5L3QB

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
b'SLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 110
structure length 307
sequence length 307
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
B PF04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qB02
3VR6A 4D4LA 3SS8A 3NIBA 3WBJA 2BCGY 2GEUA 4IJMA 4YDSA 2IYVA 4PZZA 5BYJA 2X2EA 4N1AA 4PSVA 3K70B 3OE7A 4GMXA 3LO5A 2OCBA 4X8HA 4ZDKA 3GJ3A 3CKLA 4OHWA 4A2PA 4C0HA 1TQ6A 5F9FA 4NYIQ 4HLUA 3CZPA 1IY1A 1CJTC 4DWJA 1QHSA 5DYIA 1JNYA 2O0HA 1DELA 4QBHA 2QAGA 1GWNA 4N0DA 1E4VA 3TKLA 1KK2A 1UBEA 4PHHA 4V0KA 3KFXA 5JWOA 3QKSA 4BZPA 4RSGA 3ZLJA 4TYWA 3GLGB 4OI1A 3MFYA 4OI2A 2GETA 3MSXA 3BE4A 5H1YA 2JASA 2YKGA 1OIVA 1Z6YA 1XTIA 3RS4A 1A1VA 4RZUA 1LF5A 3CX7A 5KU1A 2ZSFA 1AS2A 2GDJA 5A4JA 1OB2A 3A58B 3TUJC 4B75A 3UWOA 1VDZA 4BEJA 5JMTA 3AQ4A 5CM8B 4ZKDA 3WNBA 5HKKD 4MUAA 2Q9AA 3EPHA 3SJAA 1VCNA 3H86A 2ZS7A 2WKRA 2YWFA 4HLDA 2WVJA 4PAMA 2D74A 1SXJE 3H4MA 4HUTA 2FZ4A 3QXJA 1UKVY 3MG9A 1XEWX 1NKTA 4X8MA 4GDFA 4G01B 1JQLB 1N5JA 2EFDB 4L5BA 2VHJA 4K8OA 2GF0A 4DXAA 4HB4A 3L82B 3GLFB 4GZMA 2FZLA 2QMOA 4KLNA 4PANA 4LJ7A 2FF7A 2A5YB 1MRSA 4CDGA 3VHLB 3ICEA 4FIDA 2FEMA 3MMPA 4DCVA 1G8YA 5TVKA 2GAOA 2OAP1 3WMGA 4IVPA 2PEYA 3O8RA 4FMDB 1XCGB 4RVCA 2HJVA 2P67A 1O3YA 3NEJA 1QHYA 4R9UC 2NGRA 2W00A 3GLHB 1AM4D 3LY5A 2C77A 2EFGA 4QG7A 4KVAA 4Q4JA 1T91A 3JVVA 2ZJBA 4KI0A 2GVZC 4F91B 1AK2A 3FKSA 5JZVA 4A1FA 3I4LA 3OEEA 1OIWA 5TARA 3GJ4A 1ODFA 3X1DA 1DAMA 3PUYA 3VR4A 5GVSA 1D8TA 3ZVMA 1H8EA 1ZUIA 2VBCA 4KVGA 5UKDA 1T4GA 3R20A 1GM5A 2VP9A 3EPJA 3AF4A 4QXAA 4UNNA 1GRNA 3ICQB 3TQCA 1NN3A 4F38A 3EIHA 1LB1B 4OQNA 4LHYA 1QHHA 3KQUA 1Q3HA 4TQ9A 2I3BA 1YJ5A 4UXIA 2J9RA 2GEVA 5G41A 4PC6A 4QHTA 2IWRA 4US1R 2B21A 1CRQA 3R9IA 3GEEA 1S8FA 5D3MB 1MO5A 1VIYA 2F9LA 1QRAA 3TAHA 1ZP6A 5LDDC 2WM9B 4ESVA 2RGDA 3LFUA 1ONBA 1GG2A 4I1UA 5BW8A 3U3RA 1SVKA 1U81A 3NHAA 2BBTA 2VSFA 2F3RA 2KJQA 2QY9A 4LJ5A 4BFUA 2VYFA 2PJZA 4Y0AA 4EKDA 1IONA 4GSYA 1X1SA 1TF7A 3A1WA 2CCJA 2BDTA 1XEWY 2GJ9A 3SBEA 1DO0A 3KJEA 4JVSB 4QJ4A 1GIAA 1QHIA 3Q8XB 5L3QB 1LF0A 5F3WB 3AP1A 2G1KA 4H1VA 2ZE5A 3CM0A 1DG1G 2JLZA 1H8HD 2GRJA 1OFHA 2PEZA 4B3GA 4NL4H 3QBVA 3P1JA 4Q7MB 3CF2A 2F55A 3HPRA 3B1XA 3PV0A 3SE0A 2J0UA 5DE3A 3QE0A 3VKHA 1L7VC 4URWR 3WMEA 1NIJA 2GVDC 1T3HA 2ZRGA 3HDTA 1DAKA 1SXJA 5E7JA 1H8ED 5FPHA 2FV8A 3TMKA 3U3KA 4AYWA 3THOA 1RFLA 2PL3A 3C5CA 1JI0A 4LJ9A 4M2LA 1FTSA 4TT3A 3Q5DA 1AIPA 4IDPA 5FR1A 5LB2A 4ZI2A 1G18A 1GL9B 3FKQA 3PQCA 5FOTA 4D81A 5IT5A 2IYUA 4B6FA 1IXRC 4OQXA 3DVLA 4QBFA 4DLRA 1R6BX 3H2YA 1QG2A 1X8JA 1WA5A 1II8B 1N6HA 2QMUA 2X19A 2XB2A 2EYUA 2W2VA 3QXXA 4WZ6A 1I2DA 3EZFA 4TQAA 3KZ1E 4BECA 2QU8A 1U0LA 3BWDD 4NYIR 1VCMA 4HUQB 1Z0IA 3CRRA 3KQHA 2WKPA 3RRMA 2OHFA 2O8EA 1GVNB 1LFDB 5JFGA 3AB3A 2FFHA 4Z8XA 1RJ9B 3I1FA 2WSSA 3KDSE 1XCPA 3VKGA 4TL9A 1ZM4A 2HLDD 3GCGA 1NL3A 2FU5C 1E2JA 1ZNWA 2I1VB 2OBNA 4QC2A 3SJZA 4Q9KA 5FI1B 1V43A 4E09A 3TR5A 2QSZA 2RKOA 5DO9A 1AKEA 3VHXA 3U4QA 1TMKA 1ETUA 3ZVRA 4URVR 5FOVA 2ZQ5A 2QMHA 1NMZA 4HSEA 4M1YA 3V4FA 3IEVA 1GZSA 2F6RA 3MAAC 1N6LA 5FL7A 3X1ZA 1TADA 2RGXA 1GP2A 2ZRDA 2V4ZA 3PXGA 3RYTC 2BMEA 2GXQA 3NEYA 1K6MA 4JMPA 4DIEA 3LA6A 3B85A 1XRJA 3DL0A 3AVOA 4QGHA 3K70D 1LVGA 4Q4HA 4OK3A 3AP2A 1C4OA 4DT1B 4IDHA 4JLMA 1Z0FA 5HCNA 5GJBA 1E9FA 3LW8A 2RGEA 1CJUC 1KDPA 1V5WA 1DEKA 3U3OA 1CXZA 1VYVA 2GCPA 2F9MA 2IF0A 2KE5A 1XTQA 2IF2A 3LQQA 2RGNC 3ZIAD 4C30A 2C98A 2CHQA 1YR6A 2DR3A 2ERYA 3OESA 5JSZB 2ZI5A 3FVQA 4W7SA 4I4LA 3KJGA 4BUJA 2BV3A 3RANA 1M7BA 1S96A 2XJ9A 5EXSA 3T1OA 4GFDA 4RFSA 4IEEA 1EG7A 1UF9A 4TWZA 3CH5A 3OHMA 4TMZA 1BOFA 4V02A 1UKYA 4JLAA 5SZIA 421PA 1CKEA 1E1QA 2DFNA 2GKSA 2DCUA 3AEZA 4KODA 2IBMA 4LJ4A 2GJAA 4Q7LA 1FZQA 4JLPA 3TBKA 4BFWA 5C46F 4BGDA 3AVTA 4OQFA 3QF7A 3BD9A 1TF2A 2FDCA 2QG6A 2WHXA 4TMWA 2WSSD 1QHNA 2AFIE 4O25A 1F2UA 1XD2A 4TTQA 4BLRA 1NN5A 1UPTA 2VHCA 4R2HA 4NCKA 2BIFA 2A7QA 1D5CA 3N2IA 5BWMA 2IYWA 3LV8A 3HYRA 4HAVA 4A0GA 3EA5A 1TQDA 1DAHA 2IYQA 4G5RA 2ZRBA 3B5JA 1F2TA 3LWNA 1W2HA 2ATVA 2ZE7A 4OYHA 3NVAA 1WF3A 5LBIA 5J4HA 2OBMA 2OLKA 2ZI9A 3RC8A 5EZ5A 3RVBA 2QTHA 1A4RA 3I73A 3D7MA 4LHWA 1OT3A 3KQNA 1SHKA 1KO4A 4II7A 4LBYA 4O2RA 1TQ2A 2A78A 1BMFD 2F1JA 2JATA 3QPUA 1J99A 4FMCF 3MRSA 4DVGA 4FMBB 4C0BA 2Z4RA 3B1ZA 3L0IB 2JLYA 1OXSC 3OFNA 1Z2AA 1SVIA 5H70A 4NBSA 1C1YA 2BBSA 4R98A 1OH7A 1VIAA 3FMIA 4LPKA 4PO9A 2RH5A 2P3SA 3MWJA 1RIFA 4M53A 1E3MA 3U44A 5CYPA 1Q44A 4ERNA 4CT5A 4B76A 2EVWX 4CZ2A 3UMFA 2RCNA 1NVWQ 2W2XA 2WWGA 1CR4A 1J8MF 1KIMA 2J41A 3AH8A 3CX8A 3K0FA 5KHOC 1FL9A 5JI2E 1EGAA 4IXMA 1LS6A 2RGNA 1SKYE 2BJVA 4A9AA 3QXCA 1U98A 1IY2A 2IC5A 3DOEA 4OJQA 3SOPA 3WXMA 3KKOA 3ADBA 2WAXA 1YZTA 2JA1A 3C7KA 4Q4AB 2LCFA 4U5XA 2JLWA 1XTRA 3LW7A 3NBFA 4DHEA 4EPYA 3QJYA 4L16A 3PUXA 4IDQA 4TL6A 1XNJA 2C8VA 4EUNA 4C2TA 3FPAA 3BAFA 3EW9A 4BFVA 3FHTA 2ZTSA 4ZDIA 1XCMA 3U7EB 2KWIA 4X8OA 4RJLA 4EJSC 1CP2A 2ZJ2A 1K5GA 3BFKA 2CK3A 1UAAA 1OHHA 4JZKA 3JZMA 2DB3A 3CBQA 4BFZA 4CEHA 4EPVA 1UEJA 2J7KA 2XZLA 3PR1A 3K09C 3NHBA 3L43A 4ASUD 3QKRB 5KO2A 3K9HA 3BC1A 2WOOA 1KOFA 4AKGA 4JJKA 2ECKA 4V0OA 3ZQ6A 1TU3A 1NMXA 2P6NA 4JBXA 2TMKA 1L4YA 2ODEA 4AIIA 2Q3MA 4HAZA 1T5IA 4B3BA 4FXPA 3P4YA 5FTLA 2R6DA 5JRJA 1CIPA 5AK0A 3QEOA 1R5BA 4XTCS 2GESA 3OFND 4UQOA 2J7PA 1J2JA 4NHOA 3CRVA 3KXLA 3DKVA 1W0JD 1XTJA 4B35A 4YONB 3N70A 3U7FB 1JAHA 3IIMA 4YC7A 1OXXK 1XEXA 3BS4A 1YR9A 1KI7A 2ZR0A 3D31A 5BN3A 2HT1A 3UMSA 2GNOA 1OB5A 1EFTA 4JSTA 1Z06A 1P2UA 3VTKA 5DN6D 4LC1A 1W0KD 721PA 1NJGA 2V9PA 4AC9A 4PC1A 2N46A 2PX3A 1XTSA 3ADCA 4XWKA 2GXSA 2IUSA 3IKJA 4LBZA 1GITA 1X6VA 1KDOA 2VIIA 4NCIA 3UANA 2VHUA 2CJWA 1GL7A 2AR7A 2D3WA 5HE9A 1E1RA 2W0MA 3FMPB 5EP2A 2JLSA 3KKQA 3WYAA 3KFVA 1KI2A 1DAIA 3TVDA 3IQWA 2CEAA 2JDIA 4O0MA 2YOGA 4R2IA 4RKEA 2ZRHA 1NJFA 2HCBA 2LWIA 4FCTA 1NKSA 3QKSB 4A6PA 2RGAA 4KBGA 2Z83A 1CJVC 1Q1EA 3OAAA 1OHHD 4L9SA 4FWTA 3WRYC 2QTVB 5JECA 2O8BA 1IN4A 1SGWA 1TEVA 2V6IA 4DDWA 2IYYA 1HY3A 221PA 2ZRIA 2CHGA 2W2TA 2HF9A 1ZC3A 2ANBA 3UWKA 4Z1MA 2HXSA 4IFBA 3QI2A 4D6PA 1VYUA 1KMHA 4A0RA 1R0YA 4D4MA 1P3JA 2NQ2C 3VR3A 5HZKA 1W46A 1IM2A 1DS6A 3RS5A 4ACAA 3K09A 4ZO4A 4AKIA 4G3XA 4ZKEA 3O8CA 1VYTA 3QVVA 4HEJA 4JLKA 4RCYA 3AKYA 4NKRA 1U0HC 2C5LA 4MITA 4DCSA 3IEUA 3UMRA 1KHTA 3FHOA 6Q21A 4FN5A 3Q7PA 5E7MA 1G64A 1XZQA 2IWHA 5FUWA 1Q3TA 5JEDA 4XD7D 4D4KA 2OXCA 3FTQA 3PUZA 2Z4SA 1HQCA 2NIPA 1T5LA 1KNXA 2NZJA 1JB1A 3VX4A 3C15C 1WP9A 1KO8A 1Q0UA 1GNRA 2WOJA 3B9QA 3IGFA 2YVUA 4GNKA 2Q21A 2ORIA 3K9LA 4Q47A 1E2EA 4LCBA 1SVWA 1G6OA 5KPJA 4JS0A 3I8XA 5EP3A 1ZVQA 1R5OA 3CRW1 3C41J 4HAYA 3EC1A 1ZJ6A 2RAPA 2ODNA 1G8HA 2FSHA 3BFVA 1OH6A 3FFAA 1NP6A 3A4MA 1P9RA 1G4AE 4HB0A 2Z0MA 1JAIA 4BFXA 2CDNA 4Q4JB 2QBYA 4FW9A 5JS7A 2DYKA 1KI4A 2WJHA 2D62A 5FOSA 3KQLA 1MKYA 4JYBA 1S9HA 2O8CA 4W5WA 4RZ3A 2E87A 3BH0A 4M21A 4F4CA 3HYTA 2JEOA 3DM5A 3NBZC 3FYHA 1ZNZA 1S1CA 2WJJA 3DMNA 2P65A 3TK1A 2XITA 4DEYA 2B8WA 4MRRA 5HR5A 2E9SA 2L0XA 2J0VA 2QORA 2VPPA 5F9HA 2LKDA 4A2QA 4JLNA 1S0UA 1OJLA 5JJKA 3OEHD 4TMTA 5M04A 4U7DA 4DSUA 1EFCA 3K0AB 5L3SA 1KJZA 1QHHB 5DHFA 1JALA 3CX6A 3EZ7A 3I32A 3RWOA 1DADA 2V1XA 4KHZA 3Q9LA 1E9DA 2IHBA 4N0EA 3R7WA 3EPLA 1G3RA 4TLDA 1KSGA 4HAXA 2KBEA 4KFTA 4W9MC 2OCPA 2OLJA 3KTAA 4Q21A 2QT0A 2YC2C 2GCOA 1YR8A 3GJ8A 5JI3E 1BIFA 2Z43A 3T5DA 3IILA 1YZUA 1S1MA 3PEYA 3Q72A 1OH5A 1AN0A 3DPUA 1T8TA 2FH5B 4D4JA 4BZXA 4NDZA 5IK2A 4WW0A 2CL0X 5LD2B 2J0SA 2X8AA 4P4UA 3CNNA 3SJCA 1J90A 4RZ2A 1VG0B 2QZ4A 1OV4A 2GA8A 2ZR9A 1IXZA 2QENA 2ZAOA 4JSYA 1W4RA 5CJ2A 3SYLA 1FNNA 2OV2A 2PT5A 3CNLA 3ETLA 4DB4A 1GRQA 1Z22A 1P4SA 2KI5A 2A5FA 2HUPA 2F1HA 2BEJA 2EFCB 3ND8A 5FOUA 2KSQA 1XX6A 4I1VA 2BWJA 2J0UB 2DWQA 2W6JA 5K8TA 2OO7A 1A5TA 3BH6A 5DHAA 4CYMA 2WWYA 5KDOA 1OKKD 3VU9A 1SXJB 3PIRA 1E9CA 3WNCA 3U5ZB 1YVDA 2J5XA 3UG7A 4CT4B 2VP5A 3L0PA 4LZZA 3TAUA 3SU8A 2DWPA 4JYCA 3M4YA 2HEIA 1ZYUA 4HB3A 3TQFA 1ZCAA 3K0CC 4RD2A 2X2FA 1IAQA 4KBFA 3VQTA 3BXZA 3Q3JB 3T35A 2A9KA 4ZIRA 1D9ZA 3A1UA 3NTUA 1SVLA 5GADl 4LJ6A 4WZAE 2QP4A 3L0SA 4Z51A 2R2AA 1YRBA 4KV9A 5EE0A 5KSPA 1RKBA 4RD1A 4H1UA 2OUKA 3QKUA 5SZHB 2IYLD 3B1VA 3P27A 1IBRA 4BFYA 2X1VA 4CGZA 2REXB 3BRWD 2EWVA 1VPLA 4YQFA 1VTKA 2ASEA 3AV0B 1PVOA 2O8EB 3MJRA 1JJVA 3AF2A 2FSIA 2C04A 5DI9A 4XSHA 3RS0A 1Z0KA 4C0KA 3RDPA 4FMDF 4EPXA 1G17A 3IO5A 4YMWA 4L15A 1MRNA 4UKDA 1ZC4A 3FE2A 2NTYC 4WZBE 1KKLA 1N0VC 4YXWA 5FBVB 3A37A 3U4QB 3AVWA 1CRPA 2JLXA 1E9BA 1HH4A 1XU4A 2BCJQ 3B13B 4TYPA 2CLDX 4ZCLA 3I3SR 2Y8EA 3GEHA 4I99A 4FD2A 2HCJB 2XSZD 1KSJA 4A8JC 4DCUA 4S35A 4UNSA 1G3MA 4JL8A 3IUYA 4MRPA 3W3ZB 4IVRA 1VHLA 3V9PA 1G7CA 5KNCA 3AF1A 1ZMXA 5H68A 3W3AA 1Q20A 4B48A 2QP3A 2XZOA 1BO6A 5DGXA 1Z0DA 3OE7D 4Q4HB 4XWOA 4YMSA 4U00A 3VR1A 2QN6A 4P4TA 2NPIA 1JXOA 2ORWA 2ZJ8A 3ADDA 3R9WA 1P75A 2O52A 4JL5A 4YDHB 2VSOA 2ZROA 4PTLA 1W36D 1E2LA 2GXAA 1S2MA 1PLKA 3ZGXA 2N42A 4P0TA 2WJVA 4O2LA 3GFOA 1XXHA 1PJRA 3AVVA 5FTKA 1UBCA 4AG5A 1GTVA 4AWXA 2BM1A 4PC3A 4MUBA 2VP0A 4LJ8A 1YE8A 5J5CA 2F1RA 3QSYA 4BASA 2AKAB 4O3MA 1A2BA 1EK0A 1UBGA 3SDZA 3GLGE 1L8QA 5TDHA 2MMCA 4S2EA 2ZI6A 1LTQA 3THYA 2O8DA 4M1MA 3CZQA 1TF5A 4G5OA 3K70C 1VCIA 3PJRA 3T34A 1FX0A 2ZUDA 4KCGA 1F2UB 1US8A 1FFHA 1ZD9A 4Q01A 1NLYA 2QP9X 3I5XA 1DPFA 4RD0A 4WA7A 3PEWA 1EFRA 2HYDA 3C4JA 5AUNB 5K8IA 3HP1A 4Q4LA 3BERA 1RRCA 4OJKA 4Y0VA 3MUFA 1GSIA 3KL4A 4UJ5A 3AP3A 2OILA 1JPNA 2OZEA 1F2TB 4C7OA 2H7VA 5C4GB 1SVMA 3ONWA 2NO7A 1E2GA 4B73A 2WMNB 1II9A 1NG1A 1TUEA 2WIAA 1HURA 2FPMA 4PO1A 2D2FA 4Q1EA 3GLIE 1XFAA 2MSEB 1FMLA 4NP6A 3ZYCA 3KB1A 5KNDA 3HR7A 3ZH9B 1FOEB 5B57C 5KDDA 3ASYA 4PPQA 4CEIA 2WBLC 4UNQA 1Y3AA 3QBTA 4TSFA 1YU9A 3ZZUA 2VTKA 2AL7A 3HWSA 4QHSA 1WMSA 4OHVA 3TUIC 1NVVQ 1I2MA 3FMOB 1NSFA 4MH0R 121PA 2FN4A 3L2OB 1LS1A 4G1UC 4OI4A 2GAAA 3RS2A 4JLDA 3TW4A 4HLCA 4D2IA 3G82C 3KQKA 3U44B 3RNLA 3GLHE 4E03A 4WIAA 4DSOA 2VRWA 3DEFA 3FKSD 3P20A 5AUQA 2PMKA 3OEED 2R8RA 3K0EA 2WSMA 3K0FB 4M9ZA 1O87A 4QJ5A 1DG3A 4UNPA 1IJEA 4BLQA 3B2EA 3WP1B 1K8RA 3GFTA 2B7BA 1XMJA 3VNUA 2QM7A 4HB2A 5EE5B 1Z6AA 4LJYA 5KSZA 5JWRA 2QM8A 2B7CA 1NNEA 5K8UA 3FWYA 1RRFA 1M74A 4C0QC 4IOJA 5FUVA 3FB4A 4LSGA 3QVUA 2QRZA 4MYHA 2YWEA 3QOFA 2J59A 5GJWC 2GILA 5B64A 3W5JA 1JR3E 3CH4B 1QZXA 4L9WA 2JJ2A 2PCJA 4AY2A 4M1KA 1DARA 1PZNA 1T9HA 4OQMA 1TTTA 4HAWA 4BEBA 1UEIA 4LPSA 3QUSA 4BFSA 4CEHB 2EQBA 1YQTA 4KYIB 2A30A 1KI8A 2YNMA 3CPHA 4GMDA 4TL8A 2ZVPX 5DSZA 2GBLC 2GJSA 4DLSA 4V0NA 3OF5A 5IRCD 1CR0A 4DSNA 2R6CA 1X8LA 4B6EA 3EA0A 2MSDB 3B1WA 4I81A 5J4KA 2RHDA 3IHWA 1UBFA 3HU1A 1TNDA 3H1TA 4M4SA 1XTKA 1KZGB 1JQJC 5DI3A 2W58A 2OM2A 2C9YA 2O0JA 1EXMA 2XOKA 4B34A 1HE1C 3LXXA 3NG1A 2IS1A 4Q5IA 1Z83A 2ODWA 2WJIA 4UNRA 1XEXB 3KJHA 1XJQA 3W9YA 1OPXA 3CNOA 1XF9A 2GXUA 1IQPA 1E2KA 4WBSA 1DAFA 2C03A 1KZ7B 3FHCB 1E79A 2QL6A 2XAUA 1VCOA 1W5TA 4C9BA 5F98A 4B47A 3AKEA 1E0KA 4EPRA 2XNSA 3SQXA 1W7AA 1P9WA 3I8SA 3QXHA 4GRAA 2EFHB 3MWLA 1OF1A 1AZSC 2JLRA 2C96A 2IXFA 2IS2A 3SJBA 1SXJD 2IYXA 5AJXA 1J70A 3HR8A 4TT3D 4JLJA 2PLRA 2J0QA 1EESA 2CJWB 4MYUA 5JHHB 2ZYTX 1Z5ZA 1G7SA 1F48A 3UXMA 1G8GA 2Q3HA 4PPNA 2HF8A 5JBQA 1N5LA 3X2SA 4LWZA 1WQ1R 1ZM3A 4FCVA 4DBLC 4JL6A 4KYUA 3IHLA 2ONJA 3GLIA 5A0FA 4PAOA 1PV4A 2JJ2D 1J8YF 1A7JA 1KO1A 2G88A 2VF7A 2O8BB 1B0UA 1CU1A 3O8DA 3R8FA 1OYYA 1EFHA 5CB6A 1HYQA 4ILEA 5AJWA 2CBZA 2EFEB 3AGQA 3U2QA 3UK6A 3FFBA 3LH5A 4Q1FA 3BJIC 5L3VA 3B78A 4KXFB 4LBWA 4ACBA 3UATA 1KMHB 4LRWA 2AWOA 4MRSA 4TL7A 1G3IA 1HV8A 3Q7QA 1QG4A 3SC3A 3O8BA 4RKFA 5G53C 1G1MA 1CULC 1RYHA 5AJYA 4JIMA 1Z29A 2ZEJA 1SKYB 3LBNA 5FFMA 1XEFA 3VAAA 2IA5A 3NC0C 5KOYA 1KI6A 1E6CA 1N5IA 2D7CA 3UIEA 3VFDA 1K5DA 4E07A 3LVQE 4PR0A 5FTJA 2YWGA 3NKVA 4TYYA 5FL7D 2XB4A 1G291 1P62B 4CEJB 1FMJA 5GVRA 4DDTA 2YOHA 3RRZA 3SZRA 1MO6A 2R62A 3WYGA 5EE1A 4C4PA 2ZE6A 4BLPA 4AI6A 4J0QA 4Q1AA 3WHLA 5J40A 3PEVA 1R8QA 3GJ0A 2JCSA 3X1WA 1T6NA 1ZRHA 2VA8A 3AF0A 2BVNA 3MGCA 4C0SA 1JR6A 2XX3A 3B1YA 4PPFA 5LPNA 2FSGA 1ANKA 1A82A 3WP0A 4TTRA 5FPKA 3AVXA 1G4UR 2ZSEA 1EFUA 4HZIA 4P3YA 2QBYB 5FUYA 5IF9A 1WXQA 2CNWA 5IHPA 2K5UA 2O8CB 2V8OA 3H84A 4JVLA 1E0JA 1IHUA 4IEIA 2OCYC 4IRUB 1N6IA 2FG5A 4MKGA 4B74A 4Q66C 1KTVA 3WMFA 2V3CC 4V0ME 2H1LA 3BBPA 1E1QD 1NVVR 4PSAA 3IPXA 5E4FA 2QT1A 2MSCB 3LXRA 4IOLA 3EZ6A 621PA 1KJYA 1MO3A 2ZUCA 1CJMA 2C78A 4LX0A 2ORVA 1EX7A 1S3GA 3SFZA 5HPYB 5L3SB 2G77B 3ADKA 2IT1A 4BZQA 2G6BA 3FDIA 1NN1A 3D6TB 3TSWA 1D2MA 4ARZA 4XWAA 3R7WB 3IBYA 4MKFA 2DWOA 2AK2A 1YZGA 1ZD8A 3K9GA 3KTAB 2HYIC 1E0AA 4EFMA 4W5JA 2GCOB 2SHKA 2ZRMA 3EXAA 2P6UA 3MCAA 4HATA 4DEXA 5KSYA 3BIFA 4ZPXA 4B33A 3RWMB 4DJTA 5E95A 1G16A 3QQ5A 4P4SA 1GUAA 1P2TA 1GAJA 5DISB 3V4RA 2WIBA 4LY6A 1G5TA 1MO4A 2ZJYA 4DLXA 3WYFA 4KITB 1MABA 3QKTA 2JJ1A 1UJ2A 1D9XA 3A1VA 4LJAA 2FPKA 5AJVB 1G41A 2OFXA 1NF3A 2R65A 2CVFA 3CLVA 3LX8A 2P5TB 1Z08A 4IDNA 1ESNA 1F60A 2FGJA 4QJ3A 3U61B 1HT1E 4XTRA 4GBMA 2OBLA 1SZPA 3BOSA 2AX4A 3X1XA 3CWZA 4AG6A 2D4HA 1R4AA 3DZDA 4C0JA 1S3SA 3S1AA 3QG1A 4TLAA 1FUKA 2H5EA 2HXYA 1RZ3A 2GZDA 3LVRE 4A0FA 4TMKA 2V6JA 3OIVA 2WPDA 4Q02A 1D2EA 4GL2A 3VU9B 2ZRPA 2WZQA 4TMXA 1XD8A 4M8NE 4LYAA 1G5RA 1KI9A 1NI3A 3NWJA 4NYMQ 3W8NA 1Q1ZA 1X3SA 1KSFX 1W36B 1P7CA 2ZE8A 2F43A 3DKPA 4FINA 2Z5FA 1RW4A 4JBYA 1E2MA 4YLGA 2CL7X 5TY0A 3W34A 4PAQA 4ZIRB 5C2JB 4MDEA 2XTNA 2W0SA 2QAGB 3HPQA 4ON9A 3ZVNA 3QXSA 1G20E 3SR0A 2ZS9A 2VP6A 4Q48A 1N25A 2ZJAA 3NXSA 4OI0A 2C9CA 5EXTA 4EDHA 2CK3D 3N5CA 4GT1A 5C4MA 3ZD7A 2YJTD 3UKDA 1T3LA 4D25A 5BXQC 5FI0B 4YMVA 3U7GA 2G9NA 4XVRA 4LI0A 2V7QA 4L8GA 4DB2A 1SQ5A 1ZINA 2NMVA 1KI1A 3K53A 4EJSA 5EUQB 1ZD1A 4AKHA 4F7WA 3A1SA 3D8BA 4KU4A 1HE8B 2OFWA 3C5HA 1JEDA 5EJEA 2J7PD 4BFTA 2NO0A 3G5UA 4V0MA 3R9XA 2AD1A 1KY3A 4BWYA 1ESMA 1KGDA 2QPOA 3QG5A 4PHGA 4BLTA 2ZYVX 2ATXA 4GI7A 4QHYA 2C95A 3ZS9A 2P2LA 2WV9A 4Q03A 3U60B 3KUDA 4OKSA 1Q1BA 2VF8A 3B60A 3CW2A 3IIJA 5CITA 3MWKA 2D06A 3EIEA 4ZDWA 4JLVA 1KI3A 1UADA 2C9OA 4KFRA 2IS4A 4TN1A 2FE4A 1VG9B 4M22A 1Q57A 1ZNXA 2P0EA 1NY5A 5LB4A 5JCPA 3LAWA 4NCNA 4Z8YA 1E1RD 3NBYC 1P73A 4LV6A 3ZVLA 3BK7A 4OHYA 3SYNA 1XXHB 3MLEA 2QTFA 2HDNB 1VMAA 2IUTA 3DZ8A 4DKXA 2JDID 3DOFA 1Z6GA 3EASA 3RS3A 2VQSA 2A5DA 1Z47A 2FEOA 3EAQA 4DUGA 1R8SA 2Z6VA 2AXNA 4IOKA 3T61A 3W5IA 3OAAD 5TMPA 3QPWA 2YC4C 4PQFA 1G3UA 2BMDA 2GCNA 1I4TD 5KPDA 4URXR 3I62A 4HZUA 3LX5A 1RRPA 3U3MA 3THYB 2O8DB 2V7QD 4DSTA 1U90A 2ZU6A 4LDJA 4A6XA 2ODBA 4WXPA 5AUOB 2FJUA 4Z1MD 1FX0B 1QF9A 2Q0HA 4PX9A 4I1OA 1JEEA 1MOZA 2XNDA 4MKHA 3EARA 1G6HA 1US8B 1IJFA 2GEDA 2OG2A 1OXUA 5GJCA 1L4UA 1E9AA 5FH9A 3TUZC 4IFEA 2CHVA 2AHOA 5SZKB 1N2CE 5J47A 3GD7A 4U02A 1Z63A 2XXAA 2ZJ5A 4HLUC 4MGYR 5FPSA 3DMDA 4PFSA 1G7TA 3A4LA 1KYIA 1WB9A 3P4XA 3SYKA 3EZ2A 2DFLA 1OXVA 1NRJB 4GPTA 1UDWA 3BB3A 1SULA 1UKEA 4C7OB 4PXAA 3VMFA 4IKEA 4HDCA 4AYXA 3VNVA 2IK8A 2H17A 2P6RA 1II0A 2IYZA 3I92A 2NO9A 1T8UA 2NPFA 1U8AA 1TPZA 4B2PA 4PPGA 3KKMA 1G8FA 2QUZA 4TQUS 1KK3A 3NH9A 4CEIB 2ONKA 1G3QA 1G9XA 4MYTA 2PH1A 1P6XA 2JGNA 1TAGA 4N3NA 1WBBA 3CO5A 1CS4C 5AJZA 5FUXA 4QBGB 5C1BA 4PQYA 2F7SA 4PC7A 1Q21A 4LGMA 2ZRCA 3W90A 4M1WA 1IOZA 2UKDA 2GK6A 2B92A 3CPEA 3NBXX 5L8VA 1FP7A 2BEKA 3SBDA 4DLYA 3CF6R 2I1QA 1W4AA 3LDAA 4MDFA 1PLLA 2ZYUX 3F0TA 1W5SA 4PHFA 4F4JA 4R7ZA 1U9IC 2DHRA 1AA9A 4V0LA 5HZHA 3I61A 4NCHA 1DO2A 3OIUA 3QIAA 4JT4A 3Q85A 4JKIA 1HTWA 2G0NA 4CIDA 4XIGS 2E1RA 2FMXA 1GNQA 4XJXA 1VHTA 3LBIA 4V03A 2J46A 2QSYA 4B43A 1ZUNB 5FOWA 4PO8A 3OIWA 4CRWB 5J4VA 5JRZA 4I1SA 2WWFA 3IQXA 5IDVA 4POAA 3EIQA 3J81k 2BOVA 1D6JA 2ZI4A 2EW1A 1U99A 3F8TA 3TNFA 3X1YA 4F93B 3P26A 2ZRKA 4MKIA 4B3FX 1E9EA 1NBME 1J7KA 1RRGA 2FSFA 2IW3A 2QPAA 2RGGA 4RCZA 3TSOA 5JHGB 4TZ6A 1LV7A 1NLFA 1OLOA 1XDBA 2RHMA 4WOPA 4NYMR 4XH9B 1DVRA 5ELXA 4Q9HA 2BMFA 5CB8A 1QDEA 5AR1A 2J87A 3ZQJA 5DLQC 4JJZA 4Q19A 4RD4A 2NZ8A 5DH9A 3EPKA 5IK2D 4Q9IA 3ND9A 3T12A 3MJHA 5EXPA 4MYCA 5DI3B 1SVSA 1N6OA 4Q00A 1U0JA 2IEYA 1XMIA 4MGZR 2CE2X 5EP4A 4B71A 3B6EA 2ZU0C 5HCIA 4DDVA 1NN0A 1AJEA 4DIDA 2BC9A 4F4IA 2PJRA 5KSOA 4C0AC 1QHXA 3AVQA 5FBLB 3SFVA 1RPZA 3LD9A 5D3QA 5EXXA 3AVPA 1E2QA 5FPYA 2GWHA 4M1OA 1KMQA 2WJGA 4M9SA 3RHFA 1MT0A 2F1IA 2OEPA 2XJ4A 5HTKA 3W6PA 1KDRA 2QA5A 1Z6TA 2NO1A 2W6JD 5KYKA 2WJYA 1ZIOA 2IYRA 4QM6A 2R6FA 3THWA 1E69A 2JLVA 4HDOB 3RAPR 4IOMA 4C3ZA 4LHXA 4KAXA 1VG8A 1M1YE 2ERXA 2Q9CA 2UVQA 5BN5A 1QVRA 3CF0A 4HDQB 1AQYA 1EWRA 3C8UA 3ZZTA 1U9IA 1COWA 5LD2C 2VHTA 3QNUA 3GP8A 3M0EA 1W49A 3GLIB 3A1TA 4RD3A 1Z6XA 3SEAA 4Q9JA 5JWHA 1E99A 2X77A 5DNYB 3AKCA 4LHVA 2ZAMA 4EPWA 1YZQA 1E2HA 3E1SA 3EX7C 4RFSB 1XZPA 4NTZA 4CW7A 3K0CA 4BE7B 1WCV1 4Q1BA 1R0XA 2ZRLA 1P9NA 4AKEA 3OIYA 1KO7A 2QPTA 2ZI3A 3WNDA 2XTZA 3ZDQA 4KFSA 2FA9A 3THXA 1M7HA 2BJWA 4US0R 2ZS8A 1H8HA 3TW8B 1SXJC 1FW6A 3E70C 5TXGA 1AZTA 1AS0A 2ZRJA 3AM1A 4C2UA 1XD2B 4XVQA 4R71A 3GJ6A 4EIWA 2R6AA 2REBA 1W44A 4TYNA 1E96A 1GKYA 3DO6A 4YXWD 2CLSA 2FNAA 1NLZA 2J3EA 1CEEA 2DPXA 4G0NA 4H9GA 4HI0E 2W6IA 1KI6B 4NZYA 1DTSA 1HEIA 4BLSA 3ZZ0A 1GFIA 2YWHA 1IY0A 5E7IA 2IXGA 4LHZA 5G40A 1R0ZA 5EUMA 2O8FA 4BRUA 2RMKA 1ZCBA 3W6NA 5KTYA 5JS8A 3GLFE 3G0HA 3K0AA 3KJIA 5FBRB 1NVUQ 2C2HA 1G5PA 2FFQA 3C14C 3CUEF 5AWFC 5HE8A 2Q9BA 4DLZA 4E5UA 3GJ7A 4A8JA 1E2PA 2JLUA 1X1RA 1NBMA 4HLQB 4Q1DA 4M9QA 5CLLA 2RGCA 3QF4A 1COWD 1P60A 4NCJA 1OFUX 4UXHA 4HAUA 2AXPA 2GHIA 1E98A 3ECCA 3PITA 5CDFE 1ZU4A 1EX6A 2OESA 4B3XA 3BB4A 1AGPA 4JVMA 1CF4A 3CONA 4A36A 4B32A 4ZCMA 2KB0A 2XTMA 2CL6X 4FI3C 1TX4B 2CE7A 4LYJA 4GP6A 5P21A 3NDBB 4ZV4A 2JIZA 1ZAKA 1XMSA 2HLDA 1E4YA 4EQ6A 3SI7A 4NYJQ 5FPTA 4ABYA 4Q18A 2YV5A 1KJWA 3K0SA 1OXTA 4WVFA 4RFVA 3TVTA 1XPRA 1NSTA 4KSCA 1LY1A 2ZXUA 1Z0JA 2WWHA 5J4YA 3CB4A 1E9RA 2PX0A 4DLUA 2ZSBA 2CXXA 2VLIA 4D0NA 3FOZA 2C99A 1E2FA 1OIXA 3TRFA 4EFNA 3RSLA 3F5FA 4ARZB 1EFRD 4Q1CA 2YOFA 4FCWA 4G5SA 1A2KC 1XP8A 3B7GA 2NG1A 2ZITA 2FWRA 3W6OA 5CIWA 2W6ID 4K81B 3WY9A 1NY6A 2WWIA 2BMJA 4DLWA 1ZIPA 2QEQA 2WTUA 2ZJOA 4RY2A 1T3SA 1E2IA 1MR3F 1IXSB 4PHTA 1GRRA 1RE0A 3U7HB 1BH2A 3PVSA 2CCKA 3PENA 1ELOA 2WWWA 4UXJA 1CLUA 2DY1A 2A5GA 4P4SB 4C0LA 2DBYA 1TL7C 3ZIAA 4GOJA 4TLEA 5EE3A 1R0WA 3ASZA 3U6KA 1KAOA 5G3ZA 4AK9A 1MABB 1Z07A 4XSGA 5EE9A 3GFPA 3AF3A 3IPYA 4MRVA 3UPUA 4M9XA 4TSFD 2AFHE 4A0HA 3M6AA 1GILA 1NBMD 2LKCA 3TE6A 3TSZA 2WMOB 1KNQA 4NE2A 2AWNA 4EFLA 3GLGA 1E9SA 4URUR 1Q22A 2BKEA 2FX3A 1GKIA 3LBHA 1UFQA 3S1AB 4CVNA 4FWIB 1U2RA 2G3YA 1YZKA 1P2SA 2GJKA 5FOXA 2ZM5A 4QKQA 2JIZD 4ZDJA 3C16C 2QQEA 3BGWA 3REGA 4IVQA 3WRXC 3TLXA 2O5VA 3SN6A 2O0KA 1MH1A 4QOSA 3TIFA 4LBVA 4NMMA 2QNRA 3N2EA 2D7DA 2PLFA 2ZR7A 4LYFA 4IXNA 1I4LD 1QBKC 3GEIA 4LC0A 1M34E 5EQTA 5F2EA 1FQKA 2IEZA 2VHQA 5DYGA 1XD9A 3LRPA 1ZU5A 2F43B 3PUWA 3T1QA 4NONA 4QL3A 2NO6A 2QMEA 4RD6A 3GJ5A 4OHXA 3VR5A 1CBUA 5A5GA 2IYSA 3GLFA 3ZJYA 3V00A 1PLJA 1OE0A 2B8TA 4LYHA 4NH0A 3E2IA 4AYTA 4P31A 3H0KA 4ITRC 3RABA 3EWSA 3PG5A 1U8YA 1PUIA 1M2OB 4QFMA 1BMFA 2OXRA 1AGRA 5J4LA 4NPHA 2B6HA 3LNCA 2KBFA 1OFTA 2PBRA 1RC8A 1OH8A 3DDCA 3KXKA 1CR1A 1FUUA 4G5GA 5CDFA 2YYZA 3QY0A 1UDXA 4EJSB 4PC2A 3TR0A 1R2QA 1M8PA 1N5KA 2EWWA 2QRNA 3GLHA 3MWYW 4QBIA 4EAQA 3AVUA 3I72A 3I5YA 5FBQB 4PZLA 1N6RA 1Z0AA 2PZGA 2VH5R 3B8HA 3QPVA 3UG6A 3EZ9A 2GBLA 3SNHA 3VR2A 2XOKD 2WICA 1UKZA 2UZ3A 3KXIA 3O47A 1F6BA 1XMVA 5GJVC 1SVOA 5G3YA 5FTNA 1E32A 5TB5A 1ZNYA 3CIOA 1ZM2A 2GF9A 1E79D 1HQYE 2H8KA 5AUPB 4MGKR 4KSBA 1P5ZB 2WWXA 2JLQA 2OFOA 2ZRFA 4LV5B 1JR3A 5C18A 5CIQA 4OL0A 4A82A 3SHFA 1MV5A 2Q3FA 1QVAA 1UM8A 2ZIAA 4NU0A 1ZUHA 4TTPA 5D3MA 1BYIA 3SQWA 2VO1A 5B58C 4TLCA 2QI9C 2YINC 5CYOA 4ASUA 2ZSAA 5DIFA 4BQSA 1E2DA 2QGNA 4GOXA 2HV8A 1IN6A 4GOKA 5JEEA 4QGGA 2F3TA 2ZYWX 1BS1A 2GZHA 2ZANA 3IIKA 4WAUA 1M6NA 2QAJA 1N6NA 1E94E 3A6PC 2N1BA 1FPMA 2J1LA 1JXMA 2G1JA 3OZXA 4A2WA 1F5NA 4A15A 2FGKA 3MD0A 1KO5A 2P5SA 4TLBA 1U8ZA 4HYYA 2CMKA 4HZUB 4M1TA 1W0JA 1P72A 1N0UA 5L3QA 4KO8A 1VECA 3CR8A 1SHZA 3M1IA 2OT3B 1BYUA 5B30A 4GP7A 1TEXA 1G7RA 4PQRA 5CK5A 3LLMA 1P61B 1L2TA 2XXAB 3AKDA 2R6GA 3GJXC 3T1VA 1G19A 5DN6A 4URZR 1W0KA 1S4QA 2GTPA 2OSBA 3D3QA 1F3OA 1WRBA 4JT2A 1JBKA 4JLOA 1GNPA 1HA3A 4NYJR 1SKQA 4Q9LA 3VX3A 2XGJA 2PZEA 3DHWC 4W5HA 1YZLA 3U6BA 2IS6A 1ZBDA 2ZSDA 2RB4A 1R7RA 2ZI7A 4JVNA 3KB2A 4A4DA 2XEXA 1WE2A 1YKSA 2AN9A 3CRQA 1Q12A 4D26A 4FMCB 1RVDA 3TH5A 3AVYA 4D0LB 3IDQA 5JLJA 3REFA 2RGBA 2XZPA 4MQBA 1JR3D 3IBGA 4MGIR 4OK6A 2H18A 2ZETA 2BHRA 3AUYA 1CJKC 2HJGA 2ZUBA 1R10A 2ANCA 3BH7A 1GDDA 4L4UA 4DLTA 1II8A 4XOIA 4OHZA 2NOAA 2IXEA 1AQUA 1OW3B 2V55B 3KX2A 4PZYA 1N3BA 4Q7KA 3CPJB 4D0GA 2ZRNA 3FMFA 3B9PA 3RC3A 1N0WA 5EZ6B 5BN4A 4HUQA 1X86B 1KAGA 1KK0A 2AKYA 3K8YA 2IYTA 2DFKB 2CNWD 2VEDA 1ZW6A 1RJ9A 2W83A 1EWQA 1XWIA 2VP2A 3P32A 4DCNA 2FFBA 1DAGA 3R8CA 4DCTA 2J45A 3A8TA 3HJNA 3CRMA 5KDLA 4OQLA 2GJ8A 2VP4A 3B82A 5EP1A 1E0SA 2FFAA 3NDPA 1HT2E 3KKPA 1FTNA 4KJZA 4QNRA 1CTQA 3W8RA 4D82A 821PA 2BKUA 4XD7A 4A92A 4BLOA 2HT6A 1PUJA 1XJ0A 1NG9A 1JECA 1D2NA 1T0JB 2PMDA 3GQBA 5JJLA 4IHQA 1YRAA 2MMGA 3L8YA 2QE7A 2VL7A 3T15A 1VG1A 3TJZA 4DT1A 1C9KA 4LOAA 1FP6A 4CF7A 1YR7A 4ZI3A 2WKQA 4US2R 3BB1A 4MRNA 1Q1QA 1W4BA 1I4DD 3IO3A 4JBWA 1Z3IX 2FOLA 2YHSA 4ZCIA 1CR2A 1N6KA 3TGPA 2IUUA 2ZRAA 1G8PA 5CK4A 1JPJA 5L3RA 1FNMA 5FTMA 4B2LA 5JSZA 2JJ1D 3LLUA 3PUVA 2EU8A 4LUCA 3FGNA 5BYKA 1AS3A 1TU4A 1YHNA 2IX3A 1TUIA 4KLZA 3GMTA 5ANRB 4G5QA 1Y63A 4M1SA 5FR2A 3DM9B 2I4IA 1ZM7A 2ZPTX 3U3JA 4YMTA 4DZZA 3T06B 4P32A 2VSXA 1U94A 3PEUA 3KKNA 1BKDR 2CLCX 2DFTA 1KK1A 2D2EA 3PFIA 2PT7A 2V54A 3OEHA 3WBKA 1R5NA 1RYFA 5TV2A 2WPDD 1WBDA 2R44A 1NMYA 3LQRA 3THWB 2V1UA 5B2ZA 4P33A 4QGFA 1ZM9A 4DRZA 5KNBA 1W4CA 1W48A 1WDTA 2AK3A 1GL6A 2A2ZA 2FPLA 2H57A 4D80A 5H8WA 4AURA 1OYWA 3ZS8A 3NH6A 2ZREA 3L8ZA 3VKWA 3AGPA 2H16A 3A4NA 1XJCA 1DOAA 1S9DA 4E22A 4AD8A 2YZ2A 1XPUA 3ZD6A 3EWAA 3QEJA 5CLQA 3RSOA 2R9VA 4IW3B 4CEJA 3RRNA 1W2GA 5CJPA 3A36A 3RS7A 3AUXA 3L0OA 3CR7A 2QE7D 4GZLA 1QHGA 4UJ3A 1Z8FA 2A5JA 4K46A 1LNZA 1E2NA 3GPLA 1DAEA 4YMUA 4X8LA 4WXRA 4OBEA 3HU2A 3THXB 4MA4A 1NVXQ 2IHYA 4B3CA 8OHMA 5E3HA 521PA 2PZFA 2QGZA 1LW7A 1KKMA 1XB2A 1Z28A 2CVHA 1IN7A 1NIPA 2G83A 4QRHA 1FQJA 1W36C 3EC2A 4JKYA 4DDUA 2BM0A 1OKKA 4B44A 1OSNA 3Q5EA 2CCGA 1HUQA 1XPOA 2QAGC 3RRYA 4LK2A 4B3DA 2BBOA 4TMVA 2A3RA 4BRWA 2WAYA 1IN8A 5K8LA 2AD5A 2O8FB 2IL1A 4BPBA 3BORA 2GK7A 4RZXA 5SZJA 4ESHA 3JVUA 1W1WA 1N6PA 4Q4AA 4JLBA 2G0TA 4QM7A 4PSKA 4QGAA 5CM9C 2GZAA 2REOA 1TQ4A 1P2VA 2H92A 5FBWB 1JJ7A 4A8JB 4Q7JB 4TZ0A 3RLFA 4DC9A 4LV8B 2UZIR 5FL3A 2PCLA 3BFXA 1KDTA 4Z54A 3T5GA 1AKYA 4M0LA 3PCRB 3QF4B 2JJ8A 3E5HA 3EG5A 3SHWA 4URYR 1DE0A 1KY2A 1YZNA 2ZJZA 3F3YA 1IN5A 1Z2CA 3CWQA 3HU3A 1M7GA 5JJIA 1W47A 1B23P 3QKRA 1X8KA 1XXHE 1DBSA 4DLVA 1XBTA 2EYQA 3K9NA 3JZAA 1GOTA 2Q6TA 2ZVQX 1H65A 2BBWA 4DUGD 4B2IA 4EPTA 4OK5A 4EQ6B 5HKKA 3T1TA 1T0HB 3K1JA 1VKJA 4XVUA 4TYQA 2OE2A 2QQ0A 1KSHA 2JAQA 2OCAA 2QROA 3QENA 4KFUA 1GKUB 4QNMA 3NC1C 5KUTA 2XSZA 5BQ5A 2XNDD 4F92B 2OAQ1 3WHKA 4IDOA 3KUCA 1G21E 1OFIA 5JCZA
chains in the Genus database with same CATH superfamily
1P8JA 3HH8A 3VR6A 2AJ8A 4BMDA 3GRUA 3OJFA 3SS8A 3WBJA 2NPOA 3QIVA 1U0SY 3JAKB 4BCDA 4K9DA 3GLRA 5LYYA 4GMXA 1DB3A 3ABRB 4P7FA 5LQDA 1DJMA 5DOVA 3MILA 1UQRA 2GN8A 3LX4A 2D0OB 5BR7A 3TXXA 1QV6A 1TQ6A 3STYA 1Q2XA 3U7QA 5IKMA 4EMSA 4RTRA 4NYIQ 1E1LA 4G5XA 2NWQA 2YTZA 3EK2A 4CU2A 1CJTC 1XROA 4CDRA 3TTTA 2H59A 3OE5A 2B2CA 1JNYA 1JYEA 2HSEA 3IP3A 3M82A 4NI5A 2AC2A 4G0QA 2QN9A 1GWNA 1ZZGA 2QTRA 3A04A 1XSEA 2YMLA 3MELA 5CVEA 2AQHA 1E4VA 2HNAA 1NLMA 3TKLA 4PHHA 3FCOA 1BDJA 2VAWA 2GA9A 3ZJUA 1PV2A 3GLGB 1CUJA 2BGLA 2YJ4A 5F1KA 2QTVA 3MFYA 3C1UA 3C74A 3GL9A 2FR8C 4X1YB 3ZE7A 5ERXA 4G09A 1KJJA 2ID8A 5H1YA 3IJEB 3CXRA 1A1VA 3NVDA 3E5MA 2YW2A 1DSSG 4UBIA 5LN1A 4HGQA 1M0TA 1DLJA 4RZUA 4IUYA 1V3TA 2WE7A 4MS3A 3TUJC 1FSZA 3F9RA 2V5UA 3OLYA 3OFJA 5FUMA 3AQ4A 1N2CA 1CZNA 3GT0A 3WNBA 3WFZA 2F1KA 1BDMA 2WF6A 3L0DA 2Y1EA 4MUAA 1XYYA 3B53X 3TOCA 1VCNA 4DV4B 1ZD4A 2WKRA 2FKNA 4P3XA 1SXJE 1ISPA 2BFEB 4HUTA 9ATCA 2FZ4A 3QXJA 1YRYE 1UKVY 1NKTA 3HY4A 1Z74A 3Q0TA 2GN4A 4GDFA 3WSTA 1AKVA 1GGVA 1YOVA 1L5FA 4CTOA 3GMIA 1GCUA 5FO1A 1N5JA 4CTJA 1NXQA 1U04A 3OT4A 1H66A 1BTOA 2REQA 4F86A 1W0CA 4IAOA 4MULA 1XEAA 4KLNA 5DJ5A 4LJ7A 3UC5A 4EENA 2IBTA 4S2UA 1QKJA 2RH4A 5I4CA 3PLRA 3HUUA 4CDGA 2COUA 4WPGA 2E4AA 5DU2A 3ICEA 3RSFA 3GFGA 4Q3BA 2DT8A 2C1EA 4BCBA 1BKYA 1E60A 1MZVA 2G6TA 1X1BA 2FEMA 3ILYA 1S2OA 4HMQA 4KXXA 4QVIA 5AT1A 4IVPA 3PFFA 2PEYA 1UANA 3I5UA 4BNYA 3AHGA 3O8RA 4FMDB 3B52X 1ADJA 1E1NA 5BSEA 5WRFA 4YYZA 2NGRA 1MAVA 4WXMA 3V1TC 4DQVA 2OM6A 1HDRA 2C77A 3LY5A 4C07A 4GKBA 8LDHA 3KWFA 1ZX1A 1SCUB 1EP3B 1P29A 1ZRMA 4ARSA 3MQFA 1J5EB 4KPUB 3KT8A 3OEEA 4V1CA 3GJ4A 1D2GA 1ODFA 4ENSA 3IXQA 3UB2A 1DAMA 3W5SA 3ZVMA 5LIPA 3ZY2A 1VYHA 2VYQA 1AMUA 3NHLA 4BO8A 4I4CA 2O2SA 4I6GA 2VHVA 2BEVB 2A1TS 4X3PA 3FYUA 1VBNA 1T4GA 2QN7A 3R20A 1LJ8A 4NENB 3LKZA 4OXYA 5UKDA 3INYA 4QXAA 4ER3A 3NP9A 1Y7IA 3CUVA 4AJNA 4ZOLA 4E2ZA 4WNYA 3TQCA 2VHYA 1RBQA 4R8VA 1C7FA 5JG7A 4LHYA 1Q84A 1WHSA 1MAHA 2PL5A 2I3BA 1A71A 3LL4A 2O2JA 3H5TA 1H4QA 3ABIA 3Q9SA 5F4ZA 3MEQA 2ZUEA 1G5FA 4S1OA 1TRHA 2GEVA 4QU8A 5BSUA 1Y42X 4QHTA 2I6UA 3KHKA 1YZHA 2B21A 1H05A 3LHKA 3RV3A 3A05A 4OUDA 4JI6B 1VIYA 1QC5A 2GMWA 3ZHSA 2FRVA 1F8XA 3M3PA 3RSSA 3TAHA 5LDDC 4XJTA 9ABPA 4ESVA 1EWVA 2NU6A 2WTXA 3E3MA 3HQ4O 1RM4A 1WY7A 2H4FA 1ONBA 3LFUA 2AUTA 4I1UA 4QPJC 3D59A 4YRJA 5BW8A 1PZFA 3RM3A 4JJ6A 2P2NA 4AXBA 3RYCB 4ZCSA 4WXEA 2BBTA 4QNNA 2JFUA 1EPUA 2CJPA 3BGIA 3OZFA 4NFHA 2QY9A 4BFUA 2IUEA 2C2OA 1TEZA 1EINA 1YMUA 4EKDA 1RI1A 1RZUA 1C81A 4G07A 1ATIA 1TF7A 3I9JA 5IC5A 1QQBA 1BWSA 2C0PA 3A1WA 2XKKA 2BDTA 3WK6A 3L07A 3JYHA 3N2NA 1TDJA 1J2UA 1NW5A 1RYBA 2X5JO 4FOSA 1JILA 4R31A 5ALDA 3SBEA 3SY8A 3KJEA 5A05A 2HOQA 4JVSB 5AHXA 4YPVA 1ORTA 1DO8A 3Q8XB 4DDMA 5L3QB 1MAUA 1LF0A 3LUBA 2BKAA 3AP1A 3H5AA 3P2MA 2ZUFA 5F3WB 1LLQA 2IY8A 3DWGA 4H1VA 5H80A 2YMPA 4G1FA 1HE4A 4MW1A 1LSOA 5EJ2A 5BPFA 1HFEL 1GUBA 1NHWA 4EUSA 1IULA 1MFPA 1TA0A 3P1JA 3BD6A 1RMYA 3ASUA 3CF2A 1AUXA 3PYMA 1ZUWA 3PD0A 1HKUA 3PV0A 3SE0A 4DR1B 2C9MA 4TT8A 2J0UA 4Z5XA 5DE3A 5E3IA 5FX2A 1K3TA 1V5FA 2PZ8A 2HW8A 1RJGA 4MRAA 3B12A 3F9CA 1WXIA 2J6HA 3ZDBA 1YOBA 4G0UA 1U7HA 4XJVA 2GTHA 4DV1B 1SXJA 3O4GA 3OC6A 4AMUA 2FV8A 4EW3A 1O0CA 2CLHB 1JH8A 4A3SA 4HTFA 5HXAA 4YJGB 3Q5DA 1A04A 1R74A 1UJNA 1GSHA 4DBZA 3K9QO 4MQ5A 5LB2A 4JP5A 1MX5A 2Q6VA 2QV0A 3O82A 5DMXA 2R79A 5FOTA 4N39A 1UFVA 2DSNA 4UM9B 9LDTA 3L40A 5IT5A 2IH4A 2GBFA 4UEOA 2X5NA 1S5PA 3T7RA 3AZOA 3DAOA 3R5TA 4QBFA 1YQEA 3DHEA 3HSYA 1R6BX 1C80A 4MWZA 5BMOA 1Y3HA 1YQGA 2P9EA 2PFKA 3H2YA 4CR6A 1YJQA 5FBHA 3RO7A 1JHZA 3EY4A 2J3DA 1TJ3A 1WMFA 2AX3A 2EYUA 1WW8A 1D2AA 1GV1A 2CKMA 4M7WA 5EAIA 2OCGA 5JAIA 1VBFA 1I2DA 2HGZA 3HABA 4BECA 4HKTA 4CKEA 1JFVA 3O2NA 1P0MA 1TYBE 1W6RA 1Z0IA 5JS6A 4S1VA 1YCFA 1KFJB 2ICAA 2N0SA 5AKLA 5JFGA 3OOHA 4KN9S 3SFTA 4Z8XA 3EJ6A 5H5JA 1XCPA 1YS7A 1T1RA 1JE1A 1ZM4A 3JWPA 3R6GA 4GLJA 1XZCA 3BF7A 3C6XA 2I1VB 1V96A 5K8JB 2X14A 3TOZA 1PFQA 5GONA 5DZSA 3N0XA 4FQ8A 4CG1A 4X62B 2Y4OA 5FI1B 1IZ0A 3C6QA 3U4QA 3VHXA 3RASA 3GRPA 1GTZA 4U2GA 1WMAA 3OOEA 4CKBB 3F9IA 2E4UA 1EM6A 2GS9A 1JMYA 1W9MA 1AQJA 1D1SA 2HA6A 3I6BA 2R1TA 3A6EA 3LWDA 3PX7A 2E55A 4IR7A 5GAJA 1JIJA 5FOVA 5IJAA 4BE4A 2EKLA 4EZEA 4ED9A 4RABA 2F6RA 3OD5A 1HDGO 1N5MA 3H3FA 2J9XB 1TADA 4E6EA 4XCXA 1RC1A 5BWCA 3SKYA 1T1EA 2Y67A 1XRJA 5CURA 2QVCA 1IH8A 5JROA 4YRAA 3D3KA 1ONSA 3AVOA 2XF2A 3PBKA 1DIAA 1CY4A 5DBGA 4AWAA 2VDJA 5EWJB 4N01A 1FJHA 2I4NA 4FBLA 3LW8A 2RGEA 5EIFA 2XHEA 1KDPA 3AIIA 3NHRA 4B3SB 3U3OA 3AF5A 2FMKA 1LPNA 3NPAA 2GCPA 2QG9A 3AX6A 5CA0F 2JBWA 4CG0A 1D2HA 4CCYB 2JFGA 4Q3EA 1LVHA 1WV0A 4JITA 1VJRA 4YV2A 3FWNA 4BQOA 2O1WA 1RQLA 2H1WA 1AN9A 4DEVA 4DV7B 4W7SA 1RYNA 4U1RA 1L4HA 4CM9D 4RTJA 1YGPA 3OE1A 1EVYA 1R00A 4IEEA 1UF9A 3RREA 3T3MB 1NQTA 5LXTF 4KZKA 3NOQA 2L2QA 4V02A 5IKXA 4ALKA 2FZKA 4DTIA 421PA 5I5GA 4C3UA 2PKQO 1I7PA 3AEZA 2D7DA 3SZUA 3KCNA 1OMOA 2GJAA 4CF3A 4BGDA 1JX6A 2P5YA 5DV9A 2VJCA 2O5RA 2X3FA 1YQQA 2WD9A 5FT9A 2VDWB 2PUGA 1W76A 3PHJA 1EVJA 2QVBA 3LDUA 4MVJI 3TW8A 1TF2A 1V3QE 3L6DA 3CINA 1J8DA 2QG6A 4PYQA 2WSSD 1QHNA 1IU9A 4OXNA 2PUDA 2HFKA 4O25A 4TTQA 5CFLA 3PPVA 1CY6A 4BLRA 4ENPA 1NN5A 2C61A 3QBJA 5KYNA 2A7QA 1D5CA 3VJMA 5BWMA 4LHSA 3LV8A 3ZHZA 2JD2A 2NT4A 1U0OC 4UHJA 3TIGA 2GD1O 3KWJA 2VPIA 2IYQA 3B6MA 3PHHA 2C58A 2G4CA 1NVDA 4IIHA 1JIKA 1F2TA 3CS3A 3LWNA 4OM7A 1XWWA 3GA7A 1Z4LA 4N65A 4YRFA 3SQOA 1TGVA 4DANA 2F64A 3JSAA 3GW8A 4MUHA 4OYHA 5EKUA 2ZI9A 3HDHA 4X65B 1RFGE 4J16C 3RVBA 1N0IA 3I73A 3E15A 3D7MA 4PSDA 4YAKA 1YASA 1SHKA 2NP7A 3A4YA 5DHSA 3C3MA 3ELUA 1V39A 1TQ2A 5KTMA 4DVJA 2A78A 4TROA 2JATA 3IP7A 1UJ6A 1DKUA 4NZZA 4YN3A 1I01A 1PGPA 2FEAA 4PU0A 1XZIA 1EG2A 3BE5A 1OXSC 3BYZA 2OZLA 3A2MA 1SVIA 3HCFA 2BBSA 4R98A 4RS4A 3VZQA 3KQQA 3MA0A 3C6YA 1SY7A 2G0AA 3MWJA 2HDWA 3DL7A 1N3IA 2P41A 1BX1A 2XCSB 3C7DB 1QR2A 2OV4A 4LJLA 4AP9A 2OB2A 2ECOA 4IIBA 3WTCA 1T9BA 3KEFA 1A2OA 1YRQA 4UQPA 3AC0A 4D1YA 3UHJA 5DCWA 5JVDF 5LP6B 4PM4A 2IOHA 1HEYA 2HC9A 5JI2E 5FQOA 1B43A 3NTRA 4GZ3A 1LS6A 4O2BA 3QE4A 4LGVA 1MB9A 6GPBA 2P68A 3PGMA 4ZQGA 3ETCA 1ENYA 1DC8A 5AM0A 2O19A 3FLAA 5EN4A 1J1UA 1PR3A 4S24A 4OJQA 3TZEA 3F6PA 3PK0A 3BTUA 3H2KA 3JASA 2CSUA 2P6PA 4I4IA 2LCFA 3HYCA 1EEXB 1YVEI 5E3JA 4LF6B 4DHEA 3QJYA 4TL6A 4IDQA 2GHQA 1MT3A 1QWSA 1SUSA 2BFFA 1TZBA 2C8VA 3EQ7A 5LMUB 3FPAA 3BAFA 3WYEA 3ZCXA 3O0DA 4R7GA 3FHTA 1EGVB 1TTPB 2H7YA 2O7QA 3GVCA 5C1OA 4PNZA 2KWIA 1ZR2A 4X8OA 1GNLA 1TD1A 2X4GA 3PHBE 4N5NA 4RMNA 3UK0A 4C6TB 4P7JA 4X7BA 1PEAA 1MDBA 1YDHA 3QPAA 5BWOA 1BEZA 3C7CB 3JZMA 2Z9CA 3NYRA 2EP8A 3R4CA 1WQ3A 3OHPA 2XZLA 4HG2A 3PR1A 1ULSA 3Q7RA 1VHWA 3IP1A 3K09C 4ASUD 3LA8A 3PEEA 4ETIA 3R1IA 3K9HA 4PBTA 4TZTA 5EQJB 5JCJD 5HKBA 2JGLA 4Y6LA 1D0SA 1E1KA 5E6UB 1TU3A 1NMXA 2CD7A 2OV6A 3M5WA 4JBXA 5CRIA 1L4YA 4GW3A 4MQLA 2BGWA 1C9MA 1P80A 2IPAB 3P4YA 4JCOA 4N9WA 4U8GA 3TQSA 3W3AH 4KE7A 4AG3A 1JEYA 5AK0A 2C97A 3QEOA 1T9AA 4CMGA 2EDAA 2VHXA 3WGMA 2M1XA 2J7PA 1QSGA 2VG8A 1NAIA 4NHOA 4OIMA 1W0JD 3CKYA 2Y1DA 1XTJA 3PUHA 1DL5A 1EDEA 3S8EA 1OXXK 1T26A 2ZR0A 3VUFA 1OB5A 2GNOA 2MYTA 2O23A 4PNHA 4I5FA 4YDQA 3WO0A 1RLIA 1QS0B 1K8XB 4HWGA 2PWZA 4Q37A 1M3SA 1W0KD 3LZCA 1NJGA 4RULA 4HPXB 4BAZA 2N46A 5JIBA 2ZWAA 1NBOA 1IUOA 3ESRA 3GDOA 4HEA6 4JEHA 5F9MA 2WU3A 5BURA 5CDTA 2GXSA 2LV8A 2O14A 1AT1A 1EUDA 4MA0A 4OVKA 4NCIA 4E5KA 3UANA 1B0AA 3HFRA 2CJWA 2AN5A 1Y5IA 3V42A 2AR7A 2QIOA 1J49A 3FVRA 4FX5A 2OPHA 2AYXA 4MMZB 5BNFA 5A9SA 5K03A 4KAJA 5DT9A 5HE9A 1NYQA 1XJ5A 4FHGA 2W0MA 1AXGA 5EP2A 3X1KA 2RHLA 4M37A 5TMEA 3WYAA 2H1IA 1KI2A 1FDWA 3GVPA 4EJ6A 1UODA 1KHHA 2J5KA 3T4XA 4KTVE 5BNWA 2UZ0A 1EHCA 3GAFA 2PHZA 4BQIA 4UU1A 2LWIA 3N28A 1O54A 4AY4A 3OLWA 4A6PA 4Q6BA 2RGAA 2Z83A 3DV2A 4BGIA 3TRJA 1FBNA 5KYXB 1DBQA 1TEVA 4MIEA 4N5HX 3EGOA 1HY3A 221PA 1FDSA 2QGFA 2ZRIA 4F2PA 1F2DA 4CI0B 1AHPA 4BB6A 2IE8A 4N8DA 2R3SA 3O38A 3UWKA 2V7TA 3A3OA 2JK1A 3ICCA 2OOKA 5FWYB 3OJCA 4EGAA 4IFBA 5IDWA 2DUUA 4ZCPA 1RJDA 3CR3C 3RU3A 4NAUA 1DJNA 1E0DA 4YJ3B 1KEEA 1TM3E 2NQ2C 2UDPA 3LPDA 5HTOA 1W46A 3SS9X 1DS6A 4ACAA 1AKMA 3LUHA 1HTTA 3N6RA 4OQDA 4LF7B 3A4TA 2JW5A 1O6FA 4G3XA 3PYXA 2B8JA 3O8CA 1UBUS 4CPDA 5JYBA 4JYZA 2UUPA 3AKYA 3PGXA 4NKRA 1YFZA 4DCSA 3MIZA 2H2DA 1U3FA 3OP4A 3SJUA 3IMEA 2IODA 1Z4QA 4ECEA 4CWAA 2AEEA 3DZHA 3Q7PA 3TNYA 4AJ9A 5I8WA 3IR5A 1G64A 1MVNA 3Q3HA 3T95A 3WWPA 1E8MA 4D4KA 2OXCA 2Z4SA 3MUNA 1DUSA 1T5LA 2NZJA 2ZIGA 4BRZA 5BSVA 2ENWA 1WP9A 1IWPB 1GNRA 4F2HA 3HCOA 2AMLA 3GZTB 2YVUA 2MSKA 4JC5A 4Q47A 2WYIA 3NKFA 2Z2XA 1E2EA 2V65A 5FWXB 1U8XX 3ROMA 4D9CA 4DJ5X 5JASA 2P4QA 3T0FA 3WJ2A 5IZCC 1MC5A 2CXHA 4GMFA 3AXSA 4P4NA 5JISA 2NXJA 1QGZA 1IZZA 2FSHA 3AFOA 1OH6A 3FFAA 1NP6A 3A4MA 1JPUA 4GPZA 3RIHA 2C54A 1U7WA 1M2GA 3WA6A 4GEGA 4OREX 1R9MA 2QUBA 4YJ2B 1C8VB 2CDNA 1XLUA 5CB4B 1JEQA 3DB2A 4JP1A 4LZPA 3CTMA 1P5JA 4F45A 5CBPA 2H4XA 2D62A 3KVNA 3QWFA 5DXAA 1MKYA 4CE6A 1U2PA 2TMDA 2XE4A 3IUBA 4IV8A 4JYBA 1DQZA 4NBVA 1KZ6A 1C5KA 2E87A 3WOHA 1NU6A 3NOVA 3HYTA 1VL6A 2JEOA 4Q12A 3LVFO 4BMYA 1J0XO 3NBZC 3TJRA 1ZNZA 3NV7A 3DMNA 3VSBA 4TMFA 5EG5A 1NWCA 1KR5A 3S5JA 3WYBA 2XKJE 4RTLA 3EGXA 2E9SA 2L0XA 5KJ6A 4V24A 4YEDA 4H16A 5F9HA 2Y1GA 2LKDA 3FSRA 4L76A 2W8BB 1ISGA 3OCZA 5GM2A 1G21B 2AZMA 3A9WA 4CTNA 4FSHA 4KPYA 3OIFA 4S0XA 3VNRA 5M04A 3B9BA 1M6EX 3K0AB 1I7SB 1GNTA 2CLKB 2HIAA 4OXKA 4AO7A 2GRUA 4L73A 3CX6A 2XWPA 2BUAA 3O3MB 3I32A 1R4NB 3RWOA 1Y8ZA 2FX2A 1Y8AA 4KHZA 3AY0A 4PYRA 2BTEA 4KREA 4N0EA 3R7WA 4D5GA 4OJMX 3GUCA 2VJOA 3DVAB 3VH4A 4O2AF 4W9MC 1PYDA 2OCPA 2OLJA 3KTAA 2XUKA 1IWBB 2QT0A 3PIDA 2FY8A 2YC2C 3FNHA 4FFOA 1GTJ1 2IZOA 1YDFA 3GJ8A 3T41A 5JI3E 4Y9UA 4MOWA 1TZJA 2HWWA 1XLWA 1S1MA 1OR8A 3N58A 2WNSA 1OH5A 1XQYA 1V35A 1AN0A 1D1PA 1EBBA 1TM7E 1WW2A 1VLLA 3DPUA 3GUZA 4LXUA 1T8TA 4WLOA 3RGWS 4D4JA 5C37A 1UK8A 3S81A 4NDZA 5IK2A 4N0MA 3OX1A 4BC1A 1IDOA 1N4DA 2CL0X 4GGMX 4GX1A 2JIBA 2AOXA 1E7YA 5ALWA 2J67A 2X8AA 5JE8A 1MX9A 4X97A 1NQAO 3DE3X 3AR4A 3QEMB 1MRZA 4FT4A 4HCJA 3B20A 1NJ2A 2ZR9A 4B3HA 4Q4CA 3Q88A 1IQ0A 3WAGA 1W4RA 5ERGB 2X0NA 3U4CA 1AQIA 1CDOA 2OV2A 4DB4A 3NS7A 2X86A 4LGCA 1GRQA 1WABA 1Z22A 3HJHA 5FIUA 4A2CA 2CSXA 2F1HA 3U09A 2BEJA 2EFCB 2WYUA 3IV9A 4AXXA 4AN0A 3H8WA 5L3ZA 2R7LA 2EBHX 3N8IA 4I1VA 1LK0A 1AD2A 2Z4TA 3CWCA 4JZYA 4GL4A 4JBHA 4DRXA 1I2AA 1TA9A 5K8TA 4JWTA 5FKJA 1A5TA 4A8PA 5DHAA 3COYA 4NG5A 2Z5VA 2LUOA 1DQYA 4Y2PA 2YY7A 3EBPA 3WNCA 3EYWA 3LBYA 3UG7A 3KU1A 4HZGA 4IIUA 4LZZA 4CF6A 1C3JA 4ISBA 3ZCUA 4S1WA 2DWPA 3SU8A 5AVXA 2WT4A 3HEMA 2DT5A 3V8VA 2YICA 2QRVA 3IP9A 3TQFA 1AQNA 1L5HA 3K0CC 2JJQA 2XBUA 4RD2A 1SBTA 1UFKA 2CBGA 3P9RA 2Y1LA 4JI1B 3UJHA 4FLFA 4BKOA 4I14A 3R0VA 4Z4FA 1RWNA 3ZWPA 3G2IA 3A1UA 5CA1A 1A4IA 1H9BA 1N9GA 3SAJA 4ZU3A 2H0QA 1WUTA 4EYKA 3C2QA 1VL8A 3E22A 2OO5C 4KV9A 5JZSA 5SZHB 2DH5A 4ZQCB 3KWMA 2I8CA 3H5WA 4QXPA 4UZSA 3CH6A 3BRWD 1NJ5A 4L07A 1VPLA 3SF0A 5HRAA 2ASEA 1UP7A 2VZEA 5FAXA 5TIIA 3PNVA 1ECLA 1FLNA 1ZNQO 1KL7A 2VKQA 4N3BA 3RTBA 1TO6A 3PLNA 3PT5A 2D5AA 1W93A 2IIPA 3HRKA 3ZI0A 1TCBA 1MOSA 1VA5A 4GUAA 4L15A 4NEGA 5A3SA 4MWOA 4UCXA 1ZC4A 3SS7X 1SUDA 2K7ZA 2ZPUA 4YXWA 5FBVB 2XUJA 3A37A 1LUAA 1UQUA 3OPYI 3EDOA 1HRDA 1NW4A 1NW3A 2YVLA 4RMIA 4MLCA 1GG8A 2VDRB 2JLXA 1WZ2A 5A7GA 2V0NA 3A2LA 3I3SR 3Q7IA 4CL0A 2O2IA 1C1DA 4D8XA 4DMCA 4FD2A 3OX4A 1IZ8A 4A8JC 3DAHA 4S35A 1UINA 2NZWA 4JJ4A 1OLXA 3G1WA 5DB4A 3RQIA 1FPQA 5KNCA 3AF1A 1ZMXA 3A1DA 2GHTA 1J0DA 3BSYA 2JB9A 1HX7A 3MT8A 1EKXA 3AI3A 5IMBA 3O94A 1UZMA 2DP4E 1P7ZA 3JTMA 4RIHA 4TX1A 3TPCA 4YMSA 4BQNA 4QGSA 4YY3B 2QN6A 1KA9H 1F8GA 2NPIA 3D0KA 4J4TA 5TE9A 3DCYA 2FRDC 4KPGA 3RUIA 3C70A 4PRKA 4BV2A 1JTEA 2G1AA 3RD5A 1EVKA 2VSOA 3OX3A 3OZIA 5DW3A 1L4KA 1B42A 3D81A 1HG1A 1B3BA 4H7EA 1PLKA 4KIUA 3T4UA 1EB9A 2NXWA 4G85A 1Y1KE 4LMRA 1JQ3A 1N7JA 1NYTA 2VJLA 3QU4A 5SV2A 1M0EA 3ITKA 1Q15A 1R18A 4DLAA 2BM1A 1E4OA 3T9EA 2XIQA 4LJ8A 3KT0A 5CLIA 1WXEA 4LOHA 4BASA 3FNEA 1YV9A 5L7TA 1X2EA 3LQ4A 3MINA 3HC7A 4FUTA 3GLGE 3RADC 5AW1A 3CSSA 4S2EA 4OQEA 1HDEA 1AH2A 1ISMA 4U5QA 1HDIA 3CZQA 3VGPA 1TF5A 3K70C 2ACVA 1VCIA 3PJRA 3AM4A 1FX0A 1EFAA 2HRBA 1UJ5A 2ZUDA 2PD4A 3QKWA 2CN1A 1ZD9A 4JQZA 4KCGA 1M33A 2QYHA 4RD0A 1HYEA 2YFKA 5K0BA 5AUNB 3AFIA 2A0XA 3L79A 1KORA 3BERA 3F5MA 4IZHA 4OJKA 4Q4LA 3FTEA 5F7JA 3ED1A 1O9HA 2OQIA 4UJ5A 2B37A 1JLLA 2OZEA 2L82A 2EJBA 2YQZA 5JSFA 1QIIA 2H7VA 3B3FA 1SVMA 2WJAA 3L77A 3QWBA 2V3WA 2WMNB 2W6NA 3L3BA 1XZFA 2FPMA 3P2IA 4FT2A 4PO1A 3RIXA 4BNLA 1UC5B 3GGPA 4FFPA 1RJEA 3FUUA 3COVA 2DJ5A 3EQ6A 1MCZA 1FFWA 4FGKA 3ASYA 4ENWA 1DBWA 3WGHA 1T0IA 1CVRA 3QBTA 2OV1A 2EJWA 3S44A 3R0XA 3ZZUA 1SXPA 2VTKA 2AL7A 1U0BB 3QELB 2XPCA 2OENG 4RH3A 5DTRA 1WMSA 4CUZA 1E5QA 1HE2A 1I2MA 1NVVQ 2NQTA 3BBLA 3JALB 1PNRA 4BWGA 4BFLA 121PA 1CZHA 2GNAA 4QRIA 4QAQA 2A0WA 4DMGA 3AK4A 1RP1A 4HLCA 1ZQ1A 4JLDA 4D2IA 1ID8A 2Z08A 1TAHA 3E9YA 3GRRA 3ZNPA 3HNPA 5BMVB 1SJ9A 5A62A 2VRWA 3P20A 2WSLA 1TZKA 2NVBA 3HL4A 1FX1A 1YSCA 4LECA 2R8RA 5AUQA 2WSMA 4EKNB 5A0TA 1V1RA 1LA2A 1V3UA 2I65A 2EJTA 1PT8A 3GDWA 4KP7A 4LNUB 3B1JA 4RIFA 3VR4D 3LC2O 4P0PB 4BLQA 2BISA 3RJ9A 3VOSA 3WWZA 5LKAA 3GFTA 1AGNA 2B7BA 4Q3OA 4X20A 2QM7A 1O08A 1O95C 1VZ3A 2PMBA 4GYYA 3BRSA 4P08A 1SOVA 3IOMA 4FS8A 1N7GA 2QM8A 5JWRA 2AKEA 4UAUA 2FPOA 3DKKA 4JCCA 3FWYA 1S02A 1E66A 2ZXFA 2BHNA 3DBRB 1YQUA 2HR1A 2XXBA 4IOJA 3AT1A 3R3XA 2RAVA 3QVUA 1O9BA 5DBHX 2O8NA 4K9LA 1A69A 5B64A 1UPBA 3QQPA 2GILA 3FLMA 3GG9A 3DKRA 1JR3E 2NUPA 1QZXA 2WJ3A 3CH4B 3TLEA 2BGMA 4BJ1A 4BS9A 2JJ2A 3QUTA 3ML1A 2D2IA 4GR9A 1UBJS 1RHQA 1N5RA 1UJMA 4UE6A 1B2LA 1ZN8A 2WM8A 1DEHA 3RKRA 5L4NA 2GBCA 1GLVA 4AIRA 2HO5A 1C30A 2QT9A 2EQBA 1YQTA 3O83A 4OFBA 4WFKA 5DBEX 3ZX4A 2YJGA 4B87A 4R2WA 1RHUA 1TD9A 1J09A 3L0CA 4JASB 4R69A 3JD1A 2F3PA 2GBLC 2GJSA 1VLZA 3OOJA 5T6MA 1B0PA 3FHJA 4YP5A 4BMNA 4DLSA 4N76A 3P97A 3PXBA 4YT2A 4DSNA 3WYCA 3DEYX 5F52A 3EA0A 2NU9B 5A4AA 2RHDA 3B9RA 3HU1A 4FTWA 4QE3A 3VKUA 3ZV6A 5IAAA 1KZGB 2NV2B 5DI3A 1CQIA 3K6SA 3NBKA 5B3LA 1A9XA 3IRUA 1CHDA 1U7XA 1CR6A 1QCZA 2XOKA 3BK1A 1HE1C 2XB8A 3BWCA 5TRTA 3RT1A 3TCKA 4C4OA 3I2HA 5FDFA 3L01A 4HNAB 4J1QA 1GDTA 5AJTA 2ODWA 1XEXB 2VDKB 2PKRA 3CNOA 1XF9A 2GXUA 1IQPA 4I46A 3ZDFA 5CVUA 4WBSA 4HN2A 2I55A 4PG6A 1L5KA 1KC1A 4MAFA 4PF1A 2XAUA 2I4RA 2ZIZA 3O8OA 4JT9A 5FLEX 4S0ZA 3AHIA 4LXIA 5K4HA 3EIXA 2I91A 1G60A 1G5HA 2XCOA 2BHLA 3BWYA 2ZIEA 3FBTA 3I8SA 3QXHA 1OF1A 1AZSC 2HJSA 3E4DA 4XX0A 2VUHB 2C96A 2G72A 2IXFA 4XPZA 3NJRA 3N7AA 3SJBA 4BU0A 2QQ5A 1J70A 1DDGA 4TT3D 1U5CA 4WKCA 4WNIA 4IMRA 2RGRA 2QRQA 5LU8A 1ARZA 5C8ZA 5JHHB 1IXYA 4CFZA 1G7SA 3WAKA 5CXSA 1ZJ4A 2ZYRA 1E4EA 2EHDA 3QWIA 1GUFA 1M1ZA 4OAQA 3WRWA 4D3XA 5KKCA 5KQRA 2WQ7A 3DTVB 1F4PA 4RGQA 1RAGA 3K6JA 4BNJA 3F47A 3ZGNA 4DBLC 4KYUA 3IHLA 2ZGVA 4WLNA 4C6SA 2QMYA 3I42A 2GPBA 1J8YF 3VYTB 3GZNB 2CYCA 1OYVA 3CSUA 2F8TA 5EHGA 5L4SA 1VDMA 4QDTA 2C7GA 2H6EA 2O8BB 1OXBB 3O8DA 1CU1A 4XX1A 3V4PB 1JFFA 4TYMA 1EX9A 1KVTA 1Y80A 3E9NA 5AKIA 1UT5A 2R68A 4K9SA 4X3CA 4A91A 1O4WA 2XTAA 5LA6A 4LYYA 3VYRB 5LNK6 2PANA 4MIYA 1SVUA 2CBZA 2EFEB 2FSVC 4LDZA 3U2QA 4CTKA 1MHPA 1DCMA 5LMNB 1IE3A 2DX7A 3ZCRA 4MS4B 3OT1B 2WIFA 3ZOKA 5HIMA 1KMHB 2GEBA 3GWZA 4KACA 4LRWA 4OXQA 1RXYA 1XHEA 3L6EA 4JP2A 5CT6A 3G13A 1FY2A 3N8DA 4AB1A 3RPEA 3ZV4A 4UUQA 3CZAA 3Q7QA 4J29A 4EKEA 1U0TA 2B69A 3O8BA 4UUAA 4K9NA 5G02A 1JDBC 3ZD9A 1WMEA 1CIVA 4RADA 5KOYA 2UVDA 3PC3A 1CUEA 1FJ2A 4XIJA 1H85A 2ZTVA 3MAGA 3UIEA 3FETA 4E32A 1NR1A 1J6UA 5JPDA 1G2OA 1TLTA 2V7EA 1EUCA 2F9FA 1APBA 1IY8A 1ENOA 2DF8A 3IV7A 4MNTA 1G291 2ATEA 3WLFA 1KVUA 3MLBA 2YOHA 4N0QA 4ZVNA 1MO6A 3RRZA 4RLHA 1EFPB 4TV9B 5EE1A 2P8SA 1ADFA 3WYGA 1LWOA 4MW5A 1URPA 2VAXA 3L6CA 1JKJB 3I9FA 3O1LA 5BPHA 1ZRHA 4L8FA 2YDXA 4BNFA 2BVNA 3AOEC 1N2JA 2I99A 4ND5A 4OSPA 3TLCA 4PPFA 5BSKA 1NTRA 5LPNA 1OV6A 3AJEA 2OP0A 2GB4A 4RENA 3TIXB 1WOMA 4BWFB 3WP0A 3AVXA 3OWOA 3QX3A 2QVGA 3F98A 4MHOA 2ZSEA 4YP1A 4P3YA 1F8YA 3R76A 2QBYB 2NADA 3L49A 3ZQUA 4PGFA 2OKGA 3AJ9A 2RGYA 2VDLB 4Y9DA 2V9ZA 2BW0A 4AW9A 3QP9A 4JVLA 2HWKA 3PXXA 4IRUB 3K2QA 3JRWA 2GAFA 3QUCA 1N6IA 2WVGA 5ALLA 4Q66C 2D0IA 2EFYA 4CLRB 1INLA 3P45A 4F1WA 4GD3Q 3CQ9A 4WH0A 3GEGA 2H31A 4IOLA 4W5TA 3EZ6A 4IHAA 621PA 1Y3BE 3ZXIA 4Z4QA 3VU3A 3BD7A 3HHEA 1XP5A 4LX0A 5HPYB 5DM2A 5L3SB 2WAMA 5FXMA 5AO9A 2IT1A 1V47A 1TT5A 2FTKE 1NN1A 1UDCA 2BE9A 5IYZB 3I4FA 4IDGA 4S1PA 4CNBA 3H16A 3IBYA 2PGDA 1K98A 2AK2A 4HH4A 1YZGA 4X6XA 3K9GA 4EFMA 4W5JA 2GCOB 5JPIA 4ADSG 4P38A 3MQ4A 4UCWA 2P3QA 3EXAA 4HATA 3OQNA 1HFWA 3ORQA 1J0CA 3QV2A 4X1KA 3A7DA 2XCUA 3E58A 1XYVA 1GUAA 1P2TA 3V4RA 3FNRA 2WIBA 3HDVA 1PEYA 5KNCH 2QRUA 3DV9A 3WYFA 4BKPA 4O63O 4WASA 1V25A 3K5WA 2FPKA 3HSSA 4Z0HO 4CV0A 3ZWWA 4F04A 2JFOA 4NOJA 2R65A 2X8JA 2AB0A 1JHDA 2VDOB 4KE9A 3AEKA 1V8BA 1ESNA 3H05A 4XR4A 4AO8A 1W29A 4E14A 4JA2A 1UBMS 1HT1E 2IV3A 2WILA 3ZDZB 2BFCA 3MD9A 1IWOA 3L6UA 3SZRA 7GPBA 1E6KA 2O2CA 3H2IA 1XU9A 4J9UE 4NRDA 1DQPA 1MOPA 4YLEA 3T9DA 4AG6A 5KC9A 3DZDA 3DLHA 3PFHA 4RJJA 1CVIA 2C8JA 4PX2A 4U6QA 1QH8B 2HXYA 2JANA 1RZ3A 3K0BA 5F7ZA 4XRGA 3KKEA 4M6WA 2R1VA 2V8BA 4JC4A 1BDHA 4I3HA 1P2GA 3O03A 4E5DA 1ATZA 3DV0A 5ESDA 4BKUA 2AZTA 1TOAA 3JQQA 3INRA 3OZBA 3VU9B 2A58A 2Y0CA 2ZYAA 2WD7A 4M8NE 4JBGA 2HBRA 2C4KA 3WGUA 3ZXYA 1N32B 3Q9UA 1BD4A 3GFVA 3PNPA 3KSZO 2P77A 4B85A 5KVVA 2A1TR 1KSFX 1SK8A 4ASUA 4CKCB 3IKTA 4X84A 1RDFA 3TFWA 1JLKA 1MG5A 1H1LA 4JBYA 3TXAA 4YFYA 4U0JA 1NUQA 1RYEA 4O02B 1ZLXA 4ZIRB 4CIAA 3QVGB 1OWPA 2QAGB 3IQIX 3SX0A 2Q3BA 4ZC8A 1L6IA 1N33B 5JH7B 4XE5A 2GK4A 4CKXA 4MUIA 3UJPA 4KX5A 1DOZA 3OP1A 4Q48A 2W2PA 2C9CA 2ISCA 3FPFA 3JQ8A 2M6RA 3AIOA 5A4DA 4AZWA 5C4MA 3FXAA 3KT3A 2CUTA 3PWZA 1RZRA 2AV6A 4EA8A 4I6EA 2I03A 5FI0B 5K6TA 1NURA 4MROA 3OQIB 3UBTA 4FGSA 4PINA 1Q0QA 4XVRA 4A1OA 3I6QA 1J56A 1AB6A 2R7MA 4EY3A 5ALOA 3ZWKA 2A4MA 2IP4A 2J3LA 1RRKA 1DFHA 5EIBC 1C9DB 4DIOA 1I1NA 4Y7DA 2JFBA 3FROA 5M2QA 1LD3A 5C52B 3CN9A 1UP6A 1I36A 3A1SA 3HNRA 1WEHA 2NX2A 1Z6PA 4HDKB 1XTBA 5IBQA 1NNSA 2SECE 1KQ3A 2MWMA 1PFGA 1J25A 1I1OA 2IU4A 2R25B 3BWBA 4JY7A 4WL0A 3SLRA 3R9XA