5L3QA

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
265
Chain Sequence
NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 90
structure length 265
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3qA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qA02
2W2VA 3V4FA 2ODEA 2WKPA 3K0EA 2REXB 1OIWA 2J0UB 3P32A 1G5RA 3EASA 4D82A 4BLQA 2RGXA 5B2ZA 4KAXA 4YXWA 5HPYB 3QKRA 4D81A 5IT5A 4KYIB 3IBGA 4GOXA 5KNBA 1COWA 3DKVA 2J46A 1JB1A 1NIJA 2QTHA 3P20A 3L0SA 4R2IA 1XCGB 4XWAA 4OHXA 1KI9A 1TX4B 3LVRE 1OFTA 1ONBA 3DPUA 2D7CA 5FOSA 3QKSA 1YJ5A 4IJMA 3RSLA 4US2R 3HU2A 3OFNA 4KSCA 3B7GA 3D3QA 4O25A 1NJGA 3A1TA 4GBMA 1PLJA 1DTSA 4DLRA 2WOJA 4I1UA 3X2SA 3VKGA 2FFAA 1E2IA 4Q48A 4TMXA 1NIPA 3TBKA 4ILEA 4BASA 1SKYB 1E1RD 3K0SA 2XGJA 3LAWA 1UBGA 5JECA 2ATXA 3EPLA 4IRUB 1ZM2A 1RJ9A 3K0FB 4LY6A 2PZFA 2FMXA 4BLOA 2O8CA 2IX3A 3NBZC 3VKHA 3H0KA 4OI4A 4H9GA 2AFHE 4MDFA 1AK2A 3IILA 2O0HA 4PZYA 2RGGA 2GVDC 4HUQA 5L3VA 3QF4A 2AXPA 2D2FA 3KX2A 5FUWA 1WB9A 2V55B 4LHWA 2ZEJA 1JPNA 1M7GA 4JLKA 1UKZA 4YC7A 1NVXQ 1Z2CA 4TLCA 1AS2A 3T12A 2G77B 3B60A 2VHCA 1XF9A 4C0BA 2ZRBA 1FFHA 1W4CA 4Q00A 4TMZA 2ZVQX 3A8TA 3QJYA 4DEYA 2JATA 1J99A 1P2SA 5FTKA 2B7CA 1EWQA 1S9DA 1W4AA 5TARA 5BN5A 4PAQA 2HLDD 3UATA 2BMDA 2J0UA 4EFLA 2QG6A 4AKGA 1TF7A 2RGCA 1G7SA 4V0LA 3SE0A 2R2AA 1R7RA 4F93B 4J0QA 4HUTA 4F4CA 4BECA 4CVNA 2WAXA 2BDTA 2V7QD 3E70C 2UZIR 2Q3HA 2VA8A 4P3YA 4M9ZA 5EP4A 5BQ5A 4BEBA 4DXAA 3GJ3A 3SI7A 3SFVA 4AKEA 1QZXA 3VQTA 3FHOA 1S3GA 2J0VA 3X1WA 1FQJA 2ZRAA 2CDNA 3M1IA 4GZMA 3VU9A 3FYHA 2X77A 5FL7A 1Y63A 4YMVA 4URZR 4URYR 3LBNA 5KPDA 1UEIA 1OHHA 4BUJA 4ESVA 1KJZA 2JASA 5IDVA 4FMCB 1IN7A 1E9CA 1UBFA 4JKYA 4PHHA 1W47A 3RC8A 4LPSA 1FP7A 1NMZA 3DO6A 2D74A 1ZAKA 2PX3A 5UKDA 3W9YA 3AV0B 3K0FA 4GP7A 1KMHB 3H86A 1XD9A 1U90A 4WZBE 1ZUIA 4G3XA 1FPMA 3P26A 4P31A 5FI1B 4OKSA 2IT1A 2F9MA 3U44B 2EWWA 2R6AA 1RYHA 3AKCA 4UJ5A 3GLGE 2IWHA 2O8EA 4M9QA 3CF6R 1SZPA 1VG8A 1GFIA 3PENA 2FPLA 1YHNA 4QNRA 2OXRA 4A0RA 3VNUA 4IW3B 1SHKA 2HLDA 1W2GA 4G5GA 5GJBA 1A2KC 5DNYB 2A5JA 3OIYA 1JXMA 5C2JB 2YNMA 3LRPA 1HT2E 2ATVA 2C98A 4QJ5A 4MGYR 5JMTA 3EZ7A 5FR2A 1E2JA 3VAAA 4DLYA 3AH8A 2V7QA 3CWZA 1PLLA 1RRGA 5B64A 3B6EA 1Z22A 1N5KA 2ZU6A 3G0HA 2N42A 3BH7A 5DLQC 3C5CA 4PAOA 3CPEA 1W1WA 1NN3A 1WDTA 4KV9A 3W8NA 3CLVA 4NCJA 4OHZA 5CB8A 4TTQA 4A92A 2F1JA 3WNCA 4MRRA 3KQNA 3QXXA 3LQRA 3IIMA 1JAHA 2ZYWX 5EZ5A 1ZM7A 3U7EB 4BFSA 5J47A 4QXAA 1NN0A 4JVLA 4WXRA 2XTZA 1DAMA 4HAXA 4M9SA 5KDLA 5HE9A 3QKUA 1OB5A 5JZVA 4KYUA 1FX0B 1N3BA 5CITA 3B82A 3EARA 4A0FA 1ZNXA 1XWIA 2JJ8A 3CPHA 4KLNA 4O0MA 3U3JA 2C8VA 3L0OA 4GL2A 1LVGA 4XIGS 1KI4A 2RH5A 2C9CA 3K9LA 2IEYA 4KBFA 3GFOA 3LX8A 4PX9A 1XP8A 1E99A 1HTWA 1ZC4A 1KMHA 3KQKA 3EG5A 5J40A 1QHYA 4NPHA 2ZITA 3JVVA 4FWIB 1RKBA 2WPDD 5AUPB 5CLQA 2DR3A 5FOTA 4LI0A 2IA5A 2OBLA 4ZIRB 3U44A 1R6BX 3BFKA 2BMFA 2WZQA 4TLDA 3AGPA 1FMLA 4IDPA 2YWGA 4HSEA 2HT1A 2XOKD 4YMTA 2W2XA 3Q9LA 1N2CE 3I73A 4QBIA 4OI2A 2LWIA 5TB5A 1RVDA 3DMNA 3IDQA 1CLUA 3NG1A 4F4JA 2FWRA 2DWOA 1G9XA 3L82B 2JLVA 5HE8A 1ZMXA 1MO5A 2Q9AA 3IPYA 5H1YA 1NVWQ 4Q1EA 1ZCAA 2ZE7A 2QAGB 1KY2A 4LPKA 4ZCMA 1GDDA 4DUGD 3I61A 1TU4A 5EQTA 2ZU0C 5JWRA 3OEHD 1H8HD 1EFTA 2QAJA 2OZEA 2ZRFA 4GZLA 2R6FA 2H8KA 2KWIA 4JLPA 1W5SA 4HDOB 3U4QB 2RGNA 3B85A 1G17A 1HQYE 4L4UA 1CS4C 2R65A 4YONB 4TL9A 1D2NA 2JCSA 1J7KA 2Q3FA 5FBLB 4A4DA 4QM7A 2ZUDA 4Q1DA 1TTTA 2BEKA 1BKDR 3O8DA 1FX0A 5DYIA 2FH5B 3TW8B 4KVAA 1ZM4A 3GLFA 4M21A 3RC3A 2HEIA 2Q6TA 1C1YA 4IOMA 1P7CA 3OIVA 1W36C 2QE7D 3TJZA 3FHCB 3EC1A 1E2FA 4KITB 1GOTA 4E07A 4V0NA 1VIYA 4JLJA 2CCKA 4D4LA 1E2GA 4O3MA 4IVQA 5EXTA 3IPXA 4TMTA 2GJAA 5JRJA 4JLBA 3WY9A 3IBYA 2PZGA 3Q7PA 4RD1A 5FUVA 421PA 1E9BA 2F6RA 3G82C 3AB3A 1E98A 1W0KD 3IIJA 4C0SA 3ZIAD 3A1VA 1IN6A 1XPRA 4LC0A 5E7JA 1UDWA 2GVZC 4HLDA 3T1TA 1LB1B 4CEIA 1XPUA 1OF1A 1XRJA 1GITA 3W8RA 2DWQA 1X6VA 5CB6A 1W48A 4UJ3A 2BCJQ 1X86B 2HCBA 2QAGC 3C41J 1E9RA 3MRSA 3RRYA 2FFHA 1D5CA 1FNNA 3SJBA 5B57C 2VP2A 1U9IC 3A4LA 4RD3A 3NVAA 1XTJA 4V03A 3BXZA 3HU3A 2EU8A 2MSDB 1H8HA 3OEHA 3ZS9A 5JEDA 3GPLA 1JQJC 3A37A 2QAGA 3KZ1E 2ZJYA 2JDID 5JS7A 2A5YB 2CHGA 4LRWA 1R5OA 1T3HA 3GFPA 5JSZA 1KHTA 1TL7C 3U4QA 1GKUB 3RWOA 3DEFA 1DG3A 1VG0B 1JBKA 1P4SA 1XXHE 3PITA 1QF9A 1ANKA 2ZREA 3KB2A 1GG2A 4JS0A 4RY2A 3FDIA 4DCTA 1VTKA 2QE7A 1G6OA 1X1RA 2RCNA 2G1KA 5C46F 5BN3A 1DAFA 4IEEA 4A15A 3F5FA 2Z0MA 3U7FB 1NKSA 1Y3AA 4NP6A 1KYIA 5EXXA 2IEZA 3SFZA 4LHYA 2CBZA 3A1SA 4JLOA 1U8ZA 2CL0X 3QIAA 3WYGA 3AF3A 3PJRA 3O8CA 1OXSC 1KJWA 3IHLA 2IYTA 3EA5A 2RKOA 1WA5A 4LV8B 1S8FA 2CCJA 4POAA 2ZSAA 4M1OA 3ZIAA 3DDCA 3L8ZA 4AYWA 3VMFA 1R8QA 4C0KA 2F1IA 2EWVA 1P61B 1E4VA 3CUEF 3KJEA 5K8UA 4GDFA 4GI7A 5DYGA 1SKQA 5GVSA 2ORWA 4LZZA 5SZIA 2QMUA 4PXAA 2NIPA 1Z47A 2NO6A 1G8FA 3PUZA 4QGHA 1A1VA 1HY3A 3OHMA 5ANRB 3SN6A 4QKQA 3FMOB 4XH9B 2QENA 4B35A 4TL6A 3AVPA 1GP2A 4EPWA 3U3KA 2QSYA 4FI3C 3T5DA 5IK2D 1CKEA 2GK7A 4P4UA 3LDAA 2I3BA 4C7OB 2BWJA 2ZRDA 2ODBA 1J8MF 1EFRA 1DADA 1UBCA 2PH1A 1LNZA 4Q9JA 3GJ6A 1Z29A 1K5GA 1E2DA 3LVQE 4Y0AA 5FPSA 4F7WA 4Q01A 3EXAA 4Y0VA 3QG1A 5EUQB 2ZRMA 2C9YA 4YQFA 4URWR 4LV6A 4URXR 2W6IA 5FPKA 3GJ7A 1N0VC 1KO8A 3NIBA 4PHTA 4TMWA 3AP3A 4Q4HB 4KLZA 3KUDA 4JVNA 5FOVA 3THXB 1NLFA 4B3GA 3CR7A 1M7HA 1FQKA 5JJKA 4NBSA 5D3QA 4C2TA 1N6OA 5JLJA 4BRWA 4DWJA 3C7KA 5EP1A 4MYHA 2AKAB 1G8YA 5FL3A 3RNLA 4DDWA 4PSAA 3K0CA 3PEYA 4YMWA 2Q9CA 4BZQA 4D6PA 2G1JA 3CX6A 1G4UR 4MUAA 3QXJA 3ZVRA 4QM6A 2VP6A 2P6RA 3T61A 2DFTA 1CR2A 1XMIA 4E03A 3D31A 3GJXC 1KY3A 2WMNB 3Q5EA 2D62A 3CO5A 1N6HA 4NMMA 4QOSA 1PUJA 2F3TA 1JPJA 4DBLC 2WSSD 1JEEA 4D0GA 2GBLA 2BBWA 1DO2A 4FMCF 2AD5A 2B8WA 1CRPA 1G19A 4F38A 3KQUA 2Z6VA 2NGRA 3HYRA 4HATA 2ZI9A 5F3WB 4OQMA 5JFGA 1XEFA 3TH5A 1PLKA 2DBYA 2XSZD 1XB2A 4EPYA 4ERNA 3AVXA 2CNWA 2ODNA 4PPFA 1AIPA 1NVUQ 4QRHA 4XWOA 4HB0A 8OHMA 1CR4A 2ZRNA 4DLUA 4AG6A 5LD2C 1VYVA 2A30A 5EXSA 2Z83A 5GJWC 4OQLA 2I4IA 4JBWA 5J5CA 4LHXA 2ZJ2A 5AJWA 2O8DB 3TSWA 3N2IA 2IXGA 3LQQA 3SYKA 4C7OA 2GCNA 1OIXA 3MCAA 2C99A 4MGIR 1JXOA 1HEIA 1W4BA 1U81A 1E0SA 4FWTA 1A7JA 4ZDIA 1VIAA 3PQCA 3C16C 2VF7A 3WRXC 3RRZA 2VF8A 4CDGA 4NTZA 2H17A 4ACBA 4LUCA 4JLNA 1NVVR 3FMPB 3LH5A 4ZKEA 3DOEA 4KFUA 3VKWA 2FSHA 3PV0A 2L0XA 3H4MA 4PFSA 4KO8A 2ZR9A 1OKKD 2FZ4A 4G5SA 3QG5A 4Q4HA 4MYCA 2WJYA 2IBMA 3RWMB 3HWSA 3THXA 2WJIA 1O87A 3FFBA 1TUIA 1DAKA 3JZAA 1GNPA 1VDZA 1EG7A 4RD6A 1N0WA 3SQXA 3J81k 4CEHB 1FUKA 1ZIPA 3MMPA 1S96A 3R9IA 3K9GA 2IK8A 3CNNA 5SZHB 2IYXA 4PZZA 1SVOA 1GTVA 2WSSA 4ASUD 1FW6A 2V8OA 1SVWA 4LJ4A 4IOLA 1X8JA 1ZP6A 1OE0A 4MKGA 4BGDA 1NLZA 1OLOA 4LK2A 3B1ZA 2Z4RA 2RGDA 3UPUA 2H18A 3EPKA 1QHXA 1T0JB 3WHLA 2D4HA 4TYYA 2E9SA 1LF5A 3NBFA 4B47A 4G5OA 4D26A 1LF0A 4OHWA 5HCNA 4DRZA 2BM0A 2OAQ1 1CJVC 2WOOA 4BLTA 3L0PA 1HE8B 1EK0A 2BBSA 4JT4A 4C2UA 2O8DA 4DLVA 4I1SA 1RW4A 5HZKA 3ZVLA 2GWHA 1T9HA 1Z3IX 5HZHA 1OPXA 1QHHA 2JIZD 2IYVA 4U02A 4JBYA 4I81A 3WHKA 3GQBA 5E7IA 2YYZA 4CIDA 2BKEA 3H2YA 2P67A 1R2QA 3I62A 4RKEA 1XTKA 2K5UA 1IY0A 3CM0A 5TDHA 3THOA 1HV8A 4Q18A 4OI1A 4ZDWA 3LXXA 3RANA 1DAEA 1T5IA 2ZYTX 5H8WA 1G7CA 4HAYA 2EFEB 3TRFA 3LXRA 3MD0A 1JR3E 2C77A 3L43A 4ZKDA 1QVAA 1XX6A 5A5GA 5EE3A 1IXSB 3REFA 521PA 5EP2A 1LTQA 3NEYA 2DWPA 4EIWA 1Z63A 4GOKA 4CEHA 2QP3A 1WGWA 4RCYA 1E79A 4TN1A 4UNRA 5KOYA 3KXIA 2YOGA 5KDDA 2BCGY 1JAIA 4C0JA 5TMPA 5DI3B 1UJ2A 4X8OA 4P4SB 5C1BA 1E32A 3VX3A 2IC5A 2FE4A 4KSBA 2A5FA 2PBRA 3P4XA 4G01B 4DIEA 5L3RA 1P75A 2GCOB 1OV4A 4A6PA 2OCYC 4BFYA 5F98A 1IQPA 1D2MA 4TLBA 3SS8A 4TT3A 2RGEA 3LV8A 4B48A 1EESA 1SKYE 5EJEA 3HPRA 4E09A 4BFVA 3L8YA 1G21E 2SHKA 3T1QA 3VR4A 1JEDA 1F60A 2ZJOA 5FOXA 1XPOA 3SBEA 4DLTA 3ICEA 1SVKA 1TPZA 3QENA 1Z6AA 1ZC3A 1GVNB 2CK3A 3GJ8A 2DPXA 1F5NA 4EFNA 2IYYA 4Q7MB 5DN6A 2J1LA 1BMFD 1W5TA 3U3OA 3VR2A 1CU1A 1YR8A 4TLEA 5BWMA 2ZS7A 4A2PA 1P9NA 2OEPA 2ZSDA 121PA 4LJAA 3FPAA 3DL0A 821PA 4IDHA 4JLAA 3TR0A 3UWKA 3K70D 3SC3A 3UKDA 1U0LA 4WW0A 3GEIA 2ORIA 3SDZA 4BLRA 4QJ3A 3VU9B 3WBJA 4W5HA 1EFCA 5GVRA 3ZZ0A 1II9A 3CR8A 2CL7X 4I99A 3UG7A 2XEXA 3L0IB 4URUR 4V0MA 1PV4A 4DKXA 2Q0HA 2WICA 1N6PA 3R20A 3ZQ6A 3Q85A 2QMHA 2QI9C 4W5JA 1QBKC 3DHWC 1Z6YA 2H16A 1VHLA 2P3SA 5DI3A 1B23P 4P4SA 1XMJA 1SXJD 2BMEA 3X1ZA 2ZI4A 4ZDKA 1Z0IA 4PSVA 3JZMA 4AKIA 3LX5A 1YU9A 4MKHA 2GCOA 2XZLA 3JVUA 3BB1A 4QNMA 5A4JA 3L2OB 4Q4AB 1JECA 4DLSA 4GFDA 1HE1C 4UNSA 3U61B 4JL5A 3AF4A 2O8EB 4U7DA 1YZLA 4MQBA 3VX4A 2QT1A 3M6AA 1ZM9A 4TYWA 2DFLA 2OG2A 3RRMA 1OIVA 2X2FA 1GRRA 5G3ZA 1XMVA 3KXKA 1OSNA 3CRVA 2QTFA 4JJZA 3MWJA 1VYUA 1SVLA 4KJZA 3ZVMA 1ZW6A 1PJRA 2LKDA 4BFTA 1RFLA 1QVRA 2R6CA 4YDSA 4D25A 5AWFC 2BKUA 3TMKA 4C0QC 4DCVA 3MLEA 1M74A 4B3BA 1Z06A 3C14C 3PXGA 1KKMA 2FF7A 4L16A 1NVVQ 3TR5A 5J4VA 1Q3HA 3E1SA 3I1FA 2QT0A 2VHJA 1IJEA 2P2LA 1X1SA 1CEEA 1S2MA 4PC1A 3KKQA 1E9FA 4TMVA 4JJKA 2ZSEA 4Z1MD 1DO0A 2V54A 5EP3A 4NU0A 3I72A 2H7VA 1OJLA 1Z0JA 4NONA 2WJGA 3AVYA 1XEWX 4ESHA 4GNKA 5C4MA 1UKEA 5K8TA 3V9PA 1T91A 2ZI3A 4TZ6A 4FCWA 1E1RA 1WF3A 1SXJA 2IF0A 3EIHA 4JIMA 1KIMA 1GKIA 4ZCIA 4DJTA 4RFSB 2GESA 1KZ7B 4MITA 4DCUA 2C96A 4DHEA 2WMOB 3CONA 1S3SA 3HJNA 4CGZA 4JSYA 3R7WB 3HPQA 3OZXA 3W6PA 5EE9A 4Q4AA 2BIFA 2CVHA 3NC0C 1QHGA 1KTVA 3QBVA 4NE2A 3Q72A 2IS4A 1P3JA 2PCLA 4RKFA 4RFVA 5KDOA 3NXSA 2XZPA 4TL7A 2QBYB 4XWKA 3FTQA 4OJQA 2DFKB 1YRBA 4OK5A 5KSPA 2ZE6A 5KSZA 4V02A 5DI9A 1UEJA 2GTPA 2XJ9A 2PT5A 2QTVB 3CH4B 3EPHA 4LWZA 2BBOA 2GAOA 3H84A 2B7BA 1L4YA 3LY5A 4Q19A 3ND8A 4Z1MA 1WE2A 1KMQA 2ANCA 2IXFA 5EZ6B 2ZRKA 2NPFA 3IO3A 3GJ5A 4IVPA 4Q9HA 1MO3A 4WZAE 4WOPA 4JLVA 4C4PA 1II8B 4H1UA 4HLQB 2FGKA 4JYCA 1G64A 4MRVA 2AXNA 2XNSA 4MYTA 4Q4LA 1P9WA 4AC9A 4DDUA 2CEAA 2OSBA 2V6JA 3PUYA 4M1KA 3SR0A 6Q21A 2IYZA 3BB3A 3ZLJA 2OUKA 4AWXA 2QSZA 2X2EA 3QF7A 3GLFB 3AF0A 3RLFA 1G8HA 3BIFA 1AGRA 3N5CA 4BLSA 3MG9A 4RFSA 2JLWA 1KK0A 3RS4A 3VR6A 4QGAA 5A0FA 2GNOA 2Q3MA 3N2EA 5CIWA 3MWKA 4B2LA 4BWYA 1E2QA 3SJZA 5KNDA 2GCPA 2PZEA 2QUZA 5JWOA 1OXTA 2LKCA 3TSOA 1DOAA 4QHSA 3R7WA 3BC1A 4LYHA 2CCGA 5CK4A 4BFWA 2WIBA 4KI0A 2QGZA 2CLDX 4XOIA 3A58B 3AP2A 3OAAD 3WYFA 2W6JD 5B58C 2OFWA 1KSFX 2HDNB 2FFBA 2NOAA 2KBEA 1K5DA 3KJHA 3AEZA 4HEJA 3EIEA 2P5SA 4PQYA 4TYNA 1Q1BA 2IYUA 2J41A 3CZQA 3WMFA 2QBYA 2KE5A 1NBME 5DHFA 1QHNA 3LFUA 1XEXA 4TWZA 1T5LA 3GD7A 4CEIB 1GZSA 2PMKA 1G5TA 1DAHA 1AA9A 1Q1QA 4K46A 3LNCA 1FNMA 2HT6A 3QXHA 4WA7A 2KSQA 5BYKA 4NYJR 4A9AA 4JSTA 4Q9LA 3BJIC 3K09A 3QPUA 3AF1A 1W36D 4WVFA 3LW7A 2RGNC 1IONA 2HCJB 1I4LD 3QNUA 4BQSA 4D4KA 4B3XA 2OILA 2P65A 3BOSA 2FNAA 5JHHB 1ZNYA 4HB2A 3SNHA 2GXQA 4X8LA 5JSZB 4ARZB 4TLAA 3VHLB 1II8A 5D3MB 4LJ7A 3BFVA 2IF2A 3F0TA 1C4OA 4LV5B 1RE0A 2OFXA 3RAPR 1F2TA 1Z6GA 2V1XA 3I8SA 1I4TD 4IXMA 4MGZR 4E22A 4QBFA 4KU4A 1AS3A 2R6DA 2YHSA 4A82A 4PTLA 1GSIA 3GJ4A 3AQ4A 2FX3A 2VYFA 4FN5A 4DDTA 1JALA 2NMVA 1S1MA 4B6FA 5KYKA 2QPOA 4JT2A 2OM2A 5JCZA 3GLIB 4TSFD 4MYUA 1YZQA 4Q9KA 4KFTA 2WPDA 3HR7A 4HDQB 1OT3A 1ZD8A 2WWYA 2WJHA 3CNOA 2IS6A 3I5YA 3PFIA 1Z08A 1DEKA 2PLRA 3RS3A 1UADA 2CLSA 2XNDD 4TQUS 2YKGA 4S2EA 3FKSD 1UFQA 3BGWA 2ERYA 5KO2A 2XOKA 1ZM3A 2ZR7A 3PUVA 4MUBA 3ZVNA 1D6JA 5TVKA 2AFIE 2AX4A 3NH6A 4PHFA 2VQSA 1OXXK 3F8TA 4HAUA 1T3LA 4UQOA 4MKFA 5EE1A 4Q02A 4QHTA 1VCNA 1DBSA 2BC9A 5SZJA 3TAHA 4DDVA 1EFHA 1FUUA 1HUQA 2FV8A 3OIWA 1KI8A 1YKSA 4JMPA 5F9FA 2OHFA 2GJSA 1Z0KA 4CYMA 2ZJZA 2ZUCA 2V4ZA 4HB4A 3FVQA 1RC8A 4DUGA 4IVRA 3A6PC 3PG5A 1S4QA 1Q1EA 4TYQA 3DM5A 2AK3A 1OH8A 1WXQA 5E7MA 4PC7A 1NG9A 1Q21A 3PIRA 1N5JA 3GMTA 1GM5A 2J5XA 1Z07A 1JNYA 1VPLA 2V6IA 1G3IA 4ARZA 1M6NA 1Z2AA 2ORVA 5D3MA 1CIPA 4N3NA 2OXCA 4HI0E 2YC2C 4DCNA 2O8BB 2KBFA 2XTMA 1IY2A 1KOFA 1CTQA 2ERXA 4HLUA 1VKJA 4AG5A 2AD1A 2D06A 3BRWD 1W2HA 3CNLA 1BO6A 3SYLA 1KK3A 1JR6A 3IKJA 1WBBA 1XMSA 1G5PA 2KI5A 2FZLA 2EW1A 2VHUA 4Q1AA 3GLIA 5GJCA 3TKLA 3GEEA 1BH2A 3ADBA 5FH9A 1PUIA 3FKSA 4NYIR 2QY9A 4OJKA 4OK3A 1WBDA 5L8VA 2F43B 1W0KA 3UXMA 1G4AE 1HYQA 4LDJA 4W5WA 4MRNA 4EJSA 1M8PA 1UDXA 3D6TB 4EPTA 2ZS8A 2REOA 3RS2A 4LJ6A 2A5DA 2GDJA 4B34A 3FE2A 4DLXA 1AQUA 1A5TA 1X3SA 2VP5A 2WSMA 4YMUA 4N1AA 3DZDA 3LLUA 4N0DA 4PO9A 3RYTC 2C04A 1N6LA 4QGGA 2QNRA 3NBXX 3TVTA 4CF7A 2ODWA 3PCRB 3T15A 4PPQA 1AM4D 4XJXA 2VTKA 1QDEA 3UMSA 2IUTA 2XAUA 2GKSA 3X1YA 3LA6A 2ZIAA 1E4YA 4DSUA 2F55A 1YRAA 1KDOA 4G5RA 4US0R 3SBDA 1BYIA 5BXQC 4RZUA 1O3YA 1S9HA 2IUSA 3Q8XB 4B2PA 3CX8A 5JS8A 4W9MC 2JDIA 2PJRA 2CL6X 4HAWA 4M53A 2R62A 4Q47A 3DM9B 1G3MA 1GRNA 2VEDA 1NG1A 4NYMR 4IDNA 1CR0A 1HA3A 3DZ8A 4Q7KA 1P60A 1NSFA 1T8TA 3I3SR 1Z0AA 3TLXA 1EGAA 2AN9A 5EXPA 2LCFA 2JLYA 1YR6A 2W83A 4B3CA 1A4RA 2QP9X 4B44A 3FOZA 4RSGA 3IEUA 3NTUA 4XD7D 1TF2A 1ZJ6A 2O8BA 2VP4A 1Z6XA 3K0CC 5KNCA 2YWHA 2ZRPA 4QL3A 2G88A 2JJ2D 4TYPA 2DB3A 2GILA 4U00A 4BE7B 2DYKA 3QEJA 1E9EA 1E1QD 4CEJB 1CF4A 1Q3TA 4AK9A 2J0QA 4GMXA 3A4MA 2O52A 1OFHA 3FGNA 3F3YA 3AVVA 1G20E 1U0JA 3T1OA 1TMKA 2BJVA 2W2TA 2GEDA 5CM9C 1JI0A 1TEXA 3BK7A 2NO7A 5LB2A 4ZCLA 3THYB 4B43A 2WBLC 3IEVA 4PAMA 2R8RA 4C0LA 4JKIA 2GBLC 1ZD9A 1E96A 1A82A 2F43A 1TQ6A 2ZPTX 3BB4A 1OXVA 4LSGA 1X8LA 3ONWA 1LY1A 3QSYA 4IDOA 3GLHB 2ZI7A 4TMKA 2IYSA 3SOPA 2A2ZA 1DAIA 2H5EA 5EE0A 1JJ7A 1CJMA 4I4LA 2ZAOA 3QY0A 4P32A 5HCIA 2R6GA 2ZJ8A 4KXFB 5IK2A 1LS6A 2GJ8A 4L9WA 2CHVA 2IYLD 2IWRA 2GF0A 5AUNB 4EFMA 3DKPA 2OV2A 3SZRA 3ZD6A 2VPPA 2EQBA 1E3MA 3VTKA 2YWEA 4LJYA 4YMSA 1OH5A 3TGPA 1QHHB 3ASYA 3IHWA 4TTPA 1G7TA 3RS7A 3WRYC 2EFGA 3W3ZB 5J4LA 4IXNA 5G3YA 2BM1A 3EZ2A 5DIFA 2A5GA 1XJCA 1E6CA 3O47A 2HV8A 3NHAA 4Q1CA 4XTCS 3SHWA 2FSGA 1E0KA 1XFAA 4XSGA 3BS4A 4RCZA 5E3HA 1D8TA 3ADKA 4BFUA 2ZUBA 4MKIA 4IKEA 2YWFA 2FEOA 1XXHA 3PUWA 1KO7A 4I1VA 4NL4H 4LBYA 4CEJA 3WXMA 3CIOA 3E5HA 2J3EA 2ZRCA 1E2MA 2YJTD 3A4NA 1G3QA 1LV7A 4LJ9A 4LYJA 4PC3A 2W00A 1SGWA 4M0LA 1N6KA 3RVBA 5FOWA 3BBPA 4X8HA 3AVOA 3THYA 2H57A 2IHYA 1R0YA 4D2IA 5KU1A 3QUSA 1IXZA 1G3RA 5CLLA 1SQ5A 1Z6TA 4DCSA 3BH0A 4CT5A 1IXRC 4WXPA 1GAJA 2GZDA 1IJFA 5EUMA 3Q5DA 3GLHA 3R8CA 4OQXA 2ZJBA 3KFVA 4LCBA 1YR7A 2GEVA 4V0ME 3QPWA 2XSZA 1DS6A 2V3CC 3NKVA 1KSGA 4FMDB 2R44A 2OCBA 1EFUA 3UANA 5CYPA 1OXUA 1Z5ZA 2YOHA 2I1VB 3OEED 4MGKR 5FBWB 4Z51A 2X19A 1MO4A 2W0SA 1B0UA 3TK1A 3GEHA 4IHQA 2O8FB 1NSTA 3UIEA 1R0ZA 2D3WA 3C15C 4TQ9A 3RRNA 3MFYA 4AIIA 2FDCA 2QPAA 2ZI6A 2WV9A 1IOZA 3KTAB 1Q44A 1T4GA 1AN0A 4DB4A 5BW8A 1U94A 2BEJA 2HJVA 3GCGA 2PLFA 4E5UA 2PT7A 4AD8A 2ECKA 1DAGA 3ZDQA 4B3FX 3UMRA 2N46A 1K8RA 3RSOA 2ZJ5A 1R10A 5C4GB 1XJQA 5JJIA 1IAQA 4A2QA 4QHYA 3LBIA 2OBMA 1GUAA 221PA 1OKKA 4OYHA 4B71A 2HF8A 1ZINA 2ZSBA 4PR0A 3WNBA 1MKYA 2GZAA 4B75A 4KFRA 4RD2A 2WM9B 3RS5A 3AUYA 2WWIA 1N25A 1NRJB 4XSHA 3T5GA 1QG2A 1L8QA 2B8TA 3TIFA 5IF9A 3S1AB 4AKHA 3K1JA 5FR1A 3THWB 1BOFA 2ZQ5A 1CP2A 2BBTA 2OE2A 3EAQA 2ZRLA 5FBVB 1R4AA 1CXZA 4UKDA 5CYOA 2VSOA 4DZZA 4RZ2A 4ASUA 1H65A 2IYWA 2F3RA 5JWHA 4YXWD 4WBSA 1ZIOA 3SQWA 3KQHA 4LOAA 2O5VA 2JLSA 5DE3A 2WWWA 1QG4A 1COWD 4ON9A 1V5WA 4JVSB 4OK6A 4AYXA 1K6MA 5FTMA 3TQCA 4HDCA 1ZU4A 3SJAA 1KJYA 4Q9IA 2R9VA 1AZSC 1OB2A 1W46A 3K9HA 2G0NA 3FWYA 2V9PA 1IBRA 1MRSA 1U98A 1XJ0A 5KHOC 3U3MA 1GNQA 3OFND 4NZYA 2J7KA 1VCIA 2PX0A 1OYWA 2UKDA 4RZXA 3GJ0A 3ADCA 2O8FA 1ZYUA 1VCMA 2JLQA 4Q7LA 2P6UA 5FPYA 3CF2A 3WP1B 3BFXA 5FBQB 4JBXA 5KUTA 2OAP1 1F6BA 3KFXA 3KTAA 1CJUC 1Q1ZA 2JIZA 2VL7A 1MR3F 2W0MA 4ZI3A 1KO5A 1KDTA 3NEJA 3GP8A 2YZ2A 2AK2A 2G9NA 1TUEA 2QA5A 1RIFA 2UVQA 3CZPA 4K81B 2WIAA 1P73A 1XU4A 4C9BA 2GETA 1IN8A 4JZKA 4URVR 5K8IA 2WJJA 3LO5A 2Q21A 2VHTA 3VR3A 3K70B 2YVUA 1GL6A 4RJLA 2FFQA 3MAAC 2EYUA 2NPIA 2OBNA 1XEWY 2GK6A 4TQAA 1DG1G 3REGA 4LYAA 2P6NA 3S1AA 1KI2A 2RB4A 3VFDA 2A9KA 3THWA 1FOEB 2WWXA 5AUQA 4BEJA 4M1WA 5JI2E 4F92B 1W44A 2ZAMA 1NKTA 1SXJB 5ELXA 1G7RA 3K8YA 2FJUA 1YZNA 4NH0A 1JR3D 4Q5IA 3MWLA 1AZTA 3QVUA 5LB4A 3T06B 4EPVA 3PUXA 4M22A 3U60B 1C9KA 2ZM5A 2FSIA 1ELOA 1L4UA 1DE0A 2FEMA 1A2BA 1UAAA 2EYQA 3BAFA 2QEQA 2BMJA 3UK6A 1GL7A 5FL7D 4Q1BA 2HJGA 2BHRA 2ZRJA 4CRWB 3G5UA 1TADA 1G1MA 2CJWA 3DOFA 1OHHD 1R0XA 2GJ9A 5LBIA 1E0JA 1QHIA 2VLIA 4A0HA 1F3OA 4CW7A 5H68A 3OF5A 1BMFA 2G6BA 3K0AB 4UNNA 2ONJA 3VR1A 3K70C 1FTSA 4MDEA 3KKPA 2XB4A 4WIAA 3WYAA 3TAUA 1GIAA 1XCPA 2ASEA 5CDFA 1MH1A 3U2QA 1ZD1A 4CZ2A 1N6IA 1U0HC 3ND9A 1AQYA 5L3SB 3EZFA 4ZV4A 3IGFA 3W90A 3WNDA 3EX7C 4C30A 2XB2A 2ZXUA 3ETLA 2BOVA 2VBCA 3AKDA 1GWNA 3QI2A 2QL6A 4GP6A 3B2EA 4P33A 1SXJC 3QXSA 1QRAA 1DPFA 2NO1A 3RDPA 4IEIA 4EDHA 5JI3E 4P4TA 1XD8A 4M1TA 2YC4C 3WMGA 4Z8XA 4Q03A 1JR3A 3C4JA 4LBVA 4B6EA 2VRWA 2XTNA 2J45A 1M2OB 2DFNA 3NWJA 4RD4A 5IRCD 1J8YF 1NMYA 1MABB 2IS2A 3SHFA 4N0EA 1MRNA 1ZRHA 2ZYVX 1FZQA 4XVQA 5DH9A 1R8SA 2OO7A 5FFMA 2RGAA 4EAQA 2QP4A 1D2EA 4BPBA 3IO5A 4KFSA 3K9NA 4YDHB 1ESMA 2NO0A 3GLFE 1NJFA 2OT3B 4BFZA 1KO1A 1GILA 3PVSA 1TNDA 4PPNA 4R9UC 3C8UA 5P21A 1KSHA 1KSJA 4O2RA 3EIQA 1FP6A 3AVQA 3VNVA 2VSXA 1LS1A 3CRW1 4EKDA 1XEXB 3UMFA 4PHGA 2C95A 3BE4A 4B3DA 1G6HA 3CW2A 3ZJYA 1CR1A 1GNRA 4FD2A 2PJZA 3EW9A 3K0AA 5DSZA 4UXHA 1I4DD 1VG9B 2Z5FA 1NY5A 2A7QA 2ZTSA 3ZH9B 1KAOA 1Q12A 3NDBB 5JBQA 1AJEA 1NY6A 1AGPA 1WP9A 2J7PD 1Q20A 5AR1A 2V1UA 1VYTA 4OHVA 3B9QA 2JJ1D 3LBHA 5G53C 2ZRGA 1RRPA 3AUXA 3C5HA 2QZ4A 4PO8A 4FW9A 3P27A 1BIFA 2IL1A 4D4JA 5L3SA 2RGBA 3VHXA 2RHDA 3H1TA 5FBRB 4C0AC 5JCPA 4F91B 3FFAA 1ZNWA 2C78A 2WVJA 4QC2A 2OCPA 1F2TB 2CMKA 1G3UA 4M1SA 1I2DA 3KKOA 3MUFA 2ZYUX 4D80A 4A36A 1P5ZB 3U6BA 1GL9B 3CWQA 1SVIA 4MH0R 1MABA 2KJQA 4LJ5A 1HT1E 4LJ8A 1KAGA 2NTYC 2QQ0A 2AKYA 1IY1A 3QXCA 4W7SA 3KB1A 4KVGA 1TQ4A 4XVRA 1KI7A 4C0HA 2GXUA 5AJVB 2UZ3A 5J4KA 3AVUA 1RZ3A 3D8BA 5JJLA 5JRZA 4BZPA 721PA 2QMOA 2EFCB 5IHPA 2ZETA 2ZS9A 3NH9A 3B8HA 4Q7JB 2QORA 2F7SA 1PZNA 1MV5A 2GXAA 1XZPA 3GLIE 4NCNA 1US8B 3LW8A 5AJXA 2AWNA 3GLGB 3AVTA 4DLZA 2XITA 3PR1A 2QRNA 4Z8YA 1UM8A 2YV5A 4DEXA 3K09C 4B32A 1KI3A 1F2UB 4TTRA 1WMSA 2J7PA 1W36B 1DELA 1D9ZA 4FMDF 5CJ2A 2DHRA 2JJ1A 4JL8A 4Z54A 4US1R 1Z83A 3TUJC 1Q22A 4NDZA 1E2NA 1UKVY 2GEUA 3P1JA 3W5IA 3TUZC 2PEZA 1NF3A 2BJWA 2CXXA 1G8GA 1KZGB 1HURA 1Z28A 4IFBA 5FTNA 1E2HA 3WP0A 4PQRA 3HP1A 4JYBA 5TV2A 2JA1A 4EPRA 2O0KA 5HR5A 3CRQA 1U8AA 3R8FA 1TAGA 4GMDA 2HYIC 2OESA 4QJ4A 1ZVQA 4LBWA 3WBKA 2VHQA 2QPTA 2JLZA 2G3YA 2XXAB 2FSFA 5LDDC 1TQ2A 4WZ6A 1KO4A 4FMBB 1YE8A 1G18A 4P0TA 2ZJAA 2CHQA 4IFEA 5E95A 2Z4SA 3EWAA 4OBEA 1J2JA 4R71A 4BLPA 1SVMA 2WKRA 1E0AA 1Z0FA 3MJRA 1FTNA 3IQWA 2FA9A 4D0NA 2HXSA 4G1UC 4IOJA 5FTLA 3OAAA 1FL9A 2W6JA 1NLYA 1IM2A 1KI6B 1R0WA 2VH5R 1E9SA 5KSYA 3KL4A 4UNQA 5JHGB 2HXYA 5DGXA 4LGMA 1N5IA 3M4YA 1T3SA 4EJSB 4HAZA 1MOZA 2O0JA 4GPTA 2C2HA 4V0OA 2HYDA 3B13B 1US8A 3GLGA 2WJVA 3BH6A 3CF0A 2A78A 5HKKD 3UWOA 1MT0A 1NMXA 4IOKA 2QU8A 4MA4A 2PL3A 3EZ6A 3GFTA 4PC2A 1F2UA 4X8MA 1FMJA 1KGDA 2EFDB 1J90A 1YR9A 2IS1A 2H1LA 1WCV1 4ZPXA 1E9AA 2DCUA 3I92A 3M0EA 1NBMD 2IYQA 2VP0A 1L7VC 5DISB 4FCVA 2TMKA 1XDBA 1R5NA 4ZIRA 4PO1A 2NO9A 3PEWA 4A2WA 2D2EA 4GOJA 2PCJA 2C5LA 4LC1A 1IN5A 4UNPA 3B5JA 3QOFA 4YLGA 1T6NA 4O2LA 3MWYW 5AUOB 4HYYA 2F1RA 4HLUC 3OE7D 4KBGA 1W4RA 4PC6A 1XD2B 1E94E 1M7BA 4LHZA 2OLKA 2H92A 4U5XA 2GA8A 5F2EA 2IUUA 1PVOA 4FINA 2MMCA 2J9RA 4M1MA 2XXAA 1MO6A 2X1VA 4TZ0A 1II0A 3T35A 4UXJA 5K8LA 5FUYA 2WTUA 3T1VA 3BORA 4TSFA 4AY2A 1VCOA 2HUPA 1N6RA 3ZD7A 2XJ4A 1E69A 2WAYA 1U9IA 2CLCX 1EFRD 2P5TB 4D0LB 1W49A 4Q66C 2VP9A 5FPHA 3QEOA 1YZUA 4EJSC 2Z43A 4XVUA 4GT1A 2XNDA 3TVDA 4MRPA 2C9OA 1KI6A 1WQ1R 3EZ9A 4B76A 2VIIA 2GHIA 1SHZA 5E4FA 2JAQA 1CJKC 2W6ID 4G5QA 2WWGA 3U7GA 3B1YA 4EQ6B 1ZCBA 5BYJA 5HKKA 4NHOA 1WRBA 5L3QB 4FXPA 1Z0DA 1E2PA 4AURA 4XTRA 5G40A 5G41A 4B74A 2GRJA 3IUYA 3UG6A 3O8RA 1I2MA 2JGNA 3QQ5A 1IHUA 1ZUHA 3W6OA 2ZR0A 4ITRC 4WAUA 5AJYA 4I1OA 2J0SA 3Q7QA 1D9XA 1NP6A 1NBMA 4B73A 2N1BA 2PMDA 3AKEA 3GLHE 1KI1A 2QRZA 2FOLA 3U6KA 1NL3A 4M4SA 1ZBDA 1JQLB 4A6XA 3B1XA 3QE0A 3OE7A 4GSYA 4L9SA 1LFDB 2B21A 1RYFA 2ZI5A 2ONKA 4NCHA 4EUNA 4JVMA 3B78A 1TU3A 3T34A 1CJTC 1XD2A 2GXSA 1XCMA 2W58A 1KNQA 5TXGA 1M1YE 3BERA 1P2TA 4OL0A 2CNWD 2OFOA 3IIKA 2JLUA 3MJHA 2ZROA 4TL8A 3QBTA 3DMDA 3AVWA 4A0GA 3CRRA 3ZQJA 1P6XA 3P4YA 4LYFA 5C18A 4BZXA 1XXHB 3ZZUA 5LD2B 3A36A 2WKQA 4AYTA 3EA0A 3U7HB 3O8BA 4HZUB 3FMFA 4JL6A 2OCAA 1TF5A 3W34A 1DVRA 3IQXA 2AWOA 2YINC 5H70A 2FU5C 4K8OA 3AM1A 3KQLA 2MSCB 4NKRA 1RPZA 4ZI2A 2EFHB 1YZGA 1YZTA 1ETUA 1N5LA 2PEYA 1EXMA 2E1RA 3LD9A 4KODA 3FHTA 2FPMA 1CBUA 1HQCA 1XTIA 3B9PA 2FGJA 2RAPA 3PEVA 3KXLA 4EQ6A 2QGNA 2IYRA 3LLMA 4PZLA 5L3QA 3ASZA 1KKLA 2E87A 4DLWA 1KNXA 1BS1A 1RRFA 4ABYA 3B1VA 1KDRA 1UPTA 4MRSA 3OESA 2XX3A 3EPJA 5CK5A 4HB3A 3CH5A 1T0HB 4PQFA 1ZUNB 1IN4A 3QPVA 2F1HA 4QBGB 5DHAA 4Q4JB 5J4HA 1P9RA 4NYJQ 2GZHA 5FPTA 1UBEA 2QMEA 1U2RA 3FKQA 3CBQA 2HF9A 2KB0A 1XBTA 3PEUA 5BN4A 3WMEA 1LW7A 3R9WA 4DT1B 3ZGXA 4Q1FA 1ODFA 2EVWX 2GAAA 4A1FA 2Q9BA 2QM8A 3KKNA 1SVSA 3W5JA 4G0NA 1KK1A 2MSEB 3A1WA 5KTYA 4QBHA 1XNJA 1GKYA 4IDQA 2IHBA 4XD7A 3NBYC 3CX7A 3NC1C 5AK0A 2ZRHA 3RHFA 3W3AA 4HZIA 3AGQA 2JJ2A 2QM7A 4M1YA 3U5ZB 1E1QA 1TEVA 3SEAA 1U99A 1NNEA 2ZE5A 3I4LA 3MSXA 5DO9A 1VMAA 1VHTA 1KDPA 2ZRIA 3KDSE 2WHXA 3K53A 1E2KA 4JLMA 1V43A 4FIDA 4FCTA 4RVCA 2QQEA 1E2LA 4M9XA 1XTSA 3EWSA 3QVVA 4NCKA 5HTKA 3TSZA 1VG1A 3KJGA 2IXEA 4M8NE 5TY0A 4ZO4A 4EPXA 2I1QA 4H1VA 4HZUA 1G8PA 1HH4A 1Q57A 1YQTA 2GJKA 2MMGA 1OFUX 3AF2A 2AL7A 4QGFA 5AJZA 1H8ED 1W0JD 3KKMA 4A8JB 1XTRA 1S0UA 4DSOA 1TQDA 1ESNA 3U3RA 2C03A 1ZNZA 2NZ8A 3TNFA 1T8UA 1EX7A 3ZZTA 5SZKB 4AI6A 4R2HA 4RD0A 5KSOA 3X1XA 2REBA 2X8AA 4R7ZA 3ZS8A 1E2EA 4UXIA 3ICQB 2FN4A 1R5BA 2ZVPX 3CKLA 5KPJA 3TUIC 1ZU5A 5B30A 5CIQA 2XZOA 1G16A 1S1CA 1DARA 4LHVA 3OIUA 1UF9A 1L2TA 1NN5A 4S35A 1F48A 2NZJA 1YVDA 1OH7A 2B92A 3N70A 3BD9A 1E79D 2CVFA 3A1UA 4Q4JA 3ZYCA 2DY1A 2IW3A 4QFMA 3CB4A 3V00A 5LPNA 1KK2A 2ZE8A 1N6NA 2JLRA 1P2VA 3SJCA 3TW4A 2A3RA 4DT1A 4KCGA 5FI0B 1BYUA 4OQNA 5FUXA 1QHSA 5GADl 3ADDA 3HU1A 3CRMA 3TE6A 4B33A 2QN6A 2VO1A 2GF9A 1EX6A 4L5BA 3HYTA 4TT3D 2VSFA 4BRUA 1W7AA 5J4YA 1VECA 1EWRA 3B1WA 4R98A 4F4IA 1X8KA 2FG5A 2D7DA 2ZANA 2B6HA 3I32A 4L8GA 1XTQA 4GRAA 1UKYA 4Q21A 2JLXA 1YZKA 1U8YA 4A8JC 1CRQA 5CDFE 1H8EA 1W0JA 1GRQA 3QKRB 4PSKA 2CK3D 3SYNA 1J70A 3HR8A 2BVNA 2FPKA 2CE7A 5DN6D 4DB2A 4OHYA 2Y8EA 4M2LA 4NYIQ 4PPGA 4B2IA 4A8JA 2AR7A 3QKTA 4II7A 5CM8B 1M34E 4KHZA 5FTJA 2F9LA 3E2IA 4DSNA 1NI3A 3V4RA 1AKYA 1CULC 3I5XA 3NHBA 2CE2X 3LWNA 2G0TA 3QKSB 4LX0A 2ZSFA 3DVLA 4HLCA 1OYYA 3OEEA 2P0EA 5FOUA 1SXJE 2AHOA 1OH6A 4DVGA 4DSTA 2J59A 3CPJB 3EC2A 2NQ2C 4ACAA 4CT4B 2ANBA 4ZDJA 2RHMA 3KUCA 5GJVC 2CJWB 1AKEA 4QG7A 4BFXA 1N0UA 3HDTA 1NN1A 1OW3B 2QROA 3D7MA 3I8XA 4RZ3A 2WWHA 3FB4A 5EE5B 3RS0A 1XZQA 3BWDD 3VR5A 2RMKA 3W6NA 3KJIA 2NG1A 3ECCA 1RJ9B 3AP1A 4NYMQ 2YOFA 5CJPA 4DC9A 4DIDA 1OFIA 1G41A 2JEOA 5JEEA 4PANA 4JLDA 3RABA 1P2UA 2O8CB 1P72A 2G83A 3Q3JB 3TQFA 1AS0A 3QF4B 4HAVA 4HUQB 4LBZA 3SU8A 621PA 4NCIA 1E9DA 1Q0UA 4C3ZA 4OQFA 2J87A 1RRCA 3AKYA 4OI0A 1Z8FA 3FMIA 4L15A 1SULA 3R9XA 3NDPA 4V0KA 2BV3A 3X1DA 5M04A 2OLJA 1G291 2WWFA 1JJVA 4D4MA 5F9HA 3MGCA 1P62B
chains in the Genus database with same CATH superfamily
3LQYA 2Y3GA 3W9BA 3SNKA 5B2ZA 2IHUA 4GOXA 2DKOA 3HJCA 3L0SA 4CM6A 1LIHA 4RO0A 4RWZA 3CCCA 4DVYP 1VGVA 1OFTA 5C80A 3G5MA 4KSCA 2XRMA 3LC0A 4F2DA 2PL1A 3LESA 4LZWA 2DR0A 5KWVA 3E5MA 3CVOA 4G63A 2RGRA 4M88A 3PQEA 2CW0F 3FDFA 1XU7A 4U6QA 4ITUA 3H04A 3U9JA 1TFUA 3OMLA 2B7CA 2ZXWC 4BJHB 2YY5A 3ESYA 3IIEA 2F48A 1B0PA 2JGAA 5EP4A 3WKDA 1L1QA 1FC0A 1WSAA 4ZEXA 1XZHA 3Q7SA 1A1SA 4EHAA 3KS9A 2JAUA 3JYYA 4LXHA 3P9SA 2FEKA 3T7AA 2I2CA 4BUJA 1ZCZA 4FU0A 2V9ZA 5TGZA 1OWNA 4P2GA 1A9SA 4Y9SA 3TQOA 2I7DA 4IZIA 1KVRA 5KNDD 4Y2VA 3FX2A 3IB3A 1GFIA 2EAUA 1H0KA 4NJMA 4E13A 1PFKA 2ATVA 4CI9A 1Y42X 3VAAA 1JU4A 3G0HA 4J9UE 3GBSA 1OQAA 1NW4A 1GZ4A 1CYEA 5KTSA 1VL5A 2RBKA 1I4YA 1ZM7A 4BFSA 4BS9A 4LF7B 3KZOA 2FQQA 4G7OF 1IOLA 2HMTA 1PZGA 5H4GA 2C9CA 3V55A 2IEYA 5EFZA 4PX9A 3EH1A 4Y2HA 4OQQA 2XCOA 2HSDA 5FOTA 1KQGA 3UFBA 4JJFA 1YBAA 1N2CE 2YH2A 3M5PA 3VHRA 3MT7A 4K0DA 3BXPA 2ETSA 5CCBA 2FFRA 1OLXB 4KRFA 1W59A 4ZCMA 3NHLA 2ARKA 4G5YA 2BSXA 1G17A 1BMQA 2WB7A 1JU9A 2GYYA 3WDMA 1TTTA 2GHQA 5HG0A 1ZVMA 3BBLA 4CUJA 1YKGA 4M21A 1MA3A 2HB6A 3KSDO 2BEUB 4E1VA 1ZOSA 1KJJA 3AZOA 2CXPA 4YVFA 3NYLA 2HFJA 3WY9A 4JC0A 3G2MA 1CUCA 2H4XA 4CEIA 5AKYA 2LCQA 1GGEA 7AT1A 1XEAA 3SJBA 2VP2A 3E1GA 4BJ3A 3F7NA 4MRMB 3WYEA 3C45A 3ED5A 4LOIA 1CDOA 3AGUA 5I6DA 5LZ9A 5CP8A 2EKZA 2XQKA 1H2BA 4EVRA 2D5CA 3PGVA 4QPDA 2C82A 4F6RA 4AMVA 1YL6A 3VV3A 3A1SA 2C3YA 2COUA 3ER9A 2VDUE 5IKOA 4AJJA 2X8BA 3EDMA 3WWDA 3AJEA 2QMUA 2J9UA 4Q6WA 4ZVRA 3AVPA 2AMYA 1EHIA 3JATA 2R8OA 2E48A 3QLVC 3GNLA 3PPIA 1G2QA 1LNZA 1ZEMA 3I23A 5TVGA 4G41A 5KVCA 1B3RA 1PEYA 4DILA 4MQEA 4PHTA 5K1ZA 1JL3A 5FOVA 4BMXA 4NBSA 4CF6A 2JKYA 2QSUA 1PSDA 4AP6A 1FDIA 1GQSA 3PDIA 4BKQA 4KE7A 3LAYA 3NUQA 3GJXC 3LKDA 4DQUA 3CO5A 1N6HA 3AZPA 4QOSA 4DBLC 4FYWA 3PE6A 3WLNA 4AX4A 3PMRA 5DBFA 4I55B 3T95A 2DBYA 2XSZD 1XB2A 1W4LA 4HB0A 3IEIA 5JTUA 2JKVA 5CX1A 1Z7Qc 2R25A 4BQPA 3K6JA 2FPGB 1OIXA 2GCNA 4I1PA 4C04A 1HKHA 4JDPA 3ZGVA 3C16C 3D7RA 4EJ2A 5IYZF 4ZKEA 3VVCA 4BDSA 3GM2A 2PSJA 4PFSA 1H85A 1DGQA 5DCLA 4K9DA 4BNXA 1VPTA 2HJ9A 1EG7A 4ZJYA 4CEHB 3T4EA 5KCZA 1QUFA 3DTNA 3ACCA 2IK8A 4RTRA 4HQ0A 1QQ7A 4N01A 1NJ2A 2CXTA 3I01A 1ZOPA 1RWVA 4GNRA 1XCJA 5L0CA 4LK2A 4NFYA 4C3DA 1RLOA 2D4HA 3WHLA 5HFJA 4MLDA 1W85A 5ALWA 1CJVC 4JH0A 3VR4D 4Y1EA 5HZKA 5B4TA 5AVZA 2RBEA 1WHSB 3LOQA 2QTZA 3RANA 3ZPXA 2ZYTX 1HNNA 1H2RS 1P4JA 2L69A 5IDXA 4CM5A 2IIPA 4DQKA 5H4HA 1RS0A 2YMPA 3KOUA 2QP3A 1AHNA 2Y9MB 3J7TA 4DCJA 5DI3B 5C1BA 2GYUA 3TVYA 2PBRA 2JF0A 4DIEA 2OD9A 2OJED 1EZ1A 2G62A 1WXEA 6ABPA 3HPRA 2GMWA 3OQMA 1L1EA 2IXBA 4K1LA 4YX9A 4MR9A 1ORIA 5CEEA 2VAVA 4EABA 3QENA 3S81A 1GVNB 3V3TA 1AN9A 5A2QA 1R6XA 1ACLA 4A2PA 1SOAA 2OEPA 2YBDA 4B5LA 3MT0A 1IEQA 1M5UA 3SC3A 1E5LA 4FI3F 1XLTA 4CL8A 1FNDA 2NV0A 3IRVA 1GTG1 2L17A 4IDFA 2QMHA 1HFEL 3CEXA 2Y3BA 1LLDA 3BB1A 3NTRA 1IXKA 4Q4AB 5AOBA 4IF6A 3VX4A 1TE2A 1XMVA 1OSNA 3MWJA 3ZOKA 3JQBC 1P2GA 4D25A 4HNVA 1BQEA 4AUEA 1EB8A 5KTRA 3PXGA 3DZAA 2ACWA 4UUAA 4D9FA 1RDFA 1V2HE 4TXHA 4NONA 5FUBA 1UKEA 1YWGO 4AJ1A 3EIHA 4H59A 2F00A 4C6TB 4Q37A 3CONA 2GUWA 2Z5GA 4XEUA 2DFVA 5HHTA 3R7WB 3KD3A 3S7ZA 3OZXA 4RWEA 4C7JA 1BS2A 5EE9A 3R5KA 1R1DA 1Z4PX 4G85A 1QRSA 4MEBA 2CVHA 2QZSA 2KC3A 2AYXA 1FFSA 1WLSA 4XWKA 2AJCA 2YYSA 4OK5A 3F5DA 4IGEA 5IASA 4F8YA 3HUFA 2QTVB 3JVIA 4Q19A 2PWZA 2JVIA 2NU7A 3T5AA 3IO3A 5CVCA 4WZAE 4HLQB 4CKYA 2PT6A 3ICCA 4LE1A 3H2GA 5DKFA 2VHZA 5CI8A 1PN3A 2JFZA 5DYTA 1PP4A 2O2SA 4ZK2A 5A3JA 2WJWA 2I4TA 3RF6A 2PZEA 5JWOA 1P80A 2ODTX 4CMBA 1AXRA 1T26A 2P9QA 2OFWA 3KJHA 3LS2A 3RUFA 3PDUA 3R7SA 2WHQA 4TWZA 4CEIB 1GZSA 5DQZA 4WA7A 3PXEA 4NYJR 3LW7A 4HWOA 3FHLA 2XMDA 2P4UA 1Y1TA 1DLIA 3G68A 1OW8A 3UPTA 1ZLYA 2OVFA 3GM3A 4LKOA 2R6DA 3VDQA 1LFAA 4UEJA 1KEUA 2OM2A 3GPCA 5JCZA 3E9VA 1A69A 2A0UA 5JROA 3EEBA 3I5YA 4UHDA 2WAMA 1VMKA 2HSWA 4MUBA 1NURA 1TM7E 1JKMA 4MKFA 4RTKA 2WT8A 4YUYA 3CTPA 2CHUA 3JATB 3OEYA 2WA1A 1VJ1A 3E35A 4YJGB 2OC9A 1WXQA 2IOQA 1T2UA 2WDZA 1N5JA 3RC9A 3MQ4A 4XZ3A 4MQEB 3PFHA 3RC2A 5GTDA 3II6X 3RK0A 1AXGA 1P4GA 1W88A 1SC9A 2CJYA 1Y33E 4U5EE 1CZRA 5DZSA 5GJCA 3SIXA 5EY5B 5CRIA 3K8OE 3VHQA 4EJSA 3ZXYA 1VBMA 2GYWA 1UC4B 1X3SA 4HH4A 1IEWA 3M6UA 4QGGA 3DYVA 3TVTA 3PCRB 2GKSA 2RHLA 2H54A 1P5JA 2IUSA 3UT5A 4S2UA 3UBTA 3AUSA 2WU0A 4Q3KA 3UTCA 1QP8A 4RSGA 3BZBA 3EHMA 3RVMA 3SWWA 1Q6ZA 2ZRPA 5AW0A 3H5AA 4CEJB 2BMAA 5I9BA 3L8MA 3ZC3A 1T3ZA 2GEDA 2O1EA 5JYCA 1ZD9A 1IVYA 1A82A 1JDNA 1J21A 2Y1KA 4ZCQA 3ILXA 5G0WA 2ZI7A 4TSKA 2EFJA 2EW2A 1W76A 4GBGA 2ZJFA 4HXYA 1GPNA 3QV2A 2IWRA 2GF0A 2OTCA 4ARUA 1L8XA 3NOOA 4TTPA 1MNEA 3DDSA 5T8KA 1MEJA 3WRYC 4IKOA 5AVXA 1IDN1 2FRDA 4UD2A 1RPJA 4MV9A 5A9SB 4M8IA 4MKIA 2OD7A 3KB6A 4EWLA 4WRRA 3V4ZA 4LJ9A 1LV7A 3EVZA 2OPBA 1V95A 1SQ5A 4DCSA 3RJ9A 3PQ5A 4WXPA 5CG1A 1GAJA 2GZDA 1YGYA 2JFOA 4S0ZA 4XCVA 4FMDB 1H2HA 4LIPD 4MGKR 1MO4A 2IIBA 3F9IA 2WY2D 3UQYS 3EPVA 2ZI6A 4HR7A 2HJVA 2I2BA 4QOIA 3PJGA 5FI3A 4BO4A 3T4PA 2OVBA 4D9BA 3UGPA 1YQXA 2ZSBA 1ZINA 2GZAA 3RS5A 1FMWA 2XECA 2PUTA 2C7OA 1NUHA 1YXMA 3KHTA 3W6ZA 4DUZB 2GWWA 5FBVB 2ZYIA 3EA4A 2ADFA 5EJ9A 4B3TB 1BE8A 1JBQA 3CLTC 3ZY2A 3QUTA 1C7RA 3ETNA 2O8FA 4Q7CA 1N2HA 1Q84A 3KTAA 4L1KA 5DTIA 1HC7A 2YZ2A 4L02A 2G9NA 3DBOB 2D5BA 3FOBA 4FB4A 1L5HA 2WIAA 1P73A 3G2OA 3UMVA 1JSLA 1Y7TA 2IDZA 2FLKA 2PFSA 5KYWB 5K0LA 5ALLA 2EYUA 1VJ0A 2GK6A 5K99A 1KI2A 1Q0QA 5JI2E 2LIPA 2P2NA 4QT0A 1E64A 1SOWA 1ILWA 4CM8B 5LB4A 1P2BA 2N9UA 1MENA 3INGA 4FFLA 4XIJA 2FEMA 1JQKA 2J9FB 1T24A 1L7PA 5FL7D 5H3LA 5JS5A 2IDJA 1JFRA 3PHF2 1AE1A 1E0JA 1MUUA 3OF5A 4MCIA 1ICEA 1QYCA 4EKGA 3VR1A 1J5PA 3WYAA 3RT1A 2PKQP 3LT5A 3PS9A 3T5BA 2NUAB 3ND9A 1C3EA 3FN4A 2I8AA 2BOVA 4IINA 4P33A 4K9SA 3MUOA 3RDPA 4RD9A 2FEXA 4UVEA 3G6KA 2JJYA 2XTNA 3QZUA 2DFNA 1KFBB 2GK4A 4D96A 3DLIA 3RVQA 4EDFA 4RNDB 2WVQA 5EJ5A 3MYFA 2FWNA 2NO0A 3CH6A 3WWEA 1RIIA 4PHCA 2DLDA 1MB0A 2FHPA 3PIIA 3WIDA 2SBTA 1ESDA 3VR6H 4B82A 1VG9B 5KNDH 2ZTSA 1ZJ5A 1Q12A 3LOPA 2C4UA 4NWIA 5C5IA 1Q20A 5LP6B 2P61A 2GS9A 2QN2A 4PO8A 4U7GA 1XPJA 2DOKA 2ZB2A 2PF4E 3FFAA 3FPEA 3T1YB 4ONSA 1A04A 1YQDA 4IR7A 4Z9JA 4A36A 3BTOA 4MP6A 1PEKE 1PGJA 2PWPA 3CWQA 1T1JA 1SUBA 4OGKA 4DJDC 1KAGA 3GODA 3DT9A 1G1AA 1TQ4A 1SRRA 2G80A 1TZKA 4R0NA 1YR2A 1NA5A 1PZNA 3BWYA 5BUZA 1DQSA 2A9OA 3UA4A 4AJHA 1TCCA 2YV5A 3K9CA 4FFWA 4B32A 3DAYA 3LK6A 2X7JA 4FLFA 3KAQA 2W4BA 1ZNQO 2JIOA 1EP2B 1LSOA 3WDKA 2DUMA 3LF1A 2OESA 3HWX1 3QLEA 2VHQA 2IPOA 2G3YA 9ABPA 4H0CA 3B70A 2ZJAA 3EWAA 3NKFA 4KAAA 1REQA 1NMSA 4GQHA 1SBTA 4D0NA 1E5XA 4MW4A 4RIGA 3EFHA 2A69F 4EJSB 1MOZA 2H4HA 1XT6A 4V0OA 4DG9A 4MV1A 2WJVA 3UWOA 1NMXA 1UP6A 3WGYA 3P0FA 4FZVA 5COFA 2NADA 4WOBA 2ZTVA 3OT5A 3D6VA 1YF3A 1T6ZA 3O10A 1RAHA 2F1RA 2QV0A 4FUTA 4U5XA 3SP1A 2G9ZA 1JV2B 3GAFA 3OWHA 3GEPA 2NN3C 1Y9DA 1GQOA 1OFVA 1T1IA 3G9UA 2VA9A 1EFRD 1RLJA 1VL0A 2XB9A 3QEOA 4BX2A 2Z43A 4FHFA 3G85A 4B76A 3MQ2A 3SXUA 5HKKA 2Y1XA 1E2PA 3FVRA 5AVWA 1CUEA 3UG6A 3FYUC 4M0EA 3ZHCA 2J0SA 4NS1A 5KIAA 3PX7A 3GLHE 1Z4QA 1XYGA 4K1OA 1NL3A 1ZBDA 4ZEVA 4Z4CA 4RZSA 4H60A 4JVMA 4JI0B 5TXGA 3HNIA 1SU6A 2JLUA 4TL8A 3NV9A 1FS5A 4LXYA 2WINI 1JA0A 4WESB 2OGWA 3CLSC 3DP9A 4V1CI 5TMBA 1CBUA 3A7EA 3P0IA 2FWPA 1T5TA 2FGJA 3VSCA 2H1HA 1BS1A 2HKVA 2AFIA 1JHOA 1VI2A 2VBGA 3D4BA 1V7ZA 4PBTA 1EDOA 3WMEA 1RXQA 4Q1FA 4UBKA 1RHRA 3HZZA 4J0CA 4GLBA 3KOYA 4G0NA 3AG5A 4YAGA 4F9GA 5A6AA 4O2BA 3CX7A 4AZWA 4YACA 2JJ2A 3VU1A 4D41A 3U5ZB 4YGYA 1Z23A 5A6BA 1S2IA 4YAKA 1VHTA 5ER9A 1V1RA 5FXMA 4MWDA 5JSUA 1MGPA 2JHGA 4DJJA 3GAMA 3TSZA 2IXEA 5BRJA 1S2LA 4FDMA 4A8JB 4CCYB 2Y0PA 3WQBA 3ZZTA 3T7IA 1BX0A 1Y6DA 1ETHA 4R8KA 2AA3A 2Q7XA 1Z4LA 2BCEA 3CX3A 2X1MA 3HE3A 3ROMA 1BR2A 5JSFA 4UU1A 3KLPX 1DQZA 5FUQA 1CPYA 1AT1A 1TCBA 1J2YA 4PK4A 1GR1A 3UB2A 1OILA 3DUFA 1T3GA 1QQ6A 4PCVA 3T0FA 2JJMA 4W9NA 4F4IA 2FG5A 3UTDA 3R3VA 2FHSA 4G1EB 2JLXA 3HYLA 4UE3S 3QKRB 1VOTA 1LLUA 1QCDA 3TTUA 3SQNA 4EATA 5IAEA 1NI3A 2Z5LA 4RF3A 3SD7A 1R6DA 3UCEA 2VZ8A 4MS4B 2A0BA 2BKXA 2KW3C 4CT4B 4HGQA 4HNHA 4BFXA 3KVOA 4DUPA 3TTYA 4LXUA 3M9XA 3N53A 4KH0A 1XZQA 4QXRA 4ZHSA 3KJIA 8ABPA 3I3OA 1G41A 4JLDA 4EFDA 3N2NA 2FEPA 4TGLA 4ZANA 4YRBA 1C1HA 1CVIA 4R1TA 1HMYA 2AC7A 4S1PA 2YFYA 2JL1A 2GBIA 3HBJA 4KYIB 3DGEC 1NAIA 1AV7A 5D87A 1L3BA 3ON5A 3M4NA 1M5RA 2L42A 4RQBA 1Y4CA 2PZJA 1YJ5A 4AWBA 3D3QA 2KW5A 4YH1A 2HMAA 4QICA 3TBKA 2QV7A 3K0SA 1C9YA 1UBGA 3VVMA 2FMXA 3BZUA 3NBZC 3T7RA 3H9CA 5LOVB 2XVZA 2ZEJA 1KRXA 4MMYB 1CZNA 5E2BA 3EXG1 1G4HA 1W4CA 3A8TA 5JAQA 4YAFA 5BN5A 1FJ2A 3TXAA 2HLDD 3EGEA 1GPDG 4V0LA 5HS6A 4LJRA 3K1YA 4C1NA 2GM4A 4BO0A 4R1OA 2J0VA 2NXWA 3AJMA 3V7WA 1DFHA 4Y18A 4OMFG 2C1ZA 3ZNQA 4D3YA 2K87A 2VDKB 3N8KA 3ZQ4A 5IAJA 5JO9A 3K0FA 4Z9FA 4OQZA 1XQYA 3AKCA 4OG2A 2ZSJA 5CDSA 4G5GA 1A2KC 1NVAA 2RHTA 1NI4B 3L79A 3OLZA 5B64A 3TXYA 3H6KA 4M49A 2RHGB 3CLVA 1I51A 1FMFA 4IFIA 2VDMB 4MRRA 1C3XA 1W35A 3R41A 4MCHA 4JASB 1R9MA 4R8VA 3KJFA 2EJVA 3S27A 4O0MA 1HL3A 2IGBA 4HH1A 3MXOA 4P9TA 5JRDS 2KMLA 4H7KA 2WPDD 3A7DA 4I14A 4LI0A 4LCEA 2WZQA 1FMLA 3NO4A 3PUHA 4AJKA 4IIGA 3MAJA 3OT4A 3KJZA 1SU4A 3W06A 4HNGA 4MUYA 2V7GA 6YASA 3I73A 4QBIA 4GE0A 5IYZA 2W6PA 3NG1A 4JJIA 1L5ZA 4XIFA 3GCWA 2XL6A 1TU4A 2L2QA 4FJ0A 4MDHA 4JLPA 1ND6A 2G63A 5DXFA 4TL9A 5JXWA 1J7KA 4Q4CA 5KKNB 4Z9BA 4FD3A 3O8DA 1FX0A 1T5SA 1ZM4A 3JQDA 2VOJA 2ZUTA 4QUKA 3TJZA 5E3AA 3N0XA 1GOTA 4QX6A 1TECE 1VIYA 4WKGA 4PNHA 4ZU6X 2QM3A 2J9VA 2Q8PA 3IBYA 3PHIA 3Q7PA 2A4MA 1E9BA 3G1TA 3OJ0A 1RXIA 4TTAA 4HADA 4TUYF 4J3JA 1G2OA 5HNKA 3VSAA 3O4JA 2ZD9A 3DZGA 1ZGGA 4M7OA 1XRJA 1GITA 1C1DB 3MRSA 1W94A 3RF7A 2JJQA 4QRIA 3BXZA 4RDXA 1FDOA 2A58A 2FQXA 1RI4A 4CKWB 4OHPA 2HJWA 2BF7A 2GD1O 3GFPA 1GKUB 3ZXXA 4P3OA 4D42A 5C8YB 3BAZA 4S04A 4HEHA 2FVYA 2H00A 3ZXIA 4CQLA 4Q6BA 3U9LA 4AN0A 4OAPA 3PXBA 1KYIA 5EXXA 4ZT7A 2AFIB 2HW8A 1SC3A 1WULS 3W5HA 4EUKB 1R8QA 2M1XA 4M6WB 2EKDA 1E4VA 3KJEA 3ZXSA 3NYRA 1A1VA 1U7WA 4GE3A 3FMOB 2M9MA 4QOHA 4Y2TA 3LDAA 2WIDA 3ZI4A 3CUYA 1PYDA 3IR7A 5JAHA 2B9EA 1RWXA 3K2EA 5D91A 4IWXA 4URXR 1WWKA 1PT5A 3CW9A 4O29A 1QU3A 3NIBA 4G8CA 2ZKIA 3VVBA 1QIMA 3THXB 1SUFA 4ZVVA 3SZOA 4FGSA 1U8FO 7REQA 4U39A 3PEYA 4M0MA 1EQ2A 2O2XA 3VSEA 3WQRA 5K01A 3NJ4A 2D62A 5FLKA 5D3ZA 2I5PO 1P74A 1UXIA 1U5BA 4HATA 5JFGA 1XEFA 3TH5A 4EPYA 1OBFO 3AVXA 2H8AA 2O2EA 2X5OA 4X1YB 4G84A 1OXKA 1J0AA 4RA9A 4BLUA 4GR9A 4Y2XA 4UQPA 3M15A 2H17A 1H6AA 1V8FA 3ZE9A 1GQFA 2C4WA 2PS0A 3QG5A 2LRHA 1K3TA 5ADVA 1Y1SA 2AZDA 2WJPA 3F3KA 1ZIPA 1K89A 3KOOA 1PS9A 4ASUD 1FW6A 1EUYA 1B6GA 1SVWA 4KXUA 4BGDA 5EHGA 3AINA 4OHWA 4KPFC 3I1JA 2BEVA 3OICA 2WOOA 4PZAA 2BH2A 4DR2B 2GWHA 1O95D 3DXYA 5GPGB 5EJAA 2QTWB 5TDHA 4MEJA 3PFKA 4OLFA 2HAEA 1LPSA 2WM2A 3C2QA 1EFKA 3Q41A 3OG9A 2INGX 5D7NA 4RM2A 1Z63A 4IHJB 3DWEX 4KPUA 4U1RA 4C0JA 2Q99A 2ZXEA 1L4MA 5BR7A 1J0EA 2HHLA 4KX5A 3EGXA 2IHTA 5DX1A 3FNGA 1EESA 2NV2B 1C8VB 1NASA 1YMQA 1H1LA 5CB4B 3SBEA 3E3NA 2WTAA 4I36A 2PZLA 2CXSA 5DN6A 2R7UA 4R41A 1UFBA 3A11A 3DB2A 3ZGZA 2WZDA 5AHOA 3DBVO 5FYQA 4OKNA 3DL0A 1N2GA 1NWHA 3H13A 3UKDA 3KVRA 4I08A 4ZJZA 1EXDA 2YL7A 4TROA 2DJIA 2WLTA 1EZZA 4G86A 2H16A 2W6ZA 3M1AA 3H5OA 4MKHA 3X2FA 5IZCA 4FEEA 4GFDA 3T7JA 1EGVB 3AF4A 2WFLA 4EOGA 5G1NA 5BSTA 2OG2A 1DOZA 2EIKC 3UJ8A 4AAYA 3A14A 3CQ9A 3HY3A 3KXKA 5A69A 2HMWA 4HEQA 3W77A 1RFLA 4UAGA 2O3JA 3OURA 2VRCA 2YFKA 1CEEA 4PC1A 3KBOA 5KVVA 1LVUA 4NU0A 2H7VA 4A7PA 3AVYA 4ZJUA 5AVRA 1E1RA 2C88A 4RU1A 1QP4A 1OZAA 4Q24A 2C96A 3DD5A 2WMOB 3O3NB 2DSNA 3IVXA 1DJNA 1Q83A 3RWBA 3DULA 2XZPA 2WMDA 5CDGA 5EMNA 4CIPA 3K32A 4BNTA 3ABKC 2PJUA 2POQX 3TBHA 4U9IS 2C4VA 3CH4B 2I4NA 1V71A 4KG7A 4LWZA 5JQGB 4RTOA 4G9BA 4W5TA 1MMFB 1ISMA 3B38A 3FNRA 2FGKA 2X23A 1Q7BA 3QX3A 1JSXA 2JHFA 1MNAA 2E5WA 6Q21A 3T3MB 3PFNA 5FPQA 3RLFA 1AGRA 3HK2A 1KK0A 3N6RA 4LDNA 5IWCA 3JASB 1MAAA 4UARA 5EZYB 3EIEA 3GA7A 1NM5C 1Q1BA 5J1TB 3GRRA 3EQ8A 2QBYA 1PZFA 3LFUA 3GD7A 4PIVA 4C3EA 3V7NA 3QXHA 4P92A 1IONA 2DLCX 5L45A 4CLOB 1N2BA 1XJ5A 1EPUA 2WTEA 2OFXA 1N7GA 4G0UA 1KP3A 2YHSA 3SBOA 2B0CA 2QUPA 2G4LA 3CZ9A 3IKTA 5K0IA 3C8GA 4ARIA 2NMVA 1Z0UA 2AN5A 3OQNA 4Z4GA 3Q8WA 4PX3A 1DEKA 1NXSA 1TDJA 3IKVA 1D4OA 2LP4A 1T3LA 4UQOA 3M8KA 3Q7RA 3WLMA 5KVQA 5IKXA 3R6DA 1KU0A 4RHUA 2I6UA 1J2TA 4DLNA 2AK3A 1QBGA 5A7FA 1AMUA 3V34A 1GM5A 4ZT6A 2H5LA 1SCIA 4ARZA 4CS9C 4DWWA 2CVPA 2IEAA 5CT5A 1DKPA 3K4QA 1UPXA 2R48A 1BFDA 5AM5A 2D06A 2C7QA 3M5WA 4JK3A 2B4QA 2KI5A 2V74B 3GEEA 3FXAA 4HF7A 4WNAB 3W4KA 4GUDA 1M8PA 4EPTA 3FUTA 3R77A 4B87A 1YK1A 1WU8A 4L5YA 4Y2SA 1X9IA 1N9GB 1BYIA 1WMDA 1G63A 4IIJB 2H2GA 1NVBA 2JCGA 3ZJYA 1NG1A 3SZMA 1X7XB 4LERA 2NPUA 1QTQA 1J9GA 4ATNA 3CJQA 1ORYA 1TF2A 1PQPA 1Z6XA 1VL8A 1C9NA 5EMMA 3KXPA 2EINC 1XQVA 3KHKA 4HOYA 4BIMA 1U0JA 2BJVA 3PUJA 1MOQA 1I94B 4EBBA 3H3JA 1YACA 4J07A 5E0OA 1MJGM 2IYSA 3H3FA 4E12A 1GTMA 1OAOC 5FAKA 4KX3A 2XMRA 2VTEA 2W6CX 5HGXA 2BKLA 4EFMA 3DKPA 4I4CA 3GOQA 4PSDA 3LT2A 4MWGA 4RPJA 3VTKA 2GB4A 3IHWA 4HWRA 5DIFA 2A5GA 4OLJA 4Q1CA 1XFAA 4Y2JA 1D8TA 3QU2A 2ZUBA 4H18A 3DZJA 3FCSB 2I3AA 5H5JA 1E2MA 4F5ZA 3EQ9A 3GT7A 1U2GA 3AVOA 3I0ZA 5AH0A 4PX5A 2QVLA 3AEXA 1XTPA 3C8HA 4OQXA 4AS3A 4MYSA 3EGWA 5CHEA 3BA1A 4TQ9A 3ROPA 1GZ5A 2QPAA 3IV9A 2GN1A 2VT2A 1DKLA 1PJ8A 3BGSA 2VUIB 4JC5A 5IDQA 3O55A 4WGYA 3T9BA 1T2NA 3M34A 4DKJA 4D9NA 1DV1A 1PWZA 3DR5A 5DS5A 1U3DA 1WBJB 9ATCA 1CXZA 2X40A 3K7EA 2D54A 3SQWA 5HUJA 1I0IA 3HA5A 1A7UA 4IH9A 4B3HA 5FTMA 3B7WA 2AOTA 4JEIA 5TPZA 1WQ4A 1W73A 3ZCQA 2RAFA 1CC1S 2WFLB 3QX9A 1EX9A 2PX0A 1PUXA 5D85A 1P6UA 2R7LA 3QW4B 3MTAA 4IPTA 2XDYA 4PAGA 1WL8A 1T9KA 1KDTA 3I5PA 1TUEA 2QA5A 1RIFA 3GZNA 1Y8ZA 4WDRA 4JRZA 1P77A 4LYEA 4DARA 5K8IA 4BQEA 5C8DA 3QW2A 3OOHA 2UUBB 1GV1A 4LYAA 2FPPB 4FHGA 5JSLA 1P5RA 1W44A 1YZNA 3NYWA 4YJHB 4LN1A 2GCEA 4PYKA 4RC9A 4M87A 1VE3A 3EVGA 2QD1A 5EVJA 3KETA 1L4UA 1DE0A 1ICIA 2GN9A 3T7KA 2CJWA 2RGYA 2W93A 3RVDA 1R0XA 5HZGA 1NTOA 2PUJA 4L51A 3FFWA 2C4TA 1J2RA 2EATA 4L2IA 3MJCA 3IYLW 3ERCA 1J07A 3PNVA 1QF6A 1O94C 1QO0A 4JOBA 4Z0HO 4PG5A 2BZGA 2HLPA 3KQKA 1G8SA 4KQEA 1DPFA 5JI3E 4Z8XA 2V7VA 3G9XA 1NLUA 5LDHA 1L3PA 2VBIA 4ZYYA 4NV3A 2LK4A 3NS7A 1NMYA 2FMFA 2OQIA 4HKTA 3NHRA 1JPUA 1XL1A 2GFQA 1FSPA 4I9HA 1FTQA 1TZ2A 3FI9A 2R6HA 2AFHB 1QJCA 2GEBA 3EIQA 4YWJA 3VNVA 1FFWA 4PHGA 3ROGA 4IRUA 4ZVKA 2DPGA 4F6CA 1CR1A 4C6HA 2HO4A 3FZEA 2NYRA 3S3TA 1JJIA 3U8VA 3UV7A 2VS1A 1TYAE 1GD1O 3UQZA 2V1UA 3B53X 4OHVA 3R76A 1NUAA 4C43A 2ZB4A 4G67A 4NJEB 3SXJA 3GXBA 4F91B 2MYTA 3ZE1B 1YIDA 4B3MB 2JZCA 2J3HA 3HZOA 3WYBA 1M2KA 1I2DA 1WSBA 5TIIA 1JWAB 2V65A 1U9YA 5LZ5A 2BHLA 1YS2X 4MP3A 5K0SA 3TL2A 4C21A 4XVRA 3DOOA 2A0WA 2GXUA 5CW1A 4ZYXA 2H0QA 3H5LA 4ZGGA 4NU5A 4BZPA 4R2XA 1LNSA 1A88A 4E3ZA 1T5HX 4BE9A 2JARA 4EELA 3L1MA 3UAXA 5KB3A 1DELA 3LUJA 2PEZA 2BDEA 2H06A 1Z28A 3WZLA 5TF4A 2O0KA 4MMXB 2CZCA 4RHCA 3JYQA 4I4NA 4AZSA 4V0QA 5LXTA 1G18A 3L4BA 2WJAA 2B6NA 4KQFA 4KVZA 4R71A 2B3TA 2V7TA 1X0XA 2JLAA 3K8QA 1TR2A 2ZBVA 2EDCA 1SK9A 2J8ZA 5KX5A 4Z3KA 1RXEA 2BZ0A 3OZAA 1PNTA 2Z5VA 3DWIA 3GRAA 4ENRA 1NBMD 1AGNA 3I1YA 5HEKA 3LLCA 2XB6A 3LHFA 3VYTB 4EB6A 1H0RA 3MWYW 3QEKA 4CL2A 1MHTA 1XD2B 1AGXA 1RJWA 1M2VB 4FINA 2MWMA 4MVOA 4TZ0A 3G2HA 1II0A 5FUYA 2D0DA 1O97C 4TSFA 1GPLA 1CUBA 2MTBA 1VRWA 4MTGA 1PVVA 3B29A 2XNDA 2PUGA 3BICA 2RAVA 3G2PA 4KGDA 2IE0A 2WEKA 1KA9H 1YQWA 3WAQA 1GQQA 1BXGB 4B74A 4EW2A 9LDBA 5AJYA 3Q3VA 3K5IA 1ZOIA 3LT4A 2WSLA 5JMOA 2R5FA 2FOLA 3LPAA 3QJGA 4ETNA 5KJFA 1XIVA 4B8YA 1TMGE 3W9UA 1XAJA 4D56A 2X9GA 3ESAA 1MMGA 1TT5A 1S02A 2FPUA 3U7HB 2G09A 3O8BA 4OYRA 5B1AC 3W7BA 2J8WA 1MQSA 4P82A 3TTTA 4YR7A 3DZHA 3KQLA 5EMLA 3QJ5A 2YQYA 3WS7A 5EHZA 4D0RA 5JY1A 3EYAA 3KXLA 5GONB 4PZLA 3ASZA 1U2DA 1KKLA 4L8FA 4CPDA 1EINA 5KOJA 1V39A 5J4HA 2Q7DA 2OK8A 4FS3A 4AY5A 3UV3A 1GY8A 1BXKA 2GAAA 4QO8A 2R8PA 5LYYA 5ALNA 4ULVA 1K97A 1RLUA 2PJDA 2BR5A 2OSVA 3K53A 5TGTA 1OZFA 2QQEA 1E63A 2VNHA 5F28E 1QLWA 3QRWA 1W0JD 1SXHA 1JE1A 3ORHA 4AI6A 2AXQA 2PLAA 1K4YA 2ROQA 2BEWB 1R3UA 2BP7A 3MAGA 3HB5X 2PY6A 2QZ9A 3ZYCA 2IW3A 3PJDA 4J0HA 3FMVA 4CE6A 4XEHA 3MX3A 1YS6A 2P1DA 1I6MA 1SJ9A 3L7NA 4QFCA 2VP3A 3B1WA 4R98A 3VJMA 4AMUA 4OJTA 1F7VA 1R12A 1CRQA 3QPAA 1GRQA 1MNQA 4ESEA 2Y8EA 2QXYA 1JKXA 3LS1A 4GLJA 1FRNA 3QP9A 2PA0A 4JCOA 3QMWA 4NFSA 1JLMA 2NVOA 2C7GA 4DMCA 2O6HA 1M8JA 4I1RA 3GRZA 3HUDA 4YRTA 2BC5A 1CZHA 2CJWB 4QG7A 3AR4A 1TCVA 2DVMA 5AMXA 4DM3A 1JTFA 2WWHA 1SUAA 4X54A 3DE9A 3ZU2A 3BJMA 2OGSA 5JEEA 4L2IB 3FZNA 5FWDA 4J4HA 2V26A 1GZVA 3EWNA 1D0SA 2WYWA 3QMPA 1V8ZA 2C2MA 3P32A 1OGIA 5FJIA 5L0IA 3QOWA 4UDXX 2XYGA 3JWGA 3E8XA 3EVCA 3EEFA 1C0IA 1AO3A 3MWDA 3FTNA 3B7GA 1PLJA 2ECPA 1DTSA 4DLRA 3UJAA 4IHKA 3FAKA 4I1UA 3VKGA 4EG0A 1PFQA 4TUYA 3C70A 2ATXA 4IRUB 4F12A 4WOKA 3I83A 3LBFA 1V8DA 1RHMA 2V55B 1YMUA 3AU9A 1SBIA 1OFUA 1CUFA 2HRQA 3NHJA 2HK6A 3JYNA 4NJMB 4DEYA 2Z2YA 4UM8B 4NU6A 2J0UA 4KAJA 4WLEA 4GM4A 1IHYA 1QVVA 3E70C 1SKBA 1ODTC 1NC1A 5KQGA 1LLQA 3LBNA 3BDVA 3NONA 4NE7A 2ZUUA 1IN7A 1QYDA 3UGJA 2VR1A 2JH9A 4IYRA 4KI2A 2B4TO 1VOMA 4JKYA 4TV9A 3DPSA 4IXTA 5I9TA 1XD9A 4BNIA 4EY8A 1FPMA 4P31A 3L1VA 1KC1A 3H4TA 3BQNB 5L0HA 3CR3C 1T6YA 3KFLA 3OFKA 1T0IA 4QNRA 4AW9A 5FA5A 1KF0A 1C8BA 1UPAA 4MGYR 3RTAA 5JMTA 2AFVA 1DIBA 4BVFA 2D0OB 2N42A 5IAGA 3CPEA 1XELA 3JWEA 1SHLA 2AUMA 1B6RA 5AM1A 4RIIA 4KJXA 1NN0A 4WXRA 3KEMA 2O9XA 1DINA 2C8VA 3GBPA 2RB5A 3SHQA 3D0KA 1E99A 1JYSA 5HK8A 4TS1A 2JD0A 4NXNB 3DC7A 4CMJA 1POXA 3BFKA 4MUJA 3BRQA 4IDPA 2XOKD 4EHJA 4CKXA 3HB7A 3HR4A 3EGIA 5KEIA 4TT8A 2DWOA 1G9XA 5CG2A 2JLVA 3DV9A 4O4IA 4Q1EA 4XEKA 2ZE7A 5SY6A 1U8TA 5EQTA 4CKBA 4GYJA 2J09A 2EC5A 4XJTA 2C7RA 3L8HA 4HYTA 4L4UA 2CKMA 1ZK3A 3W9SA 5THKA 1P7CA 4F6RB 1W36C 4QARA 3ZDEA 4E07A 1EUCA 2WIFA 3MS2A 1DBPA 3N7TA 1K8YB 3OO1A 5HIMA 1ORRA 3IIJA 5ESXA 4N4AA 4C6RA 4YT4A 3KAKA 3RRYA 3ZV4A 2NNWB 4RQUA 4V03A 4J91A 4G7HF 2BRUA 4XLLA 4CR8A 1JT9A 5JSZA 2VJDA 1Z39A 1WPXA 1P4SA 3GMIA 1GNTA 2ZREA 1YRLA 2QE7A 2Z2JA 3ROTA 1W6UA 3PDIB 1T9GR 4DMMA 4ZVSA 2UU9B 4LRYA 3EA5A 4EYQA 5ER6A 2RHRA 1P1BA 1UT6A