ2A 3RHFA 1N0UA 3QXJA 3T34A 2BHRA 2BIFA 2IT1A 4NBSA 3X2SA 3NG1A 2R65A 2ZRNA 5BYJA 1RYHA 3T1QA 2GAAA 4A2QA 2LKDA 3NDBB 1SHKA 3O8BA 4Q4LA 1AGPA 2GZAA 1COWA 1Z0AA 1PUIA 5CK5A 4OK6A 4WBSA 5FPHA 2FSIA 2JJ1A 1RRGA 1VDZA 4TMWA 4LJ4A 4BLQA 1YZGA 2FGKA 3KXIA 3RNLA 4ZDIA 4H1VA 4XWAA 3B78A 3QG1A 4JL8A 2I1QA 1XNJA 2FFBA 3JZMA 2XB2A 3EIEA 5F2EA 4EJSA 4HAVA 1LV7A 3N2IA 5AK0A 2Y8EA 1UF9A 1Z0DA 4A36A 2WAYA 4FI3C 1VCMA 1E2IA 1H8EA 3TSZA 1DS6A 1TEXA 5FBWB 5JCZA 5AWFC 2RCNA 1K5GA 1KDRA 2IF0A 4JSTA 4PZYA 4DKXA 3VNUA 1XB2A 3P26A 2ZPTX 4Q7KA 4KLZA 3CRRA 3OHMA 4UQOA 3FKSA 2IYVA 4BFTA 1MO4A 2FSGA 2Z4SA 1ONBA 3QUSA 3W5IA 2VO1A 1OIXA 3GJ8A 3RS3A 1G64A 4ZI2A 4JLPA 2ZREA 1ZM2A 4ERNA 3MSXA 4D2IA 2J0QA 2G9NA 5AUOB 4OI4A 2FZLA 1JXOA 3S1AA 4G1UC 4WOPA 2B8WA 1KSFX 4MRRA 3U5ZB 3A6PC 2C98A 3KX2A 2ZR9A 3ZVNA 1E32A 1US8B 2QUZA 1MO5A 2ZRFA 4KVAA 3WHKA 4D4KA 4KSCA 1VG1A 2ZYWX 4Q9HA 1KI9A 2JA1A 4QJ5A 1DAKA 4TYQA 5JBQA 4KYIB 3RWMB 4BECA 3QY0A 1TADA 1KI4A 2ZS8A 1E2GA 3VKWA 1ZIOA 1P2TA 3T1TA 3LLUA 1OE0A 3B1YA 4YXWA 4NCIA 1LFDB 3C4JA 3CRMA 3AVTA 1QDEA 1CTQA 2PT7A 5JCPA 3L8YA 1G19A 3LW8A 3NBFA 2VBCA 2CMKA 4GT1A 3EIHA 2R6GA 4JLOA 5C4MA 3A1WA 5EP3A 1Z6TA 5DNYB 3UKDA 5FUVA 4B6EA 2QRZA 4ZI3A 3BB1A 4DLWA 2WTUA 3LX8A 3GLHE 1E79D 1P5ZB 4H1UA 1BMFA 3SYNA 1XEXB 2ZRJA 5L8VA 2C96A 2NO9A 3CH5A 3W3AA 4V0ME 5FTKA 3NBYC 3W90A 2KWIA 2AXPA 2HEIA 4GP6A 4M1KA 4Q21A 4DCSA 3RANA 3K0AB 2GHIA 3IEVA 2ZRMA 3I1FA 2VP4A 1E1QA 4I1UA 1KDOA 4ZCIA 1U99A 4D4JA 2VH5R 4K81B 3OAAA 4JZKA 2IYTA 4Q1CA 4ASUD 2W6IA 3V4RA 1P9WA 4DWJA 5JHHB 3OEHD 4C0LA 1AS3A 1T5LA 1R5NA 3DM9B 1DTSA 2IX3A 1E2DA 3NBZC 4NH0A 4QBIA 1D2NA 2DWQA 1GRRA 1UFQA 4PPQA 3TW8B 4RD1A 4D81A 2GZHA 3BRWD 3KKOA 3NDPA 2BEKA 4BEJA 1KY2A 1MABB 3AH8A 3EG5A 2Q9AA 5DHFA 1YHNA 4M4SA 1BYUA 5EE9A 3JVVA 4IW3B 1WDTA 4OYHA 1IHUA 2G1JA 4RZXA 2WMOB 3PUZA 5F3WB 4UXHA 4B2PA 4CT4B 1UDWA 3BXZA 3LQRA 1T6NA 4C2TA 2B7BA 1VKJA 621PA 2W2XA 2C9OA 2ZE7A 5EP2A 1UAAA 4PHTA 2ASEA 1EGAA 1PZNA 1I4LD 4I1VA 4TT3D 3WXMA 4R9UC 2HYDA 3THOA 2FDCA 4N1AA 2HYIC 1W1WA 3SOPA 1KI7A 2ZU0C 3DZ8A 5LD2C 3P20A 5DI3A 3QBVA 3L43A 4Q19A 1IY1A 4JLAA 3TJZA 4KV9A 3BH7A 1AS2A 1NVXQ 1E2HA 2CLDX 4H9GA 4CYMA 2XTNA 4DSNA 1CEEA 2FGJA 2QMEA 3ADCA 4LV5B 4HAWA 4HYYA 4F7WA 3AVPA 1VECA 1OFTA 1ZM9A 2IS1A 3WNDA 2V4ZA 5HCNA 2IYLD 3L8ZA 1E3MA 5DGXA 4OQFA 2JATA 3IUYA 3IILA 2ZSEA 4OK3A 1XXHB 1TL7C 1VCIA 2IHBA 3SN6A 4BEBA 1ZC3A 4QJ3A 3AVYA 4LUCA 2B21A 1ZP6A 2PBRA 3THXA 4HUQA 4A0FA 3K9LA 1KI1A 3AV0B 4XH9B 4RJLA 2ZSFA 1GZSA 4OI2A 4MRPA 4Q9IA 3SZRA 2NPIA 1KK3A 4NP6A 3RSLA 4BLPA 4DC9A 4QBGB 3U4QB 3ADKA 4GMXA 3P32A 2GXUA 3VKHA 5EQTA 3C8UA 2YYZA 3D6TB 4B3FX 1IXRC 3MJRA 3L82B 5JWOA 1ZM4A 4LBVA 3LD9A 1R8QA 3MLEA 1M74A 1P2UA 2RMKA 1GKIA 2BM0A 2OCPA 3QEOA 2J0SA 1QHNA 3K0CC 3RS5A 4GOXA 4Q4HA 2W0MA 3G82C 4PSAA 3KXKA 5GADl 2NOAA 1NN5A 1XTJA 3UPUA 4QJ4A 2ZRIA 1F3OA 2D7CA 2QY9A 4DDVA 4LGMA 4B2IA 1MH1A 3ASYA 1G7SA 1KIMA 1D2EA 4LHXA 2FSHA 1FZQA 3A4LA 3KJHA 3EC1A 3KTAB 3P4XA 3W9YA 1G9XA 4MRNA 1G5TA 5GJWC 3KL4A 2ZSBA 3TIFA 1GL7A 2NO0A 1II8A 2J9RA 2ORVA 1R4AA 2ZRHA 5FOWA 1GNRA 3TW4A 3DM5A 1ZINA 4HLQB 2A5JA 4V0KA 3Q5DA 1UBEA 4CF7A 4JJZA 1NG9A 1OIVA 2GCPA 1FQKA 1TU3A 2AWOA 1CIPA 4TL7A 1JECA 3LDAA 3EIQA 3OE7A 1CR4A 4QC2A 3U44A 1EESA 3A4MA 3G5UA 4KLNA 4MKIA 4A8JA 1DEKA 3RDPA 5EXXA 1UDXA 3RRYA 2IXFA 4EPTA 1EX7A 1W5TA 1JPNA 1XPRA 3ZQ6A 1GKUB 2WM9B 2IS6A 1Y3AA 3T61A 2ZRPA 2XTMA 3F3YA 3NH9A 2IS2A 1W48A 3FE2A 3OF5A 2QT1A 1NMZA 2RGNC 5AR1A 5L3VA 2ORIA 4GFDA 4F4JA 1E2NA 1TNDA 3ZS8A 1AN0A 1U0JA 3NHAA 4C7OB 1KKMA 3B2EA 2RGCA 5DN6D 2CL0X 2VL7A 2ZU6A 4DDTA 5FBRB 3TUZC 3QXCA 1AM4D 2ZYTX 4PAQA 2VA8A 1G8YA 4OHXA 4ARZA 1G3IA 2CL6X 3T1OA 4KU4A 4LBWA 2ZJ8A 3B1WA 4QHSA 2GJAA 4Z1MD 4LZZA 2LKCA 2EFEB 2IXGA 2PL3A 1IN5A 1SVKA 3QF4B 4XSGA 3Q72A 5D3QA 2ZRBA 1SHZA 3RC3A 4B48A 1DOAA 1E4YA 4MUAA 2CNWD 4ZIRA 1NRJB 3C15C 1NVVR 2GDJA 3BFKA 1ZD1A 4CW7A 4FXPA 3X1XA 2J5XA 121PA 1XD2A 3AEZA 3I62A 3A37A 2WICA 3LV8A 4M9SA 1L7VC 2AFHE 3BBPA 5E95A 2G83A 4DEXA 4DT1A 4LCBA 4MA4A 1TTTA 2AXNA 5DHAA 5B64A 1XEWY 1R7RA 4HZUB 3UMRA 4BLRA 3DEFA 3RVBA 1F5NA 4B75A 1FTNA 4OQLA 1UJ2A 2A5GA 3UK6A 1JEDA 1G1MA 2YC2C 3BGWA 2XSZD 4AG5A 3KQUA 1CJVC 3GQBA 4C0HA 2FX3A 1P73A 1M7BA 3ECCA 1OHHD 1VIYA 3MGCA 4HB3A 1R0ZA 4A6PA 1KO7A 2GK7A 3HWSA 1SVMA 3HJNA 1VHLA 1JAIA 1VG8A 3W3ZB 2XITA 4PX9A 2OT3B 5HZHA 5BN3A 2FH5B 4FWIB 3AM1A 3ZIAD 1EFCA 2YHSA 2RGDA 4X8HA 3SQXA 1F2UB 4QXAA 3K0FA 1EG7A 3B5JA 3TUIC 3P1JA 3Q3JB 3BC1A 3RABA 4R98A 4O2LA 3GP8A 4IVPA 2QORA 3U7EB 3CR7A 1U8YA 3GJ5A 2J87A 2GXSA 1PJRA 5SZIA 3UG7A 3ZS9A 2ZM5A 1GFIA 2EYQA 1DG3A 3AUXA 1U98A 1EFRA 5BQ5A 5IT5A 4W5HA 2BMDA 2R62A 5L3SB 2OE2A 4KFTA 4PPNA 1XTQA 3PQCA 4KHZA 3BERA 5HPYB 4BLOA 3LX5A 4PZZA 4FMDF 4DLZA 3GLIA 1H8HD 1DAIA 3THYA 4HAUA 4NTZA 2AK2A 2GA8A 1IXZA 4A82A 1IAQA 2ZRKA 3B85A 5ANRB 3TE6A 2GBLA 2IL1A 2WBLC 2OZEA 3NVAA 2RGEA 2CVHA 2Q3HA 2VHJA 4A0RA 4UNQA 2P5TB 5KUTA 1RRFA 4DB2A 1NN0A 2A78A 3NBXX 3BS4A 2ZUBA 4Q47A 1E2FA 1UADA 2FG5A 4OI0A 2J7KA 3BFVA 4CT5A 4PZLA 1NN1A 1NMYA 1KO5A 1NLYA 2W83A 1BS1A 2FV8A 4K8OA 1G4UR 2YWFA 5FOUA 4PC2A 2IYYA 2XXAB 3KB1A 1JJ7A 4WVFA 3M1IA 1RVDA 2O0HA 3NTUA 2ZJAA 4IEIA 4A15A 4CEHB 5TMPA 2IW3A 4E22A 3CLVA 3WMEA 1BKDR 3CF6R 4XVUA 1T91A 3I8XA 1KTVA 2QEQA 2NIPA 5BN5A 2EYUA 1KMQA 2UVQA 3RS2A 2ZROA 4NYMR 4S35A 3GCGA 4HLCA 4XOIA 2F9LA 2IA5A 5EP1A 1YR9A 5KSYA 1E9EA 1ZM3A 821PA 3UXMA 5G41A 3U3RA 5GJVC 2EFCB 2DWPA 2JCSA 3T5GA 4US2R 5J40A 4IKEA 4XWOA 4O3MA 2OXRA 1T8UA 4LJAA 4BE7B 1IJEA 5CM8B 1U9IA 1FL9A 4ZCLA 3FMFA 3LRPA 2V9PA 2FPKA 4M9XA 2MSCB 5JI3E 1NSFA 3QPWA 1ZD8A 4WZ6A 4CGZA 1EX6A 2C99A 4RZUA 1Q57A 4JL5A 4U02A 1D9XA 4Q03A 2NZJA 3QBTA 1A7JA 1FMLA 3IIJA 5FR1A 3SJCA 3Q7PA 3KQLA 3AF2A 5TY0A 4LBYA 4NCJA 5J4LA 1N5LA 2CCGA 2QE7A 4WXRA 4YQFA 1L8QA 1RRPA 1VIAA 2ANCA 4KFRA 2IWRA 1BOFA 4A6XA 2OG2A 2VSXA 2YWHA 4JKYA 2IUUA 1XMJA 3IIMA 1KMHB 2RHMA 1Z6GA 2W58A 4M2LA 5J5CA 4MGZR 1M6NA 1NL3A 1TPZA 4LSGA 3TQCA 1DPFA 1N6LA 1L2TA 4EPXA 5HKKD 2BKUA 3FOZA 2BM1A 2XTZA 1FTSA 1NSTA 1XD8A 4JSYA 4EPWA 4G01B 1OYWA 4RKFA 2JLXA 1SGWA 2ZTSA 3LNCA 4AKGA 3FFAA 4DDWA 2IBMA 2C8VA 2XZLA 3EASA 1Q3TA 4FIDA 4NE2A 4B6FA 1S96A 4F38A 1FMJA 3SE0A 3QE0A 1T4GA 4OHWA 1KNQA 4IOJA 4EKDA 5GVRA 1XXHE 1AGRA 4C0BA 2HT1A 2D4HA 5DISB 2ZR0A 2W00A 4AIIA 4QRHA 1E79A 4XVRA 4KBFA 1Q20A 2OLJA 1M8PA 4B32A 1S2MA 1W4BA 5CJ2A 4IXMA 2BWJA 1PV4A 4RD4A 2E1RA 2QMHA 1JR6A 1E94E 4G5OA 2JLSA 1X8KA 2ERYA 2JDID 3I4LA 3ICQB 4M22A 1YRBA 3REGA 4PQYA 4TYNA 3R7WA 1XPOA 2VP0A 4ASUA 3ZZUA 1K5DA 2YVUA 4GBMA 2P67A 4KJZA 2DYKA 3OEHA 2NTYC 4NMMA 5HTKA 4C4PA 1N2CE 2VRWA 1X6VA 2QU8A 4NYJQ 1E0JA 1U0LA 1RKBA 1P2VA 2P0EA 5EUQB 1N5IA 2PJRA 4CVNA 1JNYA 4JLJA 2HF9A 2JLVA 2IEYA 2UZ3A 2O8CB 1QF9A 4LJ5A 2QNRA 1D2MA 4I1SA 4M1TA 3U6KA 1OXSC 4WZBE 1NY5A 2FSFA 2ZAOA 5KNBA 2XAUA 5TARA 1M7HA 3VMFA 2OXCA 3UG6A 1XTIA 2RGGA 2ZI7A 4IDHA 1YZLA 4Q18A 1HURA 2N1BA 2WMNB 3IHWA 4NCKA 2PLFA 1IQPA 2O8EB 3MWJA 1OB2A 2O8DA 1CKEA 1NKSA 4R2HA 5FPYA 1W49A 2OBMA 5EE5B 3VKGA 4KAXA 4TT3A 5HZKA 1DARA 2PZGA 5CDFE 3LLMA 3WNBA 4MKHA 3VR4A 5JSZA 2MSDB 3NC0C 3GJ7A 4A92A 4B73A 2F1RA 4L5BA 1M2OB 1IY0A 3EZ7A 2BBSA 3QSYA 5KHOC 1QBKC 2IK8A 1P3JA 1I2DA 4LDJA 2HXSA 4JBXA 1JB1A 4N0DA 3U3MA 1MOZA 4NKRA 1X8LA 2KI5A 1ZYUA 3L0OA 2OAP1 3OIYA 4E5UA 3I92A 3KKMA 1E9BA 3AQ4A 3PEWA 1YR7A 4TN1A 5AUQA 2FJUA 2EWVA 3AVQA 4UXJA 2AD1A 1JI0A 1N6OA 3CWQA 1XMVA 3QKSA 1R10A 5IK2D 3GLFA 3EX7C 3ZYCA 2PMKA 4DLSA 1GSIA 1T9HA 2ZJZA 5LB2A 3VU9B 3IKJA 3UMSA 2H5EA 2J0UB 1E2JA 2JJ8A 3LVQE 5JZVA 2XOKD 1X86B 3M4YA 4TL8A 3N5CA 1ZNZA 1F60A 1G291 1GDDA 4FW9A 4CRWB 3DOEA 1AQYA 1J99A 3LBHA 4PHFA 2OM2A 2D06A 1JR3E 5L3RA 1P2SA 4US0R 4EUNA 3VAAA 4IHQA 3HDTA 5FOSA 2PCJA 5KNDA 4PQRA 4JT2A 2R6AA 3IBGA 5AJXA 1Q1EA 1G5PA 2CK3A 3UMFA 2QROA 3LVRE 1P72A 3HYRA 4DLYA 4PPFA 1GWNA 4Q1EA 3PEVA 4GL2A 3DMDA 1IXSB 2EFHB 2VF7A 4KSBA 1J90A 1IY2A 3QF7A 5EUMA 3ZJYA 2GESA 3AF0A 5BWMA 2QG6A 1AIPA 4K46A 2GCOB 3IPXA 1W0KD 1N6HA 3SU8A 4LOAA 4OQMA 3D31A 3A36A 3TR5A 4EPYA 3PUXA 5CM9C 3BB4A 4NYIR 2KE5A 4TWZA 4JLDA 3TBKA 2V8OA 3LXXA 3ND8A 4M1MA 2QM8A 4B3GA 3AP1A 3I73A 3TUJC 2P65A 1HE1C 1TQDA 1GNPA 3I61A 2KSQA 4BFSA 2GVDC 2HJVA 1Z0IA 3EZ2A 3D8BA 2Q9BA 4URVR 1LS1A 1MKYA 3U7HB 4UJ5A 2QBYA 1SQ5A 2HXYA 5TV2A 4LK2A 4WZAE 2NO6A 2GZDA 1T3HA 4PC6A 5DYGA 1GIAA 1XRJA 2QQEA 3K09A 4G3XA 3WY9A 1N0WA 2PZFA 1G3RA 1M1YE 1FUUA 1XMIA 1YZTA 4M9QA 5JEEA 4G5SA 1CP2A 1D5CA 1Y63A 2A3RA 2ZRAA 4V0LA 5EE1A 4IDNA 2CJWA 5G3YA 4PAOA 1MR3F 3VR1A 1AK2A 4BQSA 1NNEA 3C41J 3A1TA 2JIZD 1SVOA 3PFIA 5G3ZA 2C5LA 5JFGA 3U60B 2WWWA 3KUCA 1UEJA 5DN6A 5C4GB 3AVWA 3O47A 3SC3A 1F48A 4EQ6A 1KJWA 3I72A 4V02A 4IOLA 4RVCA 2AK3A 4OL0A 1WBBA 2Z5FA 1SKQA 2NO7A 1IONA 1ZVQA 2R9VA 2CCJA 4Q5IA 5KYKA 3SEAA 1XDBA 4Z1MA 1TMKA 2P5SA 4C0KA 1XTSA 1Q0UA 3B6EA 2WJGA 2JLZA 2YNMA 3QG5A 1KJYA 3MMPA 3GJ3A 1L4UA 4JBWA 2BBWA 3UIEA 4V0NA 3PIRA 4O25A 4RFSA 4W5WA 4XIGS 1E1RD 3SBDA 4MUBA 3K9HA 1VG9B 1XEXA 4DDUA 4C3ZA 2QTVB 1XF9A 3HR8A 5LBIA 3HU2A 1G7CA 1GRNA 4AC9A 3MRSA 5B30A 1Z0FA 4HEJA 2WPDA 2L0XA 2V7QD 4C30A 3NEYA 1SXJA 3PCRB 2ZJ5A 4FCTA 1AZSC 3CRW1 2VQSA 5L3QA 1Z6AA 4ZO4A 2DFTA 3U7GA 1NVUQ 1HQCA 1P9RA 3LA6A 1Z28A 3LW7A 3GEIA 4JVMA 3DHWC 2FNAA 4RCZA 3A1VA 2YZ2A 1NN3A 4RD6A 2OAQ1 2RGBA 2XSZA 4Y0AA 3KKPA 4IDPA 3CWZA 2FEOA 3B8HA 1OHHA 4RD2A 2RH5A 3FFBA 3WHLA 2DPXA 4TYPA 2J46A 1C4OA 2N46A 3NWJA 221PA 4HATA 1MABA 5CLQA 1CRQA 2LWIA 1UEIA 2CHQA 4HLDA 3CZPA 2ZRGA 3EWAA 1Z0JA 2QP9X 2KB0A 2XGJA 4DCTA 1DELA 2XZPA 4DUGD 5DI3B 2O5VA 4OJQA 5TDHA 1Q21A 1OF1A 1R2QA 2WWHA 3HP1A 1V43A 5J4YA 4PO1A 1SKYB 2YWGA 3DKPA 2RHDA 4XWKA 5GJBA 2NZ8A 4Q4JA 2IYQA 4HI0E 4CEIA 4B3CA 4KO8A 1RFLA 2CLCX 2OFXA 1JALA 1XCGB 2F1IA 4C0QC 4Q1FA 2WJIA 1H8HA 4P31A 4MITA 4LPSA 1E69A 4O2RA 1UKZA 4IVRA 4TL9A 3NXSA 1V5WA 1YE8A 2DBYA 3OZXA 3N2EA 1IBRA 5TB5A 3EZ6A 3THXB 4HUQB 1J8YF 2GILA 4BRUA 2DR3A 3SBEA 4BASA 1II9A 1UBCA 3DVLA 1P60A 1KI6A 3VQTA 2G3YA 4AKHA 2P3SA 3CX8A 4QOSA 2G0TA 4EFNA 4IJMA 1ODFA 3Q8XB 3KZ1E 1GG2A 1G6OA 1KAOA 2RGXA 4LX0A 3BWDD 1Z3IX 4NCHA 3B60A 4WW0A 5JMTA 5G53C 2ATXA 2JEOA 3SR0A 1LF0A 1GUAA 1W0JD 2V3CC 4W9MC 1YR6A 1NBMD 4FCWA 2CE2X 1X1SA 1AA9A 2VHUA 3CF2A 3AVXA 2QL6A 4WAUA 4F4IA 3U4QA 3K1JA 5JWHA 4FN5A 4Q4HB 1S3SA 4Q4AB 3QJYA 4EJSC 1C9KA 1U0HC 1XFAA 3LY5A 4LI0A 4PHGA 3SHWA 3AKYA 1Z47A 4X8MA 2VLIA 4BFXA 4IXNA 2GTPA 1GOTA 3C16C 4AD8A 4D4MA 2ZE5A 2ZYVX 3R9WA 2XNDD 2EQBA 1Z2AA 1KI3A 1TQ2A 5H70A 2E87A 4BRWA 4PSKA 4C0SA 2YKGA 1II8B 1P9NA 2F3RA 3MJHA 5TVKA 4TQUS 3QKRB 4M1SA 3PUVA 4URXR 3EWSA 3AGPA 5KU1A 2EU8A 4ZDKA 5BXQC 1OT3A 1RPZA 4RZ2A 2FMXA 3L0SA 4BZQA 4CIDA 4TLBA 2A30A 1E0SA 1M34E 2IUSA 3D7MA 3X1YA 4X8LA 4PXAA 2IXEA 2AR7A 3IQXA 4JMPA 2ZS9A 3U44B 1EWQA 3W8RA 2C78A 4AURA 5LPNA 1OW3B 5FBVB 1CBUA 3F5FA 4OHYA 2WJHA 1KI2A 3R20A 5HE8A 2YWEA 3WYFA 4Q9LA 1F6BA 1VCNA 2R8RA 1O87A 2MSEB 4UNSA 3ZD6A 2KBEA 3FGNA 5CITA 5KDDA 1LW7A 5AUNB 2WWYA 2BCGY 2BC9A 2ZRDA 3BOSA 4NONA 3EW9A 1BIFA 2ZI5A 1S9DA 1VTKA 3OEED 1QG4A 2SHKA 4P4TA 4RFVA 5HKKA 4L4UA 1EWRA 2PX3A 3ZZ0A 3PR1A 1HY3A 2J41A 3SQWA 2ANBA 4LC1A 1IOZA 2XJ9A 1ZCAA 2ECKA 1E4VA 2GETA 2W6JD 4XD7D 4TMKA 3CNLA 4NDZA 1A5TA 3BB3A 4UJ3A 1U81A 1UBGA 4ZDWA 5K8TA 4CEJA 4WXPA 3THWA 1S9HA 2OESA 4TZ0A 3LAWA 4J0QA 3RC8A 2XZOA 3H0KA 5KDLA 2AWNA 2CBZA 2RAPA 3KB2A 2ZITA 3QXHA 4URUR 2FU5C 1P75A 3EA0A 3FMOB 3B1VA 2X1VA 4HLUA 2QP4A 3L0PA 4G0NA 4QBHA 3VHXA 4ZIRB 2O8FA 4KITB 5DSZA 3C7KA 3GFPA 1E6CA 4IOMA 4LRWA 4LYAA 1NBME 3I8SA 2A5DA 2JDIA 1TAGA 1VYVA 1XD2B 4AYXA 2QAGA 4XJXA 3WMGA 1E2LA 2WHXA 2W2TA 1Z29A 4UXIA 4FMDB 4L16A 2BMJA 1E1QD 4DT1B 2JLYA 1Z63A 1GAJA 2VPPA 1KK2A 4OQXA 3DKVA 4Z8YA 3B1XA 4O0MA 1TEVA 2CEAA 2FF7A 4PANA 3I32A 4G5QA 4BFVA 1E2PA 2IF2A 4BGDA 1CJMA 2BBTA 1RW4A 3PG5A 3UANA 4MRVA 4B34A 3AF3A 2WVJA 3CIOA 3AKEA 3K0EA 2ZANA 4MGYR 2GAOA 4MYCA 3B9QA 1OXUA 3TGPA 1ANKA 2GXAA 2D7DA 1KOFA 2BOVA 2H17A 1ZU5A 4DIDA 1FQJA 1LS6A 1HA3A 5DO9A 2J7PA 2ZRCA 2ZAMA 1NVVQ 2Q3MA 1ZW6A 2GEUA 2V55B 3QXSA 4XTCS 2QTHA 4IVQA 1IJFA 2VP5A 5FPKA 3CONA 3K0FB 5P21A 2MMCA 2ZRLA 4M1WA 1OXTA 5EE0A 4G5RA 5BW8A 3PV0A 2C04A 3U3OA 3O8DA 1E9AA 2BJVA 3FKQA 4X8OA 4Z8XA 2A7QA 4EFMA 4LHVA 4BFWA 1N6NA 3C5CA 1OKKD 1G6HA 4L9SA 4PSVA 4DBLC 1K6MA 3KJIA 4D82A 3P27A 1WGWA 1U90A 4S2EA 1XPUA 2HLDD 3CNNA 2VIIA 1Q1QA 3GLIB 3A58B 1OPXA 3THYB 4MH0R 4P0TA 5CYOA 1HYQA 3QVUA 1NIPA 1WA5A 1G5RA 1JXMA 4GI7A 4DLRA 5J4VA 2AKAB 2FFHA 3PEUA 1KSJA 5FFMA 1P62B 2DHRA 3E70C 1QHGA 2AHOA 3MWLA 2NG1A 2O0KA 2QI9C 2J0VA 5AJZA 3EC2A 3GLHA 3DMNA 4PR0A 3A1SA 3DOFA 5FTJA 5IK2A 1XEFA 3VR2A 4V0MA 3OIUA 3X1DA 2N42A 2B8TA 4TLCA 3RS4A 5FL7D 4JIMA 1KZGB 1P4SA 2O8BB 1NJFA 1NLFA 2XOKA 1XEWX 2MMGA 3FTQA 1ZUNB 2EVWX 1II0A 1W5SA 2FOLA 1JEEA 1WMSA 4D4LA 3EXAA 1S1MA 4AWXA 2CE7A 5DLQC 1E9CA 1JBKA 2IYRA 2Z43A 1J7KA 2PMDA 5KDOA 2X19A 3CNOA 3EAQA 3U3JA 1MO3A 1U94A 3NHBA 2XB4A 4Q66C 2F43B 4Y0VA 3WMFA 4GDFA 4CEHA 2KJQA 3B82A 1X8JA 3QKTA 2GXQA 4URWR 5F98A 1F2TA 1G8PA 2CDNA 3FHTA 4FD2A 2PEZA 4ZKEA 4QGGA 1YKSA 2PEYA 2H16A 4HAYA 4V03A 1NKTA 4DCVA 3QENA 1S4QA 4L9WA 4JLVA 3LFUA 4QL3A 1CR1A 2UZIR 1JPJA 1Q1ZA 5E7IA 2WOOA 5JRJA 3AP2A 1XMSA 1YJ5A 4JVNA 1CJTC 1YZQA 4B3BA 2GF0A 1U2RA 4HDCA 1T8TA 1UPTA 3PXGA 5FPSA 1DE0A 5H8WA 2QTFA 2JJ2D 4NYMQ 4ACAA 1DAHA 4LYJA 1X1RA 5JECA 2NPFA 1PLKA 4JLBA 4TMTA 3H86A 4M53A 4MRSA 4TSFD 3TLXA 5JI2E 4ZV4A 1RZ3A 2VP2A 1UBFA 3OIWA 1AKEA 1WP9A 4N3NA 2GJ9A 1X3SA 4A8JC 3DO6A 4URZR 1MRNA 2A5YB 4C0JA 2ODBA 3O8RA 2ZJ2A 2QAJA 4ESVA 2DCUA 1K8RA 1CLUA 1GM5A 5CIWA 1QHXA 2IYUA 2O52A 1FP6A 4XVQA 2JLRA 2R6FA 3ZH9B 4YMWA 4B3DA 5C46F 3ADBA 1RJ9B 1WE2A 3RLFA 3HPQA 1ZD9A 2D3WA 1CR2A 5FL3A 1WB9A 1W36C 1P61B 2FFAA 4YMTA 1SKYE 4DJTA 3HYTA 2JIZA 2FWRA 2WAXA 2G0NA 4JJKA 5JJKA 4II7A 3MWKA 5G40A 4IFBA 1I2MA 1U8ZA 5DYIA 3H1TA 3BD9A 1T0HB 5HCIA 2WSSD 2V54A 2WJYA 3OIVA 1KNXA 1ZNWA 2I4IA 4GP7A 2ODEA 1R8SA 1NLZA 2HCJB 2QPOA 3TAUA 4GPTA 2ONJA 4DLVA 2H1LA 1ETUA 2GEDA 4QHTA 5D3MB 1MRSA 1QHYA 1FUKA 1P7CA 4ZKDA 1JR3D 1ZUHA
chains in the Genus database with same CATH superfamily
1XTZA 1QGUB 3VVMA 4Q05A 1WMFA 1XBTA 1R0YA 1AKMA 3U62A 3SM3A 4I66A 3I9LA 3AKCA 2BMEA 3H5IA 4LGYA 3LYHA 2C2GA 2GARA 4J75A 4LHYA 1MB9A 1DXQA 4ZVKA 4CQMA 2Q28A 2A9JA 1Y1KE 5M04A 4D6YA 3H2GA 4YRSA 1KP9A 1N57A 1XVTA 2AFIB 3WYAA 1LB1B 2EFGA 4X97A 4OK5A 3AW8A 4DUPA 1GAWA 1CY8A 2YICA 1Y33E 2J5RA 1SUIA 4PLVA 5JOQA 4OMFG 1WDWB 4FOPA 3OFND 2Y3GA 2ZBQA 4P5PA 4CIYA 4MCAA 1T5OA 1WSAA 1PT9A 3IHLA 2GBLC 2WWGA 4Z0TA 3W2FA 2EJTA 2XPCA 4KQGA 4QRIA 3CKLA 2OTCA 2BCJQ 3VZPA 5CNIA 4CODB 1FFXA 3WL5A 1YUBA 3AF5A 4ZCRA 4MS4B 5FOXA 5KTYA 2XYQA 3WAGA 1VJCA 3DT9A 4WLFA 1XMPA 1SUWA 1E1CA 1UFRA 2DFKB 3GPBA 1B8OA 3RG8A 5B58T 1OIWA 3ROGA 3U9LA 5J47A 3DG9A 3LXMA 3GK3A 1A4RA 4EJFA 2H07A 2PZJA 3CLTC 3NV7A 2OSBA 3JAKA 1Z22A 2UUPA 4ZQHA 4JL6A 4GWGA 3BKXA 1O96B 1LIHA 1V1MA 2JL1A 4LJ9A 1E0DA 2NO1A 2J85A 2IHVA 2R751 5FOTA 5A5GA 2PKXA 4OKIA 3TYXA 1MMAA 1IZZA 4PLFA 1I80A 3GLIE 3YASA 2IUFA 3BXEA 3KDSE 1XQYA 1N25A 1Q3HA 1GVNB 2PXAA 3UOGA 2QGNA 2NSHA 3EIOA 3SJBA 2CNWA 3L0CA 3SE7A 1EVIA 1PVVA 2IV7A 2OV3A 3NO4A 1CYEA 2X1MA 3VI4B 4OU5A 3U39A 1KAHA 1Z7EA 2F7SA 4F5ZA 4JN6B 3IVAA 4Z4HA 4YYEA 4FYXA 1EXVA 1XZJA 4JT4A 2VEDA 1IDN1 2VBFA 1RRMA 5BQFA 1RJDA 4JLMA 4H4EA 2O20A 1XTTA 3SHTA 3IJPA 4L3VA 3OA1A 4H3VA 1M1XB 2G07A 3JQ9A 2ORWA 2B6HA 1FFDA 5T41A 5EN4A 4LJ8A 4EECA 4OD0A 3GRUA 1R3UA 5AOVA 4ITRC 1YVDA 1U0OC 1G16A 3IVMA 1PQUA 5HWSA 1N0VC 3OKPA 5FUWA 3NVDA 3URMA 1LQ2A 1MG0A 1Z7WA 2X86A 5J1SB 2GN9A 1ZG3A 1MQ8B 4MMXB 2H9IA 3R5XA 3TLGA 2OV2A 4BFYA 2HO4A 4FFSA 5EXPA 3VKVA 2F4NA 1UWKA 5EKUA 1BH6A 2HREA 4J94A 3K53A 2UU9B 2IOFA 3V8QA 4JVLA 4RTMA 2PFDA 5CA0B 1C7FA 1TKAA 2CFTA 4QUAA 3FMIA 1OH6A 2JJ2A 3ZJUA 2WZCA 4NX2A 5C9ZA 1AHIA 1GARA 2V6JA 3DH0A 4W5RA 3ACCA 2OJED 2OHGA 2AFIE 3AETB 2WSYB 3FHOA 4ZK6A 2RHBA 2PA0A 2B1JA 4FZRA 4X7RA 4JI7B 3HBJA 4X64B 3ZLTA 4GECA 2Y1WA 5MHTA 3JARA 2C03A 4JJ7A 5A0FA 5GGYA 4QUGA 4OXRA 2NVUB 4KQ2A 3M6WA 3FUCA 1X0VA 1KARA 4KIUA 3AF4A 2YNMC 1CE8A 2JAWA 3KT6A 2WT8A 2QZZA 4LYFA 3OZDA 1B16A 3D3WA 4YQYA 2Z0MA 3MYRA 1UKEA 5BQIA 5HNKA 1SEPA 3H7AA 3ILXA 1DO2A 5LBTA 5L53A 3DMHA 3WIEA 4KMOA 4DZZA 5KTRA 4J1TC 2YV5A 3PDCA 4ZI5A 3RSOA 1D0VA 3CZAA 3GHYA 2P1ZA 1GPLA 4DV6B 4EH1A 3LQ1A 1LLUA 2WDPA 1F8YA 1U5BA 4IDQA 1JQ3A 3IEUA 3L41A 2C4KA 1TF2A 2JIRA 5I9NA 2UUAB 1PJ2A 3KFLA 2H0AA 5F23A 3PA8A 4RY0A 3AOEC 1N33B 4IS3A 1VJGA 3ON5A 2AKYA 1M66A 4FOTA 2G1PA 3ONEA 3LK7A 4FDMA 4HFFB 5HMLA 3DLTA 4D8XA 1NU7D 1MV5A 1UM8A 4AB1A 2D59A 1C3OB 4Q15A 2HWWA 4W5OA 4X1KB 1F5SA 1GA6A 3NJRA 4C3DA 3T7SA 2RJOA 2IFTA 3IO3A 2F43A 3ZHZA 3MD0A 3O2SB 1YRYE 1OW7A 2JAPA 4HRAA 4EPVA 2VHCA 4WKBA 4E2XA 1MX3A 3K6SA 3JQ7A 2O0MA 3E2IA 1JRAA 4L75A 3HL0A 3FYHA 2FPPA 2ORYA 1E6EA 3PQ8A 1BXRA 4GYWA 2D2EA 3ZNPA 3QVJA 2ZM6B 4RIIA 2H4FA 3DEKA 3ZPXA 5IRCD 5EC8A 1IK6A 3TTUA 5AM0A 3IX7A 8ADHA 2MYNA 3C63A 1OD6A 3EG9A 2BRUC 5C8ZA 1T10A 4LMBA 3MJVA 1ESMA 4OBEA 4EVSA 5AVQA 3B7GA 2ZEJA 2ZXWC 3HU5A 4P4SB 1TRHA 3QEBZ 5D3MA 2QLMA 1AJEA 4GYKA 4YLYA 3EFOB 4F92B 3HUUA 1WRBA 3QOYA 4V1CB 4P8RA 1OREA 2VT6A 4M1YA 2DPYA 1OV4A 1X7HA 3RFUA 3ZD7A 1Q7CA 4R54A 2KX7A 4QQ8A 5ETJA 1IZ8A 1LDGA 3IMGA 5A6BD 5ECYA 1N5KA 2OGUA 2V0NA 2X51A 5TMBA 5GJCA 2Z2KA 1V96A 3PWKA 4JYAB 2ODTX 3NKDA 4JCCA 1ABFA 3AR3A 2P6RA 1IPHA 2A5LA 3QU7A 1UPBA 3C3EA 2QTCA 4ENWA 3KYDB 1GTSA 2HA5A 2YIDA 4HT3B 4NBSA 3ZW7A 4AWBA 2VHYA 3F3SA 2JJ1A 4TS4A 5EQFA 1YZGA 5A3VA 4BV2A 5L7YA 4JL8A 5AK0A 1UP6A 1KHHA 4A36A 2VCBA 3WLJA 1VCMA 1DCKA 4MYDA 4MV4A 3VNUA 4LDAA 6AT1A 4JGGA 1QIDA 4Y6RA 2OLEA 1NP7A 3PC2A 3W5IA 1ONBA 4MICA 2H2FA 1XTUA 1AKNA 4IQ0A 3MOGA 5REQA 2REQA 5AUOB 4HQKA 3M5PA 1U9ZA 3EGXA 3K92A 4FHZA 2JPUA 1TCVA 5CR9A 2ZR9A 1SA0B 1YK1A 1DNPA 2HLNA 1FS5A 1KI9A 1OBFO 3A31A 5CG1A 4BECA 5JZSA 1BXGA 4BP8A 2CNDA 3J80A 1P6UA 1WU8A 3CRMA 4FEAA 5TC4A 3EEBA 3O7MA 5AMXA 3AMVA 1TJNA 3E8SA 4HDNA 1Q17A 1YARO 3JQQA 3EMVA 4EITA 1B41A 2WTEA 3WBBA 3D6UA 2UVPB 5JMPA 2OY0A 3FAPB 4FQ5A 4Z6KA 4GQHA 1A9YA 1TGVA 4O5AA 4HNAB 3CTPA 3WVNA 4V38A 4AJKA 5IBRA 3V7YA 4OYHA 4J07A 1RXVA 2D1QA 3SEOA 5A0VA 1VKJA 3I9FA 1WPQA 4MGEA 1F6DA 5I4BA 1PU2A 4MW7A 3D7KA 1NZDA 4R9UC 2GJ4A 4EATA 3U9TA 3L43A 1G2PA 4JAVC 1N2XA 1C1XA 1ESCA 2O7QA 1Y4AE 4DSNA 4RZHA 1B14A 4HAWA 1VECA 1OFTA 4S1PA 2LCQA 3WNDA 4MW4A 1OXKA 3SN6A 3FLMA 5E3AA 1XZMA 1IQ0A 4HDSB 3B2NA 3AV0B 2P9JA 5KAPA 3SZRA 5LQNA 2E0IA 3D1JA 4CMAA 2GXUA 1TC1A 2Q5CA 3UTCA 1ZM4A 4AQDA 4C78A 1JG1A 3ANMA 2OCPA 3OC0A 2DGDA 1G20B 2PGOA 1D7OA 5I9BA 3CNHA 5IAAA 5B1HA 4CL2A 2BLLA 2B0JA 3CEMA 2ZBPA 1GV0A 4I1IA 2PWPA 3RRFA 3BIOA 4FCCA 1YVIA 4TL7A 3EY4A 3G88A 4RTKA 4M8LA 3KCNA 1GEGA 4RANA 3M34A 2ZJ1A 1PR9A 4MQFA 4WKCA 1UBMS 5A6JA 3MRTA 4U2EA 2P9EA 1KKMA 3B2EA 4TSRA 1CY2A 4X3PA 1V1JA 3OUZA 2ODPA 3OPQA 5A4AA 1QVWA 1AO0A 2OKGA 1QUFA 4LZZA 4XX0B 2FPUA 3DOCA 1ZIDA 1PHRA 4X0EA 1SC3A 4GSKA 2Q5FA 1OXBB 1ZZEA 3GGJA 3LLKA 2LGJA 1KAQA 2FUCA 1A2OA 3GIWA 4AS3A 2HQBA 5D86A 4XCXA 2CUKA 3QBJA 5CGQB 3WIVA 3F74A 4RYLA 4HJXA 4PX9A 2GSDA 3MXTA 3OOHA 2IV3A 1M1YB 1VJRA 2Q29A 3HKBA 3G2LA 4WRRA 4FGSA 2BPOA 1GFIA 3AUXA 2YJ3A 1U98A 5L3SB 3K6RA 5EZYF 1W76A 3AIIA 4HAUA 3SYRA 3KSRA 4QQRA 3MAJA 3MRXA 5F21A 1UBJS 2I4MA 3DJNB 4IV0A 3R6DA 3S0XA 5C1IA 2ZUBA 4BPMA 1R18A 3I2GA 4H3KB 4CT5A 3L5OA 2W83A 3WV4A 1ODTC 4IDDA 4K8OA 3A6JA 5CLHA 4AIRA 3CYFA 3T4RA 4ZLCA 3VNAA 4JW1A 4XVUA 3TB4A 2P9FA 4R3WA 4MHTA 3S90A 5BN5A 2WU0A 4N8EA 1XPJA 1H42A 1L8AA 1DKMA 3OOEA 5JY1A 1QPZA 2ZRQA 1USWA 3DVRX 1NJ1A 2J9GA 4XWOA 3TO5A 3L3BA 3GRFA 3KOXA 5HSGA 1D9XA 3G5AA 3EDCA 3SJCA 4CU2A 3Q7PA 1XZDA 4GXNA 1NWHA 4BE9A 1QV6A 1KYQA 2I0FA 3FNGA 3GUHA 1KMHB 2EHDA 5J5CA 1NSTA 5T8KC 4IJKA 4BKQA 1B0PA 1UANA 2CSUA 5I5GA 3I53A 2WTMA 4CS7A 2BL4A 4NE2A 3RIPA 3TPFA 3Q5GA 2VQ3A 4YBRA 4X65B 3BBLA 4JLSA 2JLSA 4P58A 3KZNA 3QLUC 1I5NA 1Z2PX 1JDSA 1NX6A 1KYYA 3TIGA 1UIRA 5ALFA 2YASA 1CDOA 1JNYA 2IEYA 1G8KA 4Z4GA 3E7FA 3UJCA 2XAUA 1QX3A 4BMZA 1NJ2A 1Y7PA 4LRYA 2N1BA 4FYIA 2X8BA 1GSHA 3JASB 4P53A 4X91A 4BXOA 1ZDMA 2PYIA 4LKOA 2UZ1B 4B6OA 3BCHA 1CHDA 2PY6A 1I36A 3CZCA 5FORA 5HF9A 2BBSA 5AHKA 1Z5UA 3OETA 3T5TA 5EJ6A 4N0DA 3MQ2A 3L0OA 1ZGZA 4F0JA 4IIJA 3I01M 2YFQA 3V4VB 5AHOA 1HE3A 3EQ8A 4M88A 1AKWA 4TL8A 4IHJF 3G2OA 3ZJ4A 4YRJA 1BSVA 3FVTA 3CUVA 3ZOKA 4E5PA 1CPQA 5LYJA 4FEYA 1C4XA 1ZY2A 2B4TO 3L6DA 3C3BA 1IXSB 3WR5A 1T35A 4Q37A 1IY2A 3QF7A 2JX0A 2GCOB 3KUKA 2A59A 2D1FA 1U3CA 4AJHA 4V3BA 5ADHA 4B3GA 3LTNC 1L4MA 1TQDA 3QMPA 5DBOA 3AK4A 1I6LA 1Z3CA 2ZTHA 2QD3A 1U2QA 4RESA 5D1HA 4CM7A 2CKMA 1LA2A 2K2WA 4E5MA 2WJ3A 3M5DA 4EZIA 4J29A 1ZD2P 1M1YE 4M9QA 3H3JA 1YDHA 3SYMA 5G3YA 5AVZA 3E3LA 2C5LA 2ATCA 2DUNA 1AQNA 2WM2A 5C4GB 2P30A 3AZPA 3VNRA 1K3FA 1WZ2A 5F7XA 3B12A 3DF9A 2SNIE 3TWOA 1E60A 3KZKA 2PAAA 2V6FA 4P84A 2GPYA 4LW8A 1FRFS 4QT4A 4R7GA 3G49A 3TW0A 1U89A 2JEZA 4O4IB 1HMYA 2G40A 2NSLA 3RODA 5TF0A 3PCRB 2WG2A 5LQMA 1NULA 1Z6AA 2YN4A 1QHEA 3NYLA 4RD6A 3KKPA 2ZCJA 4RD2A 2RH5A 1YH3A 4YCAA 2I7DA 5G2OA 2J46A 3K96A 1F7VA 4HATA 3IP7A 1UEIA 5JPIA 3E5NA 1QBGA 4ILKA 1R2QA 2GHTA 2VJMA 4CM3A 5C81A 1WXEA 4P31A 4IZIA 3GYBA 3L1MA 2GA0A 1Y8RA 1WTCA 4L02A 3TZLA 3PLRA 4JYMA 1R4MB 1IBLB 2F8MA 3CTMA 2G06A 2LPMA 4NCHA 2Y71A 1E8MA 1LF0A 4DMKA 3SBXA 1NBMD 1AA9A 3H9QA 3OTHA 3RIYA 5JLAA 4AJNA 2PQMA 3K1JA 3RUFA 4Q4HB 3H8WA 2WL8A 3HM2A 4X8MA 4IXNA 5EPEA 3EDYA 1RU3A 2M2IA 1ID8A 4B85A 5LYYA 5JARA 4X92A 3WWEA 4TQUS 1AGYA 5EHNA 1VOMA 2XD4A 4BZQA 5D1NA 2F62A 4YJGA 2A84A 2AVNA 1QP0A 4LJLA 4TKUA 3HTKC 2KBEA 5CITA 5KDDA 4E4TA 1HDGO 1NT2A 1VTKA 1RHRA 3M15A 1EWRA 2ECKA 1NUTA 1TR2A 3TRDA 4L6AA 4UJ3A 3OIGA 3GAMA 3HFSA 1SO8A 3LAWA 2IXAA 4XE5A 2JNWA 1TPYA 4GUAA 3VYSB 1X7YB 4HLUA 4Q4ZF 5BWNA 1KPGA 4EO7A 2DKNA 1E6CA 4L4ZA 4KIGA 1HMPA 1RKVA 4MNDA 1MJGM 4CR6A 2JGRA 3ZZMA 4ZYYA 1TECE 4IBOA 1T2UA 3B1XA 2FF7A 2BBTA 3IHUA 2V65A 5HUHA 3K30A 4CUZA 4Z2YA 4E08A 5A02A 1JLRA 3K0FB 4EGJA 3PSHA 4E1AA 3WL7A 3DBIA 2E4YA 3W8HA 1DP4A 4EG3A 4AQYB 4S2EA 4ZP1A 4P80A 1XPUA 3CNNA 4DARA 5MGNA 5L0HA 2FE1A 4J0CA 1KE1A 4CN8A 1UCFA 4QOFA 1HY5A 1AXEA 4NK4A 4KVFA 1V7ZA 2BC5A 2BP7B 2I2CA 2K7FA 4OYYA 4O02B 1ONNA 5ELLA 3JQFA 4DR1B 1YSCA 1ZA1A 4XFJA 1NQTA 1BWPA 4URWR 5JDIC 5LP6C 1F2TA 2HHCA 2YS6A 1WMAA 4UE6A 1R88A 1YRQA 4W6ZA 3QTHA 3PNLA 2OM6A 1CQPA 1LBSA 1HDXA 5JRJA 3LWZA 5EJ9A 4KOAA 1XMSA 3KL2A 3UAZA 4S3MA 1TFKB 2DAPA 1FVFA 1OZGA 1E8DA 2ACVA 4RHCA 3IAEA 3MGKA 5E9QA 1TYZA 3NKLA 2QNBA 1WP9A 3ICCA 4DMRA 4FSDA 5HG0A 3C62A 4MP8A 1OCZC 1EUQA 4GR9A 2Z95A 4J32B 4UHKA 3A7EA 1WB9A 1FMCA 4B4WA 3IAHA 5BN1A 4DLVA 3D3EA 2RG1A 3DBLB 3GA0A 4FWVA 3WB0A 1FOEB 3QMKA 4JJ4A 5H9VA 1YVEI 3TE7A 2WZLA 2GPTA 1YU9A 4KH1A 3BXOA 3K31A 4P7BA 4PM4A 4CQLB 4GGPA 1SMKA 1K1EA 1YU6A 3PR2B 4L28A 2I2DA 2R60A 2XCQA 2B7LA 4C3OB 4H0NA 3ZVLA 2H9YA 5FEUA 4F91B 2RK6A 3VFDA 4YJ3F 5FOVA 7MDHA 3QWIA 1GPBA 2PUEA 4KJXA 2NYVA 3ITNA 2WLTA 4C87A 2VJLA 4ZGBA 4JZAA 1QIHA 3SKXA 1JKFA 4CV0A 1RAEA 4ID9A 4N0EA 2C5EA 4EP1A 3TIIA 2R79A 2PL9A 3GLFB 2Q50A 3PI6A 4QEKA 3O8CA 2L17A 4QI0A 4P3XA 3UV6A 1NHGA 3L01A 4W8OA 4BLWA 2QX6A 1OXMA 2DFNA 4W9NA 5EZQA 4E70A 2V96A 4P92A 1GL3A 5C1BA 2OCAA 2Y05A 1Z0KA 3OPYA 3QLVC 4HWKA 3WAJA 1MB4A 2X15A 4KWTA 4H08A 4LDNA 1U2EA 2JGIA 1W4RA 1G2OA 3AUSA 3M9XA 4J03A 1W44A 1PLLA 2VSFA 1E3WB 1KO4A 1NUQA 4FNOA 2XM0A 3OZ7A 3OU6A 3INRA 1PG2A 3KWJA 2FFQA 4FFVA 3QVMA 2R8EA 2XH8A 5FO1A 5AKZA 4Z9HA 2GPBA 1VLMA 4LIPD 4XLNF 3LKDA 4YP1A 4EHFA 5ULLA 4KWIA 3LVBA 1POWA 2ZIWB 4WKOA 5G02A 3RT9A 3AKZA 1RXSA 4UC0A 2OEPA 2QUHA 4I4TF 5IBCA 2QRNA 4U9IS 4HTAA 4R9NA 3WRWA 1U1IA 4YMGA 1ISRA 1IRIA 1ORRA 1ZH4A 2VTBA 4TL6A 4F3RA 1R5JA 2WFZA 4LNHA 1GCAA 1MIOA 3UY4A 1Z8NA 4DCNA 3DBRA 4HQRA 4MQ9F 1YFKA 4WFIA 2FB9A 1SULA 4I55F 3WLPA 1JFVA 4PC7A 2Q49A 2Q6TA 3RM3A 1CUYA 2HUPA 3ED1A 4I14A 4ZAVA 3WFIA 2YXLA 4ND3A 4U7FA 1ZIPA 2V7EA 4H7FA 3VR5H 3TQSA 3NEJA 1XKTA 4WA7A 1ZQ9A 2P6UA 1JMYA 1JSXA 1XWJA 4LF5B 1HFWA 3BMNA 1EHIA 2MOKA 5LA6A 5GZ3A 3LQ4A 1AXGA 1VI6A 2OEXA 3LCCA 5D51S 5F7OA 1FJGB 3M3PA 1M6VA 1FVXA 3DE8A 3GEEA 4QZVA 1FR0A 3E23A 2G77B 4FNGA 1GGFA 5DGCA 1IUNA 3L7DA 1DFGA 2C2YA 4ND1A 1M6YA 1GZ3A 4C9BA 1NW9B 2PXHA 2VHQA 1JILA 1NV8A 5HA5A 2ZJOA 1NQ5A 4FE4A 2DWOA 5DGDA 5JD5A 4J49A 1G5HA 4GBGA 3A28A 4PXSA 3W7VA 4A8JB 4J7YA 1A27A 1A5SB 3QKRA 2WC1A 5JSLA 1GLGA 2DVMA 4FYHA 4NWIA 2PRJA 1NVAA 1Q0KA 3JZ0A 3MUFA 2WJJA 3KVVA 2K5UA 3C1OA 2G3VA 1IN4A 3CVUA 1BYIA 2B83A 3LNMB 4YXWD 4Z0NA 1CEYA 2P11A 3I2YX 2PE5A 1U2PA 4J90A 6LDHA 1JHOA 1LNZA 1FP1D 2ZR7A 1JR3A 1NVWQ 3IUEA 2O8FB 3FWZA 3GLFE 1XTPA 1FRZA 2C5GA 3C1AA 3CUWA 2HJMA 1LJ8A 4QXOA 1E2XA 3BZUA 5IJ9A 2DHDA 1QGOA 3DKIA 3V2UA 5K4HA 4TQAA 4ZREA 1RP7A 5IVKA 1KOJA 5H68A 3A0RB 4CR7A 1THZA 2H8AA 1PT5A 1MT3A 3IDZA 4M87A 1JKJA 3CWCA 4MVUA 4DY4A 3U6BA 1W2WB 5D2CA 1NAIA 3CF0A 4FN4A 2CNKA 5KREA 2EG9A 3TR0A 5CYFA 1KO8A 1YQGA 5FV7A 4BLSA 3DAFA 1VCOA 4JY7A 3IOCA 2HQOA 3H9UA 3K9GA 2HDNB 4G9BA 3K8YA 4CS8C 4B35A 4FD3A 1DINA 1VSTA 1SVWA 2ZVQX 2NYUA 3MG9A 5CLGA 1GPH1 1XKLA 3CT4A 2FZ4A 1NR7A 1VRWA 1JS1X 4W7IA 4R2LA 3BPSA 1X1EA 4OSEA 5AKLA 3QZCA 3HCOA 2KW5A 4RHTA 3LQFA 4H4KC 4MAMA 4TRMA 4I4LA 4OJTA 1IN8A 1OJLA 3WBKA 2P9CA 4YRPA 4XDGA 5L0FA 1DIAA 2P4UA 5E0OA 2GS9A 3F96A 3HO8A 3EGDB 2FW8A 2PBZA 3S4YA 1S3GA 4FP9A 4ZQEA 1EIWA 3LC1O 4ZT7A 1KXZA 1KTIA 1T9GS 4MRAA 4MMYB 1UOEA 5CJPA 1BFKA 4HXYA 3ICVA 4BQPA 1CJUC 3QQPA 3KELA 1N9GB 1P45A 1AKTA 5BXYA 2OO5A 5INTA 8OHMA 3ONFA 5HKBA 2ZIEA 3L05A 4Z51A 2C9MA 2M4EA 4Z54A 1EU1A 3KT3A 1Z83A 1IMOA 2H7VA 3PE3A 3E5HA 2RHCA 1Q1BA 3RRMA 5KINB 2PR7A 2LRHA 2ZUDA 3JQAB 1LWNA 2AIRA 3PBKA 3N8HA 4M9ZA 1TKCA 3UHPA 1PDOA 3UC5A 2GN6A 1G6KA 2TMDA 3G02A 2GFHA 4FYYA 1KP2A 1O0BA 2PXCA 3QKWA 6GPBA 2XWSA 3HPRA 5HUJA 2GI4A 1DRJA 4MYTA 2J7PD 1NTRA 1KSGA 1K04A 4JC7A 1LVUA 2AE1A 3NIBA 1BQEA 3ZWOA 2FR0A 1YJCA 1QYCA 1V11B 1N75A 2GVZC 4DV1B 1OWMA 3TMKA 4DXDA 3MSCA 5KKCA 4UTZA 2Y9MB 3VVLA 2BEUA 3OFKA 4E12A 3MMNA 3USES 4IIDA 3RYTC 3I3SR 2R44A 1KEEB 3T9OA 1QYVA 4EVRA 3V5ZA 1BX0A 4A2QA 3IEMA 4OK6A 3VZDA 4LJ4A 4W8KA 1AB6A 2A9RA 4H1VA 1YQUA 5CP8A 3OJXA 3JZMA 3MMSA 4GLFA 4M7RA 4EJMA 2J6IA 4NCQA 3H75A 5FBWB 3US6A 1L5VA 1Y5RA 3L1JA 2FRDA 1XAIA 2HRQA 4ZCPA 3ZZ1A 3GPCA 1DB3A 1XHLA 3UZUA 5GINE 3K0HA 1TOAA 2ZRFA 4D4KA 3MCZA 2XUIA 3TTVA 4Q9HA 4C3VA 2R68A 4TXMA 4ZVSA 4KWHA 2O23A 2X40A 3A4TA 1EX9A 2ZVJA 4DYVA 1GADO 1XEXB 4H7JA 2PMBA 4C1NA 1SQ0A 2C3UA 2QL7A 2PX6A 4JI8B 2I3ZA 1YQXA 2Q0QA 3PCVA 1FJHA 4EHAA 3PLAE 4YRRA 2DWQA 1USIA 1MTOA 4D81A 2Y1XA 1V3QE 1H9CA 3AH8A 3PWSA 2EIXA 5J63A 5JU6A 2HQRA 3RFYA 1I3OA 2VZ0A 3W8FA 2C9OA 3U9MA 3GWZA 3F49S 2I6TA 1I4LD 2H0QA 2FUNB 4J0IA 3C8HA 3SOPA 4JUAA 5LD2C 4PLZA 3QBVA 4KNVA 4RE5A 4TPKA 1RKUA 4Y2XA 3DLBA 1JFFB 2XRFA 1QIMA 2G5PA 2COUA 4WK2B 4OQFA 1HDIA 1XXHB 3E35A 1UQUA 3JZFA 1RLJA 4ZODA 4HVAA 1FBTA 4OI2A 1GZSA 3UAGA 4KNYA 3RSLA 4BLPA 4O6YA 3U4QB 3OY7A 2AX3A 5J2TB 1FS4A 3IS3A 2I6UA 3L82B 4L08A 2RMKA 3OBBA 5EXDA 2FPRA 5K0FA 3SD7A 4GQIA 4JDPA 4RTQA 3KXKA 3G85A 2PNFA 5C52B 5GV8A 1G5TA 2UZAA 4JOCA 2QSJA 4MVWA 1GKKA 2HD4A 1OIVA 4POOA 4ZYLA 5HDBB 2JGFA 1HOXA 3L02A 3EXHC 2AC4A 1F6WA 1Y3AA 2WTAA 3F3YA 1W48A 1NMZA 5AR1A 5L3VA 2XKKA 3GG2A 3AIOA 3QYFA 5CIVA 4Y2QA 3WIBA 4AF8A 4MOWA 2YRWA 3FHJA 3F7MA 4Q6BA 3HA5A 2Z6QA 3PQ5A 4JJIA 3QF4B 4MVQA 2ZRBA 2NAFA 2E2WA 4X90A 3OT1A 4E15A 5EFOA 1E77A 2DETA 4KXXA 2DE0X 1XD2A 2YQ4A 1G0OA 1JRLA 5JXWA 1Y4ZA 2HPAA 1P4AA 1PFYA 4LCBA 4HDRA 5BSKA 1K27A 1CJVC 3ECCA 4PCAA 1U7DA 3EHMA 1VIYA 4GC9A 3QE9Y 1JAIA 3WL3A 3SJ7A 2D5CA 2OHOA 4UHJA 2X2OA 2GGSA 2N1MA 4YBZA 3DMPA 3RFXA 3IP9A 2BTEA 3GP8A 1JR8A 3RVQA 2HSWA 1PQPA 2WIKA 4PPNA 2R00C 1ZWLA 3NHPA 1Z7Qc 3B85A 1JG2A 1UFBA 2LDBA 1SIWA 2A78A 1VBMA 3NBXX 1L7PA 1KO5A 3UM9A 1R8XA 2IYYA 3R7SA 2DWUA 2WJWA 2ZJAA 4P83A 3CHYA 3LGSA 4JODA 2OAGA 1QCYA 1V54C 3HLZA 1VYHA 1E9EA 2EFCB 4BGIA 5MN4A 4US2R 3FOBA 5I5EA 2L2QA 3T3HA 2V7VA 5A4DA 1HE9A 1CETA 1F9EA 3MS7A 2IY8A 1GPDG 2CBXA 1F20A 1FMLA 4G07A 5DTMA 1C41A 4RHUA 3NB0A 3U0VA 3AM4A 3E0QA 2I34A 4NXNB 1C30B 1N7JA 5CVUA 3PQ4A 1FMVA 4P7FA 3Q3IA 3DMFA 1EP9A 4EPXA 2BKUA 5EMKA 1TZJA 4WEOA 2JLXA 5HGJA 4F85A 5B7GA 3R41A 2H4ZA 4XSVA 1UBUS 1LX6A 3KWMA 4KRFA 3BF7A 2WR8A 4MVJP 3WFZA 1XXHE 4C0BA 4BG0A 1Y4SA 5CJ2A 2WTNA 2YWAA 1DIOB 3JCZA 3E9MA 1Y3DE 2LFFA 5LQKA 2X4GA 3EDMA 3L8MA 3K1IC 1P2VA 2P0EA 1JLMA 1D2MA 4M1TA 2VCYA 3RF3A 3MT0A 2NV2B 4OL9A 3V4SA 4PZDA 3NHJA 5TARA 4WCFB 2GN8A 1UPCA 2OXCA 3UG6A 4IDHA 3KQMA 2ZYDA 5EWJA 1Z62A 1TLFA 5JJ5A 2OBMA 3SXZA 3LLMA 2WPNA 4R2KA 4GXTA 4A92A 2QVBA 3X43A 5TQ0B 4X1YB 3THRA 1NMSA 3AUAA 4LDJA 2HXSA 2PSFA 4ZOLF 2HA4A 1V5GA 5DM60 3C4VA 1E9BA 1YR7A 3RYIA 4ARSA 1RI1A 4DPKA 2EWVA 3DLAA 1J23A 3HB5X 2ISSD 3NGXA 3AXSA 4OSOA 2EBFX 3GDGA 3LNRA 2H5EA 3FD8A 1IBSA 2CFRA 3TMYA 4D99A 1M83A 3HXMA 3E2MA 5DNDA 1JIXA 2FW7A 5C5DA 4DDKA 4YV1A 4FQ7A 3T9BA 1AY0A 2YEVA 3GR6A 4R8KA 4KSBA 4KQXA 1W0KD 3GARA 2DUWA 4EG6A 2CW0F 1UBNA 1Y34E 1AUXA 2ZJ0A 1UT5A 3TBKA 4KXLA 1GZHB 1QYRA 4L85A 1V5FA 1JIQA 1PSDA 3LT2A 2GVDC 2Y99A 2AEEA 1SYQA 2HXYA 4PC6A 4Z4QA 1SVNA 3KSBC 4HWRA 4ENSA 5TS2A 3H5TA 2C5FA 4W1QA 3K8OE 3EXIA 2A3RA 2ZT7A 2W6MA 3QVGB 2PL5A 1GYRA 4I5GA 3L1KA 1ZPDA 5G3ZA 3H1AA 4GW3A 3IAAA 2I6XA 3M9WA 3RIGA 4BKRA 5BUZA 1ZOSA 2R9VA 4GH5A 2EPNA 1CWUA 5KYKA 4H6PA 4AJJA 1L4UA 4MCJA 1CJBA 1XZIA 1L5MA 1HTBA 5IJAA 4GZ3A 4DDUA 2QTVB 3HU2A 1KF0A 5K0GA 3ED5A 1P2DA 1ZCJA 4EW2A 4U9EA 1BU5A 1R4ZA 1Q0MA 5GY7A 2ZJ5A 5A7FA 2OD2A 2X8JB 5C5CA 3QEAZ 4W63A 4XB1A 2F3SA 2HDOA 2PH5A 1NNLA 3DBHA 1EGHA 2DLNA 4ZMSA 3ZD8A 1EQ1A 5FLEX 1NW8A 4MR9B 2XGJA 4GWKA 4OJQA 3KK0A 2H5JA 2RHRA 3NKEA 3O74A 3EULA 3EQ9A 1B15A 1NP3A 2PD4A 5T1DB 3MYIA 4JHXA 3U48A 1YE8A 4C6SA 3MN1A 3N2LA 3S7ZA 3CX8A 2Y0PA 3KZ1E 4HFRA 2RGXA 2HWYA 4HF7A 4HHEA 1SXGA 1Y5IA 5JMTA 4MDHA 2VHUA 4DQ0A 1I1NA 1UAGA 4OHFA 3ZU3A 3PRKE 3KCQA 4MHSA 3W5CA 4XRGA 4Q4AB 1RJFA 3QPAA 2ZE5A 4L27A 4NOJA 5BSFA 3ODPA 1OFUA 5TVKA 1H6AA 4DBZA 2NADA 5E9WA 2WUEA 3LVFO 4GP9A 3L0IA 1RBMA 1GGVA 1NWCA 3GCXA 2AQIA 3TAXA 2F8LA 5G0TA 5L51A 2O9XA 3EW9A 3NPMA 5AXAA 5AT1A 1HY3A 1OA0A 4NDZA 4J0QA 4GL4A 4MLDA 3IQ6A 2FPIA 2VDMB 4BE4A 4H16A 5DYWA 2RC6A 1SC9A 3CKYA 3WLAA 4M36A 5EJIA 5EIEA 1O77A 3ZLVA 1E1QD 3TLZA 5IULC 3VU1A 5EYPB 4N03A 4DZTA 4BGDA 3ONNA 3B3QA 4WADA 4WOCA 3GDWA 1T6BY 3B9QA 4XWJA 2VHXA 3B5IA 2J6BA 4Q3NA 4RPIA 1ZS9A 3RE1A 1I6MA 1UPAA 1OXTA 3EISA 4V39A 3D2CA 3JWPA 5EAIA 2C04A 5FIUA 2HZBA 5BO5A 1GY8A 3W78A 4HXEB 2X23A 3ETGA 4LOKA 3BUSA 1JKIA 3WGUA 2AHOA 3F7NA 3JRWA 1A50B 1TFOB 1QYDA 3TXXA 1KNYA 2BFFB 5FL7D 4JIMA 3WGQA 1S7GA 1U2DA 4QTUB 2CE7A 2O6LA 4ZYTA 1P0FA 2R84A 4U9DA 2PMFA 3R5KA 3O4JA 3LUFA 3KVRA 5IKXA 1F8FA 2P5UA 1YDGA 3TOLA 4BVAA 2WF9A 5DGTA 3M49A 1L7XA 4LYJA 1PLKA 5LQUA 2A57A 2VBIA 2N47A 4N3NA 2JARA 2A5YB 2ODBA 3CXUA 1JUDA 3IVCA 5CIWA 3DLIA 5GONA 4LXIA 2J0XA 3RLFA 1JA0A 2O3RA 2FFAA 3WLHA 1MU0A 3TD9A 4II7A 1U8ZA 5TQ2A 2CXUA 3GXBA 4MLPA 3JATB 4EQZA 3F6BX 3T7AA 1E6LA 1X7GA 3R3JA 1YNOA 3UJ3X 5JASA 2Y3HA 3E3MA 1Z6YA 1HL7A 3RVKA 2SKCA 4KH0A 4PYLA 1VBNA 5K8UA 5IUJC 2VT7A 1E1DA 5E6UA 3PCXA 2XCLA 4IRUA 4K9QA 3BIJA 4REOA 1E2EA 1OR8A 3T8YA 3C3MA 5UKDA 3JALA 4QPZA 2O8DB 3SC2B 1CG6A 1QHHA 1QWOA 1T5HX 2OD7A 5LWHA 4RD3A 1CEXA 1GGQA 1LF5A 3DAGA 3IRVA 1FCJA 2WTBA 2QRMA 5THKA 4YCDA 2JAQA 2R6JA 4UTXA 3ZV3A 3COPA 1NXWA 4P4UA 4I1OB 4QHYA 4OXQA 2J1LA 1DXHA 1QXSA 1QRAA 5AJHA 1L9KA 4CV3A 4HC4A 1GSAA 4U5XA 2EEZA 3FRJA 4X6XA 3R4VA 1K0UA 1AH2A 1BVYF 2V9ZA 4L1KA 1CUFA 2C94A 5K8JB 2YHAA 1PV1A 1V35A 4JFAA 2HSBA 4BQNA 1TK2A 5JSHA 2OBYA 2NAPA 3PD1A 4NBRA 5DBHX 4U7GA 2J32A 2W6ZA 1HLDA 1DWQA 4QUBA 4U7PB 5DWQA 5ICSA 4RMNA 2I6GA 5KNCA 3DPUA 3BH6A 3KPVA 4RLFA 3G0GA 3OZVA 4ESHA 2PX5A 1US8A 3H2JA 2GKOA 5CJJA 2JIDA 1ZMTA 3TKYA 4LTDA 4XD7A 5E6RB 1FY2A 4HN9A 3ZEIA 4R3NA 4FDLA 1YOVA 2DHEA 2XF8A 3M1YA 2LCFA 1R5BA 4IUYA 4RFSB 3ZUGA 3K70B 3M5CA 3AFGA 1SAYA 3AVUA 2OCCC 3LCRA 2EX4A 1TUIA 4INOA 3AWIA 4RH1A 4F6RA 1KSHA 1VKZA 3UMBA 1VA5A 4Q39A 4E07A 4K40A 2P27A 4L9RA 1XU4A 1PD0A 2CMGA 1V41E 2J5QA 2IWHA 5JS2A 3SXUA 2CNNA 4INZA 5B1YA 2RI1A 1G42A 5DASA 4YY3B 3SSOA 5IAGA 1NDQA 3E1GA 3PICA