5L3QB

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
SLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Signal recognition particle 54 kDa protein
total genus 110
structure length 307
sequence length 307
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
B PF04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qB02
2O8BA 2FGJA 1DAHA 2VP4A 1OYWA 2HV8A 4HYYA 2GBLC 1N5JA 1Z0DA 3AF4A 3ETLA 1PUJA 3PUYA 2C03A 4EJSC 5KUTA 1YHNA 1KHTA 4MKFA 1DTSA 1QRAA 4P4SA 3UXMA 4US2R 5DI3A 1YZKA 1M8PA 1T4GA 1SZPA 3LV8A 2W6JD 1OSNA 2JLUA 2IYZA 1IN7A 1Q3TA 3FHOA 1V5WA 4YDSA 1XEXB 5AUNB 3AVYA 4PSKA 5JWRA 2O0HA 5KPDA 3ZH9B 3CRMA 1E9EA 3QJYA 5A4JA 4JL6A 3CRW1 4Q4AB 5BN4A 2CVHA 2GEDA 3K53A 2VPPA 2JASA 5DE3A 1TNDA 2J59A 1XMIA 1Z8FA 2OCBA 2RAPA 3AUYA 1QG2A 4POAA 4CF7A 2VHJA 3OEHA 3SEAA 3K9HA 3TVTA 2XNDD 3BD9A 4TMTA 4EJSA 1ZC4A 1ZM9A 2AKYA 3H1TA 4JLNA 1CJKC 4FI3C 1G5PA 2OAQ1 1E99A 3QI2A 2IWRA 1LF5A 2C8VA 2GHIA 3BXZA 5GJWC 4URVR 3T5DA 3SS8A 4Q03A 3PCRB 2JLWA 1KI6A 5J5CA 4ZIRA 2QGZA 1GSIA 4QM7A 5L3RA 1MO5A 5KPJA 4NCIA 4OI0A 4M1OA 4DB4A 1E3MA 2JJ2A 2ZS7A 3ADCA 4D80A 4Z54A 4AKHA 5AJZA 3VTKA 2IYQA 5EE0A 4MH0R 1NMXA 1ZJ6A 1E2FA 5C4MA 2NMVA 3G5UA 2RGNC 3T61A 1G64A 1W36C 2VSFA 3PVSA 3FE2A 5AR1A 5UKDA 1J2JA 3KDSE 4GSYA 4L9WA 2QZ4A 2RHMA 4RCYA 2V1UA 1LNZA 4OI2A 1G3QA 3E5HA 4GMXA 2ZTSA 4LV5B 3LH5A 4B34A 3KFVA 1HY3A 1TQ4A 4Q01A 1M7GA 3PFIA 1J70A 3AVQA 5SZJA 2ZSEA 3MCAA 4HLCA 1IXSB 5JEEA 3MWLA 3R7WB 3VMFA 4TZ6A 3CPHA 221PA 1KSFX 2P6UA 3VR2A 3ZD6A 1G7TA 4W5WA 3WRXC 1QVAA 2N42A 3CONA 3ZQ6A 2ZE6A 1E79D 2IA5A 1NMZA 3F5FA 4EQ6B 3I5YA 4I81A 1DBSA 3A1TA 5ANRB 2IXEA 2WIAA 2GJ9A 5KNDA 621PA 2FN4A 4RCZA 4WZ6A 2ZJAA 3RABA 2HXSA 1K5DA 3MGCA 1U94A 4DLYA 1N6NA 4LI0A 2FV8A 5K8UA 3BE4A 5SZHB 4DDWA 2GEUA 4G5GA 4UJ3A 3PENA 3WBKA 1T6NA 1BMFA 2NTYC 3QPUA 4QJ4A 5TB5A 5KHOC 1MT0A 3DZ8A 2HT1A 1E2IA 2AFIE 1Q12A 2PEZA 3GEHA 5EZ6B 5JEDA 1E98A 3QQ5A 2Z6VA 3H4MA 4BFYA 2OESA 3QKSB 1XPUA 2QP3A 4IFEA 4TSFA 3BBPA 2ZE5A 4RVCA 5DLQC 5C46F 2QA5A 1JALA 3TUZC 4W9MC 4QM6A 4B2LA 5DN6D 1RIFA 3NDPA 4O0MA 2QMUA 2WJVA 4TL7A 5C4GB 4R71A 1EGAA 1CRPA 1XJCA 4LCBA 5G53C 3GLGE 1OH6A 3LLUA 2WMOB 2NO7A 2IEZA 3JVVA 3W8NA 1XCPA 2R44A 2GCNA 4DLTA 4URZR 1G18A 1LS1A 4B75A 4ZI2A 4UXHA 2V3CC 2P67A 2H92A 5EXSA 3VU9A 4TT3D 4TQ9A 4BLRA 1HT2E 2OLKA 3T06B 1X8KA 5FUYA 1GVNB 4HB4A 3KTAB 4KCGA 4XWOA 1AZSC 3SC3A 3D6TB 4DSTA 5HCNA 3KKPA 4OKSA 4GNKA 2IWHA 3KFXA 1EXMA 2A5GA 4IVQA 4KFTA 2G77B 3U4QB 3K8YA 3NBFA 2QMEA 3GJ5A 1E1RA 2XSZD 2CEAA 2J0QA 2GZHA 3DVLA 4FMDF 4KI0A 4LC0A 4NYMR 4DEYA 5EXPA 1J90A 3SFZA 5EE5B 3OIYA 2QM8A 4BFTA 1R5OA 4LPKA 3A6PC 3CX8A 4XSHA 3UG6A 2IYWA 1CRQA 3VR4A 4Q1FA 1KZGB 3KKQA 5J40A 1KSJA 4AYWA 3AVVA 1KTVA 4WZBE 3JZAA 3IO3A 5K8IA 4OK6A 1D9XA 1Q20A 3H2YA 3SNHA 3TRFA 2DCUA 4MYUA 4KVAA 1U9IA 2ZRJA 2QPTA 2BKEA 2E87A 5E7IA 1YZLA 1ZVQA 4B3DA 3CR7A 2W6ID 4LHVA 4JLAA 4ON9A 4PC2A 1QHNA 4BRWA 3P27A 1XCGB 3TUJC 3FHTA 4KSCA 3K0AA 3HR8A 3PG5A 5IHPA 1YR9A 5J4LA 4JLVA 1Z0AA 2GJKA 2NG1A 4RZXA 4DSOA 1E79A 2BKUA 3W6OA 1H8HA 2VP0A 4M1SA 5JJIA 1JR3E 1E0KA 3BK7A 1BS1A 5JZVA 1FZQA 1LB1B 4B32A 1DS6A 2OSBA 3B1YA 2FPLA 4Q1BA 2X1VA 1I2MA 1DAMA 1XTKA 3CB4A 4D82A 4M1YA 2FFQA 1G6OA 1KJZA 2BM1A 1IY0A 2YZ2A 2P6RA 2FH5B 4RSGA 1NG1A 1KJWA 3DOEA 1GL7A 2OE2A 1KDPA 2ZRGA 1DAIA 1N6HA 1CJMA 4Q1EA 1OYYA 4IVRA 5BWMA 4Q7MB 2IT1A 5TDHA 3CPEA 5IT5A 4NTZA 4HDQB 2BMDA 1GKUB 2RKOA 3TAHA 1ZW6A 2DFNA 5FL7D 4ITRC 4JKYA 3I5XA 2WM9B 2AD1A 1ZC3A 2J0UA 1KGDA 2WWGA 1FX0B 1QHHB 2ZJ5A 2PCJA 2YWFA 5SZKB 2QTHA 3KKMA 1OB2A 5FBQB 1BO6A 2CHQA 1P72A 1UBEA 1G3IA 1GNRA 1OFIA 1KI9A 4A6PA 1E32A 3MJRA 1UKZA 2AWNA 2VLIA 5DO9A 2W2TA 4Q9LA 3MD0A 2ZAMA 2C96A 3CUEF 2WJGA 4S2EA 5HKKA 1G9XA 2FOLA 4PHGA 1QZXA 1YR8A 2DR3A 2JLXA 1P6XA 3K0CA 1E94E 1E9DA 2BMJA 3AVPA 1OPXA 1AK2A 1TX4B 1KK1A 1KMHA 4IFBA 3FMIA 4TYPA 1MO4A 1IN6A 1C4OA 2ZJOA 4DLVA 3L2OB 4EPVA 2WTUA 1C1YA 2JLRA 2QE7D 2OEPA 4M0LA 2FU5C 1US8A 5CJPA 2J41A 4HZIA 4LYFA 1E4YA 4BECA 3RS7A 4V0ME 1UKYA 1W4BA 1OXSC 4E03A 5JFGA 3PEUA 3GFOA 2I1VB 3X1DA 1ZCBA 3CBQA 3A37A 4NHOA 1E2QA 3B60A 3E1SA 2ZANA 1IY1A 2IL1A 4BLSA 2F1RA 4TMZA 3K0SA 4HDCA 2X2EA 3FWYA 1DVRA 1ZUNB 3HYTA 5J4YA 3F0TA 1OF1A 4MUBA 3X1XA 3MAAC 4H1UA 4OJQA 3V4RA 2ZRPA 4JLKA 1W36B 4M1MA 2RHDA 4V0MA 3IUYA 1W4AA 3TR0A 5FL3A 3ND8A 3TLXA 5CM8B 1G5TA 1N0UA 1OJLA 1FUKA 2WSMA 1KIMA 2PLRA 2ERYA 5FTJA 3SYLA 1CLUA 1P2VA 4HAXA 2XTMA 1IOZA 4F91B 5L3SA 4GOKA 1VKJA 3QE0A 1SVKA 1VMAA 3LQQA 4M8NE 4XH9B 2YINC 1S9DA 4LSGA 5FOVA 2BMFA 2QENA 3HU3A 3REFA 4O3MA 5JCZA 2YYZA 2V7QA 4XSGA 3SR0A 3L8YA 3QKSA 1II8A 4LJ6A 2OO7A 3DKVA 1E2LA 1WCV1 5DGXA 3SJCA 3O8CA 3UMFA 5FBLB 2PX0A 4JKIA 3NKVA 4DKXA 1E9AA 2DYKA 1OFTA 2DBYA 4EFLA 5G3ZA 3I92A 4WXPA 4KAXA 1UKEA 5EZ5A 4DLZA 3U7EB 1FMLA 1XP8A 1L7VC 3VR6A 4D0GA 4I1VA 2CHGA 1NVXQ 2YV5A 3QY0A 3EAQA 1HEIA 1XFAA 3EC1A 4DVGA 2WWYA 2CL6X 3ZZUA 2EWVA 2HDNB 2BMEA 5JHGB 4CEJB 4GOJA 4QFMA 1Z6GA 2W58A 4ZDIA 1PV4A 1Z0KA 1Z3IX 3W34A 4K81B 4EPTA 2QY9A 2Q21A 2NOAA 1CR1A 1B0UA 2DB3A 2ONJA 1F60A 2G3YA 1XJ0A 1KO8A 3ASZA 3CLVA 2GXQA 2ZJ8A 3VNUA 2LCFA 4BWYA 5F9HA 2ZU0C 2QAGA 1AGRA 2GESA 2F6RA 2O8CB 1P60A 1Q1ZA 3LY5A 2IHBA 1DO2A 1IBRA 2ZRNA 2H5EA 3R20A 1OXUA 1OXXK 4FN5A 4V02A 4OQXA 4R9UC 1KMHB 4PXAA 1NJGA 4EUNA 1EFCA 2FMXA 2BCGY 3OFNA 4OYHA 4JJZA 2JIZD 4P4UA 4QJ3A 2IX3A 3WY9A 2O8EB 1QHSA 4M1WA 5AUOB 1TF7A 4ZKDA 2FGKA 1OB5A 4A1FA 1XMSA 4TQAA 1R8QA 1VYUA 2XTNA 2E9SA 4DDUA 4LJ7A 2ZETA 4NYIQ 4LV6A 3VQTA 2Q3HA 4CEIA 1E2NA 5DI3B 1IAQA 1XB2A 4GPTA 4QC2A 4XWKA 2VH5R 1K5GA 2F43A 4TSFD 3UWKA 1QG4A 4D26A 5DN6A 4MGZR 4LHXA 3S1AB 4L4UA 2QRZA 4Z1MD 4FMBB 5EE9A 3W90A 4DSNA 4JVLA 2YWEA 5JRJA 4LYJA 3CF0A 2FFAA 2O0JA 4HUQB 4QRHA 3LWNA 3QF7A 2G1KA 2VF7A 4TL8A 1F48A 3TW8B 2FDCA 5KTYA 1MOZA 2QORA 2F43B 3CPJB 1SKYE 4JBWA 2O8CA 3JZMA 1X86B 2ZSFA 4F93B 3AQ4A 1P4SA 1P9WA 2ZRIA 4XIGS 1II8B 4LHYA 2GZDA 4Q7KA 2IYUA 3HR7A 4F4CA 3NTUA 2GDJA 2WJJA 4UXJA 4Q4JA 1YR7A 5FOXA 4PHFA 1PLKA 2EFCB 3K1JA 1WB9A 4B6EA 5L3SB 2O8EA 4Q19A 3SN6A 4YC7A 2QP9X 3UKDA 3W5JA 2XSZA 4IDNA 4QBGB 1Z28A 3DHWC 1NN5A 1NY5A 3TJZA 4B2PA 1DG3A 1XRJA 2ZJZA 1KO4A 2GTPA 4RD6A 4DDVA 1B23P 3OE7D 3DZDA 2BV3A 3QG5A 4HLUA 2ZSBA 1TUEA 2J7PA 1W1WA 3AUXA 4GBMA 4J0QA 1QDEA 4Q02A 3VKWA 4BLTA 2GEVA 4DEXA 2GAOA 3VNVA 2ZVQX 2O8DA 3OHMA 1CP2A 2W83A 1G3UA 3MWKA 2WWFA 1DAKA 4YMTA 2C99A 1JB1A 4NMMA 2QT1A 5FBWB 1PLJA 5BN5A 2ORWA 1XD2A 5AJWA 1CBUA 2ZRDA 2ANCA 4NPHA 4N1AA 2AHOA 3MG9A 3KQNA 3C14C 1F3OA 3SHFA 2O8FB 5TVKA 2O0KA 1XXHA 2GK6A 4FMCF 5KSOA 4URUR 4TN1A 2W6IA 2HJGA 4NDZA 1YJ5A 4DJTA 1LS6A 1XPOA 3RS4A 4JLJA 3A4MA 5FBRB 3UG7A 3LX8A 2ZS8A 4DB2A 2VO1A 3I3SR 4WAUA 3AF2A 4GT1A 3THXA 4Q66C 3MMPA 1G8GA 2UVQA 3SJZA 3TK1A 1T9HA 1H8HD 1NJFA 4M9ZA 2D2EA 4X8OA 1TTTA 4Q4LA 3VFDA 1XXHB 1DO0A 3AKCA 1M2OB 1PZNA 2AKAB 1T8UA 3QBVA 4JIMA 4PR0A 5TXGA 3RHFA 4DC9A 5AK0A 1W5TA 4MDFA 3L8ZA 4MITA 1NNEA 4PO9A 2ZJYA 3GLGB 3U3OA 1ZU5A 3O8RA 3A8TA 2Z0MA 1WRBA 2FWRA 3TQCA 1A4RA 2JIZA 4LBYA 4TLBA 4TQUS 3UWOA 2OZEA 2VL7A 3EPLA 4B33A 1A2KC 3B1WA 4R2HA 4PAQA 1NIJA 4A2WA 3DMNA 4S35A 1FTSA 4LYAA 1GWNA 1L4YA 2OXRA 1KO1A 5TY0A 4NU0A 3IPYA 4B3CA 3VR3A 4DT1A 3KL4A 1RJ9A 1II9A 2IF2A 1G1MA 2A5DA 3BOSA 4HZUA 4CIDA 1RRCA 1PUIA 1IONA 5LDDC 1G8PA 2J7KA 3KXLA 4B6FA 1FL9A 1GRRA 2ZSDA 4RFVA 4A4DA 4BLQA 4YQFA 3Q9LA 3EZ9A 3W3AA 2WIBA 4Z1MA 3QKRA 3IPXA 4IEEA 1G7RA 2CL7X 3KXKA 4V0KA 4KFRA 1Z2CA 4BLPA 1F2TB 2F1JA 4QHSA 4IOLA 3BJIC 1L8QA 3WHKA 2OBMA 4JSYA 1X1SA 4GDFA 3AVWA 4M53A 2N1BA 1XJQA 1GAJA 2HUPA 4M9QA 5ELXA 1R5BA 1I4TD 4HB3A 1KI1A 4ACAA 4EPRA 4WA7A 2I4IA 3WYAA 2MMCA 5D3MA 2FSGA 3HWSA 1EFUA 5JMTA 4CZ2A 3O8BA 3TIFA 3WXMA 1ZU4A 2ZSAA 1ETUA 4GZLA 4B43A 5KDLA 3PIRA 5FH9A 1VYVA 4C7OB 5JCPA 3K9NA 1X8LA 4QHTA 1Y63A 4AD8A 1E2KA 1E2JA 3AGQA 4A8JC 4E5UA 4ZI3A 3IKJA 2IUUA 3W8RA 1JR3A 4N3NA 2NO0A 3QKTA 3QXHA 2AD5A 1R0WA 2WICA 2D7DA 4GI7A 4GRAA 2QE7A 3OE7A 4HUTA 2J7PD 3R9IA 4KFSA 3GD7A 2GK7A 3NG1A 4WOPA 5DI9A 4A6XA 2YVUA 4Q9JA 1W36D 1M7HA 1AKYA 1IN5A 1W44A 3QUSA 4OQLA 4EIWA 3MLEA 5E4FA 4ACBA 4DLUA 1CTQA 5IK2A 4C4PA 2XITA 1TF2A 3AVUA 1XZQA 2QNRA 1NN0A 3GJ7A 2JA1A 1OE0A 1Q22A 3PITA 3BH7A 2EYUA 2PT7A 4HEJA 1JQJC 5CYPA 421PA 2PZGA 4A0HA 5HE8A 3BB4A 4QGHA 1R6BX 3ZQJA 4CT5A 2P5SA 5GVSA 3AEZA 4CEHA 2GJ8A 4D4KA 1YZQA 4A0FA 3V9PA 2QT0A 1OXTA 1XMVA 3IQXA 1KOFA 1M6NA 4NKRA 1Z6TA 4TL6A 3MWYW 2IXFA 2ZI6A 2ZJBA 3ADDA 1Y3AA 2QBYA 1JPNA 2ZU6A 3TSZA 2V7QD 2RH5A 4AI6A 2XOKA 5L3QB 5JS8A 4LJ4A 2ZQ5A 1VHLA 2JLZA 1COWA 5K8TA 3FKQA 4RY2A 3LQRA 3HU1A 1NBMD 3T1TA 2FSHA 3DPUA 1U2RA 2NZ8A 2P5TB 3OEEA 4ZO4A 3VU9B 2SHKA 1G7SA 4ABYA 1XXHE 4KFUA 3WYFA 2QAGB 4FW9A 3K0EA 4PSVA 5KDOA 3D31A 4DLWA 1UADA 3NC0C 2YOHA 4Q7LA 2KJQA 2OFOA 3GLFA 1LTQA 4Q21A 1G8FA 3UPUA 4IEIA 3R8FA 3LVRE 4L15A 2J0VA 1ZUHA 2H18A 2R2AA 2AN9A 1XF9A 5BYKA 3V4FA 2MMGA 4JYBA 1II0A 3LA6A 2GCOB 4OI1A 1CR2A 2FNAA 1Z5ZA 3BS4A 5IDVA 4LHWA 3KJHA 3SYKA 1S0UA 5FPHA 4UNQA 4O25A 5FBVB 4MRNA 1UJ2A 4MKGA 2QTVB 2QRNA 1R0XA 4AC9A 3NXSA 4HDOB 1G21E 3MRSA 1IM2A 1ZNZA 4ARZB 3OIUA 1NMYA 4UNRA 1GKYA 2JATA 2WWWA 1EX7A 1Q1EA 2AXNA 3OFND 3NC1C 4LBWA 4XJXA 4NYJQ 5JBQA 4UKDA 1ANKA 2HF8A 1AQYA 1XEFA 4XOIA 2TMKA 5LBIA 4D0LB 1F2UA 2WOJA 3QBTA 5FPSA 3N2EA 4MKHA 4C0BA 1JR3D 1VIYA 5K8LA 2WAXA 1KNXA 1X6VA 2V9PA 2ZRBA 3GFTA 4OL0A 4OQFA 4PQFA 4JYCA 5B58C 2Q3FA 2XB2A 5FI1B 5FI0B 2CLSA 3CNLA 1E9FA 1NKSA 1R0ZA 1T5IA 2PEYA 1NP6A 4PC3A 1OKKA 1HYQA 4TWZA 1XTIA 4V0NA 5DIFA 2BEKA 3SDZA 2GZAA 2B6HA 3LO5A 4HLQB 1N6LA 4FIDA 121PA 1NN3A 3EX7C 1G3MA 2CBZA 2XZPA 2LWIA 3MSXA 2Q0HA 1QVRA 2QL6A 5IK2D 1R7RA 3Q5DA 2AK3A 2FX3A 4QKQA 1EWQA 4JLOA 1I2DA 4LDJA 5A0FA 2WWXA 5G3YA 4EPYA 3P20A 2PLFA 5B64A 1AS2A 1Z0IA 4IXNA 1P3JA 3FHCB 2V4ZA 4TYYA 1GOTA 1XU4A 2WKRA 1W47A 3NVAA 5F2EA 2YHSA 2QROA 1KI3A 4IVPA 2V6JA 1E2DA 4R7ZA 2OFXA 1RYFA 3WNCA 2VSOA 2OG2A 5FPYA 4MYCA 1P9NA 4JZKA 2HLDA 4URYR 3EIHA 4TLEA 1T0HB 1AA9A 3GLFB 3MUFA 4OQNA 2ZE8A 4IDQA 2C9CA 2XGJA 3SQWA 1RVDA 2XOKD 4IKEA 2W0SA 3B85A 3QVVA 4KU4A 1FFHA 2OBNA 1COWD 2IK8A 4BASA 1WA5A 1YKSA 1CIPA 4P31A 4Z51A 1SXJB 1UBFA 1G8YA 2J45A 3B6EA 1JECA 3OEED 4MYHA 2H17A 4PC6A 4Q1CA 5DHAA 1NLFA 3IBGA 1UKVY 2ORVA 3B82A 4RZ2A 3A1UA 1RFLA 3KJIA 2PL3A 3K09A 2GJAA 4Q5IA 1VPLA 2KBEA 3DKPA 3F3YA 4CVNA 4V0OA 3EXAA 1S1MA 3QPWA 4D6PA 2C2HA 1KI8A 3VR1A 4DRZA 3IILA 2DHRA 3KTAA 2CCKA 2XJ4A 5SZIA 2B8TA 5GJBA 2ZRCA 2EW1A 1FUUA 1QHGA 1XD8A 3LFUA 3AF0A 4XD7D 3SOPA 1OIXA 4OHXA 1VIAA 3U2QA 1MABB 4BFUA 3AF3A 3JVUA 1TUIA 3QPVA 1KI2A 3FTQA 4HAZA 4AG5A 2DFKB 4ESVA 2C78A 1WQ1R 2QGNA 4LX0A 4U5XA 3K09C 2A78A 4DCTA 1G4AE 2XX3A 2HYIC 3OIVA 1VG0B 3GLIE 2Z43A 4YDHB 3BRWD 5JWOA 4WVFA 4B48A 1ZAKA 5BQ5A 3IEUA 2GF9A 1YZNA 1E2GA 4C9BA 3C41J 3BFVA 3TSOA 5L3QA 1W49A 4CGZA 2CNWD 3BB3A 3C4JA 4RD0A 1EX6A 3ADKA 2GNOA 5EQTA 3PEVA 3ZDQA 2R62A 4BEBA 1JXOA 4Q9IA 3TR5A 5DNYB 4X8LA 4OQMA 4TMXA 4UJ5A 1T3LA 2QU8A 1J8MF 3TBKA 1XWIA 5HE9A 3NEJA 3RRYA 1NG9A 1S9HA 1ZIPA 2WKPA 2FJUA 3U3KA 1ONBA 4EQ6A 2G0TA 2A5FA 1IQPA 1TQ2A 4CEHB 2CVFA 5E7JA 3RWMB 5B57C 1Z47A 3GJ0A 4EPWA 2AX4A 1OFHA 4PQRA 3BERA 2O8BB 2BBTA 1W7AA 4E22A 5EP1A 3GLHE 4D4LA 1WBDA 5CDFE 1KK2A 3WMGA 1SVMA 2BVNA 3PUXA 1ZP6A 1FX0A 1CJTC 1QHHA 1E96A 2ZR7A 2BHRA 1P75A 3FMFA 2PT5A 2ZYVX 2NO1A 2V8OA 2VP2A 4LBZA 3IDQA 3A58B 5GADl 4C0LA 4F7WA 2B21A 2XNSA 1J7KA 2DY1A 3IHWA 2MSCB 2MSEB 1NF3A 2ZI5A 4HLDA 3HPQA 2ASEA 3EWAA 2ZRMA 3BIFA 1YQTA 4KO8A 1KO7A 2ZVPX 4ASUD 3Q85A 4MGKR 3QENA 3WNDA 3CWQA 1FQJA 3EG5A 3QKRB 5F9FA 4QXAA 2WV9A 4PFSA 4FCVA 4Q18A 4LZZA 1FP7A 5C18A 1E0SA 4DSUA 1DARA 3SZRA 1NVWQ 3CKLA 1JEDA 1GRQA 3OIWA 4KBFA 1Z2AA 2RCNA 4B47A 2V6IA 4AYXA 1GRNA 1KMQA 3ZGXA 3AM1A 4AKIA 3AP2A 4CDGA 4BFVA 3KQLA 1UFQA 2XXAB 3ASYA 4AK9A 4ZIRB 1K6MA 1EFTA 4PX9A 4W5HA 4C3ZA 1VCIA 1V43A 2AFHE 5FOWA 3TKLA 2WJHA 1UF9A 2VF8A 3C5HA 2CLDX 5D3MB 1Z83A 4D81A 1RRGA 5EUQB 3TGPA 3TW4A 2H8KA 2YC4C 3SBDA 2CJWB 2ZRHA 3LLMA 4JVSB 3SYNA 4EDHA 4XD7A 2EWWA 2Z5FA 2DWOA 3ZZTA 3ZVMA 2BM0A 4ILEA 5H1YA 4IDHA 2IYXA 3X1YA 2N46A 3LNCA 1LVGA 1XTQA 2WPDD 2ZEJA 4GZMA 3ZJYA 4NCKA 4PAMA 1RPZA 1RZ3A 3EARA 5EUMA 5JI3E 3TVDA 2AK2A 1N6OA 1P2TA 3OESA 3PEYA 4XTCS 4DZZA 4EPXA 2GVZC 1KK0A 1ZM4A 5FOSA 5CLLA 2OHFA 1ELOA 4PZLA 1NBMA 1ZNXA 4IOMA 1RJ9B 4HZUB 4IRUB 3Q3JB 3PJRA 3J81k 4C30A 4LY6A 2ODBA 2GKSA 3AVTA 1GL9B 2CNWA 3B7GA 3OAAD 4L8GA 4PHHA 4DLRA 3GLGA 1ZCAA 1BYIA 1NY6A 2H57A 4PO1A 4FWIB 3GJXC 4UNPA 3GLFE 1N5IA 4HSEA 1VTKA 4EFMA 4A36A 5FTMA 2IYYA 3PEWA 2JJ8A 1R5NA 2ODWA 3GEEA 1U8YA 4JT4A 4A0GA 4P32A 3KKNA 3SQXA 2P6NA 1P61B 1S4QA 2NQ2C 1UAAA 1AZTA 3U3JA 4US0R 3UATA 1SHZA 2YNMA 2QQEA 2VBCA 3L43A 4B44A 3PXGA 3C7KA 2CJWA 2O52A 2A7QA 3LDAA 1RKBA 4CW7A 3P1JA 4UNSA 2EVWX 1M34E 4MGYR 5EJEA 2DFLA 2OCPA 4MYTA 3KJGA 2GETA 5IF9A 1X1RA 1XD2B 4JVNA 3A1VA 1J8YF 2PX3A 4RJLA 1LF0A 5JS7A 1CXZA 3WP1B 5LPNA 1UBGA 3MWJA 1M74A 3ZS9A 3QG1A 4JL8A 1JJVA 5CIWA 2ZYUX 1UEJA 2QEQA 1Z0FA 3DL0A 4PZYA 3WBJA 1AJEA 3B78A 1OKKD 5E95A 2JCSA 1SXJC 4G0NA 5J4HA 3T35A 3LBIA 3N5CA 4AWXA 2J0UB 2KWIA 3DM9B 2QPOA 2FE4A 2QUZA 1D6JA 2R9VA 3O47A 4Y0AA 2L0XA 4BQSA 1RRFA 4TTPA 3VKHA 1CR4A 3GJ4A 3GJ6A 4JVMA 4A8JB 4MA4A 1MV5A 5H68A 1XNJA 1HTWA 4NBSA 2QMHA 3QXSA 2KI5A 3RRNA 3FPAA 2EQBA 3E2IA 5FR1A 2PZFA 4G5OA 3S1AA 2H1LA 4YXWA 3HPRA 4GP6A 5BXQC 1G5RA 5LD2C 2OUKA 2RB4A 1KZ7B 3R7WA 2CXXA 1G291 1KSHA 2QBYB 5HCIA 4NYMQ 1W4RA 3G82C 2HLDD 3RS3A 2BC9A 2ORIA 2BIFA 2IBMA 1JNYA 3Q5EA 4X8HA 1G41A 4O2LA 1AQUA 1TU4A 1HH4A 3N2IA 4CEJA 2FPKA 2Z4SA 4ERNA 4JS0A 4OK3A 3QEOA 1VCNA 4AIIA 2J46A 4AYTA 3A1WA 3HDTA 2EFHB 2BBSA 3L0IB 3Q8XB 3VKGA 1W46A 1VYTA 3AKDA 1KDRA 1U0LA 4XTRA 4MKIA 1OV4A 3OAAA 2W0MA 2Q6TA 4OHWA 4Q00A 521PA 2ZRFA 1KI7A 2PH1A 2X19A 1P2UA 3CF2A 3QKUA 3P26A 3LXRA 2IS2A 4ARZA 2IC5A 1H65A 2R6GA 1NLZA 1WF3A 1FTNA 1W0KD 4MQBA 3V00A 1DAFA 1VDZA 1KNQA 4LYHA 5JWHA 3W5IA 3WMFA 4M9XA 1AIPA 3FMOB 2EU8A 1OT3A 1M7BA 1TMKA 1TL7C 2VEDA 4D4JA 2FFBA 4ZCIA 1FPMA 1KKLA 2WWHA 1E9RA 3EZ7A 3NIBA 1ZD9A 3C15C 3TQFA 3BWDD 1D8TA 2QAGC 2ZRAA 4RD4A 3EA5A 4B35A 2FEMA 2NGRA 1Q1BA 3P4YA 4ZDJA 1NL3A 3GLHA 4U7DA 1EWRA 2C9OA 2FZLA 4PPGA 5EP3A 3K0CC 4BFXA 4YONB 5KNCA 2VSXA 2G6BA 4IW3B 1LW7A 3CX6A 2IYLD 3WRYC 1D5CA 2IF0A 4CYMA 5BN3A 1CR0A 2JDID 4V03A 4DIEA 3RWOA 721PA 1G16A 1T3SA 4DIDA 4A0RA 4NCNA 1HV8A 2BEJA 4IJMA 4GFDA 4A9AA 4DLSA 3T1OA 1XEWY 1UDXA 3T1QA 1SXJE 3T5GA 1D2MA 1GP2A 1O3YA 3RC3A 2NO6A 2XXAA 3RYTC 1D9ZA 1H8EA 3UK6A 4FWTA 2BJVA 1NVUQ 2B92A 4LOAA 3ZS8A 2NZJA 2QPAA 4BZPA 5HZHA 2VP9A 2F55A 1YU9A 2C04A 3AKEA 4GL2A 4KBGA 3ZIAA 3EIEA 3SU8A 4XVQA 3FOZA 1FQKA 3THXB 3B2EA 2XZLA 2HEIA 4C0HA 1CF4A 4P4SB 4RZUA 4Z8YA 1SVSA 3ZD7A 1XTRA 1EFRD 3I32A 5EP2A 2JLQA 1W4CA 2WJYA 2FSFA 1KSGA 2QMOA 1JBKA 4TTQA 3AGPA 4YXWD 4A2QA 1AS0A 1W5SA 1MABA 4G5SA 4TYNA 5KSPA 2LKCA 4GMDA 4JBYA 4PSAA 2G9NA 1VCMA 2RGDA 3CWZA 3D3QA 2BBOA 1UM8A 3HYRA 2RGCA 1FMJA 5B30A 2QM7A 3EPKA 1CJUC 4UXIA 4F4IA 1KAGA 4EJSB 2OXCA 1QHIA 2VRWA 3LBHA 4FINA 1N2CE 4ASUA 5EXXA 4Q4HA 5JSZB 3I61A 1OH7A 5FUXA 4HLUC 3QSYA 3PV0A 4IHQA 4FMDB 3SJAA 2GXSA 2CL0X 1KO5A 4P3YA 1NIPA 4M9SA 4QHYA 2LKDA 1T0JB 4KHZA 4CT4B 1P2SA 2CE2X 2HCBA 1Z22A 2UKDA 3BH0A 3LAWA 4NONA 5C2JB 1VECA 3HU2A 2GRJA 2QQ0A 5CITA 1CEEA 1NBME 2O5VA 1GILA 2VIIA 2ZPTX 1GUAA 3OZXA 2NPFA 2A5YB 5CLQA 821PA 4MRRA 1GL6A 1HURA 5DHFA 5IRCD 4Q9KA 2CCGA 2P3SA 3T34A 1ZM2A 2X77A 4MUAA 3VHLB 3IIKA 3GFPA 1KKMA 2UZIR 2WWIA 1GM5A 2OCYC 2QI9C 4M21A 4BFZA 2WPDA 3R9XA 3HP1A 5DYGA 4WW0A 4KVGA 1S8FA 2A9KA 4PZZA 4A92A 4BGDA 3RAPR 4M2LA 1IHUA 2G0NA 2ZUDA 3SE0A 2KSQA 3IIJA 1N5KA 3EZ2A 5AWFC 2ODEA 3GEIA 3UANA 1GKIA 4ESHA 1TQDA 1KYIA 3O8DA 4Z8XA 2OILA 2VQSA 3KZ1E 1M1YE 1JPJA 2PJZA 3LXXA 3U6KA 1RC8A 1PJRA 1OXVA 2NPIA 3F8TA 6Q21A 2OM2A 3B1VA 3K70B 4RKEA 1SQ5A 3WMEA 1EESA 4ZCMA 3THYB 4EKDA 1JEEA 1SVLA 1ZBDA 4TLDA 2KBFA 2BWJA 2HYDA 1VG1A 2DPXA 2JLVA 3RRMA 4UNNA 4NL4H 3BGWA 2C77A 4PHTA 4AG6A 3NBZC 1S3SA 2P65A 5HR5A 2YWHA 2G83A 2H7VA 4FCWA 3FFAA 4TTRA 3U7GA 1G19A 3Q7PA 3SHWA 4HI0E 2D7CA 1IXZA 1Q21A 3KUDA 2OT3B 3QXJA 1IN8A 1E0AA 1YZTA 4I99A 2GF0A 5KSYA 2REBA 3ZIAD 3W9YA 4Q9HA 4OHYA 1BIFA 4LJ5A 3NBXX 4I4LA 4YLGA 1IJFA 2QN6A 4RFSA 4X8MA 2ZS9A 4PC7A 3C16C 1EFRA 4TLCA 4Q4HB 1GNPA 5GJCA 4Q7JB 4PPNA 4TMVA 5JSZA 3L0OA 3ZVRA 1VG9B 2ECKA 2JGNA 4C0SA 1LFDB 1AGPA 5DYIA 4NZYA 4M1KA 1LV7A 4URWR 4KODA 5HZKA 2Q9BA 2VA8A 1EK0A 3NDBB 2R8RA 2VHTA 1SKYB 2J3EA 3OF5A 2A5JA 3GJ8A 3U61B 4AKGA 1XD9A 3THWB 4DT1B 2FG5A 4Q48A 5KO2A 1IN4A 1NKTA 1WBBA 2I3BA 3ICQB 1SVWA 1T3HA 2B8WA 3M0EA 4TL9A 5KU1A 1ZIOA 4IXMA 1DAEA 2CMKA 5EE1A 2HXYA 3QNUA 1L2TA 3REGA 3RVBA 3TH5A 1G6HA 4HAUA 4MDEA 1US8B 1XEWX 3LX5A 1AKEA 4B76A 4H9GA 3NEYA 4EAQA 4JLDA 1Z6YA 1Z07A 2R6DA 2IUSA 2FA9A 3QXCA 1P73A 1ZD1A 1E2PA 3EIQA 2GXUA 2I1QA 1AS3A 2CE7A 4MRSA 2KB0A 3EPJA 3RSOA 3TMKA 5KYKA 2ZRKA 1FNMA 3BH6A 4JT2A 4TLAA 3T15A 5CK5A 5FOUA 1HQYE 3SFVA 1JR6A 5AUQA 2RGEA 3GQBA 3I1FA 1GIAA 3IIMA 2IYVA 4B74A 3WNBA 2PMKA 3EW9A 1U81A 4US1R 3B1XA 1W48A 1FOEB 3IHLA 4LJ9A 1FP6A 3L0PA 4NYIR 3M6AA 5J4VA 2IEYA 3L0SA 3U44A 3BC1A 5DH9A 2A2ZA 2PJRA 3BB1A 2RGXA 3FFBA 2K5UA 4FD2A 2F7SA 5EP4A 3IEVA 2PCLA 4WXRA 5E3HA 3ZYCA 3KUCA 5CIQA 3ZVLA 2GBLA 4A15A 1VG8A 2DWPA 2FF7A 5HPYB 1YVDA 4AY2A 2YOGA 2CCJA 3NWJA 4LJ8A 1E69A 5CK4A 1PVOA 1SVIA 1HT1E 3KX2A 1MR3F 5EXTA 1X3SA 5G40A 4BE7B 4B3FX 1Z6XA 2VHCA 1R2QA 5CM9C 3LW7A 2GVDC 1GFIA 2FPMA 4D2IA 2CLCX 1E0JA 5JLJA 1R4AA 1W0JA 2BDTA 2GCOA 4HUQA 3B13B 4RD1A 4C0JA 2ZIAA 1ZYUA 5FPKA 3CO5A 4HB2A 4JLBA 2FEOA 4B73A 1R10A 4QL3A 5L3VA 1KJYA 1TPZA 2DWQA 3DOFA 1DAGA 2FZ4A 1EG7A 2ZROA 4UQOA 2IS4A 3PR1A 2GAAA 5JI2E 1W0KA 1Q3HA 1W2GA 2X8AA 3Q7QA 4M1TA 2V54A 4TMKA 3U60B 4CEIB 3AF1A 3FDIA 2ZI4A 2ANBA 5LB4A 1W2HA 4M22A 3ECCA 2A3RA 2HF9A 4C0QC 3ZVNA 1KI4A 4NYJR 1JAIA 4G1UC 4DUGA 3ZZ0A 1D2NA 2PMDA 1WMSA 2ODNA 1S3GA 4MGIR 3H0KA 3CZPA 2Q3MA 2HCJB 2ZYTX 3KB2A 3U3MA 1NSFA 1MKYA 1ZD8A 1LY1A 3NBYC 4DDTA 2BBWA 3CF6R 2WAYA 1XCMA 4A82A 3GP8A 3FGNA 3GLHB 5J47A 1E6CA 2Y8EA 3KJEA 3W6NA 2HJVA 5F3WB 1E9CA 1MO3A 4OI4A 2EYQA 2JDIA 3MJHA 2WSSD 2ZJ2A 3SBEA 2F1HA 1AN0A 4DWJA 5AUPB 3I4LA 1Z6AA 2WZQA 3ND9A 1VHTA 4LJAA 4IDOA 4W7SA 1TU3A 4O2RA 3QXXA 1E1QD 4RD3A 4KLZA 1NRJB 4HAVA 4HAYA 3X2SA 1WXQA 2ZAOA 5KNBA 1OHHA 4C2TA 1Z29A 4P4TA 1GZSA 4LC1A 1H8ED 3AP3A 1ZM3A 4HB0A 1OH8A 2Q9AA 3SJBA 3NH9A 2EFGA 4BEJA 2OFWA 1ZNYA 1KI6B 1S96A 3NH6A 4KXFB 4LJYA 3EC2A 1ODFA 2WJIA 4G5QA 4I1SA 2EFEB 5KSZA 2D2FA 4QNRA 3CRQA 4I1UA 3VAAA 4Q4AA 3U7HB 5FTNA 4P0TA 4BUJA 4IOJA 1A82A 1DPFA 3FB4A 4XWAA 4C0KA 4QGAA 2D3WA 1U8ZA 1T8TA 1N3BA 3X1ZA 3H84A 2XJ9A 3K9LA 4JL5A 1XDBA 3FVQA 3GLIA 1RYHA 4PQYA 1UPTA 3D7MA 2ZI9A 1N25A 1ESNA 2O8FA 3X1WA 4B3BA 4DCSA 2R65A 4QNMA 3U4QA 3RRZA 1S2MA 4YMSA 4V0LA 1Z0JA 4LK2A 3W3ZB 3AH8A 4MRPA 2F3TA 1N6PA 2W2VA 1IY2A 4GOXA 2EFDB 1WP9A 2Q9CA 4TYQA 3C5CA 4JMPA 4QGFA 1HA3A 3DM5A 1OIWA 1BYUA 2NO9A 4K46A 4WIAA 1N6KA 5C1BA 5KOYA 3EZFA 3MFYA 3Q72A 2ZUBA 2ZM5A 2YC2C 2JJ1D 1KK3A 1F5NA 4Q1DA 3AVXA 2Z83A 1Z63A 4JJKA 4Y0VA 1SXJA 2ZR9A 4D25A 1NN1A 1X8JA 3LRPA 1CULC 4YMVA 3ONWA 1OIVA 5A5GA 2MSDB 3CH5A 1IJEA 2GWHA 2WBLC 4E09A 4Q1AA 3P32A 1HE1C 1E9BA 1FNNA 3VX4A 5FOTA 2IS1A 4M4SA 1HQCA 3VHXA 2W2XA 1U0JA 4DUGD 2AL7A 4LV8B 2OAP1 4N0EA 4DCVA 1XTSA 4KYUA 3KQUA 4IDPA 3U7FB 1YZUA 2C98A 1ZNWA 4H1VA 2ATXA 4KSBA 2NIPA 1P5ZB 3H86A 1QHXA 3ZLJA 2ZRLA 3THWA 1WDTA 5DSZA 1ZUIA 4BFSA 3A36A 3E70C 2R6AA 1KDOA 1RE0A 3DEFA 4G5RA 3VR5A 3B9QA 3CNNA 3B5JA 2JLSA 2IW3A 3KKOA 1N0WA 1QBKC 1YE8A 4PC1A 3FYHA 4NCJA 4II7A 1G20E 1PLLA 1N5LA 1Q0UA 5FUWA 4DXAA 2YOFA 2ZI7A 3A4LA 1F6BA 1E1QA 4L5BA 4E07A 1EFHA 2ZREA 3M1IA 4OJKA 4PO8A 4YMWA 5JJLA 3DO6A 1OHHD 3PQCA 1ZM7A 2HT6A 4BZXA 4DBLC 1Q57A 2P0EA 2V1XA 1NSTA 1XZPA 3PUWA 5KDDA 1A1VA 1F2UB 1GG2A 2X2FA 2D74A 4WBSA 1SHKA 4PAOA 4R98A 4BRUA 3DDCA 3UMRA 4D4MA 1BH2A 2D62A 1XTJA 3HJNA 4FCTA 1JJ7A 3VX3A 1G8HA 1ZMXA 4DHEA 5H8WA 1YR6A 3GMTA 3L82B 1U8AA 3QVUA 1KDTA 1MRNA 1Q1QA 2AR7A 3GCGA 4C0AC 4DCNA 3EA0A 3CW2A 4HAWA 1CS4C 4N0DA 4QBIA 2XNDA 2W00A 4KLNA 4RD2A 3B8HA 1G17A 1TAGA 2QG6A 2DFTA 4ZDWA 1JXMA 1VCOA 5JECA 2VP6A 3CNOA 2RGNA 2OBLA 4LWZA 3WHLA 3WP0A 3UIEA 4YMUA 3ICEA 1TF5A 2WMNB 5CYOA 3GLIB 1F2TA 4BFWA 1Z08A 2F1IA 1DELA 1SVOA 1I4DD 3PUZA 4W5JA 2RGGA 3T1VA 5FTLA 2ONKA 3IQWA 3I62A 4L9SA 2JJ2D 4D0NA 2BJWA 2V55B 3PUVA 4PTLA 1GNQA 3BAFA 3EWSA 3WYGA 2ZUCA 4Q4JB 5CDFA 1IXRC 4KJZA 4TYWA 4B3GA 1SULA 2GCPA 4ZCLA 1T5LA 2CDNA 5E7MA 1ESMA 3RS2A 3IBYA 2IUTA 1HE8B 1G7CA 5JRZA 2VYFA 1QF9A 2AWOA 3TSWA 4QOSA 2J5XA 2CK3D 2QSYA 2BCJQ 2ZR0A 1I4LD 1JAHA 3IO5A 5FR2A 4B71A 8OHMA 3LW8A 2IXGA 1Q44A 1TEXA 2REOA 2XB4A 2ZITA 3AV0B 1E2EA 1WE2A 2PZEA 3CM0A 3TE6A 4F38A 1XEXA 2AXPA 2F3RA 1N0VC 2ATVA 4AURA 1BKDR 3M4YA 2IS6A 1CJVC 1SXJD 2A30A 2OLJA 3T12A 3AP1A 2R6CA 2REXB 1RRPA 1L4UA 2JEOA 3AKYA 3K9GA 1MO6A 4TMWA 2C5LA 4K8OA 3BFXA 3I72A 4NCHA 4KITB 1DE0A 2D06A 2YKGA 4C2UA 3CH4B 4ZPXA 3RS0A 5GVRA 5FFMA 4ZV4A 2IYSA 1BMFD 2H16A 3CZQA 4JSTA 5BW8A 4G01B 3K0FA 2XAUA 4KV9A 1U9IC 2WVJA 4U02A 3EZ6A 3FKSD 5LB2A 1A5TA 3B1ZA 3EASA 3RANA 1E4VA 4L16A 1W0JD 3AB3A 5FPTA 4AKEA 2VHQA 4A2PA 2O8DB 4FXPA 1BOFA 2XTZA 4ZKEA 2ZYWX 3BFKA 4QGGA 1XPRA 1KY2A 1UDWA 4NP6A 1D2EA 1QHYA 3UMSA 4RKFA 2C9YA 5JHHB 5P21A 2ERXA 4OK5A 5J4KA 1MRSA 1CKEA 1JI0A 3CX7A 1UEIA 2D4HA 1GTVA 3RSLA 4BPBA 5AJVB 4CRWB 4C7OA 1K8RA 4DCUA 3I73A 4TZ0A 4TT3A 3KB1A 4RFSB 1P62B 1NVVR 4XVUA 4NE2A 1JQLB 1DADA 2CHVA 3B9PA 2G88A 4URXR 4JBXA 2B7BA 3IGFA 3K70C 5CB8A 1G4UR 4U00A 1UBCA 1Z06A 1O87A 1XX6A 2C95A 4PPFA 4B3XA 1N6IA 3NHAA 4Q47A 3K0AB 3EPHA 2B7CA 2BOVA 1S1CA 2VTKA 3CR8A 1YRBA 3TNFA 1OW3B 5LD2B 3K0FB 3U6BA 2XZOA 2IYRA 2F9LA 1E1RD 2OV2A 5G41A 2IYTA 4PANA 1E9SA 3W6PA 3CIOA 2WSSA 4OHVA 2E1RA 5TARA 2QP4A 4R2IA 3I8SA 1A2BA 2XEXA 3D8BA 2VP5A 4HATA 3NHBA 1TEVA 4IOKA 1KY3A 1U99A 3LVQE 1T91A 4WZAE 4JLMA 5CJ2A 1YRAA 3THOA 4P33A 3GJ3A 3LBNA 2W6JA 1DOAA 2J9RA 4BZQA 2QSZA 2JAQA 2J0SA 5EE3A 2CK3A 3R9WA 3I8XA 3QF4A 2J87A 3FMPB 1U0HC 2OCAA 5DISB 4LBVA 3CRVA 3A4NA 4QG7A 3QIAA 5AJYA 4QJ5A 3RS5A 4ZDKA 5AJXA 1J99A 1CU1A 2GXAA 2FFHA 1A7JA 4OBEA 1ZRHA 4OHZA 1OLOA 2G1JA 3OEHD 5D3QA 2KE5A 2IHYA 3R8CA 4RZ3A 2QAJA 3P4XA 2YWGA 3N70A 2ZI3A 2GILA 2RMKA 2WKQA 1E2MA 1R0YA 3SI7A 1XMJA 1HUQA 1C9KA 3QOFA 1TQ6A 1ZINA 2VHUA 4DLXA 4A8JA 1GDDA 2Z4RA 2FSIA 4XVRA 5M04A 4LUCA 2GJSA 1TADA 4B2IA 5L8VA 1XBTA 2PBRA 3CRRA 4JLPA 3U44B 1U90A 3K70D 1U98A 2P2LA 3AVOA 3TUIC 5TMPA 2F9MA 3RLFA 1KAOA 1YZGA 1P9RA 2J1LA 5H70A 3FKSA 3G0HA 2RGAA 4LHZA 5B2ZA 5F98A 1G3RA 1MH1A 1FW6A 3ADBA 4KYIB 5BYJA 4FMCB 1DG1G 1P7CA 2JJ1A 2UZ3A 3QEJA 5FUVA 4I1OA 4F92B 3LD9A 3U3RA 4G3XA 5FL7A 5GJVC 3GPLA 1E2HA 1NVVQ 3QF4B 4QBHA 4F4JA 5JJKA 1NLYA 3KQKA 3KQHA 1SGWA 2GA8A 4EFNA 1OH5A 3C8UA 4BLOA 2R6FA 3THYA 4LRWA 1AM4D 2WOOA 2JLYA 3U5ZB 1OFUX 2YJTD 3TAUA 1RW4A 5TV2A 4LGMA 1N6RA 3DMDA 1DEKA 3RDPA 2ZE7A 4QBFA 5HKKD 1GITA 3RC8A 1NI3A 2RGBA 3A1SA 2ZXUA 1SKQA 5FTKA 5HTKA 5CB6A 4NH0A 3KXIA 2QTFA 2WHXA 4GP7A 4MRVA 4PPQA 1R8SA 4LPSA 3BORA 3RNLA
chains in the Genus database with same CATH superfamily
3G5MA 1RLMA 3EY4A 4OHBA 3U19A 1DUVG 4G0YA 4N5LA 2HV8A 3QJ5A 4HYYA 1N5JA 2CD7A 3JWHA 4I5FA 5G4KA 3ETLA 3VNAA 3IELA 2C03A 1NXQA 1S2IA 5CT6A 1KHTA 4NDAA 3OF2A 2MSNA 5BV8A 4P4SA 1ISSA 4AX4A 4JHXA 4M3NA 4FEGA 2J3HA 2YQ4A 1F6DA 2I71A 3S8EA 2W6JD 1ZK4A 1RWPA 3NHSA 3O2SB 1IN7A 3FHOA 2OYRA 3LUBA 1QTQA 1XA4A 3OZIA 2O2JA 5JWRA 4JZYA 4N3GA 2V0CA 3C4VA 5KPDA 2QE6A 4F06A 2CWDA 3MOIA 5ALDA 2RHGB 2Y4NA 3QJYA 5JG7A 1RYDA 3TOZA 3I8OA 3BHIA 4KQJA 1Y6GA 1E3WB 3ECSA 4LJLA 4OX9Y 2GHRA 2QLFA 2CVHA 1RQ2A 3M3PA 3K53A 3QVWA 3F98A 1JSZA 2AT1A 2JASA 5DE3A 3SEFA 4WA8A 3WMWA 3PVCA 2B5VA 1XMIA 2EG5A 3BWVA 5JPIA 4EKEA 5AW6A 2V97A 5CXSA 1QG2A 1RTTA 2Z1MA 2VHJA 5EJIA 1W75A 1IPHA 2DPMA 4ZTBA 3ND7A 4BQOA 5EQJB 1ZMRA 4J6EA 1CJKC 4EHHA 1RJDA 3VC7A 1G5PA 4UMEA 5CA1F 3EZXA 2VUTA 3BXZA 2O1SA 5TQ0A 3A9UA 3O92A 3SS8A 4Q03A 3PCRB 2I1WA 2I6GA 3AL3A 2ET6A 5F5NA 4I4IA 3RUCA 1UKBA 2VSYA 3HLYA 3ITNA 4FHCA 3U48A 4NCIA 2WJPA 4M1OA 2WU0A 4DB4A 2Q5HA 2Y1FA 1DXYA 5FNVA 2DEUA 2IYOA 1XZMA 1JQEA 2IYQA 5EE0A 5GONF 1NMXA 1D04A 1ZJ6A 3M4NA 4LXXA 5C5CA 3NUQA 2QNIA 2NMVA 3G5UA 4ZEOA 1ZD5A 3L6UA 2BSAA 4EFKA 3PVSA 1IVSA 5H02A 3SHTA 2JFZA 3D6AA 4MWSA 2Y0CA 3QUTA 5AXAA 3CUUA 5DXFA 3UWMA 1P0MA 2A7XA 5F64A 3EH1A 3A11A 3ABIA 4CKBB 4Q37A 4QWWA 2V6BA 2APJA 3FWPA 2ZTSA 3L7CA 5HKAA 1SIOA 1TQ4A 4PBSA 5KVSA 3PFIA 1DKPA 3CLRD 3WL7A 4YY3B 1DEOA 4OAOA 1U3WA 4URFA 3HBNA 1J2YA 5KNDH 1BWRA 4BVLA 4X61A 1FUIA 5HIMA 3VR2A 2CB9A 4MPJA 3FBWA 5DULA 3VNQA 4UFNA 1BSVA 4MUJA 3IRUA 5FAXA 1P9OA 2C3UA 2Q4BA 2WZBA 2ZE6A 5SYMA 1GGFA 1YI1A 2HSZA 1E79D 2OO3A 4MK4A 1ETHA 1E9VA 1L0BA 2Z56A 1XQ6A 5C34B 2O1XA 3VYWA 3I5YA 2ZJ6A 4I81A 3EMDA 2ACVA 5IDWA 2WIAA 4XUGB 3TLJA 5KNDA 2GPBA 4H3KB 4RCZA 4WZ6A 1PQ4A 2HXSA 1ISGA 2GK4A 1K5DA 2CYCA 2R8OA 2ZSKA 3ICOA 1U94A 3OSZA 4DMHA 1GXSB 4Z0HO 4ZZ0A 1XWFA 3BE4A 5SZHB 4UJ3A 3HACA 4JUDX 3AX6A 4AZ3A 1C3XA 1LRJA 4UBJA 1BMFA 2A67A 2W2KA 5B1SA 2BKLA 4B3IA 2C2BA 2OMEA 3O6VA 4XX0B 4XCQA 1V5FA 5I8ZA 3DZ8A 3KQOA 4I5GA 4L4XA 2NO5A 3LT4A 4YRMA 2IU6A 1VLLA 2BGRA 4X63A 2P79A 2ZUSA 4X71A 2X13A 2OESA 2PY6A 5NULA 3HP4A 1ZEJA 3QKSB 3TNYA 1VCHA 4X1KB 1VL2A 4OHCA 4IFEA 1OWPA 3TFWA 1C9YA 4N3CA 2R3SA 2I03A 4X0EA 5DLQC 5C46F 2QA5A 4HHEA 3TUZC 4QM6A 4R2JA 1XROA 3MRTA 3OPQA 2WJVA 4WASA 4TL7A 3G2KA 1HDCA 4CM8A 1EGAA 4D4HA 4LCBA 2AFIB 1JHDA 4DV3B 1OH6A 1IDN1 1HLFA 1HX7A 1WMAA 3V1YA 2GLXA 4KTTE 4ME6A 3ZWBA 4B75A 1C5KA 4ZI2A 2H92A 3FTNA 1OASA 1P18A 4TT3D 4W5QA 1WHTB 5EZYA 1TRHA 2AHRA 2OLKA 1X8KA 1IUNA 5FUYA 3C85A 1GVNB 4M60A 3LT0A 4UTXA 4UOQA 5A7GA 3OQHA 4BV9A 3N53A 3V1LA 1U4OA 4L6CA 1WZUA 3DD5A 2ZAIA 4RK6A 1TW2A 5IASA 3VV3A 2A5GA 3L93A 4IVQA 4KFTA 3U4QB 3K8YA 3NBFA 2NU9A 3ZU2A 1D7AA 2QMEA 1XHEA 3FCYA 3GJ5A 1QQBA 1ZH4A 4AMYA 3VDXA 4N7JA 5JTTA 4HAIA 3S8MA 1JBQA 4AIRA 1PS0A 1DI0A 1MG0A 3QOWA 1KOLA 1O95A 3ZK7A 2J6CA 2OHXA 5K3DA 4BFTA 4LPKA 3T3PB 5CX1A 1N9GB 1Q0RA 4L57A 3CX8A 4V1CB 3IERA 3GUZA 1CRQA 4R1SA 4Z7QB 1I80A 3KKQA 3M81A 5HXAA 2GJ4A 1KTVA 4P80A 1TLTA 5CA0A 2O8NA 3JZAA 4Y1EA 3Q41A 2QX9A 1UK6A 2ZZKA 1Q20A 4K6GA 3INTA 1LNQA 4MP6A 2B1GA 3NBAA 4MYUA 1BQ4A 4ITUA 1Z56C 2QMZA 1MX9A 2ZRJA 4ES6A 1UPAA 2RI0A 2BKEA 1VJDA 3OECA 1YZLA 4J0DA 2B69A 4YJFB 3JALB 5KVVA 4D9JA 2AN5A 5IX8A 1L3BA 1ZI6A 1E3DA 1ULSA 4WECA 4ON9A 4PC2A 2BDEA 2R00A 3WTCA 4ZT3A 3H05A 5KTMA 1XCGB 3AG6A 2O7NA 3K0AA 5DNWA 2PZMA 4MR7B 1AO0A 5J4LA 2GJKA 4RJIA 3E05A 1GFWA 4RZXA 4XOUA 5JAZA 3ESCA 3W5AA 1E79A 2A9PA 2BKUA 3OEYA 1SWVA 1IQ0A 4FZVA 1PX2A 4XB2A 3WB1A 2Y27A 3QEAZ 1YJ8A 2XDYA 4JJGA 2VRBA 4OFBA 1WD5A 2RAVA 1E0KA 4PZAA 5K6AC 2HU5A 3N58A 3PT5A 3X1MA 2UVDA 3DEAA 1M0WA 1QRSA 2QX6A 3O0DA 4GVPA 4KIUA 4B32A 2OSBA 2W9XA 4QDZA 3TG8A 5HWSA 1GD1O 2X1VA 5T4FA 4I4CA 4D82A 4M1YA 1LSUA 1G6OA 1OFUA 3E35A 3ORQA 2PMEA 2BM1A 2JIDA 1IY0A 1JLLA 4GPBA 5I4IA 5IVPA 1W34A 3DT6A 2IH4A 2P9FA 3ZHZA 1TTPB 2HRCA 3QW4B 3PQDA 5AVYA 1NG1A 2YIVX 4IXTA 1T6XA 5C3UA 3R3ZA 5HKBA 1G60A 2AJDA 2A1TS 4HH4A 3TLGA 2ZOSA 4EK9A 4GLOA 2GERA 1A8SA 1ONSA 1N6HA 3VR6D 1CJMA 3D7RA 1RP1A 2AE2A 2CWWA 3HRIA 2IT1A 4ZI7B 1R6VA 4BBPA 1RE1A 5IT5A 1R15A 4NTZA 1GKUB 5E8RA 3DXFA 4TGLA 3AO0B 4KWEA 4ITRC 1QFYA 2K4MA 2EX4A 4JKYA 3FLAA 5FL7D 1ZLYA 1PYGA 2QD4A 2AD1A 1AK9A 2HJWA 2MDTA 2J0UA 1KGDA 5C8YA 4DMMA 5SZKB 4IIHA 2QTHA 4D9HA 3MJEA 4MUIA 1A27A 2Z98A 1QG6A 3Q4GA 2CHQA 2XRMA 1P72A 3DOIA 1L5QA 2W2OA 4I19A 4U63A 5KHAA 1NXPA 2OQIA 4P5EA 4UTZA 4A2CA 1CZOA 5BPFA 5A2QA 3HCRA 4A6PA 4KR3A 2VTVA 3MJRA 5IANA 5IXSA 5I9SA 2VTDA 5DO9A 5IUNC 2QWXA 2O2HA 4PRLA 4MVYA 1U5BA 4Q9LA 3MD0A 2FFJA 5IF3A 3CUEF 3C87A 3QWAA 4RDHA 4AAYA 3F71A 5EJAA 2B4KA 1K6IA 1QZXA 2JVIA 3I30X 2OCDA 4ZVSA 3T52A 5L95A 5HRUA 1QV6A 2ZWPA 3D81A 3FWKA 3I9JA 1E94E 3K0CA 5HJ5A 2H48A 2HAEA 5D6NA 1AK2A 1TVKB 2R5WA 4GDMA 4LZLA 1KMHA 3FUTA 4B8ZA 2WDPA 1DRWA 3FMIA 1Z5GA 4BUZA 5AW5A 4AZWA 5E9JA 4BJ1A 4Y2QA 3VH1A 1G2PA 1O96B 2I0FA 4WWHA 2HK8A 4DMKA 4DLVA 3AOGA 3DHEA 3ITKA 3U49A 4IICA 3E03A 4M0LA 2VJAA 1Y5IA 5CJPA 1E5LA 1BXGB 3QV2A 4ONEA 1SEPA 2AQIA 1WMFA 4CM4B 4BECA 3DXXA 2X0IA 1LH0A 5LP6F 2V6GA 2IPNA 2Q2VA 3H18A 3GPBA 5L7YA 1OXSC 3K0HA 4CM7A 4EDFA 2LRHA 3ILYA 1JDBC 3IAHA 2I34A 3X1DA 3AI3A 1ZCBA 2AJBA 3CBQA 4H7DA 4TVOA 4CLHA 1Y6ZA 3WVNA 3ND5A 6NULA 3E1SA 3F1KA 4BLSA 3VC2A 2VWQA 2X2EA 3FWYA 3KE9A 1DVRA 4L5CA 1VLMA 5TJ9A 2DQSA 4AROA 3FOWA 4KX5A 1Z13A 1GADO 2IY7A 2PSSA 4Y7DA 4CIBA 4WBNF 3IMFA 2WFLA 2DE0X 3VNSA 4M1MA 5CX4A 3BEOA 3IUYA 1HBJA 5ICGA 3GPCA 4NBRA 3I05A 4X44A 4P3NA 1H3EA 1USKA 4IFIA 1ZBQA 2WJWA 1SQ0A 3HN7A 2YASA 1MIOA 3EIFA 3B8EA 3F97A 1VLZA 1OJLA 1FUKA 3TG2A 4WTOA 3V4SA 1JEYA 1RAFA 2GYVA 1G63A 1KH3A 2HD4A 1TVEA 5FI5A 4JB3A 3VVBA 3SYLA 3LUHA 4BQEA 4FMPA 4E4RA 4QUAA 3H1EA 1VGRA 2GPSA 2XTMA 1TJNA 4GI2A 4D56A 3LDFA 5FLYA 3D6MA 1SVKA 4NMLA 5GTDA 5IZCC 1X7WA 2FN3A 3PR3A 2YINC 3N59A 5FOVA 4LSGA 5JQGA 3JQBC 3HU3A 2QENA 3OCWA 1N2ZA 5FWYB 5BSUA 1W2WB 2V7QA 3CCFA 1JSLA 3MMNA 3SR0A 1II8A 1PS8A 3CISA 1I7QB 4IQ8A 4KFCA 4ARIA 3O8CA 4O8CA 3SJCA 1ULZA 3R7LA 5FBLB 2PX0A 1NC3A 1PBTA 1DX4A 1Y98A 3NTXA 4Q39A 1E9AA 3S2UA 2O0LA 1ZG3A 1PJLA 1YRLA 4TOIA 5G3ZA 4DA8A 2OVBA 4WXPA 3N9IA 5A9TA 2OXTA 4DLZA 5KKCA 1LVHA 3MAGA 1R4MA 3U7EB 3E0QA 3M2PA 3RUDA 2CHGA 3ELUA 5CVDA 4KOAA 1NVXQ 3QY0A 4YB8A 1L5WA 1SB9A 5ESDA 2NVUB 4DVGA 2PWYA 2CL6X 2EFJA 2HDNB 3I0NA 3BTOA 2XWQA 1Z6GA 2I91A 1JQDA 4ZJYA 4K81B 2QY9A 2NOAA 2Q21A 5B6PA 1QIGA 1U11A 2NYUA 3EVCA 1R0KA 4LKOA 2JB9A 2VDNB 1W96A 5IT0A 4PZPA 2DLNA 4FKBA 1KO8A 4ZA2A 4C2BA 1K8YB 4A3SA 2X2PA 4EL0A 4YQZA 3T38A 2LCFA 3TD9A 2ZU0C 4PG4A 3WWYA 2VNKA 5KYVA 1YZVA 4I1IA 1GZ3A 4I55F 4G85A 2OGUA 1AMOA 1NA5A 1YI8A 3ZV3A 2V3VA 4NENA 5AK4A 4ZHQB 1DO2A 2B1IA 1XDGA 3I34X 2OHHA 1EDDA 1BHJA 3CLTD 3R20A 4B4OA 3HJCA 3RVNA 4DM3A 4R9UC 1H2RS 1OVGA 3BMNA 4PXAA 3ZDAA 3ZCRA 2BCEA 2FMXA 1PR4A 3OFNA 1OLSB 4O02B 4JJZA 5EUCA 2B8NA 4P4UA 1R27A 1W93A 5WRFA 1OI4A 5HDBB 3KQVA 5JXJA 3HVUA 1TF7A 5AUOB 4GI5A 3OX3A 2JH3A 2XDQB 3P71T 1Q6ZA 2EXXA 4XM0A 1XMSA 1P6UA 2XYPA 4OBWA 3MXOA 1ICIA 1ZDMA 3OPVA 1H1LB 5ICFA 4DDUA 3TL3A 4AJIA 7MHTA 3KKEA 4LV6A 5DI3B 4KL8S 4GLFA 4QC2A 3PF9A 4WKCA 1K5GA 4TSFD 3UA4A 4G9GA 1KIAA 4XWKA 4R4JA 1T8WA 3WRWA 4B4WA 1CQJB 1C50A 3S1AB 2FZ5A 3K35A 1QVZA 1D03A 1RIIA 3OWHA 4J1SA 4L4UA 2VEOA 3CEMA 4DSNA 4G0WA 3PQ8A 3JW8A 2R6JA 1P4JA 4LYJA 2O0JA 3AR5A 4GO1A 1DBPA 4HRAA 1C1HA 5F35A 3TJRA 2VNSA 1O0SA 4WVLA 3RPEA 3VISA 1G9TA 3PJGA 3UO8B 2AEMA 2IXDA 1Z5WA 2NPOA 2QORA 1DT5A 3L1HA 1SKYE 4JBWA 3TZBA 2VDKB 1QF7A 4CF5A 3QNWA 2P4QA 2E49A 3BMOA 5EMLA 3PK0A 3G2PA 1V6CA 3EFEA 3IUNA 3UXYA 5KJ6A 1YR7A 1MORA 3UV6A 1PNQA 3N86A 2RKWA 1JEQB 5ITZA 1BXKA 1WB9A 3FJ1A 4Q05A 4RIEA 4JR0A 4COOA 2AZTA 5L3SB 3LT2A 4Q19A 4LC9A 2BMVA 2F17A 4ZQBA 1JHRA 1NQTA 3UKDA 4QYMA 4LXUA 4JQOA 2JFYA 3PC8A 4GMGA 2O23A 3D5EA 1NN5A 3DHWC 1HPLA 2D5CA 4HOYA 4X7PA 2R1UA 1DG3A 2ZJZA 4RU1A 1KO4A 2GTPA 2QLMA 3MIIA 3NRBA 3VBCA 4YAUA 3OLQA 1B23P 1DX9A 3DZDA 3I2IA 1TUEA 5FJJA 4MRMB 4XQGA 2WSBA 2GAOA 3VNVA 2ZVQX 3H9GA 4TSRA 2W83A 4UPVA 1DP4A 2LVBA 2BFNA 1EFLA 2QNBA 4YMTA 4GWGA 5KWSA 2V7VA 4MUEA 1M6EX 4NMMA 2QT1A 2VSQA 4KXQA 1NYLA 3D2BA 2W48A 4OHFA 3HU5A 2ORWA 1VE1A 4RELA 3L1UA 4OMCA 4ALIA 3KHKA 4OAQA 3S68A 4NPHA 1Z25A 2DBRA 3IESA 3MG9A 4JJAA 4U7GA 3NUZA 3C14C 3Q40A 2G72A 4JOCA 1F3OA 1MF7A 4PCVA 4PRKA 5EJ2A 3SHFA 3QX9A 3ZGZA 1C4XA 3T9FA 1G0NA 4MX8A 1V71A 5FA8A 3I01M 2ZJ1A 4IDFA 1JHZA 2W6IA 1T6ZA 4JLJA 5FBRB 3A2NA 4XSVA 1QRRA 1RXYA 4TWRA 1L5LA 4LRQA 2VO1A 3I3SR 4I6GA 1TOAA 3AF2A 2IEGA 3GG2A 4WAUA 4DA6A 2WB2A 3JD3A 3SJZA 1U2ZA 1JTVA 5GM2A 1QTNA 4X8OA 5LIPA 4Q4LA 1TTTA 3T9BA 4KRGA 4W5OA 5I5EA 3AKCA 1M2OB 1K3FA 4JIMA 4PR0A 2CT8A 3FWNA 1JU4A 3B9RA 1PDWA 3JWIA 1W5TA 4CLOB 4HAOA 1T3GA 2J4CA 2SECE 1BQEA 5J2TF 4HNTA 5I9IA 5JNUA 2QW0X 3KEQA 4MIOA 4RF2A 3PR2B 1ZU5A 2G71A 1Z4KA 3RYFA 1WRBA 2EP8A 4YGYA 1YHZA 2FWRA 1YUNA 1A4RA 1NAHA 3BG5A 3FNHA 3BRWA 1Q7BA 3W6UA 4EHJA 3EPLA 4C7BA 1ZUWA 3PWTA 2JCYA 1E7YA 5CBPB 1EB8A 3RG2A 5AJTA 4IH4A 2GM5A 1Y3HA 4WXHA 1KO1A 3RWBA 2PSFA 4B3CA 2O5CA 3VR3A 1FYFA 4C0WA 4RJKA 2ACEA 3N8KA 2IF2A 2RH4A 2A5DA 2PWPA 3BOSA 4XLTA 4ZEWA 4KR6A 3G2OA 3EODA 821PA 3CE6A 1GRRA 2CHEA 1D6MA 1EWYA 1W88A 4RFVA 2GZ3A 2M9MA 2XA2A 5HS6A 2JHGA 4ND6A 1FRZA 2J3LA 3Q9LA 3DE6X 2Q28A 3K6RA 4U9UA 4QG3A 2PUFA 1GQRA 2G4CA 2CL7X 1XIVA 3MILA 1YUMA 2GEKA 1WP4A 3GLRA 2Q1WA 2YXNA 5K0SA 4GMHA 3CGWA 3TQTA 1RPTA 3IBTA 2OBMA 1Y7PA 1J25A 1X1SA 3V4ZA 4GDFA 1UXIA 2N1BA 4IHJA 1OXKB 1E7WA 2YZKA 5FO1A 1P5FA 4HGZA 2AG1A 3GNLA 2HUPA 2XR1A 4M9QA 3NIDB 3LBAA 2AX3A 4S3MA 1YGYA 3LVFO 1R5BA 3BVPA 4HB3A 4UEOA 3WDKA 4ACAA 1GUYA 1Y3CE 3WYAA 2PUAA 2B20A 1P1IA 3QELB 4C4TA 1J23A 5JARA 1G2IA 1YE5A 4ETIA 5JMTA 1W581 4M9RA 4R7GA 4ZWNA 3TIFA 5DIZA 4HQKA 2ZSAA 4N8DA 4TRNA 1FP4B 4UASA 3WV4A 1M5TA 4P38A 1QYDA 4B43A 2ZP1A 2B37A 3Q1LA 4KX3A 4C7OB 3K9NA 3FRIA 5AKZA 3GDFA 2OL4A 1GPYA 1Y63A 2Z3ZA 1E2JA 2GBFA 4A8JC 4E5UA 3UMYA 4ZI3A 3W8RA 3C8HA 5CH5A 1CVRA 1E1KA 4R9NA 1NUAA 1SEVA 1M33A 2DUJA 2WICA 4GRAA 5EXEA 3U7JA 3A9VA 2QE7A 3PUIA 3KPVA 2VK1A 3KD3A 4AMBA 4Q3BA 3VUFA 3ET5A 3ZW8A 1S5PA 4FBMA 4RHCA 4LWPA 3UJ3X 1PV1A 3O3MB 4AMGA 4RULA 2HZBA 1L5HA 3LPLA 2VAWA 4WOPA 4QAJA 1C0LA 1C0IA 3P94A 2J09A 4G4SP 2XTJA 4K9NA 3RTGA 4BMPB 1M7HA 4C7KA 4CM4A 1W36D 4JKOA 4DA9A 3MTAA 4D0SA 4OQLA 3U39A 4Z49A 3NCHA 4QAQA 1LGYA 3FCUB 5FJIA 3L8CA 2HPVA 5LOVF 1EI9A 5IK2A 3H87A 4EBFA 4KQMA 5A4IS 5IARA 2ZB3A 3MLAA 3AEKA 1NQ5A 3SOZA 3WXMA 2V4MA 1AGNA 3GJ7A 4QDUA 4DTIA 3HP7A 1QM5A 5BURA 3LLCA 5L4LA 4CXMA 1QIJA 3EUEA 9GPBA 4FZRA 1IZ8A 2H1HA 5LC1A 1LSOA 4CEIB 2G70A 1ZSNA 2PXAA 1X7GA 4BBJA 3WZLA 1POWA 3U9SA 2ZAYA 4HEJA 1JQJC 5CYPA 4H7IA 2PZGA 3BF7A 1YMVA 4PINA 3BB4A 4QGHA 5GOTA 5B6IA 1XAIA 3ZQJA 4CT5A 3LPDA 3T95A 4KWTA 3ZJ4A 2LE0A 1D1PA 1V1RB 2QGFA 4F5EA 2P27A 3GWGA 4CKWB 2QX7A 5B7QA 2F8SA 5B3JA 4D4KA 1PNRA 3AV3A 1UC4B 2QT0A 3EXG2 2IODA 1QLJA 2HEGA 2IIQA 3L7BA 1M6NA 2UUBB 4JAVC 5IAKA 1I7SB 2IXFA 2MTBA 3FHLA 4YT2A 4DV4B 4RSMA 1DQNA 1IM5A 1QP7A 2A35A 2LIPA 1TQ8A 1DTEA 1LPOA 2O3SA 4KQEA 2ZU6A 4CL0A 3TSZA 2RBGA 4D3XA 4YAJA 2RH5A 3BCRA 4KQ9A 2XOKA 4AI6A 1Z74A 4LJ4A 4M55A 2ZQ5A 2JLZA 2CNOA 3KPUA 4C3OB 4RY2A 3MQ4A 4AWBA 2Q3CA 1Y1SA 2J07A 3NRCA 1NBMD 4B80A 2R1TB 4BO9A 4RS3A 1RXCA 5EMMA 1QH8A 3OEEA 3VU9B 4ABYA 4ZMRA 3ZE8A 2OENG 1M5UA 1UIMA 1AZLA 2VDMB 3K5HA 1KL7A 4KFUA 5ICCA 1YI0A 4PSVA 4I5DA 5U4XA 5KDOA 3BL6A 3N0WA 7GPBA 1L4FA 3JQCA 4PLCA 3OQPA 4G67A 3TSYA 1NC1A 2I3AA 4HC4A 4XX0A 2DG2A 1WWKA 1YVUA 1Z45A 1M3SA 5HKLA 3DWGA 4C4ZA 4DREA 5I7SA 3OCYA 4RL4A 5C37A 1G8FA 2H9IA 1E18A 3GIWA 5LQMA 4XDGA 4OUDB 3ETNA 4IEIA 3PUJA 4BX9A 4CKEB 2HMTA 2J0VA 3R3VA 2H18A 2IPLA 4R8RA 5BYKA 1YQUA 2XHZA 3ESYA 3R0ZA 1Y9DA 2ZDHA 2NZUG 4FSDA 4JYBA 5JW6A 2UUAB 4J4BA 4K9QA 4HFNA 1GL3A 1Z5ZA 4NBVA 2ZBRA 4OB8A 4O4LB 3VSBA 3M6IA 4MQFB 4D9CA 3SVTA 2FPGA 2VPZA 1ZRNA 4URHA 3BGIA 3VVMA 4MRNA 4ZVVA 4BO2A 2JHAA 4HDOB 1U0FA 1C3VA 4Z7OB 1EUYA 4U5QA 6CHYA 3H2GA 4ARZB 1BE1A 4TTJA 1X1BA 3Q3VA 3WMRA 4JJFA 1JKMA 4EGFA 1IG3A 2HSDA 2AXNA 4MWGA 2XKJE 2I4LA 2C92A 2Q46A 1KQNA 4ZOLA 3PFNA 4JCCA 3FDZA 3GJSA 4HGOA 1Z4IA 2TMKA 1GPAA 5LBIA 3QBTA 3BX1A 2BLNA 5EKTA 4FYHA 5FPSA 3FCCA 5ILQA 5A05A 4DRXA 2D0DA 2FR8A 4N5IX 4RIIA 2UYQA 4UMFA 5K8LA 2XMPA 4RAOA 5EG5A 2QF7A 4PQFA 4PYJA 5JSZB 4OQFA 4JYCA 3EVZA 3O4GA 4RPLA 5FI1B 3QEKA 2MINA 1NFQA 1WDKA 3CVOA 3D6NB 3ZZMA 1H2AS 3BMOB 3LK7A 4E5KA 4PC3A 4TWZA 5DIFA 1XTIA 3SF8A 4NIMA 5F73A 4JB0A 1ZFNA 1UJBA 3MCTA 5BR8B 1XR3A 1LPBB 2AOTB 3IUQA 4JLWA 4B0PA 2OXFA 1Z38A 2YCBA 3FRHA 3V7NA 2CBZA 4DJEC 4DL9A 2BGNA 1KERA 3OC6A 2R8YA 1G5FA 4LOKA 5IK2D 3O2NA 1RWOA 4BMOB 2XCOA 1EWQA 4ZCPA 2IHVA 2W2QA 4LDJA 1WOMA 4EPYA 1XDWA 4L8VA 2Y77A 1WJGA 1ZOPA 1EG2A 4BBZA 5B64A 2XE6A 1NUQA 3BIXA 2XRYA 3L4JA 2IOHA 1GOTA 1XU4A 4N0PA 4WOBA 4CG3A 4INPA 3QP9A 3GGGA 4KGXA 5F2EA 1T29A 1KI3A 4OMFG 4BNUA 5IFLA 1EDOA 2Q5JA 1JYFA 3VH4A 4ER7A 3RCBA 3F7TA 2OFXA 3CZMA 4RV9A 4S1WA 3R3UA 5J9FA 3GH3A 4CKBA 3KLMX 2PJDA 3RJ9A 1T0HB 4MR7A 1BU8A 5AICA 2HIAA 3KSUA 3TLGB 3ZI4A 4ZVMA 3E9DA 3MUFA 4DTCA 2O5EA 2XGJA 2C29D 4H1WA 1RVDA 2XOKD 3B52X 3N05A 3QVVA 4KU4A 4UVEA 1YT5A 1FNDA 1R6AA 1Z2EA 2ADFA 2FW6A 1RCFA 2IK8A 1U9JA 4P31A 3FF1A 5K3FA 2PG3A 3WRVA 3H7IA 3SC4A 3LQKA 2R4QA 3B6EA 1THTA 4IIGA 2H17A 2C7RA 4FCCA 3GGOA 4QPZA 4QVKA 4Q1CA 5DHAA 1MMFB 3F90A 3KKZA 1UKVY 4X54A 4G8JA 2EW2A 4E14A 2QTBA 3B82A 3D8SA 3KS9A 3T7TA 1BCSB 3K09A 5AKKA 2GJAA 2X5XA 1XJWA 3RFUA 1M34B 3EXG1 4HYQA 4ZAZA 1S1MA 3TXYA 3W5HA 2XVZA 2V7EA 3RS9A 3ESAA 1KI8A 4AZ3B 2PL9A 4Z4IA 1E8NA 2YXLA 3VR1A 2DHRA 1D3AA 5DBIA 3NCTA 2V96A 2XJ4A 2B8TA 5GJBA 1RQPA 5A3SA 4ZI7A 4LFBB 4XD7D 5BW6B 3ZZUA 4F6RA 1WBJB 3LFUA 3BJMA 1CS0B 1UFRA 2PFKA 3DV9A 3U2QA 1B73A 3UUEA 4BFUA 4BV8A 1RDFA 1J5PA 5K3SA 1PGQA 3LUJA 2YY6A 4HAZA 1ECFA 1JDTA 3I12A 2DFKB 3BJEA 2OP1A 4C7VA 4GVLA 1WQ1R 4YUVA 3B70A 4EMBA 2Z2XA 4E21A 1HF3A 3EXEA 2WLTA 5FBKA 3TRJA 3OQBA 5C7OO 4J16A 4IDEA 1S4MA 4KK4A 3D4LA 4LXQA 2EWMA 4YDHB 3UUGA 4XRRA 5EJ6A 3NM6B 2BSQA 3PNQA 1GPKA 1OZAA 3IEUA 3HB9A 4O4JF 3WBFA 3P5BA 3NV9A 4KIWA 3HUEA 5F1PA 2V0GA 3HB0A 1U1IA 1QJ4A 3UJ8A 4G0VA 1SC4A 2Y1WA 5LXTF 1RYBA 3BFVA 2DUMA 4UATA 1XQWA 1W49A 1T36A 1YRQA 1WLSA 1JKXA 5E2BA 4B46A 1K9SA 4FQ8A 5A6SA 1JIIA 5DHQA 5BR1A 1YJXA 2I80A 1E4OA 4K2HA 4UUAA 1PT9A 3GN2A 4J43A 4IDDA 3VPGA 1T3LA 1IWPB 3PFGA 3V1NA 2CKDA 4ENTA 1GTRA 4LZOA 3TBKA 2QTVA 4FZ3A 5K05A 2Q2QA 1T24A 1YH3A 2OCXA 2R1VB 3MS7A 4MUHA 3ZWXA 3NEJA 3UJ7A 2D0IA 2D8MA 4RV4A 3IL2A 2XGGA 1Q0ZA 3SKVA 2WKPA 2PBZA 1U8XX 2IIPA 1J9EA 1ADGA 2G0TA 3HKEB 4TXJA 2Z8XA 3D7KA 1NP3A 3FYTA 2DVMA 3GRUA 3T5TA 4CFSA 4CEHB 4NFSA 1M8GA 1DJLA 1CUGA 2YNMD 4GQAA 1EFPB 5HRAA 3SR3A 4HN4B 1FSSA 2VJLA 3Q8KA 3AUUA 4KQ2A 3X0DA 1A69A 3DE0X 3SPXA 5KINB 4O1IA 1MJNA 4HPJB 2FPPB 3ZR4B 3B51X 1WBDA 1KK2A 2YIMA 2BVNA 3FMFA 4Y1FA 2ZR7A 2BHRA 4MYSA 3AY7A 3WNQA 3IV6A 2Q6VA 5ESWA 2QN9A 3IDQA 1JVBA 3DTYA 3Q11A 5GADl 5U1PA 4BNFA 3JQ8B 2G17A 5IKPA 1WSBA 1N2HA 4ER5A 3IHWA 4X6UA 2YMPA 3I9FA 4TVSA 3QA3E 3BMQA 4DR2B 2OD2A 5K3FB 4RTOA 2WJ3A 2ASEA 4Q3NA 4RTLA 1AK1A 2JBAA 2Q6IA 3JASA 3BMXA 4XB1A 2XV1A 4LZPA 1KO7A 1QQTA 1XPJA 3VUEA 3FWZA 1DKOA 3H2SA 3QKRB 1FQJA 2NT3A 2ZTLA 5F9FA 2JVKA 1HLGA 3KDAA 4KKXB 5IAAA 3IV9A 3NHRA 1KVRA 3A9RA 5ES3A 5C1OA 1R4ZA 2Q2NA 3GNTA 1MVLA 1OTXA 3GZ4A 5MF6A 4DSUA 1XC7A 2XY4A 4AY4A 1BFDA 3PXCX 4B7XA 3F67A 1L5FA 5AK6A 1GRQA 3AG5A 4I1YA 1QX3A 2G06A 1PP4A 1YDGA 1KMQA 4A8HA 3SSMA 1EVJA 3EVEA 3PKZA 5JNLA 4JBLA 5KAMA 2O2IA 1ZJ5A 1EFTA 4ZIRB 4W5HA 4KHPB 4R1PA 5F4ZA 1IOLA 5GZ3A 1LLDA 1GNTA 1XAJA 1AUPA 2IDKA 1HG0A 1BS2A 4G4JA 4K05A 5EUQB 1OA1A 4AULA 3TW4A 5EHIA 5ALFA 4RSHA 4PF1A 2ZRHA 1NXVA 3LLMA 3LX4A 1QIEA 4XD7A 2EWWA 3M9XA 3GT7A 4LE0A 4ZQHA 3U7IA 3L5OA 2FQYA 2IZ5A 2JFHA 2JGDA 3G1WA 4ILEA 4HXGA 4Q3AA 3TBFA 1G38A 4BVAA 4ZVNA 1UJCA 5DEOA 1FVHA 3NUGA 1QORA 4NQZA 4G9BA 3RVQA 3BICA 1RPZA 5EUMA 3A7EA 1JWBB 2FPPA 4K9RA 4UARA 2XT9A 4DMUB 5KOJB 2E1PA 4Z9YA 1BA3A 1T4BA 1VLQA 2OV4A 2AK2A 2YXDA 3CLTC 2QRKA 1N6OA 1P2TA 3NLLA 4JP3A 4EENA 4DZZA 4EPXA 1MZPA 2O3JA 3WGKA 1X0VA 4BZZA 3ZVKA 4W5RA 5CLLA 3ISTA 1VL0A 1XWWA 1X15A 3NW9A 4UBNA 5NLLA 4HO1X 3TCXB 2IY8A 1YQXA 4HS9A 4W8OA 2DULA 3F74A 1J4AA 4TN5A 3J81k 2X40A 4UREA 3PJRA 3KR0A 3C3EA 1DXOA 1M2OA 1GTSA 4OHPA 2XADA 2BTOA 3V4PB 3BSFA 1M6YA 2CNWA 2KYRA 4PHHA 1P1FA 4U3JA 4E0BA 1GU0A 1NURA 3EUAA 4DLRA 3GLGA 4F8EA 3GJXC 3QEMA 3LA8A 1RKVA 3G88A 4Y6OA 4EY4A 1GGJA 4C6TA 2YW9A 3SICE 1ZCJA 3MGAA 4HSEA 4JYPA 4AUMA 2HMVA 1KYQA 4F2DA 3S29A 1UMBA 4A0GA 3UENA 3I76A 4P32A 6REQB 2BGUA 3KKNA 3SQXA 1E3LA 2JHFA 2BF7A 4LRSB 1QUFA 2H7XA 1YCDA 1R12A 4EW1A 1NJ2A 1IBCA 3MFQA 3WWCA 2JVJA 4MUYA 2YY7A 4CN9A 4TKUA 5K0NA 2H8GA 2YNMA 3KAPA 3AUAA 5I7RA 4C2AA 2FWIA 4RIGA 3NOVA 1KXZA 1RKBA 1F0KA 3P1JA 3JVEA 2X1LA 5FEUA 1B6RA 1P1KA 2WD7A 4YHBA 3OCZA 5GZ1A 1B6SA 1NZDA 4FJ1A 1PWEA 4PNPA 3CVJA 1RRVA 4RJLA 2H2FA 3QVOA 4AS2A 3QITA 1CXZA 3VAYA 3NIFB 5TS3A 3ZS9A 1O89A 2W7TA 1WUHS 4KH1A 3L3BA 3QG1A 4D9GA 5HRCA 2LDBA 1HWYA 5JASA 3P4UA 1FYXA 2QEQA 3DV0B 3Q7IA 1Y5RA 4NJMA 3W8EA 3HCOA 4X1YA 2DWCA 2VP3A 1Z0FA 3DL0A 1JIKA 4PZYA 3TMAA 4CE6A 3VPDA 2C2YA 2G7ZA 3W4JA 3T35A 4QUIA 3WOVA 4JBIA 3LBIA 2XIJA 1U2EA 2KWIA 3DM9B 3H75A 2O1WA 2QPOA 1F2VA 4ENVA 2QB5A 4UBKA 3TN7A 4NF2A 1G42A 3VNBA 4DCJA 5ITVA 3G9QA 5J1SB 2OKCA 2EC5A 3UHOA 3L4BA 2CNKA 4MARA 3IALA 1S2DA 3PQEA 4HWGA 3ACBA 3WWZA 1SU7A 1JG4A 1OYOA 2W22A 1L7EA 4HWPA 1GPBA 1QR2A 3NX4A 4J76A 3DD1A 3LOPA 5EEGA 3FPAA 1K68A 5BN5B 5FR1A 3VZDA 2PZFA 2OHJA 4GZ6A 4WZBB 4OJTA 3VSAA 2F4NA 3V32A 2FWPA 3D3WB 4N6NA 3WIUA 5LD2C 3IAS1 5ER6A 3FGZA 3GRCA 5CAEB 1E6LA 4ZV9A 2RB4A 1HSZA 2CFOA 4C7JA 3R7WA 4YAIA 1QDLB 2QBYB 5JD5A 5HCIA 3H13A 3ZUGA 2HLPA 4R84A 3PF8A 2HLDD 1IEQA 4N65A 2BC9A 4NU8X 5I9BA 3AFOA 3THRA 1JNYA 4F12A 3GUCA 1SB8A 1FFXA 1XKQA 1Q0QA 3EQ9A 4W7IA 3DB2A 1DB3A 1TU4A 1HH4A 3N2ZB 4AUEA 3N2IA 2GRUA 2Z4SA 4J0EA 2VJBA 4HRVA 3L8GA 1Z7EA 4UUPA 4RORA 1CW2B 1ESDA 4OP1A 5JNRA 2ZIEA 4OJYA 4OK3A 3UZUA 3WKAA 3Q6IA 4G97A 3ZNPA 3IB3A 3R0VA 3UFBA 5LA6A 3ETEA 2ID7A 3V8NA 3HY3A 1NI4B 5LIRA 3VKGA 4J2OA 4OYYA 1W46A 5ELLA 2Q3BA 2DERA 1O4WA