5L3QA

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
265
Chain Sequence
b'NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle 54 kDa protein
molecule tags Protein transport
source organism Homo sapiens
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
total genus 90
structure length 265
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3qA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qA02
4ACAA 5UKDA 4RY2A 4TLEA 1KNQA 2VP9A 2BM1A 2FNAA 2WBLC 1A4RA 1N0UA 2GDJA 1X8JA 2YVUA 2IUTA 3M6AA 4Q5IA 4II7A 4QRHA 5CYPA 5H68A 1KI9A 4NL4H 4IDOA 3CZPA 2P65A 4DLUA 4F92B 1H8HD 4OQXA 2IWRA 4D25A 3FVQA 1JECA 2UZ3A 2PL3A 2ZJ8A 2QBYA 4KSBA 5FPTA 5BYJA 2PLRA 4PC3A 4DCSA 5LD2C 5JJKA 1UBGA 3E70C 1JBKA 1OXVA 3LQQA 3NC1C 4C0JA 4ZIRB 1SHZA 2EFEB 3M1IA 2G9NA 5FR2A 4I99A 1G7RA 1N25A 4KI0A 4A36A 2XB4A 5L3SB 3EG5A 4B3BA 4NCKA 5K8UA 2WWHA 1NP6A 2ZRHA 2BMEA 4URVR 2VRWA 5DI3A 4HZUB 4HUQB 3JVVA 2JJ8A 4HB2A 3W6PA 1SVMA 1GNRA 1UBFA 2ZE6A 4TN1A 3NH6A 4DUGD 1LTQA 3I3SR 4BFYA 1X8LA 1YHNA 2ZQ5A 5DI9A 4PQYA 5AWFC 4Q21A 1XD2B 3KXKA 3RS4A 4H1UA 2OCPA 1J8MF 3N2IA 3VKGA 4KXFB 4XSHA 3BORA 2O5VA 2XSZD 4LBVA 4BZPA 2D2EA 1M74A 1TUEA 1P72A 3EC1A 3E1SA 4CT5A 1L4UA 3W34A 4ZDKA 2PLFA 2V4ZA 3EZ9A 4RVCA 5TY0A 3UXMA 1V43A 3EZ7A 5CITA 3I5XA 4HUQA 4PSVA 2X2FA 5C4GB 4AK9A 1FMLA 2W58A 2VL7A 3RVBA 3W9YA 3EZFA 1S1CA 2AHOA 4TT3D 3BH0A 3T5DA 3C16C 1M7BA 1OXSC 3MD0A 3AB3A 2RGAA 3P32A 1F3OA 1HURA 1E1QA 5BWMA 3B9QA 1RKBA 4KAXA 4A6XA 5KNCA 3IHWA 1RRFA 2QEQA 3NEJA 3QUSA 5B2ZA 1CXZA 1G8HA 3C5CA 1NMXA 4A0HA 3BGWA 3GLGA 2YKGA 4MQBA 3A8TA 1UM8A 3PITA 5DO9A 4CEHA 2BMDA 2GJ8A 5TB5A 5FBVB 4GNKA 3MWKA 4TMWA 1IY1A 1KIMA 1XBTA 4IW3B 1XB2A 1ZNZA 4B3CA 3GJ5A 4XH9B 2A5JA 1W5SA 1HE1C 4CEIA 4QGAA 1E0JA 1EXMA 3CH5A 4JKIA 4CIDA 4N0DA 4XD7A 4DSOA 5JWHA 1F60A 1NBMA 3GD7A 2QQ0A 4W5JA 5G40A 4EQ6B 3U61B 2ZXUA 1IONA 2E9SA 2XJ9A 4XD7D 2QMEA 4AYXA 1Z3IX 4Z8XA 5FPHA 2QL6A 2QT1A 3LXRA 1IY2A 4M1WA 1A7JA 4QFMA 4QXAA 1VKJA 2B6HA 1R0WA 2QG6A 2AN9A 1AZSC 2PMDA 3CWQA 3EW9A 4E5UA 3TNFA 1KO7A 3KQKA 3AP3A 2QRNA 1XTQA 4RD1A 2GZHA 1NVUQ 4FWTA 3U3KA 2Z83A 5M04A 2O8CA 3AF0A 4H1VA 3U7GA 4CDGA 3T34A 2EFGA 3ZVMA 2WJJA 2PT7A 3PR1A 4U00A 2L0XA 1KJYA 3U3OA 1VG1A 1WF3A 2QI9C 4OI4A 4QJ4A 4OQFA 1JI0A 2W0MA 4TL9A 1TQ4A 2RB4A 5FR1A 2JA1A 3LWNA 3AVVA 2HYIC 3KKNA 1W0JD 1CJTC 4IEIA 4ARZB 4V0MA 3OHMA 2IYWA 4WAUA 5KPDA 1MH1A 2GCPA 3BRWD 5LB2A 1W0JA 3ETLA 4LBYA 521PA 3CRMA 4DUGA 5FFMA 1DAKA 4O2LA 2HCBA 3V4FA 2YZ2A 3RANA 1ZM4A 2REBA 1FX0B 5K8LA 4B3DA 2C77A 5A4JA 2OCYC 2VP6A 2A5YB 5BYKA 3U60B 5DN6D 3SE0A 1QVAA 1Z22A 1CRQA 2QE7A 1F6BA 3O47A 3OE7A 2IEZA 3THWA 2ZAMA 4L16A 2FV8A 2J59A 4IEEA 4NCIA 4B3XA 5JFGA 4QBFA 1LW7A 1XFAA 1Q1QA 3C8UA 3K09A 4JZKA 3U44B 1M8PA 4PX9A 2KB0A 3RC8A 1JNYA 4KU4A 2BJVA 2GA8A 4I1VA 5BN4A 2GXQA 3L8ZA 2O0HA 4LC0A 4MGIR 1X1RA 3WHLA 4B33A 1JJ7A 1E99A 1M1YE 1W4AA 2X1VA 3D7MA 3LW7A 4UNRA 3HDTA 4Q03A 1Z0JA 3Q7PA 2ZPTX 1G1MA 1W2GA 3HWSA 2Z4SA 2QENA 1J2JA 4OJKA 3B82A 1ODFA 2NMVA 3A58B 3K9GA 1OYYA 4QG7A 4DSNA 4LHWA 2MMGA 1G4AE 1EX6A 2ZS8A 2DFTA 4TYPA 1MO3A 4HEJA 4CZ2A 1PV4A 2J0SA 3HPQA 3L8YA 4I4LA 4ZDJA 3BFKA 3K09C 3R20A 1P5ZB 3QPUA 1EFCA 4F38A 3DM5A 1OB5A 2XXAA 3KX2A 3EPKA 2Q3FA 4L8GA 3T1TA 2VHTA 2BCJQ 4UNQA 2BMFA 3QF4B 3CRVA 5FBQB 1SVKA 4PZZA 4G01B 1RVDA 3MWLA 1U9IC 4DLVA 3K0EA 2KBFA 3U3MA 5H8WA 3HU2A 3U7EB 1B23P 4LV6A 1T91A 1XEXB 3NDBB 5L3RA 3SBDA 4LJ8A 4LHZA 4OHYA 3SJCA 2ZI7A 4IOKA 3Q9LA 1IXZA 1NG1A 2WJHA 2BWJA 4E09A 4PO8A 1M7GA 3BXZA 3THXA 3CB4A 2D7CA 4DCTA 2SHKA 3VTKA 2QQEA 3F5FA 5JS7A 4KLNA 4L9WA 4PC7A 2ONJA 1QHHA 1EESA 1KZ7B 1W4CA 5J4YA 2YWFA 4OJQA 3KJEA 2OZEA 2CLDX 5E95A 5FOVA 3UMSA 4A2WA 3W6OA 2ZJYA 4A0RA 4V0OA 3THYA 2J7PD 2ODBA 4LJ9A 1OPXA 1C4OA 3W90A 2ZI4A 1XCGB 1N6LA 1G3UA 1P4SA 2F9LA 4GP6A 2WHXA 2EFCB 1NMZA 2HF8A 3Q5EA 4TMXA 1S1MA 1OFTA 1AA9A 3D3QA 3M0EA 4EIWA 4WZBE 1J7KA 1QHXA 4YMSA 4A82A 1A2KC 2WSMA 4IDHA 2CVHA 3ADCA 3U3JA 2XXAB 1IN4A 2YYZA 4PHFA 3OZXA 3FOZA 2GK7A 4PPFA 4B43A 2ZS9A 2ZRJA 2ZRBA 4BEJA 2PZGA 2WKPA 721PA 3EIQA 3DMDA 1NKTA 3L0SA 4EKDA 1D8TA 2EFHB 1OYWA 4E07A 5C4MA 2P5TB 3OE7D 1Z29A 5FTLA 1US8B 1VYVA 2FJUA 3VU9A 1P62B 3SQWA 5JMTA 1E2IA 1RJ9A 4BQSA 4D82A 1S9HA 3CW2A 2ZRDA 1Q1EA 2GNOA 3CO5A 2A30A 5DGXA 3NBYC 4JLMA 1VIYA 4FMCB 3ICEA 1J70A 4WIAA 2XZOA 1K5GA 4QHTA 4KVGA 4ITRC 4PQFA 5LBIA 1D5CA 1GDDA 1GSIA 5JCZA 4AKIA 3RS7A 3CF6R 4E22A 3GPLA 3GJ4A 4PZLA 1Z0IA 2BBOA 3IO3A 3DVLA 4FW9A 3TMKA 3QKUA 2C99A 3H4MA 1IJFA 1JXMA 2A3RA 2JJ1D 4KV9A 3AF4A 4NDZA 4QJ3A 3BB1A 3KUCA 4C0QC 3NHAA 4B44A 1WXQA 1P75A 1E2LA 1QDEA 2DYKA 3R8CA 2IEYA 5EP1A 1CS4C 4ZKDA 1NMYA 2GAOA 2WKRA 3EAQA 1FQJA 4JLDA 2PJZA 4YXWA 2B8TA 1Q57A 3B60A 1IN8A 4W5WA 4XTRA 5HKKD 4B2LA 4D6PA 2C98A 5EXXA 4IRUB 5A5GA 4P4SA 3ZS8A 3IUYA 3LXXA 3V4RA 3AVOA 4URUR 1NN0A 1LS6A 3CIOA 1G4UR 5GVSA 4DLRA 1BYUA 2FPKA 5FUVA 3CBQA 4TQAA 1KI4A 1T3HA 2WWYA 3AVPA 3ZH9B 2A5DA 1NBME 1VPLA 3BERA 4YONB 2B92A 5DN6A 1ZJ6A 4JJKA 3AF2A 1NNEA 3MMPA 2NZ8A 3QVUA 2X19A 1CJKC 4EFLA 1OFHA 3BH7A 4V0KA 2MSCB 5D3MB 3KKOA 2JGNA 4EJSB 2CHQA 1E2FA 3CX8A 2VBCA 1XTJA 3RABA 3K70B 2QP4A 4B35A 1XEWX 1W0KA 2OXRA 4QGHA 1X6VA 1LB1B 2ZROA 1DAGA 4JLKA 4CEJA 3A4LA 4BPBA 3SS8A 4LCBA 1AS3A 2XTZA 1XMIA 2W00A 2FE4A 3VFDA 3GJ0A 5J5CA 2FSHA 3UIEA 1U0JA 4D0GA 2JJ1A 1D2MA 2VP0A 3WYAA 4TZ0A 5BN3A 1XTIA 3OAAD 2RGBA 4BZQA 3FMIA 4Q02A 4Q48A 3WYGA 2JEOA 5EJEA 4X8HA 3Q85A 1XTSA 2RHMA 1XWIA 3SYLA 4Q18A 4Q4LA 1EFUA 1KI3A 1YZNA 1XU4A 1NSFA 3ADDA 1JEEA 2O0KA 3RRYA 4QKQA 1OW3B 2AK2A 3K1JA 3QG5A 4RD3A 4LOAA 2B7CA 3U7HB 4M9SA 4NCHA 3KJGA 1E9BA 5GJVC 4G5SA 2ZRCA 4BECA 2LKDA 5EP3A 4MRVA 3GLHE 2HDNB 1E3MA 1VHTA 3KB2A 3TH5A 2XB2A 1CTQA 5FOWA 2R8RA 4O3MA 4XVRA 5DYIA 2O8FA 1NG9A 1VYTA 4L5BA 2QZ4A 1Q0UA 1GKUB 5DSZA 2J7KA 2J46A 1E32A 1QHSA 1EGAA 1KDPA 1Y63A 2W6ID 3OIUA 4JS0A 1M7HA 4YMWA 3TKLA 2IHBA 1W48A 2ZI5A 4L9SA 4K8OA 2OV2A 4Q7MB 5JHGB 3SN6A 4YMVA 1DAMA 2OEPA 4FCWA 5SZIA 4OQNA 4B6FA 5KPJA 3I5YA 1AIPA 4LI0A 3KKPA 3N70A 4Q1BA 1W0KD 2G1JA 1R5OA 1IY0A 2GKSA 1FP6A 2V6JA 1MR3F 4A0GA 3IHLA 3NXSA 4PC1A 1XXHA 4OHZA 4EAQA 1ZINA 3VNUA 2DFNA 1JXOA 2HCJB 2JAQA 2OLJA 3MJHA 2ORWA 4X8LA 3SJAA 1UDWA 1GILA 5JSZB 1D2EA 1WA5A 3ND8A 5K8IA 3CR8A 5EZ5A 1XX6A 4ZDIA 1LNZA 2VH5R 4WZ6A 2ZETA 4GZMA 4URYR 5HE9A 1N2CE 2VHQA 4N1AA 1DAEA 3ZVRA 4LPKA 4Q66C 5DE3A 2IF0A 4ZO4A 2XEXA 2HV8A 4FIDA 5DNYB 1P2UA 4LJ5A 2JLZA 1TPZA 3LBNA 3AP1A 4HLUA 1YU9A 4HZUA 2KWIA 2ANBA 3I8SA 2FFAA 3RRZA 1GKYA 1E96A 2F7SA 2IL1A 2RKOA 2ZYWX 4EJSC 2KE5A 1Z08A 3ADBA 1E9AA 4M9QA 1TEVA 3X1WA 1G3MA 3CX7A 4QNMA 1SXJA 1ZM2A 4RZ2A 3EASA 2HLDD 1ZD9A 3PCRB 1ELOA 1M34E 3LVQE 4GFDA 2FFHA 1KK0A 1MO4A 1P2SA 2B21A 2ZI9A 1HQYE 2R2AA 2XTMA 1J90A 3IPYA 3X2SA 4BE7B 4MRNA 2GEVA 5B64A 3CPHA 2GJ9A 2DR3A 1S9DA 2IS4A 1IN5A 3F8TA 1WBBA 1LS1A 3WMGA 4ZDWA 4BFVA 2H7VA 1IHUA 1TNDA 4GMDA 4M1KA 3GLFE 3U44A 2RAPA 1MV5A 1S2MA 4HLUC 1U81A 1UKVY 2AX4A 2QU8A 3LH5A 4IXMA 3W8NA 3KQUA 4DSUA 3MFYA 2A9KA 4MYHA 1XZQA 2ZYUX 2GJAA 2J1LA 1E9CA 2FEMA 2J0VA 2WOJA 1FFHA 2JLQA 5TARA 3R9XA 1Z2CA 1DAFA 3GEEA 4URXR 5KNDA 2V54A 3THOA 2RGEA 4HB4A 4P0TA 2O8DB 1U0HC 1NVVR 3KQNA 4Z51A 1SVIA 4LJ4A 5EE1A 3TSOA 1ZW6A 1OFUX 5JBQA 5GADl 4XVUA 5EXTA 4US1R 3GEHA 4FCVA 2ODEA 3UKDA 1KJWA 1TQ6A 3LV8A 1SGWA 4K81B 4CEHB 1KO4A 3SQXA 4PPNA 2N46A 2GWHA 2F9MA 4Q1FA 1DEKA 1J8YF 1S8FA 3EA5A 1T3LA 1NI3A 3DMNA 1R2QA 1GZSA 2WMOB 3FE2A 1ZM3A 2OG2A 2WZQA 2FEOA 4NMMA 4C0AC 4EPWA 3VHLB 5AJVB 4TYYA 2PH1A 3LY5A 1D6JA 1D9XA 4DC9A 2AFHE 4NCJA 2PEZA 1YZUA 1U2RA 4KSCA 5FUYA 4DWJA 2R6AA 3GLFB 2YWEA 621PA 5CJPA 2G83A 1QZXA 3QNUA 1JPNA 1SKYB 4EDHA 4JLOA 3U4QB 4BASA 1I2DA 1II9A 2EYQA 4DDUA 1XCMA 2UZIR 1DBSA 2J7PA 4BLOA 3ZZTA 4D2IA 4LHVA 4BRUA 4M9XA 3UPUA 3EX7C 1ZBDA 2IYUA 3P1JA 1KY2A 1NIPA 3G82C 1E0SA 4OYHA 4UXJA 1GG2A 4HLQB 3UG6A 1II0A 4A4DA 2OUKA 3FKSD 2CVFA 2EWWA 3EARA 5KDOA 2BJWA 1W2HA 3QF4A 4Y0AA 2WVJA 1JPJA 2X8AA 4AC9A 2D06A 1MRNA 1CEEA 2UKDA 1E9FA 2HEIA 2QE7D 2I1VB 4XOIA 5C1BA 3CWZA 2YHSA 4W9MC 1SKYE 1NY5A 4TT3A 5FL7D 1JAIA 3ONWA 4C9BA 2XZPA 5JRJA 2QTHA 3SHWA 1ZP6A 5KSZA 1TU4A 4I1SA 1E2HA 2VP4A 2CJWA 3SC3A 2VSFA 4TQUS 1FTSA 3GLGB 2QGZA 1EFHA 4Q7JB 2FN4A 1CLUA 2ZSFA 3D31A 4I1UA 2ASEA 1E4VA 2FSFA 1YRAA 2AXPA 2CJWB 3CPEA 2BIFA 4IOJA 2WTUA 4Q9JA 4PAOA 3EC2A 3UWKA 1TL7C 1GRRA 3JZAA 4A8JB 2FU5C 1DG1G 4IFEA 4AG5A 1R7RA 4Q47A 4RKFA 5LB4A 1DOAA 2H5EA 3NWJA 3T1OA 1N6RA 1K8RA 2FOLA 4XJXA 3WYFA 3FMFA 5CB6A 2X77A 1OKKD 2ODWA 3UMRA 821PA 1BKDR 4XSGA 1Q20A 1YZLA 4ARZA 1KMHA 3H1TA 2OXCA 4UKDA 4M0LA 4DZZA 1Q1ZA 2WSSD 3EZ2A 3B8HA 4PC2A 4BFTA 1FX0A 3AQ4A 5GJWC 1E9RA 2WSSA 1A1VA 4ZPXA 3SNHA 3UG7A 1ZNYA 5KUTA 2R9VA 2I1QA 3RC3A 1T5IA 3ZGXA 2GBLA 4AURA 5EE5B 4CT4B 4CW7A 1SULA 2PBRA 4Q4JA 5DLQC 2PX0A 4QBHA 4A1FA 1FW6A 2ZU6A 1DTSA 3HU1A 5EZ6B 4OK3A 4MITA 1YR6A 2G3YA 2OHFA 2EU8A 2IW3A 1L8QA 4FCTA 1XD8A 2EW1A 2TMKA 3TGPA 4PHTA 1Q12A 1KSGA 1G21E 4Q4JB 2YC4C 2BCGY 4UQOA 1XJCA 4WA7A 5KHOC 3DO6A 5J4HA 3KKQA 2JIZA 1B0UA 1N6PA 2HUPA 2GHIA 3O8DA 3TUZC 1JALA 3MCAA 4TQ9A 5AJZA 5K8TA 1LF0A 1CBUA 2ZYVX 4GBMA 4JL5A 1KTVA 3U6BA 2CNWD 2W6JD 1FQKA 2QAJA 2FPLA 3KJHA 4JT2A 3LLMA 4MKHA 3OEHA 1TQDA 5DHAA 3QEOA 1P60A 4IOLA 3EPLA 2Z4RA 3W6NA 2DY1A 2UVQA 3TUIC 2X2EA 3X1DA 4GPTA 4A8JC 1W4RA 2IYYA 4HDOB 3A6PC 4TMVA 4B3FX 4PAMA 1NY6A 3K53A 4ZI2A 4LHYA 2XITA 3S1AA 4DLSA 4V02A 2HT1A 1TTTA 2RH5A 1FP7A 1HY3A 5DIFA 4ILEA 5EP2A 3ZQJA 1GUAA 1UPTA 4HLDA 1D2NA 1CKEA 1U98A 3DDCA 5EUQB 1KI1A 2IXFA 4NCNA 4M1MA 1ZUHA 3B13B 1XDBA 3OIWA 5H70A 4NYJR 4Q9KA 4D4MA 2IYQA 3CR7A 4MYCA 3WBKA 1I4TD 4WW0A 2IC5A 3TRFA 3AV0B 2IYVA 5B30A 4JIMA 2QSYA 3K0FB 1T8UA 1N6HA 3LO5A 4TLDA 1XPOA 3TBKA 1VIAA 1RJ9B 2ZRAA 3DOFA 5HTKA 3I92A 4URWR 4M1OA 1HTWA 2HXYA 2KBEA 4IVQA 1GP2A 1YE8A 3TE6A 4B3GA 3TVTA 3IEVA 4F91B 5JCPA 4JMPA 3IQXA 4O2RA 1W36B 3IILA 2E87A 1QG4A 2FG5A 1AGPA 421PA 3B1VA 4CGZA 2D4HA 2ZSDA 1HE8B 3IIJA 1MABB 3CH4B 4LPSA 4OHWA 3CPJB 2BBTA 1OH5A 3B1YA 3L0PA 4MGYR 2WJGA 2IA5A 3IQWA 5JZVA 3THWB 1R8SA 2JLRA 1GKIA 2ZJZA 1FPMA 3LBHA 3B5JA 2CDNA 4DIEA 1LVGA 2ZI6A 4Q4AA 5KTYA 1ZD1A 1CR1A 3QKTA 3CZQA 1UDXA 1W44A 3FYHA 5L3QB 1E1RD 1V5WA 5TMPA 3BB3A 3CX6A 3RWMB 2H1LA 1WMSA 1Z6GA 3WNCA 4F4JA 5C18A 1YZQA 4KFSA 5FTKA 3B7GA 4HDQB 2IBMA 3CF0A 5HCNA 3S1AB 1KSFX 3LFUA 5LPNA 3BAFA 5AUQA 2ZRGA 3X1ZA 4LWZA 1IN6A 3A1WA 3THXB 3VHXA 4JKYA 5JI2E 3FGNA 3WBJA 3O8RA 4DCVA 1BH2A 3OEED 5DH9A 3QPVA 1T3SA 2V55B 3GJ3A 3QVVA 3KXLA 3NBXX 3M4YA 3WY9A 3A4NA 1E79D 2JCSA 2XJ4A 1F2TA 3CNOA 4AYWA 3EPHA 1DPFA 2HF9A 3FKSA 2H57A 3GJ8A 3LA6A 1MT0A 5HZKA 1E2NA 1E2KA 4P4TA 3KL4A 1OT3A 2DBYA 1IQPA 4ERNA 3A1VA 4MH0R 4A15A 2IXGA 4IDNA 1Q1BA 3RS0A 1X86B 3T06B 2CHVA 4MDFA 2H8KA 1IOZA 3BS4A 2F1HA 4B32A 2C8VA 1N3BA 5CDFE 4C0KA 1XMVA 4TMTA 4BLRA 1XEFA 2WKQA 1JR3E 1UJ2A 1U8YA 1F2TB 5E4FA 4BFUA 1RYFA 5EE3A 3AKDA 3MJRA 5CM9C 5IRCD 5FOTA 2AKAB 2F1JA 3K70C 1E6CA 4JSTA 1ZCAA 1M6NA 2O52A 4D81A 4DJTA 3H0KA 4AKEA 5JI3E 4TL6A 3EIEA 1RFLA 2G0TA 2C78A 4JJZA 4QGGA 4JLJA 1KDRA 4M53A 4K46A 1Z6TA 4TWZA 2ZJ5A 5FTNA 1IXRC 2ZTSA 4CYMA 1F2UA 2D74A 4QM6A 1SVOA 3JVUA 1ZRHA 2ZE5A 4RZUA 2J0UB 3ZJYA 1TX4B 4IDQA 1MO6A 2EVWX 1SQ5A 2BKEA 2ZJBA 2VIIA 4C7OB 3WNDA 2R6DA 4LC1A 5TV2A 5L3QA 3TJZA 1P9NA 2QGNA 1L4YA 4G5OA 1OXTA 1ZNXA 3NEYA 2PCJA 1QVRA 5FOXA 4EPYA 4MUBA 4A8JA 1PZNA 3B78A 1HA3A 1KI8A 4IKEA 1WE2A 1NSTA 1WGWA 3VKHA 2CL0X 1NF3A 1KAGA 3NTUA 4HAWA 2WV9A 3NDPA 4AY2A 4TYWA 1SXJE 1G19A 1OLOA 2CMKA 4Q1DA 4XWAA 5KDLA 1E2GA 2VLIA 3UATA 2WAXA 1C1YA 3VR6A 4BGDA 2OT3B 1JQJC 1KI2A 1G7SA 4JBYA 1E1RA 5IT5A 1QHYA 3GFOA 4KBFA 1Z47A 5SZKB 2JIZD 4M4SA 3SZRA 4AI6A 5KNBA 1N6OA 1KNXA 2ECKA 3WNBA 5J4KA 3PV0A 4RSGA 4U7DA 5A0FA 1H8HA 3I62A 1DAIA 2EQBA 4GP7A 1IAQA 1YR9A 5CJ2A 5BQ5A 2ZRNA 1XMSA 3CM0A 1Z2AA 4UNPA 1ZUIA 1BOFA 2W83A 4GOJA 2NG1A 1QHIA 3ECCA 4TZ6A 4PZYA 221PA 2RCNA 2V7QA 3QXJA 1TF2A 1SVSA 5KSPA 4ACBA 1E4YA 1HYQA 2G77B 4HAZA 4MKFA 2OAQ1 3U7FB 1L2TA 1GRQA 4LY6A 2ZRIA 2ZRLA 2ZVQX 3VR1A 1F48A 2ORVA 1G8FA 5CIWA 3ZVNA 4NYIQ 2XGJA 3SEAA 3KFXA 4Z54A 4WOPA 1X8KA 3LNCA 3KXIA 2MSDB 3OESA 4RCYA 2Q9BA 1HUQA 4OK5A 1AKEA 3HYRA 4Y0VA 1P3JA 3CONA 4DRZA 1W5TA 5KO2A 4BLPA 3EWAA 1AS2A 1E9EA 2YWGA 2J87A 4TL8A 5AJWA 2R65A 1DE0A 5D3QA 2R62A 1OFIA 1WP9A 4MGZR 5KYKA 3DZDA 2Q3MA 4QBIA 5G3ZA 2QNRA 1G6HA 4WBSA 1NRJB 4GDFA 3DM9B 5AUNB 1ZM9A 3FFAA 4BRWA 4DLXA 3K70D 4I1OA 1FNMA 5JRZA 4BZXA 2ZITA 4PO9A 1N0WA 4BLTA 1RZ3A 4LJAA 1CR0A 3FB4A 3GJ6A 4PHHA 1Z83A 2O8EB 1OH8A 1N5LA 5CB8A 2IK8A 1RRPA 2OAP1 3HR8A 3EPJA 5FI1B 4TMZA 1RYHA 4DHEA 5P21A 4ASUD 3BK7A 3GLHB 2VHUA 1Z63A 1EX7A 4KFRA 2PZEA 1N6NA 5JEDA 3PUVA 4PR0A 1PVOA 1CF4A 3MLEA 1CJUC 1A2BA 2ZM5A 4R71A 2GZAA 2CXXA 2GRJA 3TLXA 1HT1E 4OI1A 1PLKA 1P9RA 1W47A 1TEXA 1M2OB 4JYCA 3K0CC 3QXSA 4EPRA 1EFRD 3BBPA 2FMXA 1NLFA 4M9ZA 2RGNA 5G3YA 4IFBA 2PZFA 2P6UA 3NKVA 2ZRPA 1YKSA 3R7WA 2OCBA 4U02A 1II8A 1G16A 4JLNA 5DI3B 4DDVA 1W4BA 1CULC 1KZGB 1KDOA 2P2LA 2D3WA 3FMOB 4M2LA 5FOUA 2QAGC 4GT1A 2F1IA 4LRWA 2FDCA 3I32A 1RRCA 1QG2A 4LGMA 2ZIAA 2XZLA 2D2FA 2IYXA 2KJQA 3UMFA 4PO1A 5AK0A 5AJYA 3PXGA 2IX3A 3U5ZB 3RHFA 2QY9A 4TTRA 4JLAA 1X1SA 1DO0A 4DBLC 1VYUA 4P33A 1SHKA 4DVGA 2Q21A 2ZSEA 3DPUA 4B34A 5CLLA 2JJ2A 2R6CA 2RHDA 4FMDB 4N0EA 1G3IA 3QXXA 3TSZA 5FPKA 5DYGA 3LX8A 3ZDQA 1R5BA 2DWPA 1GIAA 5BN5A 1CIPA 1E2JA 2GCOA 2A78A 3ZQ6A 8OHMA 1UKZA 2QT0A 4PQRA 1ZVQA 3SI7A 2V1UA 4US0R 3CRQA 4G5GA 2DHRA 3W5IA 3UWOA 2GK6A 2NIPA 5HKKA 1W7AA 3B9PA 3WRYC 4BEBA 5IHPA 1GL7A 4GOXA 3R9WA 1YQTA 4N3NA 1ZIPA 4D26A 5BW8A 4B71A 1Z0AA 1R0XA 2BC9A 3ZD7A 1VDZA 1NKSA 1PUIA 4HAYA 5LDDC 1UFQA 5CK5A 1UADA 4JT4A 2QMHA 5HZHA 5TDHA 2WWWA 4JVLA 2CCKA 2FZ4A 3AVUA 2BVNA 3AP2A 1W1WA 3U2QA 4NU0A 4OI2A 1PJRA 1AGRA 1NLZA 1AZTA 4JVSB 4PPGA 4JBWA 2G6BA 3EXAA 3VR5A 4ZV4A 1E2DA 2GXUA 2XX3A 5EE0A 1A82A 2JASA 3FTQA 3PIRA 1U8AA 3QKSA 5EE9A 3FHTA 4M21A 3WMFA 4UJ5A 3I1FA 4F4IA 2QROA 2JLUA 4F7WA 4BFWA 1E2MA 1S0UA 3AKEA 5JEEA 3WMEA 3T15A 2VF8A 2EFDB 4KBGA 4NZYA 1XF9A 1ZIOA 1XNJA 3LDAA 5HPYB 2DCUA 5L3SA 2C96A 3IO5A 4W7SA 3PEVA 3SYNA 2P0EA 4YMTA 5IK2D 1H8EA 2GXAA 2XOKD 3QY0A 4Q4HA 5AJXA 4C0LA 3SJZA 2GESA 3GLIA 3CNLA 3HR7A 4BLQA 1H8ED 4D4LA 4EPTA 4CEJB 2OM2A 4NBSA 2ZREA 6Q21A 2RMKA 1OIVA 1ZU5A 2ZUCA 1KI7A 3U4QA 2ZR7A 3PEYA 1RC8A 1ZCBA 1DAHA 1FTNA 1HV8A 1KKLA 4MUAA 3H2YA 3K9HA 1US8A 5E7IA 2F3TA 5E3HA 1KO8A 1LFDB 1HH4A 4DCUA 3LD9A 3QQ5A 1OB2A 1DARA 2AKYA 2DFLA 3JZMA 4JLBA 2CE2X 2VP5A 2HXSA 2Y8EA 2H16A 1TF5A 5LD2B 1BO6A 3PUYA 2CK3D 4QNRA 3QBTA 1OSNA 1OJLA 1T6NA 1ESNA 1KO5A 1OHHA 4BUJA 1P61B 4LYJA 4DSTA 1Q22A 2OESA 4EPVA 2IWHA 2OFXA 3GLHA 3FHCB 1AN0A 1OV4A 3ZD6A 3H84A 4JLPA 2P5SA 2REXB 4BFSA 3BJIC 4KFUA 4S35A 3E5HA 4C30A 3PEWA 5GJCA 1FNNA 1QHHB 2VO1A 1TF7A 3SOPA 1COWA 2WWGA 4NPHA 4Q01A 2K5UA 4P3YA 1ZUNB 3A1TA 4R7ZA 2WIAA 1ZD8A 3K8YA 3MWJA 3ASZA 2FF7A 4A6PA 2IT1A 2ORIA 5IK2A 2QMUA 3UK6A 4DLTA 2ZE8A 2ERYA 1G8YA 3AGPA 4CRWB 5J40A 1J99A 1G3RA 1Z0DA 2AD1A 1IBRA 1GNPA 3KZ1E 1GL6A 3QXHA 1G7TA 2FFBA 2QN6A 3A36A 4LBWA 5C46F 3EIHA 4A2PA 3Q72A 2ONKA 1RRGA 3AGQA 2BBWA 2HJGA 5F2EA 2GETA 2GAAA 1TU3A 2WPDD 2YOFA 4PAQA 1LF5A 2F43A 4DT1B 4Q9HA 1A5TA 3R8FA 3EA0A 3VKWA 1ESMA 1MABA 2CBZA 2QORA 1EK0A 3QG1A 3F3YA 3BFVA 3RS3A 2IHYA 1MKYA 5SZJA 1NN3A 4WZAE 2ZI3A 3HP1A 3P27A 3QXCA 1IXSB 4NE2A 2F43B 3GQBA 1VG9B 3I61A 2YOHA 4DLZA 3RAPR 1G8GA 1OHHD 2QAGA 2WWIA 3I4LA 2VHJA 4NHOA 1CP2A 1DS6A 4JBXA 1Z8FA 3CF2A 2AL7A 4QHSA 1KAOA 2JLXA 1UF9A 1YRBA 3U6KA 5J47A 3CRW1 3WP1B 1QF9A 3A4MA 1E2EA 4GMXA 4P4UA 4C3ZA 3KQHA 1G41A 4WXRA 3KKMA 4QM7A 5DHFA 1IM2A 4QC2A 4DLWA 4UNSA 1TMKA 3TIFA 3GEIA 2F1RA 4LX0A 2W0SA 2IXEA 4IDPA 5FBLB 2O8EA 2W2TA 3H86A 4NONA 5GJBA 1E94E 1XXHB 4HSEA 5CLQA 3LBIA 4DDTA 2VP2A 4LJYA 1WRBA 5J4VA 3VQTA 2YNMA 1NVVQ 2DWQA 2ZJAA 4QHYA 1AKYA 1SXJC 3SJBA 3SYKA 1FUKA 3FFBA 3LQRA 2GF0A 3RLFA 1U94A 1WDTA 2QPTA 1JQLB 3P4XA 1LV7A 3X1XA 2A5FA 3MGCA 1ZC4A 2ZJOA 4P31A 4JVNA 4KFTA 3MSXA 1G18A 5GVRA 3T1QA 3Q3JB 2B8WA 4C2UA 3OIYA 4U5XA 4JLVA 4UXIA 3K0CA 1G5TA 3T35A 3CNNA 3B2EA 5DISB 3VAAA 1KDTA 2FPMA 3C5HA 2IYSA 2J45A 1L7VC 5FPYA 4PSKA 4C0BA 1SVLA 4KYUA 3TVDA 2CL6X 4KHZA 1SXJD 4I81A 4KJZA 3TAUA 3C15C 3FWYA 1P2TA 4UXHA 1F2UB 3WRXC 1G5PA 2OBMA 4IVPA 3KB1A 1G5RA 1KI6A 2KI5A 5FUWA 2FA9A 4Z1MA 1G291 1I4LD 1OH7A 1NN5A 3PUWA 3QI2A 1YR7A 1P73A 3LAWA 3DEFA 1R6BX 1U0LA 3FHOA 4DT1A 5HCIA 3UANA 5FH9A 4ASUA 2ZSAA 1VG0B 1RPZA 2ZRFA 3L43A 2QAGB 4RD4A 2AWNA 3AVWA 1XD2A 3QKRB 5EXSA 3TK1A 1SXJB 1TAGA 1AS0A 2WJIA 5CM8B 4PSAA 4R98A 4MRPA 4HAUA 3BC1A 2WWFA 2F55A 2OLKA 1NBMD 1Z6AA 4UNNA 3IIMA 5CDFA 1JR6A 3BE4A 3G5UA 4NYIR 4KODA 2O8DA 1X3SA 5KSYA 1BIFA 3HJNA 4MRRA 3ZS9A 3QBVA 4HAXA 4Z8YA 5ANRB 4A2QA 4JVMA 1Z28A 3ZVLA 2XAUA 2HT6A 2IS2A 4LJ7A 3QSYA 2H17A 4TLBA 1F5NA 3SDZA 4RZXA 1KO1A 3K9LA 3C4JA 4KLZA 2DWOA 1RIFA 3ZZUA 3VNVA 1YR8A 4OI0A 2VHCA 4D0LB 2GEUA 2BEKA 1G7CA 1OIWA 4PC6A 3QIAA 4B48A 4HATA 1E1QD 4QGFA 4P4SB 2BDTA 2IUSA 2OFWA 2IUUA 1NJFA 5H1YA 2BM0A 2WAYA 1MO5A 2I4IA 2OE2A 2YJTD 1Q3HA 3ZIAA 3LLUA 4PTLA 2WIBA 4Z1MD 3GMTA 1OXXK 4OKSA 3AEZA 2JJ2D 1HQCA 5G41A 2H18A 1KSHA 4KCGA 4IXNA 4YLGA 3QOFA 2CHGA 2E1RA 3B1WA 3VR3A 2VPPA 1W36C 4EPXA 2PT5A 3TR5A 1E79A 2IYLD 3D8BA 2C9OA 4GRAA 3QKRA 1S3GA 2ANCA 3P20A 1WCV1 3VU9B 3A37A 1Z07A 3PVSA 4WVFA 1G9XA 3Q8XB 2WMNB 2XNSA 3VR4A 1Q3TA 4NTZA 1KKMA 2XNDA 4P32A 4ESHA 3T61A 4RFVA 3K0FA 3L2OB 3PG5A 1YJ5A 1FUUA 3PUXA 4TLCA 3PJRA 3V9PA 1IN7A 2DPXA 3TUJC 2P6RA 2QPOA 4LJ6A 4OQMA 2ZVPX 2HYDA 4LK2A 2O8CB 2V1XA 4RD0A 2PCLA 4V0ME 3LW8A 1DVRA 4L4UA 1R5NA 4OBEA 4JL8A 3IPXA 3GFPA 3ZYCA 4A9AA 3K9NA 1AQYA 4LYAA 1Z06A 1R8QA 2RGGA 1T9HA 1XEWY 4B6EA 1G20E 3I72A 4EQ6A 1T4GA 1VCOA 1N5IA 1WB9A 3B1ZA 4TSFD 2O8BB 4CEIB 2RGXA 4V0LA 3TW4A 5AUPB 5F9FA 1PLLA 3RRNA 5JJIA 2J3EA 3REGA 3PUZA 5L8VA 4W5HA 3DKPA 5E7MA 2GBLC 2GILA 1I2MA 4XVQA 3X1YA 2O8BA 1GVNB 2NO6A 1CJMA 2BEJA 1OKKA 1VCIA 4GSYA 2IYZA 1GTVA 2WM9B 4HAVA 4Q1AA 2XSZA 4GL2A 2CLSA 1EG7A 2NO9A 2P67A 1XPRA 3AVXA 3OIVA 4Q9IA 4TTQA 3CKLA 3SBEA 5KOYA 3K0AB 4WXPA 2FZLA 3TQCA 3LVRE 2C95A 1ZAKA 2OILA 2C9YA 3QF7A 1MOZA 2CK3A 1VECA 2ZUDA 3SR0A 3BOSA 3BH6A 3GLIB 2Q9CA 1N0VC 3L82B 4LUCA 4NYJQ 1KMQA 2WJYA 4D80A 1U8ZA 4NYMR 2VYFA 4M1YA 1QHNA 1NIJA 4US2R 4E03A 1ONBA 4RKEA 3EZ6A 5AR1A 3DOEA 4AD8A 4LDJA 1EWQA 1ETUA 2NO0A 3GJXC 2CEAA 1PUJA 4MGKR 5EP4A 3TAHA 3TR0A 4FMBB 1P7CA 3R7WB 3SFVA 2V7QD 5JWRA 5ELXA 1WQ1R 3MRSA 2RGCA 3LX5A 2GTPA 2Q9AA 3OAAA 4OHVA 1GITA 3MWYW 4AKHA 4HI0E 1KMHB 1AQUA 1XCPA 3IIKA 4TL7A 5SZHB 3KDSE 3VR2A 1CR4A 2A7QA 3GLIE 3K0AA 3KUDA 3OFNA 5EXPA 3O8CA 5HE8A 4ZCMA 1Y3AA 2R44A 1N5KA 1G8PA 2B7BA 2F3RA 4CF7A 2JLYA 2XNDD 4MKIA 2VEDA 1TQ2A 4RFSB 4BFZA 3A1SA 3IDQA 3RWOA 4CVNA 1GNQA 2GF9A 2NTYC 1XZPA 4F93B 5FTJA 1EWRA 2J0UA 4V0NA 4OQLA 2Z5FA 3FDIA 4B47A 4D0NA 3RDPA 4DB2A 4RFSA 4Q7LA 3VMFA 1SVWA 3IGFA 2G1KA 1NN1A 4H9GA 1UKEA 4DEYA 1ZC3A 3AKYA 2HLDA 1KK1A 2ZANA 4B2IA 1UBEA 3QPWA 4FD2A 1H65A 4B2PA 3NBFA 1OIXA 2GXSA 1T5LA 3MAAC 4Q1EA 1RE0A 2QP9X 3FPAA 3RS5A 3T12A 4ZKEA 3THYB 4B74A 1BYIA 1O3YA 2G0NA 3VX3A 5B57C 4AG6A 1ZNWA 2V3CC 4B75A 5FTMA 2LWIA 3OF5A 4AYTA 4ESVA 5L3VA 2OSBA 1ZYUA 4D4JA 2V8OA 2JATA 1D9ZA 1G3QA 3V00A 3CUEF 5F9HA 2C03A 4JYBA 2D62A 3OEHD 3RS2A 3WP0A 1T0HB 4F4CA 3FKQA 2ZEJA 2NOAA 4J0QA 4O0MA 2GCNA 2FSIA 1KYIA 2VQSA 4URZR 4RD2A 5AUOB 2C04A 3SFZA 4XWOA 4UJ3A 1GM5A 3DZ8A 5JECA 3W8RA 3B85A 1P6XA 3BIFA 4YC7A 2VSOA 2Z6VA 3BFXA 4PHGA 3C14C 2GVDC 5F3WB 1FZQA 2EYUA 2JLWA 2NGRA 4QL3A 4RD6A 3KJIA 4POAA 5KSOA 3GFTA 1RW4A 2BMJA 5FOSA 1Z6XA 3G0HA 4HYYA 4B76A 1VG8A 3PQCA 4C0SA 4L15A 2W6IA 3TSWA 1N6IA 2ZU0C 1XXHE 2ATXA 1VMAA 3I8XA 1N5JA 3QKSB 3ASYA 4FXPA 3REFA 1BMFA 3Q7QA 1XJ0A 2ERXA 2FFQA 2OFOA 1BMFD 2MSEB 4PPQA 5EQTA 1GFIA 1HEIA 2YWHA 4YQFA 1E2QA 1Z0FA 3IBYA 3AUXA 2LCFA 1KSJA 2FH5B 3W3AA 1R0ZA 2WICA 1U9IA 1ANKA 1G17A 4KITB 3C7KA 4LSGA 4V03A 5JHHB 1CJVC 1YVDA 2ZAOA 2CNWA 4G5RA 5BXQC 5HR5A 1Z0KA 2FGKA 4Q4AB 3VX4A 1OXUA 2ZR0A 1YZGA 2BBSA 3C41J 4M22A 4TLAA 2OO7A 5CYOA 4C2TA 4R2IA 1EFTA 1P2VA 5IDVA 5IF9A 1NLYA 4TYNA 2IS1A 2AFIE 2FGJA 3SHFA 2Z0MA 2A5GA 2JLSA 2J0QA 2ZJ2A 2DFKB 1R10A 5FL7A 1XRJA 1KGDA 2C5LA 3GP8A 3TW8B 4C0HA 1DG3A 2FWRA 4Q19A 5E7JA 3T5GA 1GWNA 1QRAA 2J41A 3L0OA 1W49A 2GEDA 1I4DD 2YINC 5F98A 3HYTA 3T1VA 2NO1A 4G0NA 1XMJA 4ZI3A 2IYRA 2JDIA 4Q1CA 1NVWQ 3HPRA 4LYFA 1KI6B 1FOEB 2CLCX 4M8NE 2HJVA 3AVTA 2LKCA 2XOKA 4HLCA 1E69A 1II8B 1W46A 2AWOA 3CRRA 3I73A 5JJLA 2V9PA 5EUMA 1K6MA 1TUIA 3AUYA 2W6JA 121PA 2G88A 5J4LA 1S96A 2QM8A 2NPFA 1G64A 2C2HA 3IEUA 5FUXA 4LV5B 4MYUA 2R6GA 3L0IB 1K5DA 4MA4A 4JL6A 4D4KA 1W36D 2QPAA 3NBZC 4HB0A 4RZ3A 3W3ZB 4ON9A 4YXWD 1P9WA 2QTFA 1ZMXA 4Q7KA 4AKGA 1KY3A 5C2JB 4M1TA 4X8OA 4DDWA 1R4AA 2IF2A 2V6IA 3CLVA 3NC0C 4PXAA 3OFND 3AH8A 3U3RA 4TMKA 1E9DA 4FMCF 2IYTA 3B1XA 2ZRMA 1JAHA 2Q3HA 4X8MA 4GZLA 2H92A 2KSQA 2ZRKA 4NH0A 1SZPA 4GI7A 4OHXA 3B6EA 4IOMA 3PFIA 3W5JA 2QA5A 1E9SA 3RYTC 1C9KA 4KYIB 5JSZA 1QBKC 1CR2A 5JLJA 1DELA 4IHQA 5FBWB 2QTVB 1UAAA 1JJVA 4MDEA 2Q6TA 2Z43A 3WHKA 2CCGA 4EFMA 4FWIB 4LHXA 2BKUA 4EUNA 2WOOA 2VSXA 3ICQB 4FINA 4ZCLA 4LYHA 2QMOA 1ZM7A 1JEDA 3AF1A 4G3XA 4DCNA 4O25A 2QUZA 3E2IA 2AXNA 4JSYA 1Z5ZA 1JB1A 1UKYA 1FMJA 3NH9A 3A1UA 4QJ5A 3TQFA 2ZR9A 1S4QA 4LZZA 4Q4HB 2O8FB 4FI3C 2RGDA 1GOTA 3NIBA 4BFXA 1U99A 2P6NA 5JWOA 3AVQA 3EWSA 1XEXA 3AKCA 3DL0A 4IVRA 3ZLJA 1Z6YA 1R0YA 2P3SA 1XD9A 4OK6A 4Q9LA 2D7DA 2CL7X 3FMPB 2DB3A 3KQLA 3RRMA 1UEJA 3F0TA 4DXAA 4YMUA 1NL3A 3AVYA 3ZZ0A 1KK3A 1AK2A 3GJ7A 4NKRA 5JS8A 4ZCIA 2REOA 4EFNA 1T8TA 1XPUA 2BHRA 1E0AA 3HU3A 2R6FA 1LY1A 2GJSA 2QRZA 3RNLA 1KK2A 2PX3A 3BB4A 3KFVA 4NYMQ 5FBRB 3QEJA 1O87A 3K0SA 1JR3A 2QM7A 4XWKA 4KVAA 3AF3A 3QENA 1OH6A 1KHTA 1DADA 2NQ2C 5KDDA 4MYTA 2JDID 1JR3D 1Q21A 3J81k 3QJYA 2NO7A 2GZDA 3IBGA 2ZUBA 4FMDF 3R9IA 4ABYA 4ZIRA 3AM1A 2OBLA 3ZIAD 5G53C 3QE0A 2YC2C 4IJMA 1GRNA 3OEEA 2NZJA 5FPSA 3RSLA 4B73A 2QBYB 1IJEA 2W2VA 2PJRA 1N6KA 4PFSA 4HZIA 3D6TB 2ZSBA 5CK4A 2GCOB 1Q44A 3GCGA 2BOVA 4GOKA 4QBGB 5D3MA 4EJSA 4HB3A 4G5QA 2AD5A 2ZS7A 1G6OA 5FL3A 4A92A 2PEYA 1NJGA 4M1SA 1QHGA 2XTNA 2QSZA 3RSOA 4C7OA 4BWYA 4R9UC 5FI0B 3N5CA 1OF1A 3DKVA 3P26A 2EWVA 3LRPA 4KO8A 1E98A 4TYQA 2OCAA 2O0JA 1U90A 4TTPA 4AIIA 2IS6A 4BLSA 1EFRA 3MG9A 4HDCA 3BWDD 4MKGA 1E2PA 2A2ZA 4A0FA 1FL9A 3ND9A 2N42A 4DKXA 4LBZA 3O8BA 1VHLA 4G1UC 4XIGS 1GL9B 3NHBA 2QP3A 3MUFA 2ODNA 3IKJA 1SKQA 1ZU4A 1UBCA 1XTRA 2F6RA 4QOSA 1KOFA 2I3BA 2WWXA 2FX3A 1CRPA 4HUTA 2AR7A 3GLFA 1XTKA 3NG1A 2VTKA 3WXMA 2NPIA 4OL0A 4TSFA 4FN5A 2ZE7A 4NP6A 1COWD 4DEXA 2GVZC 4S2EA 5B58C 1CU1A 3KTAA 1OE0A 1VCNA 3KTAB 4RJLA 3PEUA 3SU8A 2YOGA 1PLJA 2ATVA 5CIQA 2CE7A 1KJZA 1HT2E 3PENA 4R2HA 1GAJA 2C9CA 3DHWC 4YDHB 1AJEA 1TADA 3BD9A 4AWXA 2BV3A 4DLYA 1WBDA 1E0KA 2Q0HA 2YV5A 2RGNC 3P4YA 3Q5DA 4XTCS 2W2XA 5TVKA 5KU1A 1YZKA 2OBNA 1XJQA 2FSGA 2JLVA 1UEIA 2GJKA 2J5XA 2VA8A 4MRSA 5TXGA 2PMKA 2CCJA 4RCZA 1VTKA 1YZTA 2WPDA 1DO2A 2AK3A 4LV8B 1BS1A 1MRSA 4YDSA 3ADKA 4DIDA 2MMCA 3GLGE 2ZYTX 2N1BA 4Q00A 1XP8A 3NVAA 4DB4A 3N2EA 2J9RA 1NVXQ 2VF7A 4C4PA 2WJVA 4PANA 1S3SA 1AM4D 1VCMA 1T0JB
chains in the Genus database with same CATH superfamily
1TT5B 1EYZA 2FRVA 4JVOA 1PG2A 2OB2A 5GV8A 2YHIA 4GQBA 4TLEA 3UAOA 2ZSUA 1Y9AA 1TOAA 3E84A 2BM1A 2FNAA 3GJQA 1LK7A 1O54A 3GRPA 1JHRA 1Z5UA 4FHEA 4HGOA 2IE8A 4UTZA 3M6AA 3VH4A 4NMHA 4OYRA 1V7ZA 3RUPA 2MYPA 1VI2A 3OETA 3ENZA 3VSEA 1C1HA 1F8UA 1AVOB 1XA3A 5JD5A 4IDOA 2XH8A 3CLKA 5FX2A 2P65A 4F92B 5ELXA 2G72A 1R5JA 4Z7NB 3IX7A 2HV9A 3OQBA 2IWRA 3FVQA 2COEA 3FUCA 3G5TA 2PL3A 1EFAA 1YMVA 3T6JA 1C4WA 1DDGA 3ABZA 4KSBA 5HIIA 2NXWA 3GXBA 4XGKA 4BVAA 4DCSA 4F7DA 4YAKA 3DAFA 1P4JA 1OXVA 2BAGA 4XXHA 5TJHA 3NC1C 5F5XA 4EQZA 1GT6A 1QH0A 1R50A 4ZIRB 3A11A 3BREA 3QVKA 4XJVA 3C70A 2G9NA 3EFOB 2FK7A 2VOEA 5EN4A 4ZTBA 3U09A 5HX7A 1G7RA 1N25A 1Y1TA 3L8MA 2XB4A 3DF9A 4JOQA 4KI0A 4B3BA 4MVWA 5K8UA 1UBUS 1FA9A 1QC5B 4ZI7B 4RADA 2OJED 5JCXA 3RJ5A 2XMQA 3QLUA 1G5FA 2AN1A 2WHRA 2WYHA 1UBFA 2ZE6A 4N65A 4O08A 4CSAC 2VI5A 1LTQA 3I3SR 4XCVA 1YHNA 2X4DA 4L57A 5HS6A 4LA4A 5G4LA 2HBYA 3RS4A 2QL7A 3UJ7A 2OCPA 2P4EA 2W4IA 2TYSB 3B6MA 5AW8A 1U8EA 2CSUA 2OZKA 4XSHA 4Y1FA 2IX9A 3SEFA 2WZCA 1T0IA 4H08A 4LBVA 1FVFA 3AHEA 5AVWA 4N48A 1YZHA 1Q7EA 4WK4B 1T9BA 4Q6BA 1M74A 3EC1A 1WKBA 5U4QA 1ECCA 2DWCA 5AHRA 3ZG6A 2JGRA 3L8DA 3N0VA 3ECAA 4CM5A 2PLFA 1HRKA 5TY0A 4JJ7A 5HJ5A 4F21A 5LVAA 2GQ0A 3QHPA 4KP7A 1JFSA 1NW3A 3WNVA 1CHDA 4IZIA 3ABSB 2W58A 5ALKA 3RVBA 1S1CA 4MVSA 2HBQA 4FFOA 1XQYA 1Z35A 3EQ9A 4X6LA 4GYTA 1KVTA 1QB7A 3C16C 1Q1GA 3FJ1A 3HP4A 1P7ZA 3AB3A 4AJLA 5H3HA 2H1HA 4FDLA 4W82A 4P6VF 5J5VA 3HH8A 1E1QA 5KQGA 3EFHA 3ZY6A 4KAXA 4A6XA 5KNCA 4XFJA 1RRFA 1H05A 2QEQA 1ZCFA 4F6RB 5EJ5A 3OLCX 3NDIA 4Q9AA 3DJUB 4A0HA 3FOEC 5DLPA 3L1MA 1QOQB 2PFDA 4LVNA 3LZCA 5CFLA 1S02A 3WGIA 3QEAZ 4CEHA 1CJSA 4YLYA 3K6BA 1SBZA 2XAAA 2Y05A 5EKXA 5EZSA 2VLBA 2FMFA 3MT8A 3SMQA 3T3MB 3WL4A 3E27A 3P9NA 4H7PA 4ZYLA 1GUYA 1XB2A 2PK3A 3JAWA 3BE5A 2FMKA 1T6ZA 2JBAB 1HE1C 4G1BA 4N49A 2HMTA 4UEKA 4QGAA 4BY9E 1OA0A 4N0DA 3NHJA 3LQ4A 4C6TA 3M3HA 2QQ0A 3K1HA 1T25A 4PJNA 3FAKA 1N5OX 3FWZA 1KTMA 1P0CA 2FVXA 4XD7D 5I47A 3UGJA 2QMEA 2UAGA 4Z8XA 1M57C 1BR4A 3HSYA 2PX8A 5FPHA 2QL6A 5KNCH 256BA 3EXHC 5I6DA 4QTTB 4DYVA 1IPHA 4MTFA 1P4HA 2ZJ7A 4D57A 4BJ3A 2CD7A 3DTVD 1KP2A 3K9QO 2VHWA 1THMA 3CWQA 2W6NA 3EHEA 1D4AA 2OK8A 3I0MA 4XX0B 1LVHA 5I48A 3OZTA 3NYJA 2Y69C 4HFFB 2FN9A 4ALNA 4Q4DA 4RD1A 3W2FA 3WB1A 3H11B 4JLSA 3ADOA 4Y18A 3U3KA 4G2TA 1EHYA 1X3LA 4H3VA 1TCCA 4FWTA 2PGJA 4E5MA 3BWCA 3IKLA 1EIZA 1IBMB 4KQHA 5SYNA 2O8CA 3H1BA 4H1VA 4A03A 3U7GA 1LNSA 4CDGA 4Q82A 4F4HA 2VQDA 2JJYA 4ETMA 2OHIA 5LOVB 1YRQA 1ULHA 1H6DA 3PK0A 4I3GA 3PVZA 2EFGA 3E9CA 4HFKB 2G62A 4NSNA 4MB2A 3CXUA 2W8ZA 4QX6A 4DV2B 4EB6B 2IZ0A 3V80A 1W5BA 2QI9C 4CMIB 5IJZA 4QJ4A 4LRTB 1JI0A 5IT4A 4EI8A 5BVHB 5KZMB 2CZGA 1TQ4A 1KEPA 2RB4A 4EYQA 3RTEA 1WTYA 1FFEA 3FBWA 5FPQA 3U9TA 1UQTA 3WHIA 5IXSA 3AVVA 2PIDA 4Z9XA 3U40A 2H6EA 1E64A 3V5YA 2IYWA 4IDFA 3AI7A 1MH1A 3BRWD 3EN0A 2Z5VA 3E03A 1W0JA 2J9BA 3ILXA 3PJGA 5EJIA 4BNNA 4LGYA 5FUMA 4MAFA 3BUSA 1X0VA 4M0UA 3EWNA 3K5PA 5KIAA 1QGUB 3ZLVA 3KSMA 4MV6A 3OWHA 2R02A 2GASA 3W5AA 3RU3A 1UG7A 2BC5A 1ZM4A 4UARA 4EG5A 4HCJA 2KYRA 4DMRA 4CI9A 2ETVA 1FFTC 1SCIA 4NULA 5J2UF 3SE0A 3SSOA 1YUNA 1Z22A 4U3JA 1YUMA 2OXFA 4H4DA 4CDMA 2J9FB 4WZBA 5CCEA 1RXCA 3OE7A 4WASA 4DQXA 4L16A 3EUFA 3L1JA 2FV8A 2J59A 2P3QA 4IDAA 4IEEA 4NCIA 4TTIA 4C2AA 2BFMA 5JFGA 3F1KA 2P9GA 1NFNA 1XFAA 3K09A 4E2YA 3CVOA 2YXPX 1M8PA 1TCUA 2KB0A 2NTJA 3B9BA 3RTGA 1LH0A 2BJVA 3RD5A 1R0KA 4PCVA 5A6AA 1HYBA 3HR4A 1LDEA 2BFFA 3E53A 3VR0A 5EL0A 4NZZA 2VSQA 5GMOA 1UOPA 2Q50A 2YXDA 3WHLA 2FCRA 4RCVA 2O0LA 1E99A 4EGJA 1RHRA 4TGLA 3QA9A 4FYWA 3T3PB 1W5AA 4C7VA 5JALA 2DX7A 3RPEA 5HUHA 4MJLA 1RLUA 3WLOA 2O54A 2ZPTX 3CEPB 4UCQA 1LSJA 4IUCS 1PK9A 2Z4SA 4GXNA 5TVGA 5EJ9A 3JWGA 3Q0IA 4WK0B 1GQOA 3GJTA 1RAGA 3MBIA 2G76A 1HDYA 1OYYA 3OH8A 5IJWA 4BU0A 4YNBA 3MHPA 1B00A 2C7VA 4CZ2A 3AY0A 3UGOA 2QXUA 3HPQA 1LDBA 1RRKA 1U9JA 3GORA 3S29A 3ZTMA 1SPBS 2BH2A 2JK1A 1R15A 1EBFA 5C1DA 2J3LA 1EFCA 4M60A 3DUFA 5LQSA 1OB5A 2F62A 4O8CA 3KX2A 5ESWA 4ZVNA 3R9KA 4F85A 2VHTA 4MEBA 3PNSA 4IM7A 2HZ7A 2NUTB 3OSUA 4DRJB 4UDYX 3IB6A 5FBQB 3ZWPA 1Q0PA 5EJ2A 4HX9A 5IT0A 1DDOA 4JASB 1PWZA 3O8OB 4L0CA 3MPUA 1TJ4A 1F38A 1TWAA 4FONA 3HU2A 5H8WA 6AT1A 2BGJA 1T91A 4GX2A 1Q14A 1KJJA 4PONA 1LPOA 3K0HA 4MR8B 5LYYA 4MJ3A 4OHYA 4C4ZA 4MIKA 1EA5A 1FNSA 3KQYA 4OVKA 4PXSA 3RFUA 5J3JA 3ZDDA 4DIBA 4EG8A 1KY5A 2BWJA 3V8NA 1FNDA 2QRGA 3I6MA 3I9V6 4PO8A 3IMFA 4E09A 4YJ2A 2O2JA 3E7DA 1LSOA 1TVMA 2D7CA 4DCTA 3Q3CA 5HRUA 1QX4A 2GGSA 3ZBUA 3TB6A 3F5FA 4DJFC 4PC7A 2P0AA 4DREA 1MHPA 3ZTZA 3GNQA 2HKVA 1CEXA 4Q3OA 1S5PA 2LFFA 2D1TA 2E85A 2Y2VA 2YWFA 3D2BA 2OZEA 1HDCA 1R0RE 4A0RA 4ALJA 3W0LB 1FVXA 4D4NA 3DZBA 5I9IA 2Q0QA 1XK7A 4LJ9A 1CUJA 1JDUA 3W90A 5KYGA 1XCGB 1N6LA 2W9XA 3AETB 2H63A 2P9YA 1JYFA 4G5XA 1FVHA 2WWVD 3STWA 1NDQA 1ML3A 4NMLA 2WHXA 3HXQA 1AKTA 4HMOA 2ZLBA 3CZ9A 3T7TA 4EIWA 5HKLA 4ZANA 4LN1A 1V55C 2KW3C 1OI2A 1QHXA 1RU3A 1A2KC 2GERA 3H7IA 3OIDA 2PBLA 4IDHA 3JWIA 1CQWA 4B7CA 3CVXA 2XXAB 1IN4A 2HJ3A 2IEDA 1J2RA 1DEHA 2B2NA 2GK7A 3FYTA 4QODA 3FPJA 4U2DA 5AYVA 4D44A 1YS6A 3INRA 3SBXA 2GBIA 2WKPA 3NJRA 3LZDA 2PNFA 3DMDA 1WDKA 5C1OA 1HMOA 4GZ5A 1KVQA 3HDVA 1YRHA 2PLAA 3IEXA 2MOKA 3K6KA 3DP7A 3NU1A 4KRGA 1UJMA 1Z29A 4PSDA 1VYVA 5I4CA 2PIAA 3VU9A 4PSCA 2I1WA 3SQWA 1JXAA 2OZPA 1RJ9A 3RRJA 2DR0A 2XZTA 4ALKA 3R9XB 1S9HA 3AXSA 1EKYA 2Q1XA 4HNSA 4OLAA 2ZAIA 3H9JA 5DGXA 4KMMA 1ZA1A 1WUHS 2Q1YA 3NBYC 1IK6A 5BOVA 4A5OA 3DNMA 4ZAYA 5LQDA 3ICEA 3L06A 3NHFA 2WZGA 2TS1A 4LXUA 4C1BA 5F7OA 3NGLA 3TJ6A 3N8HA 1VBFA 1D5CA 4GKBA 4KR6A 3E3MA 5LZ7A 1BGVA 3MTBA 1C2YA 5KOIA 3GPLA 2FSUA 5I9NA 3T0GA 3QEMA 3FCYA 1IW7F 1C2TA 4BVBA 1Z0IA 1WUKS 3U0VA 1Z0UA 3IO3A 1R16A 4YQEA 3SK0A 1ZH8A 3QKUA 2C99A 2OM6A 3H4MA 2AT1A 1JXMA 4KYTA 1JFTA 3ELDA 4O3FA 3W3AH 1EK2A 4UDXX 3KUCA 2XLHA 3IPCA 4TPKA 4LF4B 3NHAA 2B1GA 3N8KA 3R8CA 1E2LA 1QDEA 4JTCB 1QFSA 2IEYA 1YV9A 1V6SA 2MYUA 4OP3A 2WKRA 4WLEA 1FQJA 2CKDA 1WQ4A 3CNBA 3ATPA 1FYWA 3KOMA 3UOWA 2G07A 2WTMA 4AB1A 4BMYA 3ER6A 4D6PA 5EIOA 2HD4A 4TVSA 3KL2A 1V1RA 4FYYA 4IRUB 4RGQA 4X54A 4GEHA 4P4SA 9LDTA 1HORA 4RPIA 3GCZA 1PVVA 3THSA 3WYDA 3IDAA 5HOQA 5C5EA 1KS2A 1RMTA 4F3TA 3AVOA 5IJ0A 1W2WA 4JHLA 4MS4A 3OLYA 2DGDA 1P2BA 1UZUA 2GA9A 4N6CA 1WWPA 1EUCB 4DLRA 3PQ7A 1UWCA 2CUKA 3PBKA 4JWTA 5BSRA 1LLUA 1USGA 1S8AA 3ILYA 4XPWA 4YONB 4B46A 2Q5FA 1J9ZA 2HSWA 1ZLYA 2P40A 4M9RA 1NW5A 2FG7C 3LUDA 5D5HA 2GN8A 4QYXA 3FPGA 3QVUA 3SVTA 1THTA 4NE7A 4EFLA 3A1CA 1DIRA 1EAMA 3MRXA 1QYDA 3VAYA 1OD6A 1AQ6A 4EJSB 5IUJC 1ENOA 3D0RA 3RABA 2D4UA 1HEYA 1ZKMA 3L8GA 4LW8A 1VZ3A 5HV9A 1YA7O 2QTAA 1BHQ1 1SIOA 4X6XA 2ZTUA 5REQB 4F1WA 5HVNA 5IKOA 2OXRA 3FYSA 2GD0A 1IZ7A 1ODTC 1WXHA 1LWOA 4JP3A 1X6VA 3HCWA 5FTWA 1DAGA 5ALYA 3A9VA 2YFHA 3WKAA 4ARVA 1GXSA 2M6KA 5I51A 1EQ1A 3JTEA 8ATCA 3VFDA 2XTZA 4U39A 3FUTA 5CT4A 5BURA 5G2OA 4GKJB 3GJ0A 5LNK1 3OQMA 3AO0B 1AHIA 2AFHB 3BTUA 3MMSA 4UBMA 2VP0A 4MXDA 3WYAA 1U3CA 4BZQA 4BU1A 3FMIA 3C3CA 3GAZA 4K88A 1WO8A 3QE9Y 3CGGA 4Q48A 2JEOA 3TQQA 3HXMA 3PTLA 4X8HA 3Q85A 4CLRB 4L2IB 2XI4A 1KZ6A 1YQQA 3O4JA 3W5HA 2Y1LA 4DGSA 3FNBA 4U6SA 4OH1A 4B6JA 4WK2B 1HSZA 1KI3A 1DUVG 1K6JA 2AEJA 5ALHA 2C94A 3WISA 2YW2A 3ADDA 1R6XA 4MZDA 1JEEA 1WTCA 5DVZA 1P2DA 4P92A 3AW8A 1PJ2A 3HGTA 4MW4A 4B4KA 4TWAA 1IMJA 1MQ9A 3L6RA 1PD1A 5FF9A 2XT0A 1AXEA 4LQLA 4MPPA 1ZL0A 2LKDA 2ZTMA 4QOEA 4IIHA 3RSHA 5BN3B 2XB2A 1ULUA 4REQA 1KOJA 3UAGA 1EBUA 4DJJA 2RHGB 4O3MA 1U7ZA 2JI8A 2O8FA 3R3UA 4ZOEA 3UWPA 4WWHA 5EZYF 1ORTA 4QU9A 4RK1A 3UJDA 1CVRA 5IX8A 1Q0UA 5I5GA 2J7KA 1E32A 1VIMA 1K7FB 4C0WA 1EGAA 1Y63A 2W6ID 2JHFA 3ZV3A 1IK4A 1KU0A 1M7HA 5DHRA 3VZCA 4CKCA 1U0NA 3TKLA 3LECA 1UFVA 5JHGB 2YL3A 2RCYA 4JFAA 1FDRA 4YMVA 5HJ7A 3B0UX 2BSAA 3AV3A 3FA2A 3ILVA 3CVUA 1HRDA 4Q1BA 1W0KD 3CZRA 2PUAA 4JFRA 1IY0A 4ZT6A 1MR3F 3NXSA 4PC1A 4EAQA 3OQOA 2DFNA 1JXOA 3DWIA 4IV0A 3MJHA 1ID8A 4IH9A 4FUQA 5DWDA 3HSSA 4JY7A 1D2EA 1UAYA 1UH5A 5AK3A 3DB1A 2DKFA 2CYAA 3M7IA 3RFTA 3VYUB 3ZX5A 1XX6A 2RGYA 1YRYE 1KPIA 1NNI1 4ULVA 1VGRA 1C7QA 4L50A 4RVNA 1BJRE 1V11A 4JUIA 2V7BA 4TWIA 4XUGB 4QTZA 5BSWA 2EC5A 2VTEA 2O14A 4GZMA 4LY0A 5DTJA 3AQBA 5HE9A 4ZYZA 4IRXA 3HNPA 4JT9A 4NDAA 4BZZA 5DE3A 1EUDA 1U8TA 2UYYA 1C14A 5CAEB 4ZVQA 3LLKA 1E6UA 4BO4A 4YJHB 5DNYB 4LJ5A 2JLZA 5F98A 3AWIA 2HRBA 2QKYA 4QEKA 3A1NA 1YU9A 3DVSX 3GYBA 2PRIA 3W8HA 4XRGA 3ZE6A 1QJ4A 1T8YA 4LXTA 1RXYA 1LE2A 2LD4A 3A4YA 1KQGA 1R8YA 5FLEX 2QD3A 5HNKA 1MENA 1Z08A 3QY9A 1FFXB 1KORA 1TEVA 1WOMA 5DRYA 1XWJA 4MNTA 2O48X 4YRRA 4KQJA 4QNMA 5LN1A 1EGHA 2VT3A 2H8AA 1L5VA 1ZD9A 2HLDD 1F14A 2OYCA 5K09A 2O5RA 3P52A 3NOQA 2FFHA 4U2KA 1MO4A 3DVAA 2G0AA 2N75A 2Q6LA 2X86A 3GRCA 4BE7B 4X00A 5KOHB 3TZBA 4AJPA 2VAPA 3BVPA 4EGAA 2JAOA 2Y67A 2WQ7A 4NQZA 4JGBA 3W2TA 1S9DA 2IS4A 1IN5A 4CFSA 3GH3A 5JNWA 1KXZA 2Q5EA 4PIVA 3WBBA 1BDJA 4BFVA 4I1PA 3JQQA 1IHUA 4Y0NA 1TNDA 4GMDA 2CBGA 1JN0A 3L6EA 3UEOA 1RQXA 1S2MA 4HLUC 4LECA 4IG4A 4AVYA 1UKVY 4IXMA 1V4AA 1H5QA 1JHQA 3RFXA 3V8BA 2A9KA 4DFDA 4YJFB 1W4ZA 1CB7A 2DBVO 2J1LA 5A4DA 5KOJB 2IYFA 4EIYA 2JFBA 3AHHA 4MQ5A 3WYCA 2HREA 1GPWB 4RESA 3NO4A 2O8DB 1LE4A 1U0HC 3KQNA 4Z51A 3Q88A 4LJ4A 1ZW6A 3ROPA 1V48A 3F5MA 1O9GA 4HJRA 5KVCA 4US1R 3GEHA 1VE7A 2R2GA 3CEMA 1TKAA 3WNZA 3ZE7A 3E9MA 1TW2A 3PKIA 3AR3A 1TQ6A 4JXXA 3N1UA 3PDCA 1T1GA 4PPNA 5H3LA 1JPVA 3H5WA 1BS9A 5FD8A 3ISTA 5AKXA 1QAOA 1AB6A 4BNDA 4ROSA 1U2TA 1J8YF 4E5PA 1YHYA 2X23A 3BHNA 4BYMA 2JFFA 2DHQA 1NI3A 4FKZA 3FE2A 4I4CA 1GZSA 4KWTA 3U39A 1SXQA 3MUEA 3EIXA 3C45A 4X65B 1T1EA 2NZVG 4NMMA 3QVZA 4RGBA 2J9YB 2UYGA 2VDVE 4C0AC 1B0AA 2X0IA 4BEWA 4EB6A 3CX4A 3FKJA 5ILGA 1WPGA 2QLJA 3SLGA 4MV0A 2RIPA 1KAQA 4LKRA 4NCJA 2AQKA 4DWJA 1QQTA 4O5AA 3O4GA 3E22B 2UYCA 1EIWA 5K2MA 3A9WA 3BFJA 2Y0PA 1M73E 4MW5A 4XPZA 5HKOA 4EDHA 2WWRA 5DGDA 1JILA 3VNAA 1FDIA 1I2DA 3IVRA 2PBEA 1XVLA 4DDUA 5FXMA 4K1OA 3Q7EA 2J7PA 1NAIA 4BLOA 3ZZTA 1NJ5A 3KDPA 5IFLA 4L07A 5EIXA 2CXOA 3FLAA 4LHVA 2B5VA 2PX6A 4BRUA 1NI4B 4M9XA 5EESA 3TIVA 4CIBA 2YYAA 1VSQA 2QLNA 2XMSA 3FJOA 2H5IA 4JA0A 4MWDA 4DIOA 3P1JA 1KRWA 1KY2A 1HM5A 3G82C 5KTOA 1MX1A 1VKRA 3PP8A 4GXQA 2EP8A 4EBBA 1N7HA 3WWEA 4OYHA 1BN7A 2L17A 1PT9A 1VMDA 1JLKA 3I09A 5K8JB 3FKSD 2CVFA 3C8ZA 1CB0A 3HB1A 3RVRA 4Z9IA 1UZNA 2HQ1A 2HNAA 3GYGA 3NMJA 4E51A 2X8AA 4K9QA 5K0TA 1KS9A 4P9NA 3QWFA 4E1VA 2VUUA 2UKDA 2PN1A 1O5OA 3BL8A 3QXGA 2I1VB 3M4BA 4LZPA 4Q15A 4RXTA 4ZVOA 1SOAA 3CWZA 4C08A 4F0JA 4RY9A 1VRCA 1NQVA 4KLRA 4NNOA 5EJMA 1JAIA 5FHQA 3TLGB 3CZMA 3ONWA 3WGNA 4BJ5A 4G41A 4AUEA 3RGWS 2F3PA 3AL0C 3CISA 1E2HA 4EMTA 3OJLA 3DBIA 1UXHA 3EVNA 4BO0A 5A69A 2YJNA 4PX5A 3SC3A 3WNQA 1YQUA 4BO2A 4YBZA 2VH1A 4O2AF 3IL2A 1ZJ4A 4BBAA 3GT7A 3PXEA 4TXNA 1Y4SA 2Z2XA 1KWKA 4ED9A 1YRAA 3GHHA 4X90A 5IY5C 4AY5A 5LXTB 2XQIA 4S0XA 5EHHA 2IEAA 4PAGA 3I5QA 3T41A 5KWIA 3OPNA 4PAOA 1L1QA 3UZUA 1JLSA 3UWKA 1TL7C 3NAQA 1KBOA 3JZAA 2DEUA 1SYQA 2RHOA 3KHSA 1T15A 5BN4B 2FR8C 1VIVA 3BRQA 5FPPA 4FESA 3HKBA 4ENQA 2VK2A 4TKUA 1N6RA 4Z9YA 1K8RA 4XJXA 5CLFA 3FM9A 1NUTA 3OICA 5E6UA 2NX2A 1QAQA 1W76A 3WGUA 1QYRA 4XSGA 4Q7EA 1Q20A 4QWWA 3JCUQ 2RGWA 2W98A 4K7JA 1KMHA 3NEPX 3NB0A 2OXCA 1SBYA 1PV3A 5F2NA 1GZUA 2Q8PA 4YH1A 2PUVA 3ZIDA 1AE1A 4PC2A 1PZMA 2JGLA 5T8KC 4PJLA 1OILA 2ATCA 3AQ4A 4J4BA 5GJWC 3T9DA 2VKQA 2G9QA 2BEVB 1KIFA 4XGIA 3PC7A 1Y9JA 2IXMA 4L3VA 3UG7A 2CW5A 1QP7A 2I1QA 3O2NA 2YWRA 3FWNA 4C14A 3RC3A 1T5IA 1K3FA 3NALA 4JC7A 3DKKA 4MQEB 1O0BA 1QC5A 1UPXA 4ZI7A 5CFRA 4J90A 2TMVP 1ML4A 4PLTA 3NHYA 3CNQS 3EG9B 1QLEC 2OOKA 2CT8A 2QPLA 4Q4JA 4QE3A 3VU8A 3PGKA 2ZU6A 3IBTA 3LGXA 3R3YA 4DLBA 5AVVA 1YTLA 4MITA 5ADWA 3WB2A 3GV0A 2OHFA 2A14A 2GEFA 2W2PA 1UOOA 1U8UA 1WVMA 2AMYA 3AK4A 4LRXA 5LJLA 2V3VA 3A1EA 3PDIA 4HAOA 1SF8A 3TQOA 4OKIA 4UDNA 2ODTX 4UQOA 1F2VA 1X80B 4N4AA 2VDRB 1D0IA 3ODPA 4EDFA 4MK4A 1QF6A 2HUPA 2CEKA 1I2CA 3F6CA 5K45A 1WWKA 2H0AA 2NAPA 4H7DA 2HHJA 5AJZA 4MEJA 5IDQA 3DXJF 4EO9A 4L22A 3B0PA 1OR3A 2OZLA 2Z6UA 1ESDA 1BXKA 2W6JD 4I4NA 4YJKA 3HFRA 3DEKA 3QVGB 3KTFA 5KTSA 4IXWA 5DHAA 1KPHA 1Y8QB 3QEOA 2G80A 2VN8A 3KVNA 1XNGA 4IOLA 3GP5A 4LOHA 2UVQA 5F51A 2I1LA 1YDMA 2GD2A 3ANSA 5AOCA 4A8JC 1FUEA 1CRWG 2IYYA 2H65A 4J1TA 4E21A 1OBFO 3UK1A 2OY0A 4R1OA 1QIKA 1AVTA 2VDNB 1OR8A 3GRYA 3PSHA 4N5HX 1KOLA 4HNAB 1XQ9A 4QYIB 3ROMA 2JLAA 1WW8A 5J2UA 5DIFA 4ILEA 2HDHA 1GUAA 2GUGA 4JLWA 4E88A 5FNVB 5K0CA 3DDCA 1R0LA 3V33A 4EYOA 2NVUA 3GGCA 3SC2B 1B74A 1BROA 1Z73A 1DQNA 5D8DA 3K9WA 2OAGA 4WNIA 4KQKA 2R84A 1UBTS 5MN6A 5CNIA 1JLRA 1N75A 5EFOA 4ANJA 1MJGM 4FBLA 3EH2A 3QWIA 4B9AA 4EAAA 3JQAA 4HR7A 1E8DA 2BMVA 2IYQA 1J0EA 3ZDFA 2HSJA 3EC7A 2CV2A 1QHEA 3CR7A 2WAOA 3U81A 4GSKA 5A03A 2BKVA 3LL4A 4ZV7A 5A0VA 3BSYA 2JFQA 3FROA 2IH2A 4MS2A 4Y2XA 3AWDA 4V24A 2O20A 2IYVA 3X3HA 3Q15C 2ZTVA 1SG9A 4B7UA 2M6SA 2W45A 4O7GA 4YT8A 3KU4A 4Q34A 3AFHA 3LO5A 4ZT3A 2ASVA 1RQ2A 4J0KA 1U65A 4UPDA 1XPOA 1A69A 2JGDB 3ICOA 4OATA 3TBKA 2ZRAA 3Q8MA 2HXYA 2KBEA 2NACA 2HJ9A 4D9MA 5K99A 5M5BA 3TE6A 3WQHA 1GUZA 2VHEA 4B3GA 1PWXA 3TVTA 4F91B 5JCPA 4FOTA 5GOTA 2NU8B 4ETWA 2E87A 3HJUA 1SCQA 4OQQA 2P9BA 4WDRA 3P9QA 1XCJA 3B1VA 1MU0A 2HO5A 2D4HA 2GHTA 2VB6A 2WT4A 4HXFB 1MABB 2D3TA 2EEZA 1F06A 2G1AA 3CPJB 1GPH1 3GX1A 1O96B 4XR9A 2AKEA 1LBEA 3CWCA 4G7ZF 3L8CA 3KCNA 3WZ2A 1C80A 3DXYA 4RTKA 1XMPA 2Q3LA 2M32A 2W4QA 4LG1A 2UUBB 3P2IA 3DYBA 2PH5A 4MVJP 4HN2A 3TPCA 5ABPA 5ALGA 3HVKA 3THWB 4E7PA 5B12A 1GKIA 1TC2A 4F5WA 2C7GA 1CYDA 3LBHA 5KTYA 1LVGA 4NCXA 3OO0A 4FQ8A 4Q4AA 2XKAA 2ZKLA 5LLSA 2JFNA 1K7SN 3HY6A 4M46A 5BT9A 3AG4C 1W44A 3FYHA 4RK4A 1GQFA 5JS2A 5TMPA 2PV7A 2XUIA 1KJIA 3BB3A 3HVJA 3MJ4A 1WMSA 3RWMB 3WHPA 4F4JA 5C18A 3L0YA 1A7AA 4IDDA 2VBFA 1PZHA 1LX6A 4JK3A 1U0GA 3CF0A 4I9UA 3KPWA 2Q2OA 5I01A 4CDAA 3BAFA 4KXVA 2VJMA 1NX6A 5AHOA 3X1ZA 4AF8A 4ZJYA 3BMQB 1X92A 3LHKA 4K9SA 3QTHA 4JKYA 4P4LA 1UBMS 3FGNA 4V3CA 5A4MS 4M3NA 4G09A 5DBOA 5DH9A 3OEED 2VDMB 2PLNA 1C9MA 2V55B 3QVVA 1DBQA 5PGMA 1AK1A 3QEMB 2WEKA 2OD7A 3NBXX 5IKMA 3OF2A 1GDHA 2PS3A 3WGMA 1F2TA 1CFZA 4IIJA 1DXOA 3EPHA 4Q4ZF 3WWDA 1GTG1 1YL6A 2H57A 2QRLA 3FETA 4RA6A 3RREA 4CLHA 1KJQA 1OW6A 5DHSA 3WQSB 5IC4A 1GY8A 1OT3A 2DBYA 3FOPA 2AMFA 1Z5NA 2X6RA 1BU5A 3A1VA 5AKEA 5TRTA 3ZNQA 4DCPA 1VK5A 4GMGA 4JEIA 3IEEA 1L4KA 1Q1BA 2GPJA 1X86B 2GPNA 3QE4A 5LA6B 4IUBS 3COYA 1SUSA 1MMFB 2A3NA 2UDPA 5TMBA 5CDFE 1LUAA 1OWLA 2VF4X 4LJSA 5JYBA 4FE3A 1EVKA 3H7AA 3C6KA 4CDVA 2GPYA 2WKQA 1NPTO 3S8EA 5JAPA 4HTFB 4HTFA 2YMLA 3H97A 4RLHA 4PJMA 1U8YA 1Z4LA 2Q7XA 1USWA 2FUKA 2OEVA 2P41A 4XM2A 3L46A 3OKAA 2BM9A 4NHEA 3BXXA 4F9GA 3FGOA 5DSXA 5FLYA 4BL5A 5BRJA 3KWFA 4RK0A 3HKEB 2ZYDA 5DGCA 2G63A 2VAXA 1I3LA 3S68A 4EB8A 3HJTA 3CZAA 5FOTA 2AKAB 3IKVA 3QTTA 1UUFA 2X76A 5B55A 3GDOA 4F96A 1YF3A 3M3PA 4Q9NA 4D81A 2ZWIA 3H05A 3TLEA 3W2GA 3WR5A 4TL6A 5CLHA 2D0OB 5HIJA 1N8NA 2J08A 3C6BA 3HDYA 1VYIA 4JJZA 4QGGA 3M1YA 1KDRA 4K46A 1Z6TA 3TINA 4DV3B 2ZJ5A 3BMQA 5FTNA 1SKUA 3CLRD 1U6KA 3D8UA 5B58T 1ZK2A 4HDSA 3PWSA 4WLFA 4OXIA 1WU8A 2VUTA 1V3QE 2YR0A 1MO6A 4DMKA 1WLSA 2BKEA 3M3DA 2ZJBA 1PUXA 1HMDA 2R7OA 2VIIA 4CLOB 2QF7A 5JYDA 1MB9A 1T9ZA 4MS4B 5KWSA 1X2BA 1DC5A 4LC1A 5TV2A 1P9NA 3E3AA 2QGNA 3UCXA 3GPCA 4ZVUA 3NEYA 3EGDA 4MUBA 4UUMA 4P6IC 2CKMA 3HN2A 3C3MA 1C0EA 1U9ZA 1AQIA 1KI8A 1LXCA 2D1SA 2DRIA 3BJRA 2JIPA 1MB2A 1NSTA 3D2AA 3ESYA 3IQZA 4KXUA 5AMXA 1QE0A 5KVSA 5DVWA 3GDWA 3PFBA 3F3KA 2CL0X 2YJGA 3HDJA 1X7GA 1E18A 2VJCA 2G25A 1GHTA 3ANNA 1DCMA 4AY2A 3O8OA 4C06A 2CMKA 5KDLA 1ST2A 2O1SA 2AF4C 2VLIA 3QPBA 4JB0A 2VWGA 4NOMA 1GN9A 4WXMA 2FXIA 3KD2A 4ER6A 3P0IA 4ZPJA 4PACA 5CLIA 2HA4A 1QFJA 2YY5A 1EM8B 4JJAA 3GUUA 4D02A 1GT91 1JQJC 1KFCB 2J9ZB 4JBYA 3S55A 4UHCA 1D07A 1QHYA 2DB4A 3UCEA 1FXWA 1Z47A 2JIZD 1LJLA 4DNOA 1HNNA 3R4CA 4AI6A 1JHAA 5KNBA 2B98A 4FYJA 1N6OA 1KNXA 1YFKA 5D5PA 3JS5A 5ESDA 2OCIA 3FWPA 4KMRA 3S7ZA 4ZGGA 1VL8A 2BN4A 1W4LA 1GZ6A 3CE6A 4RSGA 4PFKA 3SQDA 1BHO1 5A0FA 4U7DA 4NTFA 4K7BA 1XNQB 1GFZA 2EQBA 2NU9A 3PJEA 3I62A 2G4CA 4GP7A 1M76A 3ZHZA 4UM5A 4BKRA 1WSBA 1XMSA 1IB0A 3BT7A 3QE3A 5D2CA 2BP7B 3ZNOA 1ZUIA 2QHXA 1SD1A 4QBTA 5FI3A 2EPMX 4QRIA 1K0FA 1TJ5A 4Z7OB 1GPBA 1JU3A 3BDIA 1QMPA 3PQFA 2RCNA 1TF2A 2QMYA 1CY6A 3I9FA 4I4TB 4YDQA 2EPNA 1PZGA 3E1KA 1BCRA 1LLCA 2I6XA 4GPIB 3B6KA 1YC5A 3GLRA 1HYQA 4YK7A 1ZGHA 4CF6A 3L01A 3PX3A 4MKFA 4LFAB 5FP0A 2P4SA 3ES9A 5D7NA 2CHUA 2OOSA 4EY7A 3DEIA 4J0FA 4LY6A 3DL2A 2PMCA 5DM70 4QASA 3IOMA 5IBQA 1A9TA 5LM3A 3N28A 4RV5A 1G8FA 3H6GA 5ALLA 3D1VA 5DBIA 2DHDA 5F5HA 3KXIA 3OESA 2HH9A 2XUDA 1AKEA 3HYRA 4MWTA 5CA0F 1B1AA 3G8BA 3BYZA 1E6KA 1K2WA 3R6GA 5KO2A 1JVNA 4BLPA 2J09A 2WTBA 1M2VB 2JD2A 2D54A 3EWAA 1E9EA 4HNAA 1YO6A 2YWGA 3JAKA 2JVJA 1KOGA 2R65A 1MQSA 4D4GA 4EF6A 3QU7A 5AVUA 4PRYA 3I5AA 5MDHA 3HXLA 4KX5A 2QNRA 1G6HA 3AQIA 4P08A 3DM9B 3UB2A 3FFAA 4JI6B 2X51A 3WIEA 2BFAA 2HWYA 2BCEA 4JJEA 3JCZA 4L4SA 1V39A 1PR3A 4JQOA 4TRNA 2VHVA 4I1OA 5U4XA 3E9EA 1E1CB 3R3XA 4NENA 4D99A 2QBYA 2QX7A 3RGGA 3RS9A 2VHYA 3O3OB 5B1DA 1NULA 3ZZ1A 2UUHA 2JAWA 1CK4A 1CR0A 1U3DA 3I1YA 2AGVA 3QI7A 1J0AA 4YMHA 3OFJA 2O8EB 1N5LA 1EPUA 1IDN1 3BGIA 1PWEA 3EXG2 3I45A 1Z74A 5EJFA 5FBHA 5IM5A 4L4ZA 3WOVA 1T5TA 4DHEA 2OKGA 4G9BA 2H06A 2Z5LA 2PZEA 5JEDA 3DE6X 4JELA 2RBEA 3PUVA 4J2TA 3R7NA 4DMHA 2C5HA 5EOVA 3G2OA 2GCGA 3PDIB 4R71A 2ZM5A 5ERXA 3WMXA 1YYXA 3CZ4A 4LJKA 1PDWA 4G97A 5CVUA 4I5GA 3GLSA 2EKBA 2OCDA 5AI4A 1GU7A 1TEXA 1ZWKA 3QXSA 3DGEC 3RIGA 2VNIA 1RWBA 1R5ID 1J25A 1RWMA 2AOWA 1P19A 2MT9A 2JFVA 2PGNA 4NFLA 4IFBA 2QTCA 2OMKA 3WI7A 4DPKA 1KA9H 1Y3DE 2XV1A 1G16A 3KTDA 4JLNA 4YRNA 4U7HA 4D5GA 1OTXA 1NNUA 2UXDB 3QFRA 3GT4A 1KZGB 1NSYA 4ZO9A 4BBJA 1KERA 2P2LA 4BB6A 1TIKA 3F78A 3FMOB 3LWZA 3SIPA 3RC1A 2F1OA 2NLOA 3ROTA 5HRCA 1SRQA 2I54A 1TLFA 2F1IA 2EW2A 2ODPA 4JP1A 1UPFA 2HRQA 4WN9B 3KR9A 3ET5A 4UHDA 2KJQA 4RA9B 2AUTA 5AJYA 5AK0A 4CM9D 7GPBA 3WK6A 1QCZA 2ZULA 2YX1A 3ANXA 2CWWA 2X9NA 3AU9A 2DSNA 3IDOA 2CMGA 3ORSA 3QMWA 4TKUB 5HQTA 1SHKA 3VVMA 5ALUA 2ZSEA 3DPUA