5L3QA

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
273
structure length
265
Chain Sequence
NEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDNKRKMIQHAVFKELVKLVDPGVKAWTPTKGKQNVIMFVGLQGSGKTTTCSKLAYYYQRKGWKTCLICADTFRAGAFDQLKQNATKARIPFYGSYTEMDPVIIASEGVEKFKNENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKLDGHAKGGGALSAVAATKSPIIFIGTGEHIDDFEPFKTQPFISKLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Signal recognition particle 54 kDa protein
total genus 90
structure length 265
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
A PF02978 SRP_SPB Signal peptide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3qA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qA02
2UVQA 3MUFA 3ZS9A 2ZVQX 3BFXA 1W0KD 1X8KA 1LNZA 3OAAA 1JAHA 1EFTA 3T1QA 3SYKA 1M8PA 3H2YA 4Z8YA 5KOYA 5BQ5A 4TLEA 4BPBA 2RH5A 2ZEJA 1H8HD 1VECA 2ZM5A 1FZQA 3OAAD 2RGAA 5BN5A 1ZNWA 2JLXA 3T34A 5L3RA 2B7BA 2BMFA 2ZJYA 3ZDQA 2WOOA 4EAQA 4JLBA 3AP1A 3MGCA 3KQLA 3AGPA 3GLHB 4BWYA 2V1XA 1XEFA 2QBYB 4QGGA 1WF3A 1F2TA 1E2MA 1G64A 2OHFA 4BFYA 2D06A 3LY5A 2OILA 3BB1A 4MRPA 2VP6A 5C2JB 4V02A 1X8JA 1S1CA 1TUIA 4DDUA 1HQYE 2YNMA 1QHNA 2X2FA 4MYUA 1I4TD 3AKDA 4F4JA 4JJKA 1JEDA 4TYYA 2CNWA 4BLQA 1CKEA 3IBGA 2KE5A 2VL7A 1Z2AA 2VA8A 1AZSC 1UFQA 4DLYA 1KK1A 1C4OA 2GETA 3EPLA 2O52A 3IQWA 1SZPA 5KDOA 2F7SA 3Q3JB 4M1OA 2ZJAA 3W34A 4NYJQ 3AVOA 2ZRBA 1WQ1R 1BH2A 4O25A 2IUSA 1GRNA 3FFAA 4PC2A 1P6XA 3IUYA 2YWGA 5GVSA 2Q9CA 1N6OA 5A4JA 1P61B 2ZSDA 2E87A 4ASUD 2UZ3A 4I1VA 4M0LA 3K1JA 1N6KA 5LD2B 5JI3E 1XCGB 2QAGA 2QRNA 2CVHA 2IS6A 2BJWA 1XRJA 5ELXA 3QE0A 1WXQA 2IYVA 3DKVA 2P5SA 4U02A 4W5JA 3UK6A 3T15A 3PVSA 3Q8XB 4URVR 3U6BA 1AK2A 4MRSA 4QBGB 3TBKA 5KSOA 2C95A 3AQ4A 4TMKA 2VP0A 4RD3A 3T35A 3PIRA 2C98A 2GJAA 2KWIA 4MUAA 4OHXA 1CR2A 1ZNXA 2JLYA 2QUZA 3PUXA 4I99A 5DHAA 3MAAC 3UKDA 3RANA 2KJQA 2A9KA 2KBEA 4X8MA 5JHGB 1OHHD 1JPJA 2VSOA 4GZLA 4GOXA 1OH8A 2YHSA 2D2FA 1W4BA 4DC9A 3LA6A 1CRQA 4ZDKA 1UEJA 521PA 1JR6A 5FBLB 1H65A 4TZ0A 3W90A 3LVRE 1XCMA 5FOSA 1P5ZB 3PUVA 2ZRIA 5AUNB 5P21A 4DB4A 4UKDA 3UATA 2YOGA 3PR1A 4D0NA 3L8YA 3QG5A 4DSUA 4PFSA 1Z28A 1SQ5A 1KMQA 3RRNA 1HY3A 3ZJYA 3AP3A 4L15A 1G7TA 5H1YA 2QP9X 3T1VA 4F93B 2ZE5A 2Z6VA 1CIPA 2E9SA 1PJRA 2ZVPX 1E3MA 4W9MC 2QE7A 1P2SA 3DZ8A 3OZXA 1UF9A 3B8HA 4URZR 3MWJA 4ZO4A 3AVTA 1FFHA 2O8FB 3GFOA 2A5JA 5G41A 3QNUA 5K8TA 2D3WA 3IIKA 1NP6A 1IOZA 2RCNA 4DLWA 2V7QD 1HA3A 4FN5A 4K81B 1KJWA 3BH0A 2QE7D 5CB8A 4GI7A 3EPJA 1RKBA 1G8YA 1R10A 2C77A 1XDBA 4HLCA 2GZHA 3W8NA 4DUGD 2IBMA 2CLDX 3LH5A 4JS0A 5CYPA 3RC8A 1XD9A 1ODFA 2QMEA 5L3QB 4TMVA 1ZM9A 3HU1A 3LWNA 2BBWA 2FG5A 2Z0MA 2NZJA 1AS2A 3IEUA 3QENA 2VHQA 1YVDA 1GWNA 2ZXUA 2WOJA 4FD2A 1XEWX 1LTQA 5LD2C 1G6OA 1NF3A 2DR3A 2EYUA 3CWQA 1DE0A 4BLOA 1W0JD 4TLBA 1QVRA 1P73A 1OH5A 1IY2A 4RD2A 3GLGE 1Z0DA 5EXTA 1T8UA 2F1HA 3FFBA 1Z2CA 1K5DA 2G88A 1AA9A 1GAJA 3NDPA 4KLNA 2IX3A 1BMFD 1JJVA 2BKEA 3EWSA 4HAWA 4AD8A 4EQ6A 3M0EA 4C7OB 2DFNA 2NPFA 1OFHA 3E5HA 3QUSA 1IBRA 2OAQ1 4JT4A 4P32A 4HEJA 4B33A 2NPIA 1AGRA 2GXQA 4R2HA 1Q57A 5EE0A 2FFBA 2PH1A 1CJUC 4PO8A 1GM5A 3Q7QA 4R9UC 4WZAE 1NY5A 1GP2A 1R6BX 3ZGXA 2JDIA 1BYUA 2CE7A 4EPYA 2I3BA 1L8QA 1E1RA 1KO1A 4RKEA 2OUKA 2D7DA 4Q9HA 1KK3A 3LBNA 2W2VA 5J40A 4MYHA 4IOLA 2EFDB 3KUCA 1E2QA 4PAMA 4IOJA 4Q1CA 2WMOB 1R0XA 1VCIA 4Q4HA 2B21A 4FMCB 1G8FA 1PZNA 1AKYA 5HZHA 5BN4A 2VPPA 3S1AA 1W4AA 1XZPA 1Z83A 1D9XA 1QRAA 3KTAB 5AUQA 1X8LA 2OXRA 3THXB 1S3GA 1KO4A 3KB1A 1JECA 2BOVA 4YQFA 2YKGA 5DN6A 1U8AA 4TMWA 2ZRLA 5FOVA 2OG2A 4KVGA 1CU1A 1F3OA 4LJYA 1TEVA 3RWOA 2VBCA 1BO6A 1MV5A 1T0HB 1YZNA 1IHUA 1N6RA 3GQBA 4TYQA 1SXJC 4DCUA 2ZITA 1QDEA 4UJ3A 1UBGA 4JBYA 1ZUNB 2OT3B 1NN0A 3MFYA 3QKRB 1ZU4A 1NIJA 1IN4A 3OF5A 4BFXA 4Q4AB 1F2TB 2QRZA 2WSSA 2ZU6A 2QM8A 3ONWA 3VKHA 2EVWX 2AXNA 1NVXQ 1N6LA 4B44A 4P0TA 4V0MA 4QKQA 1M7HA 4TYWA 1CR0A 1I4LD 2WJIA 3LO5A 4V0NA 1E0AA 1YKSA 1XMVA 2GRJA 2W2XA 4G0NA 1KGDA 3CRRA 1X1SA 3SU8A 2REBA 1W4RA 3H84A 5CB6A 2ONJA 5DE3A 3ZD6A 1E2FA 3KL4A 1R4AA 1J2JA 4D81A 4DEYA 3QXHA 3LRPA 1NN3A 1QF9A 4Y0AA 5DNYB 1SKYE 2ZI7A 3IHWA 2JLUA 3ZZTA 2QGZA 4DLUA 3VU9B 1XPUA 1IJEA 5KSZA 1ZUHA 3MWKA 3QPWA 4DDTA 3GLIA 4W7SA 3BB3A 3G5UA 1VCOA 1E9FA 2GVZC 1T3HA 1VCNA 3VHXA 1Q20A 1SVWA 5BW8A 3DOFA 4LOAA 5JWOA 3EX7C 5IF9A 1OXUA 5FUVA 4BLSA 4MDEA 1G6HA 4TTQA 4TWZA 4F4CA 1US8A 1OFUX 2ZREA 5UKDA 2ZR7A 1CF4A 1YZLA 4PQRA 2GJ9A 5F98A 1J90A 1CTQA 3HWSA 1E4YA 4P4UA 4C4PA 3ICEA 4C9BA 4AY2A 4DB2A 4MUBA 1XZQA 4CZ2A 4QG7A 4A0HA 3U3RA 3BAFA 4JLKA 4WA7A 2ZUCA 1L7VC 1W4CA 3ZVRA 4RD4A 1RW4A 4OL0A 4US1R 2O0HA 3EWAA 2XOKD 3OEHA 3D8BA 1FUUA 4P4TA 4R7ZA 1A2KC 3AUXA 4NPHA 2HF8A 5H68A 3FHTA 1L4UA 1W44A 1S2MA 4D2IA 2P5TB 1Z07A 2JLZA 4YMUA 1EFHA 2D2EA 4C0SA 2CCKA 4TMZA 3QQ5A 3OIWA 4A92A 1KDRA 4JYBA 4RZ2A 3GLHE 8OHMA 2H8KA 2O0KA 4G5SA 2R6CA 3F0TA 5EUQB 2ORVA 4JMPA 5EXXA 1T4GA 5D3QA 5EE1A 3IPYA 3TJZA 1ZYUA 2LCFA 3KDSE 3ND9A 4NKRA 1TQ6A 4LSGA 4DLRA 4NZYA 1P9RA 4Q01A 1ZP6A 3R8FA 1RE0A 1WDTA 2BBTA 2QROA 4LC1A 5IRCD 3C5CA 2X8AA 4CEHB 3RSLA 1JQLB 1QHYA 1G3MA 2FH5B 2R44A 3NEJA 3ZZUA 3AVYA 3RNLA 1KZGB 5J4HA 4EJSA 3BS4A 1VYVA 3U4QB 1WGWA 1TQDA 1N3BA 2ORIA 4GOKA 2JEOA 1OXSC 2QTFA 1QHHA 1XD8A 5AJYA 4DDWA 3O8CA 3GMTA 5JJLA 4LBVA 2PCJA 5KDLA 5FPTA 3ADCA 3B1ZA 1XXHE 2KI5A 1K5GA 3GLFB 3GJ0A 4MYCA 1EFUA 1GILA 1YRAA 4D80A 4HLUC 5HE9A 2ZRAA 4C0JA 2AD5A 2QQ0A 4A82A 2MSDB 3KUDA 2FJUA 4A2PA 2GEVA 4KSCA 1FTNA 1OLOA 2BBSA 2IS4A 1EXMA 1XX6A 2PMKA 3DPUA 2XXAB 5DI3A 2Y8EA 3ZH9B 5B57C 2JLRA 4GT1A 1Z6GA 4Q21A 3T5GA 3NKVA 1BKDR 2GA8A 1VTKA 3PEWA 4LJAA 3DDCA 1NVWQ 2EU8A 1NN5A 3IILA 4LDJA 2HLDA 4M9XA 4IDOA 1XPOA 1SVOA 2WKPA 3VMFA 2QMOA 3H0KA 4X8HA 5HKKA 3OIUA 3CF0A 3PUYA 4L16A 3ICQB 1KI6A 4OK3A 4UQOA 1E9BA 3EZ6A 2ZE7A 2NGRA 4JLNA 3U7EB 5E95A 5G53C 3GP8A 2CXXA 2WKQA 3C4JA 2XEXA 1XXHB 1ZBDA 1YHNA 5JI2E 3MLEA 4HI0E 2QNRA 5FOTA 1MABA 2JJ2D 4TQ9A 1RYHA 4DCVA 3EC2A 2JLSA 1CR4A 1XTIA 4ZDWA 2BHRA 1KI7A 5C46F 1CP2A 2JAQA 4HLDA 3C14C 4B73A 4QBFA 2A5GA 1W5SA 821PA 1W0KA 2GTPA 3CNOA 1US8B 2ATVA 1JXOA 2IA5A 2PT5A 1KO7A 3F5FA 2VP9A 5JRJA 1ZD9A 3B13B 2VRWA 5KNDA 4AG5A 1FUKA 2DY1A 3LFUA 2FEMA 2ZQ5A 1G7RA 2EFHB 1P72A 4K8OA 3I8XA 1GFIA 5TARA 4M8NE 3NG1A 2BMDA 5FPYA 3MWLA 1U98A 2RHDA 5H70A 3K0CA 3CPJB 3PFIA 4CEJA 2JIZA 3EIHA 3SJBA 4RSGA 2CLCX 4PHHA 1QHSA 2AX4A 3TUZC 4F92B 4V0KA 2GJ8A 4KODA 2VYFA 1YJ5A 2J0UA 2X1VA 3L0SA 3VQTA 1OH6A 1KIMA 1OIWA 3PCRB 4KO8A 3UMSA 3QKSB 4G01B 2QP4A 2VSFA 3CRMA 1W47A 1G7CA 3TGPA 2ZYVX 2YWHA 4MRVA 2ZSFA 4U7DA 3C41J 3CO5A 2AK2A 4FMDF 1R5BA 4DLVA 5HKKD 4M9SA 4PHFA 4E07A 2QENA 1Z0JA 4DDVA 1E2NA 5AK0A 3FE2A 1IN7A 3SOPA 3X1WA 1Z5ZA 3HPQA 5E7MA 4UNRA 2IYLD 2OSBA 2WKRA 2WPDD 2PLFA 2QORA 3SNHA 3TVDA 1NMYA 5JCZA 3SQXA 5CM8B 4B34A 3U3JA 4B2PA 1XU4A 1P60A 4PC6A 4POAA 2JA1A 1U99A 1DAGA 2HEIA 1II9A 4IHQA 5FTMA 3WYAA 4MKFA 5CDFA 4BLRA 4DEXA 5J5CA 5L8VA 1EG7A 1GOTA 2QGNA 2DBYA 2YOFA 4HDQB 2AD1A 2ODNA 5KNCA 1UKYA 2FF7A 3THYB 3DVLA 1GZSA 3D31A 3H1TA 1HH4A 4OQNA 2VEDA 2WWGA 4PC3A 2AFHE 1NI3A 2BC9A 1NN1A 2OLKA 3H86A 4PPQA 4Z8XA 2F3RA 2IYWA 5JEEA 3R9WA 4LPKA 3QXXA 2WHXA 3CPEA 3W6PA 3A6PC 1PLJA 4BFTA 3JVVA 5CLQA 2ZSEA 1AS3A 5AJVB 4DT1B 1T0JB 2W0SA 4DWJA 2EWWA 1GSIA 1EWRA 1NJFA 3TVTA 4QJ5A 3EASA 1NIPA 3W5JA 2CL7X 3WP1B 4LJ5A 3ZQJA 5CLLA 1ZW6A 4C7OA 5DSZA 2PJZA 1D2EA 1U0HC 3P20A 2C04A 1VHLA 1LS1A 4JL8A 4KI0A 1CULC 1DS6A 1DAMA 4HUQA 4V0ME 1Z6AA 3LLUA 1P75A 1YZGA 4CGZA 1B23P 3P4YA 4KLZA 1C9KA 2QMHA 3CB4A 4FMDB 3D3QA 2CL6X 2WWIA 1OFIA 2FPMA 2C99A 4IDQA 1AIPA 4YC7A 1KI9A 3PEUA 3U61B 3RS2A 5DIFA 1KI2A 1E9RA 4WZ6A 1OIXA 3CH5A 1SKYB 2ZJOA 3WYGA 2FSFA 2B7CA 4A2WA 3U2QA 3W3ZB 1GTVA 2VHUA 3IBYA 2H18A 4HAYA 2J41A 1EESA 1Z47A 4PPGA 3ZYCA 2GCOA 1YZTA 3I92A 3LQQA 3TQFA 4AKGA 3UWKA 2HT1A 2HYDA 5IK2A 1MO6A 3FGNA 3KKQA 5JZVA 4XD7D 5KPDA 2DYKA 2ZSBA 3BWDD 2DFLA 2GWHA 3WHLA 2H57A 3KXLA 3T61A 2YINC 1UM8A 1VIAA 3B60A 1E2JA 1R8SA 1GDDA 4JT2A 5TDHA 4ERNA 4YXWD 1AN0A 3QXCA 4A9AA 4MDFA 1KTVA 5DO9A 2C78A 4MRNA 2GEUA 1N6PA 1RRGA 2IYUA 3HJNA 4L9SA 5JLJA 4MGKR 2W0MA 1CRPA 2CK3A 3WNDA 3R9XA 1WCV1 1OB2A 4FINA 4L8GA 4EPRA 3L0IB 4I81A 1J99A 2CVFA 3AF4A 3EZ2A 2DFKB 2DPXA 5DI3B 1XBTA 3QG1A 3GLIB 1Q3TA 2BCGY 3CH4B 2IWRA 1JQJC 3QKSA 1P9WA 5FL3A 1KSHA 3W8RA 1LF5A 1LVGA 1OYWA 4OBEA 1PLLA 3KX2A 2JJ1A 4M1KA 1ZM4A 1OYYA 1HURA 3QVVA 1T5IA 4OQMA 3WYFA 3KKPA 1YR8A 2RGDA 1FMJA 2ZIAA 4DBLC 4LBYA 4O0MA 1HYQA 2P6RA 2AL7A 1ELOA 1G21E 3REGA 4JJZA 4B6EA 5JSZB 4M1WA 2GF9A 3R7WB 4C0LA 2FDCA 4D26A 2OFOA 1ESNA 4KAXA 1E2DA 2DCUA 3RS4A 4KCGA 4QFMA 1E9AA 3K9LA 3MG9A 2J45A 1MKYA 3WNBA 4HAVA 1G3UA 2PEYA 4DJTA 2B92A 2ZRFA 1IAQA 2OXCA 3QKRA 1E2PA 1KY2A 2I1VB 4M9ZA 2C2HA 2GCNA 2N1BA 1E99A 1LB1B 4M1SA 4H9GA 3L8ZA 5EP2A 3VR3A 2RB4A 2ANCA 1P9NA 2NZ8A 221PA 3DM5A 1YR6A 2AN9A 621PA 3CBQA 3GJ5A 3WP0A 2ZETA 4OI2A 2ORWA 3TE6A 5A5GA 2B8WA 1AS0A 2QPAA 1HE1C 2O8CB 5JHHB 4PZZA 2Q3MA 3LBIA 4NE2A 4RCYA 2VO1A 1CJMA 5C4MA 3B2EA 4IW3B 3DZDA 4G5GA 4TLDA 4B74A 2CK3D 3I3SR 3LW8A 4LC0A 1E0JA 4DLZA 4ZI2A 5K8LA 4CDGA 1G4AE 4UNSA 3OFND 3U3KA 3AM1A 1UEIA 1E0KA 2HXSA 1FOEB 5J4LA 2QBYA 1XD2A 2GZDA 4NYIR 3KB2A 1DEKA 1T3LA 1ZRHA 1ZMXA 5FH9A 2J9RA 2UZIR 4IVQA 1COWA 5DLQC 3ZS8A 4CVNA 4US2R 5K8UA 4DCTA 2EQBA 2AK3A 2OCPA 2QI9C 4GNKA 4XH9B 3W3AA 1Q1QA 2ZI4A 5EXPA 3JZMA 2O8DB 4RD0A 3A8TA 2NMVA 4Q02A 3QOFA 3HR7A 1NL3A 1UKVY 4QNRA 4C30A 4Q1FA 4RY2A 3RC3A 3QI2A 2YOHA 1E4VA 1I2DA 2J87A 3CR7A 4KFSA 3PXGA 4QHYA 5DI9A 1AZTA 1ZUIA 4TTRA 3KFVA 4Q7KA 5EP1A 4DT1A 4EFMA 4TYNA 3I62A 3QKUA 4IFBA 4JVNA 4A6PA 1EFRD 2WWWA 3CM0A 4V03A 1JR3A 2IWHA 3B1VA 2EW1A 3ND8A 5FTKA 2OCYC 4PX9A 4LK2A 4AK9A 1G16A 5DISB 4DKXA 4A8JC 3L2OB 1KNXA 3BC1A 2A5DA 1ZIOA 3LBHA 4LV6A 1WRBA 1GVNB 2PMDA 5JCPA 3N2EA 2CBZA 2P65A 2RMKA 3A4LA 3K8YA 3MJHA 4Z1MA 4DVGA 4B35A 1A7JA 1FNMA 3ECCA 4BRUA 2A5FA 2NO9A 3RS3A 5HCIA 2GKSA 2ZAMA 2O8BB 1BIFA 1MO4A 5DH9A 1Z0AA 4UJ5A 4WAUA 3SJAA 2ZRHA 5SZHB 4PHGA 1A5TA 1FNNA 4TQAA 5AJZA 1JBKA 3GCGA 4ZDIA 2CCJA 2QA5A 3CUEF 4Q4HB 1N6NA 3A36A 3FHCB 4ZCLA 5FOXA 3LLMA 3B9PA 3KFXA 5HR5A 4IXNA 4RVCA 2DWPA 3FVQA 1FMLA 3X1XA 1DBSA 2V4ZA 1VCMA 1ZIPA 2PL3A 2REXB 3QJYA 1KHTA 4ITRC 3U3OA 5AUPB 4LUCA 2IT1A 2YYZA 4JL5A 3KZ1E 3T1OA 4A0GA 2PX0A 3GEIA 4Q9LA 2EFGA 1V43A 1KDPA 4BEJA 3V4FA 3S1AB 1QHXA 2RGBA 5TVKA 5LPNA 3I8SA 1S3SA 2WM9B 1CS4C 1J7KA 1IN8A 1Z6XA 5LBIA 2BM0A 3SE0A 2A2ZA 4A6XA 3VR2A 1KZ7B 5KSPA 2R8RA 1II8A 1S4QA 1XEXB 1NBME 4IOKA 3LW7A 1G9XA 5B58C 3BGWA 2CDNA 3LXRA 1A1VA 1JNYA 3TSOA 1EGAA 3ZIAD 4A8JA 1IY0A 1CBUA 2A3RA 1Q22A 2WWHA 3K9GA 1MRNA 1IXRC 1OV4A 4P31A 5J47A 2J1LA 4KJZA 2Q3FA 2C96A 3U60B 4L9WA 2R6FA 2ZJ5A 1WP9A 1XJ0A 5K8IA 4TZ6A 1NLFA 2TMKA 1FP6A 1UBCA 1QHIA 4YMWA 4EIWA 2JLQA 1TTTA 2HYIC 2GAAA 3TR0A 1TAGA 3I61A 4XTRA 3E70C 1SVMA 3RVBA 4E22A 1JAIA 4A8JB 3BOSA 4A1FA 3NDBB 1WA5A 2FGKA 2G77B 2W6JD 2W6JA 2G83A 4YDSA 1Q1BA 1BOFA 4XJXA 2OBLA 4EDHA 3TW8B 1VYTA 5HCNA 3AF3A 1TADA 4QRHA 3FHOA 3NWJA 4EPVA 4OKSA 3ZD7A 3B9QA 3B7GA 3K0SA 4FCTA 3A1TA 1N0UA 4DRZA 1EWQA 2YC2C 3EA5A 1J70A 3T5DA 1U9IC 1R7RA 2PCLA 3QF7A 1TQ4A 4KYUA 2KSQA 2RGNA 4JLVA 4Q4AA 4WXPA 3V00A 2R62A 4KITB 2HCJB 5GJCA 3NH9A 3U44B 2XTNA 1S8FA 1NSTA 1CJKC 2YZ2A 4BFSA 1JI0A 3CRQA 4N0DA 2IYSA 1N6HA 1FTSA 3K9NA 2BEJA 3WRXC 3TAUA 2ZPTX 2QEQA 3Q72A 2DHRA 4DCNA 1TF7A 2IYXA 4FWTA 4OYHA 1TNDA 3FPAA 5FBWB 1E69A 5TMPA 4XWAA 5AWFC 2FV8A 2J59A 3AVPA 5DGXA 4QBIA 2PJRA 3A1UA 5J4VA 1D5CA 2I1QA 1YU9A 2WJJA 5GJBA 2QZ4A 4R2IA 1Q44A 2XB4A 3CR8A 1UJ2A 4OJQA 2G9NA 2W83A 4PSAA 3QXJA 4AURA 5JWHA 5JRZA 1WB9A 3HPRA 4QNMA 4V0LA 2WSSD 4KU4A 3PEYA 3K0AA 4R98A 3THOA 2IS2A 4GPTA 3VHLB 2J0UB 2IW3A 2ZR0A 4RFSA 3U7FB 4BFVA 1OXVA 3OESA 3V9PA 1XB2A 1KO5A 2OCAA 3UMFA 3REFA 4RKFA 4GMXA 1R0WA 2G3YA 1L2TA 3KKNA 4B43A 2A7QA 3TNFA 1VIYA 4ZCMA 4JVMA 3ZLJA 2GNOA 2F9MA 1K8RA 5JBQA 2WIBA 4IJMA 1M1YE 1FL9A 4KBFA 3MMPA 2P67A 3AGQA 5BXQC 2C5LA 4QM7A 4QOSA 2IXGA 2ZAOA 4PHTA 3FKSA 2JLWA 4D4JA 1X3SA 2KBFA 2YJTD 4HAZA 1ZM2A 2WPDA 3GFPA 3AVWA 2ZI5A 1KY3A 2FE4A 3UG6A 4NU0A 1XNJA 4OI4A 4TQUS 2EFCB 3GEEA 3B1YA 3VR1A 1U94A 2IHYA 4K46A 2AWOA 2F1IA 4ACBA 1XTRA 3WBKA 1N2CE 2XOKA 4PAQA 4AYXA 1NMZA 3CZQA 3IHLA 4OHYA 3TR5A 2GK6A 5CYOA 2OZEA 3WY9A 3CPHA 4D4LA 2BIFA 1GL6A 1EK0A 3ADBA 3MWYW 3NBFA 5KTYA 1RRFA 2LKCA 3K9HA 4H1UA 1E9DA 4B3XA 4OQXA 4DIDA 4EUNA 1ESMA 1FW6A 2RGNC 4C0BA 2YC4C 1Z6TA 2G0TA 2ZROA 4NYMQ 1Z22A 2IF0A 4RZUA 1F60A 4TLAA 1GUAA 1ANKA 4LJ6A 2PT7A 4Q7JB 4FMCF 4M1YA 3RAPR 2FGJA 3RYTC 4W5WA 4XOIA 5EUMA 4LY6A 4BRWA 4HUTA 3RWMB 4URUR 3NC0C 4JLJA 2AHOA 5SZIA 4LHZA 2GXUA 3A1VA 5KU1A 3J81k 1DAKA 2J0VA 3CF2A 3THWA 1KK0A 3K0EA 2OFWA 3A1WA 3QKTA 1N0WA 4I1OA 5CK4A 4ZIRB 2J5XA 2VHTA 1DARA 4JKYA 3F8TA 2P6NA 4FWIB 4Z51A 1SGWA 4O3MA 1P2UA 3CKLA 3C15C 4I1SA 2JJ2A 1HUQA 4C0KA 2Q21A 5JSZA 1Z08A 2VHCA 5F3WB 1F2UB 1ZM7A 1XJCA 3K0FA 4Q03A 2ERYA 2XTZA 2JCSA 4L5BA 1XWIA 1U81A 2J0SA 2WIAA 2PLRA 5B30A 1MO5A 4QJ3A 2ECKA 3UMRA 3CX6A 2IEZA 3QBVA 2HT6A 5EZ5A 5HTKA 1W36B 4PPNA 4QJ4A 1NG1A 5IT5A 1NRJB 3EARA 1PV4A 3QEJA 2ZI9A 4CW7A 3B82A 4A36A 2OAP1 4A15A 5JS8A 2W6IA 4PPFA 2HF9A 3OHMA 1KJYA 3VR6A 1CR1A 4II7A 1AJEA 2J0QA 4TL9A 2NO1A 1PUJA 1CLUA 3EZ7A 4IEEA 4ILEA 1BMFA 3TRFA 5E3HA 3T1TA 5FUWA 5CITA 1X86B 3SZRA 3PUZA 3E2IA 3OEED 1RPZA 1VG1A 1W48A 3DMNA 3RSOA 3EA0A 3GLIE 2ZRGA 1NVVR 2V1UA 1Q21A 2QP3A 1MOZA 3CX7A 4KFTA 2Z5FA 3BK7A 2JDID 1ZCBA 1L4YA 3KKMA 1E2GA 3M6AA 4XWOA 1LV7A 1OXXK 1DVRA 2GXAA 4IXMA 1ZVQA 2F9LA 4E5UA 1E9CA 3TUIC 4DHEA 4UXHA 2XITA 4Q00A 3BH6A 2NO0A 2W58A 4TL7A 1Z63A 1Y3AA 2ZS8A 2NOAA 5E7IA 2XX3A 3VKWA 1S9DA 4HLQB 1G20E 4IKEA 1KI8A 1GL9B 3R8CA 3RS7A 1WMSA 5L3VA 2GAOA 4NCIA 5EQTA 1XMSA 4Q1AA 1GITA 1QG2A 2EWVA 2XJ4A 3O8BA 3Q5DA 5CIQA 1P2VA 3K0CC 3TQCA 2ZUDA 4LRWA 3G82C 4M9QA 4YLGA 4L4UA 1XTKA 4KVAA 4XWKA 3UPUA 3SHFA 1XPRA 1XEWY 2FZ4A 3R7WA 1GNPA 4NH0A 4NHOA 4E09A 2YVUA 2GEDA 4OHWA 1U8YA 4PO1A 3FMIA 1Z3IX 4PZYA 1PLKA 2AKAB 3L82B 2VLIA 4G5RA 2F43B 3BD9A 3AF1A 2JGNA 5FOUA 5F9HA 3WRYC 2W00A 4B75A 3DM9B 2PEZA 1D2NA 2ODWA 1LY1A 4LBWA 3VX3A 1N25A 4BZQA 1YQTA 4B3BA 2P2LA 1IM2A 5KHOC 3JZAA 4GL2A 2VF8A 3LAWA 1E1RD 4IFEA 1PVOA 2ZE6A 2V54A 4DSOA 4Q18A 1H8EA 3EC1A 2WWYA 3KJEA 4LHYA 2OESA 5KDDA 3KXKA 4BE7B 1D6JA 2MSCB 1VG8A 5BN3A 1YZKA 2WAYA 1RIFA 1DPFA 2N46A 2ZANA 4Q48A 4S35A 4V0OA 3NXSA 1GNRA 5EE3A 121PA 4CEHA 1DAIA 4ZIRA 3VAAA 2GBLA 4R71A 1KDOA 3UANA 2LKDA 2PZFA 2NIPA 1DG3A 5EP3A 1TQ2A 2FOLA 4ESHA 1K6MA 2IYQA 2XSZA 3MRSA 4OHVA 2V6IA 4O2RA 3K53A 4Q1DA 721PA 3LDAA 3K09C 5JJKA 2IL1A 2V6JA 4IVRA 1SHZA 2H5EA 3BH7A 2O8CA 1G41A 2AR7A 2NO6A 4Q5IA 4B3DA 3U7GA 1G3RA 3BJIC 4PQFA 3W5IA 3DMDA 1X1RA 1XXHA 3W6OA 2R65A 1S1MA 3MSXA 5EZ6B 4DXAA 1XFAA 4D4MA 4LJ8A 5SZKB 5LDDC 4HSEA 2P3SA 3TSWA 2WJYA 5IK2D 4IRUB 1KI6B 2XJ9A 4GBMA 1FX0B 3NBYC 4PSKA 5A0FA 6Q21A 1VPLA 3QVUA 1G5TA 3SI7A 1AM4D 3AVUA 2IYTA 3LXXA 4HLUA 5BYKA 4JL6A 1UAAA 4XSHA 2H92A 4WVFA 1KNQA 3EXAA 4QHTA 3GLFE 2PBRA 3RABA 1DO2A 4J0QA 3AKEA 3SJCA 1M34E 2VF7A 5J4YA 1IXZA 3KXIA 1QBKC 3MJRA 4OK5A 2X77A 2A78A 2QG6A 3CNLA 5L3SA 4LPSA 1R5NA 1BYIA 3UWOA 3SR0A 3DEFA 1ZM3A 4JLMA 3PITA 4URYR 1LF0A 3RHFA 1KSGA 2IYYA 1Q3HA 1E2EA 1OIVA 5FTNA 2BMJA 3B1WA 1E6CA 3RS5A 3KJGA 4AC9A 1GNQA 3QIAA 1DG1G 5FOWA 2O8EB 1F5NA 4LBZA 1TMKA 2FFQA 4P4SB 2AXPA 4RJLA 1W2HA 3AF0A 4AIIA 4DLTA 5KYKA 3GPLA 2HV8A 1IONA 1GG2A 4M53A 2CHGA 1RZ3A 1OT3A 2J46A 5BYJA 1DELA 4NONA 3MD0A 4XTCS 3C8UA 2F3TA 2HUPA 3TLXA 3LNCA 2PZEA 3FYHA 2VQSA 4JLDA 1GKYA 4C2TA 3U3MA 5EXSA 1EX6A 4HZUA 1F48A 2WMNB 5F9FA 2R2AA 4TN1A 5EP4A 4DSTA 1KOFA 2D74A 4EPWA 3IKJA 4B47A 1OSNA 3NC1C 4RFVA 3BFVA 2GCPA 2GILA 4LHVA 4TL8A 3TSZA 1TL7C 2FN4A 3EPHA 1XCPA 3L0PA 4I1UA 2D7CA 5G40A 3CF6R 1G18A 3QEOA 3QSYA 3HU2A 1NG9A 2XNSA 5L3SB 1XTQA 1XJQA 3B78A 3HP1A 2IK8A 4MGIR 1N5KA 1UBEA 2XZPA 5FBVB 5GADl 4OK6A 2FFHA 1C1YA 4N0EA 4RZXA 1E2IA 1U8ZA 1HT2E 5DYGA 3K09A 3RLFA 2W6ID 4JLPA 2OE2A 5JMTA 1ZU5A 1KMHA 2XB2A 1G1MA 2HDNB 3F3YA 4KBGA 1Z0KA 3AKCA 3OIVA 1ZNYA 3RS0A 4BZXA 3FMOB 2NG1A 1J8YF 3U44A 4YXWA 2FX3A 3IO3A 1DOAA 1Q1ZA 2XAUA 3U6KA 4XVQA 1RFLA 4NCJA 4CYMA 4YMTA 1E9SA 1H8ED 1IJFA 5F2EA 3GEHA 4Q7MB 5FI1B 4A4DA 4GSYA 1EFCA 1LW7A 1G5PA 1QVAA 4DUGA 4UXIA 4EPXA 4RD1A 2P0EA 3PJRA 1IY1A 1E79D 2IUTA 4M21A 1W5TA 4NCNA 3FDIA 3KQNA 4JBXA 3UG7A 2BCJQ 5JECA 2ZYTX 3AH8A 1ZCAA 2GBLC 2D4HA 3M1IA 4LCBA 4IEIA 3SN6A 3EW9A 2H16A 4B32A 5FBRB 1W36C 2F43A 1RJ9B 3GJ3A 5FTLA 2ZRPA 1AQUA 1R0YA 5M04A 3HR8A 3AV0B 2HJVA 3WNCA 2ERXA 4OI1A 4C2UA 2XTMA 2ONKA 1J8MF 2H1LA 1KAGA 1Z0IA 2N42A 4I4LA 4QGHA 2W2TA 4Y0VA 4B2LA 4EJSB 2WICA 4QXAA 3U4QA 2ZRKA 4M2LA 4LJ9A 4AKHA 4LV5B 2G0NA 2OBNA 4LI0A 1EFRA 2WTUA 2GJSA 3O8DA 2FSGA 2ZS7A 3X1DA 3G0HA 1IN5A 1SXJA 1T5LA 1OHHA 3BFKA 2ZYWX 4DCSA 1KJZA 2QPTA 3AVQA 3PUWA 3AB3A 3MCAA 421PA 1XMIA 2OO7A 3FTQA 2ZS9A 1AGPA 4GZMA 1QG4A 4B2IA 1KDTA 4JLAA 4MRRA 4U5XA 1P7CA 1MABB 4EKDA 1W49A 3SDZA 2C9CA 4NCKA 4RD6A 4HAXA 1XTJA 1YE8A 3SYNA 3AUYA 2QQEA 1N6IA 3OEEA 3ASYA 4W5HA 1KMHB 3DL0A 1Q1EA 2O5VA 2V55B 3N5CA 4HB4A 3PG5A 1D8TA 4QHSA 3QF4B 3P32A 2Q6TA 4P33A 3WXMA 4WW0A 1YR9A 3R9IA 4IVPA 2ZRCA 2UKDA 5C1BA 1MR3F 2FMXA 4BFWA 1FPMA 1TF2A 2DFTA 2QM7A 2Z4RA 2J7PA 4DIEA 2RAPA 2WVJA 2ANBA 2E1RA 4KSBA 2QSZA 2HCBA 4MKHA 4P3YA 4B3CA 2XZOA 2WWXA 1HE8B 2BVNA 2EFEB 4HUQB 1OH7A 5FPKA 1OKKD 4TSFD 4Q9IA 4FI3C 4URWR 3L0OA 2G1KA 4GMDA 3L43A 1SVLA 5CJ2A 3SBEA 3ZVLA 1R8QA 4ESVA 3QPUA 3V4RA 1ZJ6A 4D6PA 1GRRA 4EJSC 5IHPA 4Q4LA 2B6HA 1G3QA 1NJGA 4AI6A 1Z06A 2CEAA 4KHZA 3NH6A 3ZVMA 3TMKA 2BV3A 1Z29A 2RGXA 4X8OA 3BIFA 3TAHA 4TYPA 1T3SA 4FIDA 1HQCA 3NBZC 1S96A 2O8EA 1II8B 1TU4A 2P6UA 3NIBA 1N5JA 4PXAA 4P4SA 4ZKDA 4HYYA 2MSEB 4LZZA 4F38A 1NLZA 4A2QA 1XEXA 4AWXA 3HYTA 3FKQA 1SHKA 2BWJA 4JVSB 2DB3A 2OM2A 3A58B 2G1JA 2OCBA 2IC5A 4MKIA 3OE7A 1XD2B 3T12A 4D25A 1AQYA 2FPLA 2IEYA 4PC7A 4GFDA 2XNDD 1NSFA 4LYJA 4NL4H 4B3GA 2C9YA 2DWOA 5EE5B 4FW9A 3OE7D 4MYTA 1ZAKA 2VIIA 1WBBA 2OV2A 4MKGA 4D4KA 2XZLA 4CEIA 2QTVB 3IIJA 4A0RA 3B6EA 2C03A 1GKIA 1MT0A 3O47A 3QBTA 4Q7LA 1GIAA 3LX8A 2VSXA 1G3IA 1WBDA 2O8FA 2V9PA 1M7GA 4BLTA 2BKUA 5EJEA 4RZ3A 5HPYB 2Q0HA 4G3XA 3GFTA 2ZU0C 1VG9B 3ZZ0A 2C9OA 1DAEA 4NYMR 4WXRA 4CEIB 2GCOB 1E2HA 5FPSA 4PC1A 4XVUA 5CIWA 2A5YB 4HAUA 4BASA 1OKKA 4TSFA 3VNVA 4BLPA 4HZUB 5CK5A 4C0AC 3GLHA 1U0LA 1UPTA 4OJKA 3ASZA 3VNUA 4Q66C 3CW2A 2ODEA 3BXZA 3R20A 2VTKA 1W0JA 5KPJA 2H17A 3ZIAA 4CIDA 1NNEA 3AVXA 3IDQA 3SEAA 2ZRJA 2VP5A 3EPKA 3K70C 3SHWA 1E96A 1S0UA 1GKUB 5KO2A 2FZLA 4QC2A 3FB4A 1OPXA 2ZR9A 3DO6A 3NVAA 4XSGA 3JVUA 4EQ6B 3VKGA 2ZI6A 2HXYA 1VYUA 1TX4B 2WJHA 2Q3HA 2VHJA 4B3FX 1CJVC 2ZYUX 1W46A 4YDHB 3TKLA 3BE4A 3KJIA 1G7SA 1UBFA 4ABYA 3LVQE 3BERA 4FXPA 4XIGS 4ACAA 4BUJA 2G6BA 1O3YA 3QY0A 3NTUA 4B48A 4S2EA 4IDHA 1H8HA 1YZUA 2BBOA 1NLYA 4BEBA 5KUTA 4MGZR 2RGEA 2BMEA 5J4KA 3LX5A 2CLSA 4ARZB 1I4DD 1FQJA 4Z54A 3IO5A 4TLCA 4N3NA 3VFDA 1P3JA 5FUXA 1HV8A 1KSFX 2ZRMA 4U00A 3THYA 1DO0A 2KB0A 1SULA 4FCWA 3WHKA 1T9HA 4BZPA 5JEDA 1M74A 3OEHD 4XD7A 4QBHA 1XMJA 4DLSA 1ZD1A 2OEPA 1SXJD 4Q4JB 4Q1EA 3THXA 3IQXA 4HATA 1RRCA 1PUIA 3N70A 3A4NA 5C18A 4YONB 1G5RA 2ASEA 2IXEA 1D9ZA 2QMUA 5G3ZA 1R0ZA 2IYZA 4WOPA 2CL0X 4HDCA 3SBDA 5BWMA 2F1RA 2FNAA 5FI0B 2CJWA 1G17A 3C5HA 3HU3A 1AKEA 1E2LA 4LX0A 4C0HA 4ON9A 1G8PA 2ODBA 2QSYA 2IUUA 1NBMA 2VP4A 4ZV4A 4ZPXA 1O87A 3ADKA 3AF2A 4TT3D 5FL7D 4LYFA 1ONBA 2GVDC 4PO9A 1MRSA 3FMPB 2QU8A 2J7PD 2F6RA 4JYCA 1E1QA 1B0UA 4AYWA 2PX3A 1SVIA 4JLOA 4NCHA 4UXJA 4HB3A 2CHQA 4PZLA 4ZI3A 4UNPA 1NMXA 4QM6A 1T91A 4LGMA 3C7KA 4NDZA 2XGJA 3DHWC 5TV2A 3SFVA 3IPXA 4D0LB 2ZE8A 1W7AA 1COWD 4X8LA 1A4RA 2PZGA 2IYRA 3SS8A 4Q1BA 4AG6A 2IHBA 1E98A 3RRMA 1E94E 4EFLA 3K70D 3KQKA 3WBJA 1FP7A 1N5LA 1S9HA 4B76A 1Z6YA 2HJGA 2QT0A 4G1UC 3WMFA 4LJ7A 1KKMA 4XVRA 5AJWA 3X1YA 2L0XA 4NYJR 4MH0R 2WZQA 5KNBA 5TXGA 1U0JA 1F2UA 2QAGB 2JJ8A 5FFMA 5AR1A 4DZZA 1OB5A 2AWNA 2GXSA 1JXMA 3D6TB 2QAJA 5CJPA 2V8OA 2WWFA 2Q9AA 2JIZD 3RRZA 1P4SA 2QL6A 4GRAA 3CLVA 1CJTC 2F1JA 2REOA 2YWEA 4JBWA 4KFRA 4DLXA 3CNNA 2Z83A 1DAHA 3NEYA 1P2TA 2ZSAA 2FPKA 1SVKA 3I4LA 5FBQB 2FSIA 3LV8A 4Q47A 5B2ZA 3PENA 2C8VA 3D7MA 4D0GA 2ZJ2A 1RC8A 4AKEA 4NMMA 1WE2A 2OFXA 3LD9A 1GRQA 2FSHA 4Z1MD 1HTWA 3AEZA 4KYIB 4LWZA 2O0JA 3WMEA 1E1QD 4UNQA 1I2MA 4AKIA 5GVRA 1II0A 2WJVA 3NHAA 3QXSA 1RRPA 4Q9JA 5FPHA 4LJ4A 2D62A 4GDFA 5H8WA 2FEOA 1T6NA 2RGGA 4JSYA 1TEXA 2WJGA 1SXJE 2IS1A 3GLGB 3Q85A 4LYAA 3CIOA 4B71A 4PSVA 1MH1A 3SQWA 1Q12A 4H1VA 3UXMA 1LS6A 1E79A 2AKYA 3I72A 4Q9KA 4UNNA 3E1SA 5CDFE 2R9VA 3B85A 3X2SA 4MQBA 1OJLA 1JPNA 3IIMA 1U9IA 1M2OB 3EAQA 2ATXA 4JIMA 2BDTA 2I4IA 1Y63A 2Z43A 4CT4B 4NP6A 3FKSD 4HZIA 4PTLA 4QGFA 1JB1A 5GJWC 2GF0A 4LYHA 1DADA 1ETUA 5FUYA 2J7KA 1OE0A 2BEKA 3NBXX 4FCVA 2JJ1D 4MA4A 1Z0FA 2CMKA 1TPZA 5TB5A 2K5UA 4CT5A 2O8DA 1DAFA 4LV8B 1E0SA 4IDNA 4A0FA 2ZJ8A 4G5OA 3A1SA 1Z8FA 3IEVA 3KQHA 3EG5A 3UIEA 3AVVA 4TL6A 5JJIA 1W2GA 2QTHA 1UKZA 2QAGC 3PV0A 1R2QA 1A82A 1NKSA 1ZC4A 3P1JA 4D82A 2Q9BA 1SKQA 3BBPA 5FR1A 2GJKA 1VMAA 3TW4A 4O2LA 3ZQ6A 4ZDJA 1KI1A 4QL3A 1UADA 2FFAA 3CZPA 1M6NA 3GJ4A 3B5JA 4RFSB 4BECA 4Q19A 3K0AB 3VX4A 4EFNA 4KV9A 1UDXA 2FA9A 1KI4A 4JVLA 3EIQA 3VTKA 4OQFA 2CCGA 2QY9A 2X19A 2JASA 1KO8A 3QPVA 1F6BA 4YMSA 5EE9A 1NBMD 4AYTA 1E32A 2H7VA 3EZFA 1D2MA 2V7QA 3W6NA 4N1AA 4YMVA 2GZAA 1JALA 5FR2A 3W9YA 4DSNA 2XNDA 2FU5C 2ZUBA 4GP7A 4ZKEA 4PAOA 4OHZA 3QF4A 2ZJZA 5JFGA 3AKYA 4BQSA 3GD7A 1G4UR 1XF9A 2B8TA 2RGCA 4OQLA 3GLGA 1FX0A 1KAOA 1HEIA 2GDJA 3DOEA 4KFUA 3VR4A 3C16C 3TH5A 3SFZA 5IDVA 2CE2X 1DTSA 3N2IA 4JZKA 1NKTA 4HB0A 2WBLC 5DYIA 3EZ9A 1JJ7A 4ARZA 2RKOA 1E2KA 4NTZA 1E9EA 2IXFA 3KTAA 2ZTSA 4G5QA 5GJVC 5HE8A 1IXSB 4C0QC 5JWRA 1ZINA 4JKIA 3RDPA 1G291 2JLVA 2ZRDA 2Z4SA 5AUOB 1TUEA 4QGAA 4GOJA 3OIYA 3K70B 3RRYA 1P62B 2XXAA 3VR5A 1FQKA 1KK2A 1IQPA 2CHVA 4WZBE 1U90A 3M4YA 3HDTA 3FWYA 4MITA 2R6DA 5D3MB 1QZXA 1IN6A 2VH5R 4LHXA 2YWFA 4RCZA 2GESA 4BFUA 1NVUQ 4CEJB 5G3YA 4M4SA 2CNWD 3PEVA 4IOMA 4WIAA 1OXTA 1JR3D 1ZD8A 2WSMA 1KYIA 2NQ2C 4M22A 5SZJA 1G8HA 3CRW1 3CWZA 5AJXA 1M7BA 1ZC3A 4B6FA 2EYQA 5LB2A 5E7JA 3BRWD 1XTSA 2DWQA 4GP6A 5LB4A 3O8RA 1W36D 3H4MA 2J3EA 1LFDB 3U7HB 2VP2A 3VU9A 5ANRB 3ZVNA 1U2RA 3P4XA 5E4FA 3TIFA 2QN6A 1RJ9A 3GJ7A 3GJXC 1BS1A 1W1WA 1VDZA 4F4IA 2QT1A 3THWB 2BM1A 2R6GA 3A4MA 4JSTA 5CM9C 3T06B 5KSYA 1KSJA 3CX8A 5D3MA 4ASUA 3I5YA 2RHMA 3Q7PA 4US0R 3B1XA 1XP8A 4NYIQ 3Q9LA 2XSZD 2JATA 1RYFA 3DKPA 1UKEA 3HYRA 4MGYR 2V3CC 2ZI3A 5DN6D 3Q5EA 4TMTA 3AP2A 5FTJA 2FWRA 5TY0A 4M1TA 4HDOB 4NBSA 1JEEA 4BGDA 1NVVQ 1R5OA 5L3QA 3SYLA 1VG0B 1KKLA 1NY6A 3U5ZB 3GJ6A 2CJWB 2GK7A 2WAXA 1VHTA 3SC3A 3LQRA 4WBSA 4PR0A 3CONA 1GL7A 3ADDA 3I73A 4PQYA 1N0VC 2SHKA 1TU3A 3I5XA 3WMGA 3FOZA 2NO7A 2OBMA 4URXR 4BFZA 4HB2A 3EIEA 4PANA 3KKOA 4IDPA 2X2EA 1OW3B 1VKJA 1ZNZA 2ZJBA 2ZRNA 3NHBA 2WV9A 4Q4JA 4TMXA 2F55A 1UDWA 2O8BA 1MO3A 1QHGA 4FMBB 1X6VA 4EPTA 2R6AA 3KJHA 4TT3A 5FL7A 4CF7A 2HLDD 3GJ8A 1EX7A 4M1MA 4CRWB 4C3ZA 4LHWA 3CRVA 1YRBA 2LWIA 4E03A 1JR3E 1A2BA 1SXJB 1G19A 4KXFB 2IF2A 5JS7A 3GLFA 2A30A 2AFIE 5HZKA 2QPOA 1YZQA 1SVSA 3A37A 3P26A 3X1ZA 4OI0A 3BORA 3ETLA 1Q0UA 1T8TA 1QHHB 3PQCA 2NTYC 1KI3A 3K0FB 3I1FA 1OF1A 1V5WA 3OFNA 5C4GB 3TK1A 4ZCIA 1CXZA 3IGFA 4F91B 1CEEA 1YR7A 3BB4A 2BJVA 2GHIA 1OFTA 2OLJA 5B64A 1HT1E 4F7WA 3KQUA 1TF5A 1RVDA 4TTPA 1N5IA 2MMGA 3FMFA 3SJZA 3TUJC 3I32A 2YV5A 1G8GA 2MMCA 3P27A 5DHFA
chains in the Genus database with same CATH superfamily
2UVQA 2HLHA 3JTMA 3MS2A 5C4IA 4XGKA 2OBBA 1X8KA 1JQBA 5A9SA 1JAHA 4JC0A 1RQGA 3E9DA 1XNHA 5BNTA 3T1QA 3WLTA 1UKBA 3D1LA 1M8PA 1JEAA 5KOYA 3EGXA 4FGSA 5TPZD 4FQ5A 1L5YA 4G09A 2G5PA 5CVVA 1LK0A 1RKVA 5MF6A 2DEUA 3AWIA 2MR6A 1VECA 1PU2A 5KI6A 4ONEA 3ZK7A 1FZQA 3VZQA 3PDCA 2OG1A 3EZGA 4CKXA 4XEVA 4YCSA 1VHDA 5FP0A 1VI2A 2KW5A 2C82A 3AP1A 3DUWA 3AGPA 1LVKA 3GLHB 7MHTA 1HE9A 1K06A 1E2MA 1G64A 3WRXA 4X24A 4QGSA 5F23A 2YRFA 3WYCA 4LF6B 1MHTA 4V02A 1X8JA 2MYSA 3MOSA 1S1CA 4L3OA 2B35A 5EHZA 4MCAA 5CPBA 1RJWA 1HQYE 4HL6A 4IL5A 4INOA 3O03A 1I4TD 3RKSA 4P4GA 3RREA 3RF3A 4Y6GB 2CNWA 3VAYA 1CKEA 3KRTA 3EFOA 1QFJA 2KE5A 1C3OB 5FWYA 3SDBA 4AY3A 2CDCA 4ZT7A 3S44A 2DBQA 1EVIA 1O57A 1D6MA 1PWHA 1YZ3A 1TO1E 3QH4A 2C59A 3QU9A 4L57A 4M0DA 2O52A 3HL0A 3OHSX 4TZKA 1IOWA 3C3AA 3QVMA 5DSTA 2XYHA 5CVCA 2QZJA 4NWIA 5KDOA 2F7SA 2XUQA 3R3YA 1PDVA 2P77A 3W34A 1JUDA 2EEZA 4NYJQ 3D4NA 4I5FA 2EIHA 3AVOA 5CFPA 5MGNA 1ETHA 1ZCZA 4O25A 3ABKC 1A9XA 4K1OA 1M0SA 2ECFA 1GRNA 5ILOA 4HQRA 2VI5A 3K35A 2ZIWB 3A1FA 3AEUA 4I9GA 4PC2A 5DXFA 5K3BA 2YWGA 3CB2A 4I08A 1HR0B 2FPWA 2NYVA 1SH7A 2HO4A 2LV8A 2VJQA 1P61B 2JGJA 4OQPA 4BIIA 5A4JA 3GG9A 5KQPA 3LOUA 1V4AA 4J3FA 4MPDA 4ASUD 3KPUA 4I1VA 4OYLA 3N39C 1EXVA 4M0LA 4E2ZA 3N05A 4MVWA 4GPZA 4ZI5A 1XCGB 1DKQA 4D8WA 1JIXA 2QRNA 1NZJA 4TXHA 1IUNA 1DUIA 1I0ZA 2GD2A 3BGDA 3U26A 3WFZA 4HV4A 1PS9A 1RWNA 1JSCA 2ISSD 5DP1A 3L7KA 1ONPA 5A5EA 2A94A 3JSAA 3DKVA 1CE8A 1XT6A 1SUAA 2YTZA 3K6RA 4U02A 5KQMA 2CXUA 2ZTUA 1E6MA 1EK1A 1V1MB 3Q8XB 3U6BA 1FFCA 1RQLA 1SYQA 4B0OA 3KDAA 5I3CA 3F96A 1KC1A 2B94A 5GIOE 3JD2A 5K1ZA 3OECA 3F3KA 1G6KA 1YDHA 3H65A 5E0KB 3BILA 1V6CA 2ZBVA 3PNOA 1ZNXA 3HWWA 3RASA 3V4SA 1XKXA 4AF7A 3UKDA 2JGFA 2QX4A 1LK5A 2KJQA 4IDFA 4M76B 4KOEC 4LSWA 3RANA 1GUBA 2A9KA 1EUQA 1VK5A 1JPJA 4IARA 4KIWA 5EXEA 2VTEA 4GZLA 4CM6A 4FCCA 2YHSA 4DC9A 1W4BA 2I80A 3GNQA 4ZDKA 1CRQA 1JH9A 4LAFA 1O0BA 1V11B 5FBLB 4O1IA 3AG3C 1K75A 4D3DA 3IR6A 1GZ4A 1O5IA 2JHAA 2ZRIA 3AUSA 5GQSA 3E8MA 2YWJA 4BV8A 3VC2A 3I58A 1LI4A 4GWGA 4DARA 3FNFA 1B2RA 4TRRA 1MNDA 3U3BA 1E89A 2D00A 2D5IA 2JIDA 3E3AA 1RJDA 3LSYA 1SQ5A 4OXIA 2CYDA 1OX5A 1RPJA 3A9WA 4OTZA 3ZJYA 5H1YA 3TFWA 4EHHA 3U9MA 1LBQA 3ZQYA 2ZTVA 1VE1A 3KJFA 3SM9A 4DTCA 4F93B 2XM0A 1OGJA 1SXPA 3ZDDA 3C45A 3JQDA 4DFDA 1P2SA 5JT4A 4D43A 1KEEA 1UF9A 4D0RA 1MB4A 5BR8B 3OZBA 3QLEA 2ABWA 2G7ZA 2GHTA 1U7DA 1M2EA 3EZXA 3OQVA 5KTOA 3GFOA 3T3OA 5G41A 3USCS 3B9RA 4QGBA 2XYVA 1HA3A 3I2GA 4FN5A 1QP8A 1CUWA 2FEKA 3HNJA 1K5HA 3D0QA 5AHRA 5EZQA 4XUCA 1RKBA 3DVQX 2XDYA 3EPJA 1R10A 2C77A 4GI2A 3FVRA 4R8RA 1BJTA 2AYXA 3PNVA 1PR3A 2C5AA 1ZQ9A 1ODFA 3WWPA 1ZMRA 5B3KA 2EKLA 5FQOA 1UKCA 5L3QB 1TCUA 3LM8A 4TMVA 3BSSA 4QDKA 4PWZA 2ZKIA 2JCYA 3O3MB 3RYFA 4E1BA 2FI1A 2ZIVB 3IEUA 1NC3A 1JLHA 3OFKA 3P2KA 2C97A 2VHQA 3QA9A 3F73A 4CQMD 3C2QA 4N8EA 4WK6A 5D8DA 1KJ8A 1UWKA 5LD2C 1G6OA 3VSBA 1QKRA 4IWXA 4G56A 1J1UA 1DKNA 1SOUA 1W0JD 4TLBA 1QVRA 2WTBA 4LHSA 4IUBS 4L3WA 4M6WA 4YRFA 1QRTA 1PJLA 2KS6A 2HNKA 2QD4A 1RXQA 4KXNA 5DDIP 1Z0DA 3UB3A 3W5BA 4RANA 3JYNA 5EXTA 2OORA 5FIUA 1XIVA 2FRVA 2G88A 1GAJA 4LGYA 5FWXB 2WSLA 4BP9A 3IJPA 4B5KA 3CEJA 5ER9A 1N8KA 4Q1VA 5JP7A 4WA8A 5SV2A 2IX3A 3NP7A 2A8YA 1JJVA 2V3VA 1RU3A 3K4HA 4Y6OA 4RH1A 1P91A 1R6TA 5FWAA 4LA4A 7REQA 3M0EA 1TT7A 4C7OB 1C9MA 2JJMA 4GYWA 1Z12A 1DSSG 3E5HA 4JT4A 4UHEA 1Y3HA 3FVVA 4JSRA 2Q4EA 1V8OA 4OHPA 4RGVA 4S0XA 1Y7TA 1PJ8A 1EIZA 1X39A 2FFBA 4DQUA 2X8WA 3I4FA 1TM4E 2YUTA 3A4TA 3QVGB 4PO8A 3V4LA 5ALWA 3J80A 4XXHA 2JDIA 2PMBA 1SRRA 2HCRA 4W1QA 4AICA 4AO8A 1CV2A 3DW3X 4IJKA 1UBHS 4PVCA 1E1RA 5BQPA 3TCXB 4Z9JA 3S2GA 1JHPA 1QGUA 2JH3A 1NPTO 2JL1A 1GAWA 4J3NA 2AI3A 4EFKA 4JDUA 4GRDA 2R7MA 4IOLA 1LRKA 3CTPA 1P3Y1 2IY8A 2EFDB 3KUCA 1MF7A 4YAWA 1CVRA 1E2QA 1WMDA 4IOJA 4U7JA 4Q4HA 1BA3A 3GQBB 4ZICA 2OCIA 1PZNA 3HFJA 3ID6C 5JCJD 4TV8B 5KOHA 5HZHA 2PT9A 1SWWA 3QVLA 2VPPA 3S1AA 4UDXX 1RZUA 3ORSA 1Z83A 1QLJA 1HF3A 3C5WP 3EXHB 4QSHA 3KTAB 3UC9A 1GJRA 1X8LA 4ZGGA 1JIVA 2QK4A 1H0HA 2BOVA 3E8XA 4EMSA 5KVSA 1U8AA 3DTVD 3OFSA 2Y1WA 4TMWA 2JRCA 3ITEA 3LHSA 1D1AA 2VH3A 3LNRA 1U31A 3ELDA 4MVRA 4HN9A 4QICA 4LJYA 1RLOA 1TEVA 1Q6YA 2GFHA 2IP2A 1IPFA 1NR5A 1T0HB 4IG9A 1LLFA 3QHQA 2ROQA 2REQA 1ZUNB 2YJNA 1XG5A 2VNJA 4CI9A 5A6BA 3PSAA 4XAQA 4J94A 4R8SA 4M1EA 3G13A 2P0NA 2QRZA 2WSSA 2YRWA 2ZU6A 3ANLA 3C6ZA 3L79A 3ONWA 4L5JA 2WTMA 1NM5C 2X2OA 3VDXA 3VNBA 3ZZMA 4F3KA 1NDUA 1ORRA 3AHFA 2AXNA 1NVXQ 3AXTA 3GYGA 3K8ZA 4YP1A 4FR2A 3GP3A 1M7HA 1YBMA 4RZQA 2EHJA 4HEHA 2EJBA 1I4LD 2WJIA 1R8XA 2X4GA 8ATCA 1R9GA 1XMVA 2AZMA 2GRJA 2Z3ZA 5L0CA 3BXXA 4P86A 2P41A 3KZXA 4ZU3A 3ZOZA 1KGDA 4CG3A 2ZT6A 1Q7BA 1X1SA 4G65A 3SU8A 3NWEA 1W4RA 2Z8XA 4JT8A 5CB6A 2DQKA 1ZWLA 2QN1A 3EY9A 3KTOA 3HNRA 3KL4A 1R4AA 1BEEA 2WWRA 4Q05A 4V0MA 4CMBA 4WCFB 3QXHA 3LRPA 4YUZA 2C4TA 1NN3A 1LX7A 1XA0A 5DNYB 1RCTE 1SKYE 2AFHB 3IMFA 3CG0A 1PK7A 4NY3A 1RYMA 2GS9A 2CXSA 4FZ5A 4JA2A 3G0CA 3U0VA 3UHAA 2R8PA 3LZCA 2RG1A 4OLHA 5FI3A 3MWKA 3ZEAA 3KQOA 2ADMA 2EPNA 2FWNA 4PLHA 1JIKA 4JU8A 1KZ9A 4OMFG 4RL4A 5D00A 4I4CA 4WN9A 1WO8A 2PKCA 4FVTA 3ASVA 3DMHA 3G0GA 3ZU2A 3I53A 4RKQA 2AVKA 1E9FA 1YBAA 4C2AA 1OLXB 2QN2A 1U0FA 3GRVA 2ID7A 1SVWA 3ADPA 4WFQA 3RVDA 3WNZA 4C14A 1Z45A 5ESWA 1THGA 5IF9A 3D2AA 3VOAA 3FVWA 4BLSA 2I03A 1GQRA 3DKRA 3EQ2A 3KG2A 1YOVB 1AEPA 4MDEA 1M2JA 1JT2A 4TTQA 1L7OA 3B20A 3ELUA 1O77A 1ACJA 1OFUX 1I2ZA 4INPA 1MD9A 4QPCA 3PGJA 1WHSB 4L08A 2BGGA 1E4YA 3OJOA 2PGJA 4NG4A 4OXRA 2W7TA 5IAEA 1OR8A 5EG5A 3VNAA 1JDNA 4C9BA 1YCHA 2GRUA 3LDUA 3E7DA 4KE6A 1OI2A 2QRVA 2O2XA 1YF3A 3ZDCA 3U3RA 1LGYA 4KP7A 1VIDA 4WA7A 1EFVB 4OFBA 3TFOA 4D9FA 3L6BA 2XLMA 1X14A 4P98A 4LQ4A 1DMSA 1LV8A 4OL0A 3ETJA 3S2FA 1XLVA 3L6DA 4KN6A 4B81A 1YUBA 3I6BA 4FYMA 4OIFA 5FD8A 2HF8A 5LWQA 3FHTA 1W44A 2JCBA 2Q3BA 3CCFA 4MB0A 1RTTA 3IAFA 4J0GA 3UUEA 1CZRA 2P5TB 3MVEA 2OB1A 4E12A 1PHRA 3SP1A 2C0QA 3ZQVA 2D2EA 3C24A 2ATEA 2CXTA 4TMZA 3PF9A 3PNQA 3UGKA 3OIWA 4YCDA 1CSEE 1KDRA 3KQPA 3PHIA 5LQCA 4JOCA 2XWPA 5LUAA 3WG7C 1D4OA 3B12A 1ZEJA 2R6CA 1TLFA 4L22A 4AG5A 2CD9A 1N5RA 3EVZA 2DYSC 2FUCA 1QZ3A 1JRLA 5JC8A 1K08A 2ORVA 1J9GA 5EPOA 2X9QA 5D3QA 1QKJA 1O94C 1YS2X 1DBRA 2H7VC 2OP0A 3NTOA 1QQ5A 3AG6A 4QUJA 3TJZA 4RJTA 5KCZA 2XNHA 5EAIA 3PDMP 3U4DA 3UAZA 1A50B 2IEDA 2QRPA 3A6LA 3NHRA 1WULS 2I8AA 2PVPA 4LC1A 3WZ2A 2A1IA 1XZBA 3X2FA 5BVGA 2VF4X 4OLJA 4EAAA 5IRCD 1T3TA 3AO0B 4NVRA 4BX0A 2LTAA 3BJZA 4CEHB 1QHYA 1G3MA 4IGKA 5E1MA 3WB9A 1NV8A 4IJUA 1FJGB 4CBEA 2QVYX 5FEMA 3I6MA 4GC5A 4NAHA 5CCDA 3MCZA 3KYJB 3PNBA 1KZ6A 4YS6A 5EWLB 1N3BA 1KY5A 1U4SA 2FW8A 3BEOA 3HWRA 4UHDA 4BNZA 3MJTA 4MW2A 1UEXC 1WVIA 4PEVA 3IAEA 1XD8A 2HFKA 1OZGA 5BSHA 3O8CA 1JR8A 4CQNA 5B12A 2JGLA 2VTVA 2OHHA 4IIUA 4S1OA 3RR2A 3BWEA 1XXHE 2PQMA 4DPLA 3RIPA 2ID8A 4HS9A 1D0XA 3G02A 4CR7A 1GILA 3DDOA 4LDNA 2QT9A 4HLUC 4OUDA 2XVMA 2QUBA 3VYSB 1O96B 1XMXA 2MSDB 2O2GA 3X2QC 4A2PA 4ZJUA 4GS5A 4TRMA 4QQRA 2GEVA 4NNOA 4BMVA 4LZWA 1EXMA 2PMKA 3T54A 2VASA 3BMNB 2XXAB 1LPOA 3H8WA 2BHLA 2IZ7A 5FYQA 3T4XA 4R7GA 2AW5A 3AU9A 2CCYA 4NF2A 4PZAA 4XQ0A 3NMIA 2BFFA 5TX7A 2WUGA 3G2JA 2R79A 1R50A 2TMDA 3NKVA 3QUCA 4FEEA 4G1FA 3PEWA 4RSRA 4BZWA 4HHEA 3DDCA 3AIIA 3IILA 4ZMSA 4ZT6A 1NLXA 2ZUVA 1DIHA 2YZGA 1TFRA 3GAZA 4IHAA 3T99A 5L4SA 2J31A 1N2XA 1RACA 2FVXA 2XRFA 2WM8A 2WYWA 1W35A 3AOEA 3CZCA 3FJ1A 3GAFA 4ALMA 2YW2A 2OHXA 1X1BA 3PC8C 3CF0A 5EJ5A 2P4QA 4KN5A 4OK3A 4EHBA 1QB7A 3EZ6A 4AAYA 4PFOA 7MDHA 4TVOA 4PG8A 2B0HA 4JLNA 4KC9A 3R44A 1Z0ZA 4U9EA 4PLVA 3C4JA 4K40A 3E9RA 2JCXA 3EGWA 1XXHB 1ZBDA 4GX1A 4E7PA 2Y1GA 2AUNA 2D0PB 3DYIA 5DBGA 2BR4A 3NALA 3NONA 4M1ZA 3ZDYB 1LCIA 1TM2A 3GVCA 2CLEB 4WESA 4A2NB 2GYVA 3EXIB 5TF4A 1QGED 1CR4A 5K3EA 5EEGA 4AJEA 2BHRA 5C46F 2JAQA 1UJMA 2B3DA 2JKZA 5AK3A 1NFFA 1Z7Qc 2HUNA 2VUIB 4B73A 4MV5A 4O4JA 3JQQA 1DIGA 3KFLA 3RT7A 1MG5A 4QEZA 2YJ6A 3RVMA 4K0DA 4P8RA 5JYBA 1JXOA 4OGKA 4DPMA 2Q7RA 1IG0A 4MS3B 2M1ZA 1DWUA 3H8SA 3OQJA 5K0EA 4J1TA 1U3VA 4MQMA 4B0PA 2OORC 1GPKA 5DLPA 1OAAA 1VGVA 4IP0A 1ML4A 1TLLA 4F2DA 2RBGA 1P72A 4WGYA 2WAMA 3HRHA 3K9FC 1AE1A 3I8XA 5IF3A 2B69A 4UU1A 1ZHTA 3KL2A 3NG1A 2BMDA 4IV5A 3HKKA 3C43A 5CLIA 4GYYA 3MWLA 1F17A 4ZT2A 5H70A 1PBNA 3F46A 1QLWA 1VPTA 3LGSA 1L5FA 4JUBA 4ZCSA 3RQSA 3OX4A 2Q46A 2EKZA 1FTYA 4EB8A 3CZMA 4XM2A 2Y69C 4WRRA 3VHQA 4ZZ0A 2GJ8A 5J58A 1U6HA 2E55A 3IKTA 1KIMA 5CT9A 4AX8A 3UAWA 4BLVA 1GZ7A 3QKSB 4G01B 5BW5A 1TOAA 5IYZA 2QP4A 3CU5A 4KR0A 1EE9A 2WU8A 1G7CA 4Y2GA 4CQMB 2ZSFA 3U13A 3E3MA 4K9DA 3C41J 1QZTA 3CO5A 1CNFA 4JHLA 5EQDA 4OA5A 3QVOA 4MV3A 3CKYA 3EXIA 3EXHC 1QX4A 3HLTA 1UMDB 2EARA 4YO7A 2Z1DA 5FF9A 4S24A 2PG3A 5EYPA 4FBGA 4DR1B 1SHJA 1PR9A 1Z0JA 4J0HA 1C9DB 2X8JB 2QW8A 5BN5A 4WFKA 5C5IA 4ZAXA 5JCXA 1OREA 4JE9A 1Q77A 4PLPA 5L7YA 4AO7A 2VUUA 4BUZA 2OSBA 2WPDD 1YIDA 2QORA 1SQGA 3NYWA 4U7WA 5I9BA 3TVDA 4E6PA 1NMYA 3R8CA 4AY5A 3ZWQA 1UBSB 3SMQA 3T9OA 2YDYA 3FZNA 4B34A 2NU9B 3QLTA 4OATA 1UZAA 4POAA 3BJEA 1POWA 3ESBA 4GR5A 3SXJA 1VMKA 2FHPA 2HEIA 1II9A 4OMCA 2SCUB 3KVVA 4IHQA 3RVSA 4NU8X 3Q8MA 4PICA 1A7EA 4BLRA 1QQ6A 4DEXA 2VPWA 1DKLA 1SC4A 2EDAA 2MSNA 5J5CA 1EG7A 1TUBB 5A9TA 2DBYA 2E5WA 2YOFA 3DMYA 4C07A 4HDQB 1NDHA 3IODA 4D4NA 4MMYB 4PNHA 2AQHA 2C8JA 3A9UA 3VKHA 3DVLA 4NBWA 2X0RA 3COWA 3I2JA 4WCDA 3TX6A 1OZHA 4FEGA 3BMXA 3D31A 1TEHA 3QU4A 4EVIA 1I9GA 3WJAA 4PC3A 2L19A 2BC9A 4N8SA 4OUDB 1I7LA 4Z8XA 5JASA 4E18A 4BEWA 5IJWA 4KLAA 2ACVA 4JX8A 2CGEA 4CS7A 3HYNA 1J5XA 1RPNA 4B80A 1J0DA 5IXYA 3BBLA 1UMDA 4DT1B 1Q0RA 1SBTA 1VM6A 1L7QA 4F45A 1SQ0A 2E49A 1C5KA 4QXOA 3NVMB 4GYTA 1RAEA 1RAGA 5CLFA 2I1LA 3DMGA 1NJFA 1R4MA 1XXLA 3HB1A 5CNMA 3TVTA 3INNA 3TE7A 5HTOA 1ZGJA 3V1TC 1E8NA 2FW0A 2YKZA 1RBZA 5DSZA 1D2EA 4LWPA 4WFJA 2P61A 4AP9A 1BS2A 2IHVA 3G2HA 4QWMA 1M1YB 2QRJA 2PTHA 3S27A 4KI0A 1USUA 3IFSA 3O1LA 3C8GA 1J0BA 1DAMA 4X1YB 3PK0A 5FYDA 2BHNA 1BSVA 2I2FA 1Z6AA 2CUTA 2NLOA 2XDQA 3DE2X 3O4HA 4FU0A 4V0ME 1EDDA 3WIVA 1EB9A 1PF7E 3DV9A 1MQSA 4H7JA 3FWNA 2JHCA 2IOYA 3LHIA 2MDTA 1ZOOA 1DDIA 3S0XA 4M60A 2WWIA 4X7BA 3RTEA 2C99A 3RYHA 2C2GA 1NFOA 2DUUA 3O8QA 1KI9A 4UE6A 1PFUA 3W5HA 4RBNA 1NFNA 2OFPA 4U7PB 1LWNA 4XYMA 3GAMA 3ILHA 2B5WA 4EG7A 3ZBUA 1QWSA 2VXCA 1EE1A 1OIXA 4JQZA 4ZAZA 2ZJOA 3WYGA 1O0SA 2FSFA 3C6QA 3RBZA 2MINB 2B7CA 3U2QA 2AUMA 4DMMA 3CZ9A 5HGJA 4Y8VA 1Z47A 3RIGA 4CFSA 3ZYCA 4GM1A 1RXCA 5G1NA 4D4GA 5LYJB 3U81A 2QM0A 3IXQA 3ROGA 4DCJA 5C3MA 3SR4A 1CR6A 1QGDA 3NRJA 1UK8A 2EGHA 3ONFA 4MJ7A 3JVDA 4S2UA 4QUBA 4WESB 3AHEA 1I4EB 4LF9B 1TWGA 1Z4KA 4YLEA 3V2HA 5B2FA 3ADOA 3KXLA 3LPMA 4JEIA 2YINC 3C5EA 1VIAA 4Z7OB 1SZDA 4WBNA 1ZMBA 4ERNA 5CLGA 1CNMA 1AN0A 1UXGA 4KPGA 5IKXA 4OEHA 4A73A 1RXYA 3QXCA 4A9AA 4BKOA 1AUXA 2I9KA 5JQGB 2Q0QA 3H99A 4MRNA 2IYUA 3HXOA 4LVNA 2E18A 3MJDA 2XE4A 2W0MA 3SC2B 1CRPA 4RTRA 4NFSA 3RH0A 2CK3A 2QUPA 2E4AA 3WNDA 4R9VA 5BNIA 1Q0HA 5E2QA 1F8GA 4HUJA 4PFJA 1YULA 5AKJA 1FVOA 3FIUA 5ICCA 4QFDA 5DK6A 5ULLA 2EF0A 4LXUA 1YRWA 3L0IB 2UUPA 4OQYA 3E3OA 4C0XA 3AF4A 3LX4A 2PXHA 2ZIEA 5CVEA 1UDCA 4A0SA 5B4TA 1G4HA 1GT6A 3Q12A 2WV7A 2W6PA 2VLBA 5HKBA 5KB3A 1WLYA 1S8OA 3GLIB 3CH4B 2IWRA 4KMRA 2G17A 4CKCA 4TV9B 1OYOA 5L40A 4V0RA 4W9RA 4CDAA 1R1DA 2EQ5A 3C1UA 4G1CA 1OYWA 4OBEA 3P5SA 3N7TA 2Q2WA 3KX2A 2JJ1A 4E33A 3JSZA 1Y3DE 1OYYA 3EMKA 1KHHA 5A03A 3ANNA 2HR1A 2JIPA 2DUWA 2ZDGA 1SIBE 3ETCA 4WOCA 4DBLC 2YFKA 4ER7A 1L4MA 2OZLB 4O0MA 1K8QA 2L82A 1U9YA 2C7BA 2M6KA 1G8MA 2QD5A 1C14A 5DM4A 1D09A 1LU9A 3LWBA 2P6RA 2Z98A 4GGPA 5CAEB 4DS3A 4KFCA 5H82A 3ZCQA 2FDCA 2XVXA 1PJAA 1VHJA 1G55A 3BEDA 3HJGA 3JAWA 3RT1A 1X7XA 5AC4A 1MQ8B 4GEKA 3VBEA 2QYSA 3RK4A 1E86A 3MG9A 1T8RA 4PRKA 5IZCA 2NTNA 1G3UA 2O7NA 1AXGA 4GLJA 4HDNA 1WXGA 5E33A 3QYAA 2X0EA 3D4OA 2B92A 4MW4A 4B7XA 1IAQA 1ZUNA 5JR3A 4FXOA 5KWSA 4H4DA 2I54A 1J33A 4N6GA 4M9ZA 1DCMA 1X38A 2C2HA 2I2CA 5JW6A 5CM2Z 4HLNA 3VR3A 4EM6A 3E15A 2ONYA 2RB4A 4IHJA 1P9NA 5L6LB 1T01A 2NZ8A 4YRSA 3UKOA 1QK4A 1B8UA 1TUBA 2K6GA 2V7EA 3EVGA 4OI2A 5I5GA 4MS1A 3ABMC 1ISHA 3OWOA 5IXSA 1Q0LA 3D2CA 4MVYA 1P7VA 3AHHA 4ETMA 4DR3B 3KLNA 3WYEA 5IWAB 2O8CB 3I9V1 3BCUA 3OSUA 4F3NA 2WYOA 3GWGA 1MHPA 3A28A 4JI1B 3ABQB 4G5GA 4B74A 2CK3D 3AEQA 4LC0A 2EPLX 5KVQA 2EIXA 2I34A 3PPXA 3L8HA 3H6GA 4UNSA 3KYBA 1K3UB 1BROA 2ZUTA 4Z4GA 1E0KA 4EBKA 1F3LA 2NU6B 5EERA 3UN1A 5J4LA 1XD2A 2GZDA 5F76A 5GOZA 5BVHB 4H7KA 1P1JA 1DEKA 5GY7A 1W25A 1ZMXA 1P0PA 1KTMA 5K8UA 2A9JA 2X6QA 4DCTA 2AK3A 2OCPA 3SAJA 4KQ2A 3ESYA 2XLOA 2WFLA 2Y92A 3IJRA 1QPBA 4R1SA 4XH9B 4Y6LA 2ZI4A 3E58A 4KQCA 3TZ6A 1RQ2A 5JRAA 2FRDC 4EH1A 4ZTUB 1JA1A 1TCBA 4DC1A 3JZMA 2VJBA 1E9VA 2O8DB 4LCEA 2X3UA 4ZAGA 4C05A 3M6WA 1D1CA 1NL3A 1UKVY 3IYLW 1MA0A 2LCHA 4IXDA 4RY2A 4A8HA 5LNK1 5TE9A 4B3HA 1FDWA 4N7RA 3FYDA 4IX9A 1YVPA 4G0OA 1Q0SA 2X15A 3ZD9A 4BMOB 3CFYA 5DLEA 1KL7A 2WW8A 1FXWF 2WJ6A 2J87A 1YFKA 4O6VA 4WBXC 4QHYA 2NW6A 1GV1A 1RYZA 1H6AA 1ZUIA 1XNRB 3I2YX 3ZHCA 4DT1A 1XRSB 3PU6A 4R9NA 3BTVA 1NT2A 4KGDA 3KVOA 5DM2A 4A6PA 2HU5A 2XT6A 3Q1LA 1ADBA 3LKDA 2E2WA 1ZIYA 3E4CA 3MYIA 3QMMA 4QBKA 3ND8A 2NU7A 4XIFA 1GZHB 2AFIA 4LK2A 4AK9A 3R4CA 1M6HA 5GMOA 5LXTB 4R2KA 1HMDA 1IDOA 1QIJA 3AIMA 3C98A 2DLCX 2GCGA 2OPBA 2PMDA 4DNXA 1NU8A 3JVEA 2C5SA 3K8YA 4DVGA 2F4NA 1FNMA 4K88A 4YPFA 3U1TA 3F5MA 1QYCA 1Q84A 3RS3A 1WBJB 5JD3A 3VR6D 3ZU3A 3VOSA 2F8SA 2ZAMA 2P91A 3TQOA 1BIFA 3HVHA 4R7TA 4REQA 1GPH1 4UM9B 2HMZA 4WAUA 3SQDA 2ZRHA 5SZHB 2WVOA 1ZSNA 1RWOA 5IDYA 2AIRA 4J2HA 3LS1A 1A5TA 1GTJ1 3HKEA 5CFQA 1JDZA 4XEKA 5A04A 4TQAA 2GPAA 4ZDIA 1Q0PA 2CCJA 4MRMA 2DH5A 5IC4A 2JEYA 5JSUA 2OD7A 1B00A 4F9GA 5AT1A 5HR5A 1PGJA 1JLLA 2XOEA 4LK3A 4RVCA 3VYVA 5BSKA 1DBSA 3P2IA 2REXB 3GWLA 3OJ0A 2PVCA 2DWUA 3ZDLA 2P9YA 3GUYA 3UTDA 1GT91 3KZ1E 2PX0A 3GEIA 3KE9A 1E7MA 1JHVA 1O97D 2DPHA 3JQEA 4Q9LA 5JHGB 4BEJA 2WIDA 1B74A 1UR5A 2YQYA 3NAZA 3RIXA 3JRTA 3S4YA 3TRKA 3W4IA 3N3BC 4ZCRA 5LPNA 2XHEA 3I8SA 1S3SA 4RKWA 4CQMA 3N87A 1L5HA 2HC9A 3JQ9C 1OVMA 1Y4UA 2I7VA 3KUKA 2A2ZA 3HXPA 3PCTA 4FW8A 4KRXA 3M6XA 3DCJA 5KSPA 3BXHA 4AE4B 4IJJA 3ECSA 1S4QA 3FZYA 3I04A 4M89A 4YCBA 4CJGA 5JXGA 1TK2A 4RIHA 5CJJA 4NAVA 1SF8A 5L0JA 1KH2A 2CDNA 1YHZA 1K63A 1A3CA 3NIFB 1VJ5A 5A3QA 1A1VA 1UXHA 3FY4A 1EGAA 2VATA 3FZGA 3ZIAD 1JQKA 1I8TA 2FJPA 4P31A 2BFEA 2J6HA 4W1SA 1V48A 2JLBA 2XRMA 4KJZA 5IMBA 5C31A 4F4UA 3U60B 5HJ5A 5K8IA 2R6FA 4Y1RA 1WP9A 2PX2A 1I7QB 1N8NA 1FP6A 1QCZA 1T9AA 4Y1RB 2H4WA 3CMCO 4P7BA 5EJ2A 1UBCA 1V47A 3W1EA 3BX1A 3NYMA 2JHPA 2QTTA 1TRKA 4ZIRB 1M83A 2OA0A 3D64A 1SURA 1DHRA 3ES9A 3GVIA 4G81A 4WY5A 5HCUA 3ZU4A 1JEOA 2EJVA 1VPEA 2YY5A 3NTRA 5CX4A 1GCUA 1JAIA 1Z4JA 3RVBA 4E22A 3X1JA 3K73O 3WAGA 2G77B 2VJYA 3PXAA 1Q1BA 1I3KA 3ASUA 3E22B 3MTBA 4XJXA 3SC2A 3V7UA 1T8YA 1TR2A 3M1CB 3C63A 4FFRA 3NIDB 3G8YA 3PL5A 4QRHA 1BHO1 3TW8B 4JZAA 1FS4A 2C07A 3BTOA 3OTIA 1PL8A 4KWCA 2LD4A 4F2GA 3JQ9A 3ZD7A 1P5JA 1T43A 4ZRDA 2HPVA 3D3EA 4FZRA 2EZTA 4HEA6 3VVMA 5ITVA 3T7KA 1EWQA 4YYEA 1MNAA 1XYYA 3EA5A 4HTFA 3ZWOA 4ZCPA 1R7RA 3LUAA 2RGNA 1SXHA 2ATCA 1VJ1A 4JLVA 4WXPA 1B4DA 3VGJA 4KITB 5KNCD 4BVEA 4AMUA 3H4VA 3I1IA 1Y3BE 3NH9A 4RV4A 3WMRA 1KFEB 4ZQEA 1XRQA 1L4LA 3NATA 4BFSA 2WUDA 4N0DA 4EKYA 3K9NA 3QVKA 2BEJA 1JIQA 2H2DA 3M6VA 3ENKA 3UGQA 1V54C 2VWPA 5DNEA 3TAUA 2HFJA 3C7AA 3Q72A 4L6AA 1SKMA 4BTVA 5FFNA 4I4IA 3U2MA 1V1RB 3P9KA 1ZGHA 5G02A 4I9FA 3WLEA 4JXXA 3U4HA 1EA7A 3KD3A 1TNDA 2O2CA 3KEMA 4XWAA 2VJPA 2O54A 2EC5A 5CA0A 1QO0A 2OGZA 2D1SA 4B82A 3AVPA 5DGTA 3AXSA 3L93A 3LKZA 4PN3A 3TL2A 3UMMA 5TQ0A 2VVTA 2XYQA 1D5CA 2I1QA 3HB4X 4Q34A 2QLBA 2XB4A 2G76A 4TVBA 2PKQO 1UJ2A 4IHJB 3QXJA 4O3FA 1ZK2A 2DULA 3GNSA 3JYOA 4IJVA 5A7FA 5JAOA 3HPRA 3W4JA 3U7IA 2VXOA 4V0LA 4YRQA 3RSSA 4ZHQB 1SNYA 4RDIA 5BSTA 1YMVA 3L6EA 3VR5H 4JYMA 1L1EA 4R98A 3K9CA 2JI8A 3V7NA 3F7MA 2XUJA 3K0HA 2IZZA 2ZR0A 1U04A 3T1NA 2QZ9A 3ZPXA 3ZK9A 1NGSA 1YASA 2G82A 3FGPA 3JQ6A 3DXJF 3Q0EA 5F5NA 4GMXA 1R4MB 1D07A 4GLLA 1L2TA 2QR2A 3KKNA 2A7QA 4P58A 5ALPA 3SLGA 3WE7A 1VIYA 5AC5A 3K1ZA 2JLAA 4Z54A 2GNOA 2SICE 3HACA 5T6MA 5JBQA 2WZLA 5AM1A 2VYNA 1M1YE 3COSA 4IJMA 4AXBA 4EYQA 1TCVA 1SU4A 3MMPA 4KZPA 2P67A 4ZYLA 3W5SA 2CLOB 1TWHA 3HA5A 5D3ZA 4QM7A 1M2NA 3GNLA 5E9JA 3HJCA 4EIYA 2QZPA 2ZT8A 4PHTA 3ZCRA 5CG2A 5E3JA 1A2QA 1X3SA 4D4JA 4HAZA 1T2EA 1XLTC 2OLEA 4R3NA 2A4MA 2FE4A 1QH8B 2CFSA 3IQGX 3S7ZA 2ISCA 2QLNA 2W2MA 4XJTA 3ONVA 1ESCA 1H2YA 1KMMA 3PFWO 4W7IA 2R1ZA 4DUPA 4HGZA 3D0OA 3PDHA 2ZRQA 3PFKA 3WGKA 2V4UA 1NBEA 4D8XA 3O8OB 5BV8A 1XTRA 4EFDA 4I1MA 1N2CE 3VPDA 1LBEA 4PZDA 4Y9RA 3EF1A 2IYEA 3HL4A 1LPPA 2GK3A 1W59A 4AP5A 1YR2A 2W37A 4JNCA 4OHYA 3CZQA 3IHLA 3QU2A 3QVJA 4CMIB 1XCLA 2FXVA 2GK6A 3WY9A 4CDMA 2P7IA 3D6HA 3F2VA 3CPHA 5FQNA 3V1KA 3J81A 4JOBA 2Z6AA 1OI4A 5AXCA 1YJGA 1REQA 1HYBA 2BIFA 4QA9A 1XDDA 5L95A 1EK0A 1YRHA 4D92A 3EQ6A 3ADBA 3MWYW 3EEOA 1JFTA 3CWCA 1RRFA 3K9HA 4RJJA 5KVAA 1IVSA 4TZTA 4EHFA 2G9RA 3I5AA 2D4UA 5EQFA 1UDRA 3RRXA 1GDTA 1Z6TA 2FMKA 2ZROA 4WBNB 1Z22A 2B98A 2IF0A 4WY8A 4PCUA 2VT3A 1OQAA 4LJ6A 5F33A 3N8IA 1XWWA 4LE0A 1J49A 1NJ5A 2YJ5A 4L0DA 3KPVA 3EA4A 4M9UA 5KJ1A 2XZTA 3O7MA 2VTBB 2FGJA 1H05A 4P7FA 4Q24A 4JOQA 4QATA 4W1RA 1M8GA 2IBSA 1WHSA 1DV2A 1I4ZA 4BRWA 4JLWA 3AY3A 3M4XA 4LDKA 2P9FA 5SZIA 1D4ZA 5BRJA 1VHQA 5JZBA 2HXGA 1TYAE 1YGYA 4JJGA 1EGVB 2BZ0A 3P9PA 3A3OA 2DQ4A 4L8WB 3HBNA 4QECA 2P90A 3SYRA 3GUVA 3THWA 1K40A 3D2LA 1GFZA 2A1TR 4CTOA 4C01A 4WDQA 2Q6KA 3DFUA 4YTEA 2ZYIA 3H2HA 1WMFA 3B7PA 4UTXA 3TZQA 1HW1A 4XWJA 4LJKA 4X6XA 4X93A 3E9YA 4PACA 3EGOA 3SD7A 4MYDA 3O90A 3CKLA 1CGNA 1VPDA 4WD3A 1XOIA 2J85A 4N4AA 4BO1A 2ARKA 3IP5A 4TKMA 4UVHA 5DKFA 4BB9A 2UUHA 3FCYA 4KXLA 4EKEA 3OQPA 3K6BA 2GEKA 5DM60 4DRIB 4BVBA 1NRWA 1OX6A 4IAQA 3FYUB 3GJQA 2AVDA 5HILA 4BBZA 1J5PA 3TZKA 5KX5F 5K3SA 1A71A 1U3UA 4PPNA 4BEVA 2FAPB 1XZFA 2VCBA 4HK4A 4JODA 1ZX1A 3OUTA 1YIAA 4UTOA 3KSAC 2NYUA 1QIDA 2ZI9A 4CW7A 2HHAA 3KC2A 3IOYA 3PWKA 4A36A 1T9KA 5AVQA 4OB8A 1U5BB 5TQVA 1VRVA 4ODIA 4RYLA 3OHMA 4BP8A 3VR6A 4GICA 1VP9A 1M1UA