5L3QB

Structure of the gtpase heterodimer of human srp54 and sralpha
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
307
structure length
307
Chain Sequence
SLSREDMESVLDKMRDHLIAKNVAADIAVQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYVVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEKHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLITVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAAISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 110
structure length 307
sequence length 307
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00448 SRP54 SRP54-type protein, GTPase domain
B PF02881 SRP54_N SRP54-type protein, helical bundle domain
B PF04086 SRP-alpha_N Signal recognition particle, alpha subunit, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3qB02
1JQLB 4IDHA 5DYGA 2FSHA 1XU4A 3VU9A 1F5NA 5E4FA 1GRQA 1ZW6A 5JEDA 2RKOA 4LX0A 2FGKA 4ESVA 3MGCA 1Z28A 1E2MA 1IN7A 2ERYA 1ELOA 3H4MA 2WKRA 3A37A 2BOVA 2YC4C 5B30A 4LYFA 3SOPA 3BERA 3EIQA 2OFWA 3KKMA 3LDAA 1Y3AA 2VF8A 2ZRCA 4FIDA 1Z63A 4QGAA 3OF5A 1I2DA 5FUXA 1RKBA 1P2VA 3B2EA 1SVOA 1KK2A 1U8AA 3V00A 4LGMA 3REGA 1RJ9A 3A1UA 1QRAA 1XDBA 1OYYA 2VSOA 4KFRA 1UKYA 4LYAA 2RGEA 3KJGA 4B71A 1NJGA 1OFTA 2Q9AA 2WV9A 3LXXA 1FW6A 2PBRA 2V54A 5JWRA 3W9YA 1F2TA 2XB2A 2BBOA 2PX3A 3ECCA 1SHKA 1TU4A 4CEJA 5L3SA 3LVRE 1CR0A 2ZS7A 4ZV4A 1G291 1U0HC 3VQTA 1ANKA 3RSOA 4K46A 5J40A 1YZKA 3AVOA 2ZYVX 4OQMA 4B48A 1G7TA 2WPDA 1M34E 4IVQA 4OL0A 1JJVA 2AN9A 3U3MA 4TWZA 2IEZA 1WCV1 2QP9X 3IHWA 3MWYW 4WZBE 3GLFA 3NWJA 3QKTA 4WXPA 3JZAA 2ZRFA 2CNWD 1EWQA 4AKGA 4Y0VA 1G3QA 2H92A 4JBWA 1UBGA 2ZSBA 4LY6A 2XXAB 4JLJA 4LHZA 4Q4HB 2G77B 4WVFA 1F3OA 4ZIRB 1FUUA 4FN5A 2JJ1D 3CPJB 2OEPA 4RZUA 4B44A 4DLWA 2C9YA 4Y0AA 2IXFA 3KTAB 3V4FA 1JNYA 5LB2A 2VP4A 3U3JA 1ZNWA 5LPNA 4FMCF 3ZD6A 2QQEA 2FSGA 4KFSA 1AKEA 3QVVA 4TMXA 2IYLD 4GPTA 3IPXA 5HTKA 4DLYA 2ZUCA 4TSFD 1G5TA 4PC2A 2GK7A 4BQSA 1CF4A 1Z2CA 1TPZA 5IK2D 3T15A 1FTSA 3EC2A 4FINA 4OHXA 2ZE8A 3HU2A 2HDNB 3C4JA 3AVWA 2GJSA 1G5PA 1OB2A 2VL7A 1EGAA 2Z5FA 2XNDA 1FP7A 1M74A 3QF4B 5CIQA 5DIFA 1DS6A 2JEOA 4RZ3A 2WKQA 4EQ6B 2GCPA 3ND8A 2V4ZA 2R6FA 1KI2A 2FFQA 4HUQA 5JSZB 1GZSA 4XOIA 1YU9A 4F92B 1KZ7B 2BMEA 4Q66C 3L8YA 3LVQE 3QKRB 3X1YA 1Z08A 4BECA 3MJRA 1R8QA 4JBYA 2A7QA 4L9SA 3SR0A 1HT2E 1QDEA 2XB4A 4C0QC 6Q21A 1S96A 1Q3HA 2GEVA 2QAGA 4DJTA 2X8AA 3RRYA 3U3KA 3RYTC 2CLDX 1QHHA 1OIVA 2XTZA 1SKYB 5FOUA 4B35A 4KXFB 1NKSA 3NHAA 1U9IC 2BEJA 4WW0A 2JASA 4JVNA 4QHYA 2LKCA 4I81A 1A2KC 2LKDA 1N0UA 2JJ2D 1N6OA 1K5GA 2VHJA 3A36A 1YR9A 2WWYA 2AD1A 5FBRB 2PCLA 1Z6GA 2ZYWX 1Q0UA 1S3GA 4PPQA 4C7OB 1EXMA 2WJHA 3C8UA 5FOWA 3CH5A 2KI5A 2RB4A 2YV5A 5FOSA 2ZJ5A 3U7EB 4QKQA 2AXNA 2ORIA 1S9HA 3IUYA 3U3OA 3G5UA 3ZH9B 2AK3A 1YJ5A 3TQCA 2IYVA 1QBKC 1XNJA 2ORWA 1PUJA 5FTJA 1W2HA 2VEDA 1DAFA 1A5TA 2G1KA 2JLVA 3CBQA 2DB3A 2WJJA 1TQ2A 4RKEA 4N0EA 2QBYA 2J59A 4R2IA 2BBTA 4XSGA 4TMZA 4NYIQ 3MG9A 5HE9A 1W47A 3Q9LA 4M8NE 4Q4LA 2FZLA 4O2LA 3U5ZB 3BC1A 2Q9BA 2VF7A 4HLUA 3THYA 4I1UA 4H9GA 2WTUA 4OQNA 4BFWA 4BLSA 2WWWA 2ZPTX 2C8VA 4L4UA 4S2EA 2O52A 3F3YA 2IHYA 1A82A 4NYMQ 5CLLA 3B1YA 1KI6B 5P21A 1K5DA 1MABB 3O8CA 3E5HA 3K09C 3A1TA 2WVJA 4ZI3A 1AN0A 4BUJA 4MDEA 2V7QA 4M4SA 4B3CA 2JLQA 4JSTA 4M22A 5AK0A 1Z0FA 1NY6A 1CU1A 2OCBA 2QPAA 1E6CA 1Z0AA 3WMGA 2JA1A 4DSTA 2W2XA 1OB5A 1W0KD 3DM5A 2BBSA 5BN4A 3GP8A 2D3WA 4TL7A 1U81A 2D74A 1KY2A 3Q5DA 2XGJA 4JLMA 4FCTA 3WMFA 5C2JB 1TU3A 2ZRHA 1XD2B 3R20A 4GMDA 1F2UB 5HCNA 1V43A 1XD8A 3K70C 1ZJ6A 1ZUIA 4MGZR 4F93B 2CLSA 2QE7D 2P6RA 5J4YA 5G3ZA 3OHMA 3EW9A 2QUZA 3NEJA 3OEHA 1LV7A 2XJ4A 2P0EA 3OAAA 2C98A 1E2EA 1W46A 5JMTA 1GL6A 5EE5B 1S4QA 1ZP6A 2WSSA 3T06B 1XMVA 3FVQA 3TLXA 2HEIA 2HYIC 3RS2A 2V8OA 1Z6XA 4M9SA 2ZSEA 5C4MA 3DHWC 5HPYB 3X2SA 1W7AA 1CJUC 1DEKA 1HV8A 2H5EA 4B3XA 4RFSA 4O3MA 3N70A 2ZXUA 1J8MF 2AWOA 1TNDA 4PHHA 2IT1A 2ORVA 3QKSA 1NL3A 4IEEA 4B47A 4BEBA 4TZ6A 5CYOA 4DCNA 1IN6A 5KUTA 4MKHA 4B3GA 1UBCA 4CF7A 5BQ5A 1N6LA 4V0KA 5B57C 4WAUA 2GETA 2H8KA 2ZYTX 3GLHB 3L8ZA 1PLLA 4G3XA 5EUMA 4ZCIA 1KDRA 1DAHA 4BFTA 4UXHA 4P33A 1Q1ZA 1OJLA 1KJZA 3QY0A 3TSZA 2QM7A 3CRVA 3DPUA 3HR7A 4A0GA 3SQXA 3ND9A 1E0AA 4GP7A 1ZC4A 2EFDB 3RWOA 2ZEJA 3TUJC 421PA 1QHGA 2C04A 4DUGA 1RYHA 3LH5A 2J7PA 2QP4A 1Z83A 1QHXA 3CLVA 4V0NA 4Q9IA 1BMFA 4JKIA 1J70A 4HEJA 4XTCS 3R7WA 2EU8A 4W5WA 3CH4B 3DMNA 1TX4B 4MRNA 2Q3MA 2ZVPX 1M8PA 3AM1A 1L7VC 1ZINA 1R0XA 3ZIAA 1EFRD 3OE7A 4ESHA 1E2JA 1AGRA 4LHVA 4OJKA 4JYBA 4NYJQ 2YINC 2YWEA 3LA6A 3CF0A 1ZBDA 1HT1E 3OEEA 1WXQA 3WHKA 4CDGA 2IS6A 4CEIA 1E2IA 2J0VA 3H1TA 4TMKA 5EP3A 4IFEA 1G7CA 2RGCA 1KK3A 5AWFC 4WIAA 3AUXA 3QVUA 4L16A 4HB3A 3GJ8A 3HWSA 3QUSA 2F43A 4AYWA 4TL9A 2WM9B 5H8WA 5L3QB 5KOYA 4Q03A 1E2QA 3CX6A 2W6JA 5A0FA 3K0EA 5GJWC 2VSXA 1D5CA 3AKDA 2PMDA 3QOFA 4N1AA 5FR2A 1GM5A 4NU0A 3FYHA 1R5OA 1GG2A 5FPTA 4JLAA 1IBRA 3D7MA 3AVUA 1BOFA 4I1SA 2GRJA 4D80A 5JJKA 3Q7QA 1NI3A 4WOPA 4OI0A 3D3QA 2RCNA 5LDDC 1U9IA 2QI9C 4ZCMA 1WRBA 4LV5B 3I73A 1XJCA 3NHBA 4BFUA 4Q1BA 1G8YA 3O8RA 1GP2A 1Y63A 4IOKA 2ZR7A 4LBYA 4W9MC 1WE2A 3UG7A 4FWTA 2CCGA 2DWQA 4NCHA 3N2IA 2FEMA 1N5LA 2XTNA 4P32A 3NDBB 2ZR0A 3P32A 4TTQA 3ZZTA 2F7SA 1OXSC 1SZPA 1K6MA 2FMXA 3Q5EA 2ZUBA 3VTKA 2VHUA 3S1AB 4EFLA 2ZRJA 3QPWA 3SJZA 4BZXA 3W6PA 4AY2A 4C4PA 2PT7A 4PPNA 4RD4A 1WDTA 4MYUA 3DM9B 1XTKA 4TQ9A 5KDDA 1NVVR 2CDNA 2DWOA 1ZRHA 4OBEA 1G8GA 1GRNA 2NG1A 3HU3A 4JT4A 2QQ0A 1V5WA 3GLHE 2VP5A 1NVUQ 4A92A 4YMTA 4LC0A 1UM8A 3DKVA 3DZDA 2ZI7A 5D3QA 2OILA 1FNNA 2QSZA 2F3TA 1N6NA 3T1TA 3W3ZB 4PR0A 4IRUB 4P31A 5KDLA 1Z22A 3VNUA 2CE2X 2R44A 1OSNA 1P6XA 4OK5A 2PZGA 1AJEA 1Q3TA 2ATVA 4D2IA 2VH5R 4EPVA 4R2HA 1MR3F 3U7HB 1WP9A 4ILEA 4B3DA 3WXMA 3I92A 4EDHA 4DLRA 2FDCA 5KSPA 4KVGA 1XTSA 4LPSA 2FV8A 8OHMA 4M1KA 4MGIR 3VR1A 4B3FX 3I5YA 4PAMA 2GKSA 1LFDB 1E0JA 4KFUA 3D6TB 3VKHA 2D7CA 1GFIA 3ZGXA 2DR3A 1COWD 1FMJA 1VYVA 4LOAA 4Q02A 1IAQA 3R9WA 3JVUA 2R6GA 2NTYC 1F60A 2QMEA 2LCFA 2J45A 4F4CA 1WB9A 2KJQA 3CB4A 3NTUA 2GCOB 3U7FB 5B2ZA 4CEHA 5DI3A 5FBQB 2NQ2C 2ZS8A 5CDFE 5JLJA 3FKQA 4D82A 2IWRA 5KHOC 1KI1A 1Q22A 2ZI5A 2HLDA 2O8DB 1EFHA 3KJHA 3PIRA 5GJBA 4DT1B 4ZI2A 3KXLA 1S3SA 2ZE6A 4UKDA 3CR7A 1GDDA 5IT5A 4TYPA 1OFUX 2QTFA 2GBLC 1TQ6A 2OCPA 1X6VA 4M9XA 5J47A 1Z2AA 4JL5A 3W90A 1U2RA 2ZI9A 3HDTA 4GZMA 3M6AA 4ABYA 3QNUA 1XD9A 2YNMA 2HCJB 1LF5A 1P2TA 1RC8A 4K81B 4ZDKA 5A4JA 1RZ3A 1M7GA 1A2BA 2D2FA 3EA0A 4LSGA 1PVOA 3AF2A 2DYKA 3ZJYA 2XOKA 4BEJA 4GFDA 3VR6A 1LB1B 4JS0A 1U8YA 3P4XA 2YHSA 5EE1A 4NCJA 5ANRB 4UJ5A 1JALA 4UNSA 2P5SA 5EP2A 2QPTA 4NP6A 3MWLA 4LRWA 1E32A 1VG8A 4HB0A 2JLUA 4CVNA 3PFIA 1E2LA 4EUNA 2ASEA 2H16A 2IXEA 4E09A 4BPBA 4HUTA 2ZS9A 1KO7A 1QF9A 4OHVA 5FL7D 4DEXA 3BBPA 3ASZA 1UFQA 3VAAA 1PV4A 5IDVA 1CRPA 3R9XA 1RW4A 1OH5A 4QJ3A 2VRWA 4V0OA 3LY5A 4PSVA 1EX6A 4EPWA 2AD5A 4A1FA 3UWKA 1R8SA 2EQBA 1KJYA 1O87A 3ZLJA 3QXJA 1VIYA 1U94A 2W0SA 1R0YA 1KZGB 2QAGC 4IDOA 4YONB 2J9RA 3W6NA 1E1QA 1N6IA 3PEUA 2JCSA 3EZ7A 2BWJA 1B23P 1K8RA 1UJ2A 3LLMA 3D31A 4Z1MA 3OIWA 2CL6X 2MSEB 3CPHA 2JATA 1LY1A 4YXWA 2XXAA 1E1RA 2R6AA 2CHQA 4PC3A 3TSWA 4AYXA 1TEVA 4QGGA 2ZJZA 1P2UA 2X77A 4B6EA 1YVDA 2RGXA 4ZIRA 2BVNA 2NIPA 5FOVA 2VIIA 2MMCA 1RVDA 3CRW1 2UKDA 1G19A 2GJ8A 3GJ4A 4DEYA 3KTAA 5A5GA 3IO3A 2ERXA 4F4IA 3KQNA 1UADA 4MYHA 1H8ED 3CZQA 2K5UA 1S0UA 1OE0A 1YZGA 5GADl 3THXA 2WHXA 1X86B 1J8YF 2ZAMA 1E9BA 3W5IA 5UKDA 3FKSA 4MUAA 3RS7A 2BJVA 3GFTA 4IVPA 1HH4A 4IVRA 821PA 3KQUA 5JRJA 1HE1C 1LNZA 1YR6A 4XD7A 3QF4A 4XH9B 1T3SA 2ZI3A 1NN5A 1G1MA 1G7RA 1E4VA 1E96A 2I1QA 3GQBA 4M1YA 4D0NA 5FH9A 4JLOA 2A5YB 1YZLA 3I8SA 3QKRA 1XMJA 3TAHA 3WNDA 4TLEA 1Q44A 1NN3A 4TYNA 2IEYA 1LF0A 2P5TB 3AKEA 1VMAA 1DVRA 2DFNA 4WZAE 2ATXA 4IOMA 1UKZA 4Q7LA 3NBYC 3B7GA 1SXJD 3X1DA 4HATA 3FMIA 2OZEA 1NVWQ 2CE7A 5TXGA 1VCOA 5AUNB 3VR3A 5CM8B 4A8JB 3P26A 4DBLC 3PUVA 2GK6A 4PQFA 2QMOA 1G41A 3B85A 3FTQA 1E69A 4Q18A 3WNCA 2GXUA 3JZMA 4J0QA 2QAJA 1GNRA 2VP2A 1W4BA 2G3YA 3UPUA 1CR2A 4QNMA 4C7OA 2IYTA 3QBVA 1Q1EA 4GP6A 1HEIA 4I4LA 3BH0A 2B92A 3O8DA 3RS5A 5JRZA 4A0HA 3NBZC 1R0WA 3T5GA 1KNXA 2VTKA 2ZJOA 1AS0A 2WWFA 1OKKA 1PJRA 4RD3A 5BWMA 1Z6YA 2Q3HA 4P4TA 2ODEA 2ZJYA 2ZITA 4MH0R 2ZRDA 5CK5A 1TTTA 2ZJBA 5C4GB 3F0TA 2QTVB 3GJ7A 3X1ZA 1EG7A 3IQXA 1CXZA 2AWNA 1KMHB 5FPHA 3UATA 5AJYA 3EPHA 3L82B 3TUIC 1VYTA 1SQ5A 2QNRA 2YOGA 1IQPA 3MUFA 1KO1A 1MO3A 3KQKA 3C16C 3U6BA 4Q9KA 1I2MA 2R8RA 2R6CA 1TEXA 3FMOB 4FWIB 3ADBA 1B0UA 1G64A 2IUUA 3PENA 2V6JA 221PA 2FFAA 3QPVA 4A82A 2ANBA 3VFDA 3U4QB 1KI6A 1Q57A 3KX2A 2R65A 4LCBA 4AI6A 4C3ZA 2WIBA 1XEXA 4W5HA 1OV4A 2GJKA 2QEQA 4S35A 1SVLA 4WBSA 1KSHA 2HJGA 4R98A 4HZUB 2WWIA 3A58B 3M1IA 4RJLA 3SC3A 3PQCA 4E03A 4IDQA 3IQWA 4LJAA 2H1LA 5JI3E 5JCZA 2GESA 1ESMA 2JLRA 3DEFA 3CRMA 1II8B 4ASUA 5AJXA 3ZQJA 1XTRA 4GMXA 1T3LA 4Q1CA 1NIPA 2ZI6A 4TT3D 3KKNA 4URXR 2DFTA 1BKDR 1BYIA 4OI2A 1E2FA 1I4DD 3KUDA 4UXIA 1C1YA 2CNWA 3W34A 2XITA 3BJIC 3O47A 4FMDB 5SZKB 4DLVA 2GBLA 4RY2A 4DDTA 3WRXC 1XD2A 1Q21A 2ZI4A 4O25A 4URWR 2OBNA 2V6IA 3WRYC 1F2UA 1YKSA 3OIUA 4BFXA 1KHTA 1JECA 1AK2A 2WJVA 3SBDA 4NYIR 3WYFA 2X1VA 2CCJA 1DTSA 2JJ1A 2GVDC 2XSZD 2GXSA 1G9XA 1FNMA 1G3IA 4QGHA 4B3BA 1KDPA 3N2EA 4BZPA 5GVSA 2GF9A 4C2UA 3FB4A 3PUYA 1NMYA 1XCPA 1UEIA 1Z5ZA 2PZEA 2VLIA 1FMLA 1N3BA 2WWGA 1KIMA 4POAA 4OHZA 3EPLA 4TSFA 2WPDD 5IK2A 1ZAKA 1G21E 2AXPA 5JJLA 3DO6A 1SGWA 4V02A 3LX5A 5KTYA 2IYUA 1XCMA 4M21A 1T91A 1Z6AA 1R6BX 3OFND 1AZTA 1Z06A 2EYQA 4LI0A 1GKUB 1UKVY 4QFMA 1LS1A 5FR1A 2F1IA 4XWAA 1I4TD 2OCAA 2YOFA 4JZKA 4W5JA 3LBNA 1GNPA 4PHFA 3C41J 3W8RA 4G5QA 4OQLA 4RD6A 3GLHA 1W48A 2FX3A 4FD2A 4G5SA 5K8TA 121PA 1NY5A 3AH8A 4P4SB 2OFOA 3AKYA 4XIGS 3PUWA 5EXTA 5JHGB 5K8UA 1SXJB 4LWZA 1T9HA 4LYJA 1U90A 1R2QA 1ZYUA 1Z8FA 1M2OB 3G0HA 1VG0B 4BLTA 2NO0A 3DDCA 1JPNA 2JLYA 2WBLC 2QENA 4CYMA 2FA9A 5CK4A 4G5GA 1II0A 3KFXA 3QI2A 2HCBA 1W1WA 4N0DA 2GILA 2JJ2A 2ZUDA 5EE0A 4FCWA 1GOTA 3P1JA 2RAPA 1OFHA 4BWYA 1XPRA 2OT3B 2NMVA 3PUXA 2CK3A 3A6PC 1IHUA 1N6HA 2Q3FA 4X8HA 4HLDA 4XVQA 3CX7A 2O8BB 2IA5A 2ZRAA 1YHNA 2FGJA 1D9ZA 1QG2A 4IJMA 4LJ9A 4LPKA 2YKGA 2OUKA 3TRFA 5LD2C 1NMZA 1GL9B 1CLUA 4YMWA 4F38A 3I72A 3LXRA 4OK3A 3VR4A 2C96A 3IO5A 4BRWA 3THWB 5CDFA 4DLTA 3K1JA 4UXJA 4ZO4A 2DPXA 1HQYE 2VPPA 4BGDA 3IHLA 4Q47A 1G8HA 3CF2A 2L0XA 3TJZA 3TIFA 2GXQA 3RNLA 5L3QA 5E7JA 1XWIA 3QE0A 3E2IA 4DLSA 2X2FA 4MGKR 5IRCD 2CHVA 2V1XA 4II7A 3NC0C 4QBGB 1W0JD 2G6BA 3MSXA 1NBMD 3B9PA 2QG6A 3GEIA 3K9LA 4QBIA 4RFVA 5DGXA 3TVDA 4BLOA 2IS4A 1XZPA 2O8EB 3KQLA 1G6OA 1QZXA 1JPJA 4PC1A 3TBKA 2YWHA 3KJIA 4HAZA 1CJTC 3EPJA 3ICQB 4RZ2A 4PXAA 1VYUA 5KDOA 3A4MA 2B6HA 2W83A 1NVXQ 1HQCA 3SI7A 1QHSA 2TMKA 3HYRA 4A6XA 1CULC 1OF1A 2VO1A 5H70A 3SJAA 1OXUA 1HE8B 1TF2A 1ZM7A 2YWGA 3N5CA 4QNRA 2REBA 1RJ9B 4NKRA 1JJ7A 5EXSA 4LJ5A 4NYJR 2VHQA 4ARZA 1VKJA 1DO2A 3NBFA 4P3YA 3S1AA 3TQFA 3B60A 3EIHA 4ZPXA 2IS2A 4GI7A 4EKDA 1P9RA 3K8YA 2Z4RA 1H8HA 2QE7A 2FNAA 5JS7A 4I99A 1AZSC 1XZQA 4CEJB 2F6RA 1RRPA 4PO8A 1S9DA 2CJWB 1OH6A 1Z6TA 4B2IA 1R5BA 5TARA 5CYPA 1LTQA 5ELXA 3BORA 3BWDD 3EXAA 2DY1A 1JR3D 4TTRA 3AEZA 2PX0A 1DBSA 1A4RA 3B9QA 3KKQA 1HA3A 1SVMA 2OCYC 4QGFA 2EYUA 2P65A 1P2SA 2YZ2A 4I1OA 2QGNA 4NCKA 5F3WB 3BB1A 3KXIA 4PANA 2ZYUX 4YLGA 4FMDF 2QT0A 3PEYA 5EE3A 3ASYA 2QMHA 4ZDWA 3CR8A 3AV0B 1PZNA 3VHLB 3ZZ0A 1SKYE 3UIEA 3AGQA 1ZD8A 3TAUA 1N0VC 3LV8A 3QIAA 3ICEA 1UBEA 4GNKA 4UJ3A 4D4MA 2J0UB 4G5RA 4K8OA 2IX3A 4C30A 2WKPA 4JJZA 4DKXA 1XF9A 3UANA 4LJ7A 3LFUA 2WWXA 1XX6A 1N6PA 4KO8A 3VR2A 1FZQA 3OEHD 5H1YA 3QF7A 1IM2A 1NJFA 1T5LA 1PLJA 1WBBA 3IBGA 3PVSA 2HJVA 2GCOA 3E1SA 4G01B 4C2TA 2VBCA 3T34A 2WSSD 4C0JA 2GDJA 1OHHD 3WYGA 1I4LD 3SJCA 2IF2A 1E0KA 1P3JA 2B8WA 2PH1A 4AWXA 1MRNA 1MH1A 2O8DA 1VTKA 3EPKA 5J4KA 2BV3A 3KKOA 4LV6A 4QBFA 3BE4A 1NRJB 3ZD7A 2AKYA 2D62A 3RRMA 2BMJA 1JXOA 3AQ4A 4GOKA 5B58C 1U99A 1W44A 2P67A 2YJTD 1XXHB 1ZCAA 3QG5A 2VYFA 3UWOA 3PJRA 1ESNA 3PUZA 1KO8A 4KAXA 3BB4A 1FP6A 2C9OA 3AF4A 1GWNA 2JIZD 3MRSA 4H1VA 3V9PA 4DXAA 3QXHA 4F7WA 2CBZA 2IYXA 1EFRA 3BFXA 3HJNA 4Q9JA 1P73A 1IOZA 4Q4AB 2IYYA 4JLDA 1E9SA 1ZMXA 5FOTA 2ZJAA 3U60B 1P61B 2BEKA 2ZE5A 3GLIB 3F8TA 4B33A 1UPTA 5CJPA 1ODFA 3SEAA 2ZRGA 5M04A 3SYNA 3KL4A 1UDXA 3P27A 5IHPA 3H0KA 2D4HA 4C0HA 1QHIA 3DOFA 3AF0A 2V3CC 1DG1G 3SHFA 1IONA 5BW8A 2SHKA 2PZFA 4V03A 2W6IA 2ZU6A 4DUGD 3FWYA 4TMTA 3PEVA 4Q7MB 1CJVC 1QVRA 2E9SA 2J7PD 1ZU5A 4D81A 2IUTA 1CRQA 1E2PA 4OKSA 3U2QA 4PQRA 1UEJA 3UXMA 4DDWA 2GZDA 5FBVB 3IIMA 2IYWA 2CL7X 3SNHA 1AS2A 2A2ZA 1YQTA 1HUQA 3BGWA 3OE7D 4QL3A 1MO5A 1OPXA 2HT6A 4JLVA 2ZE7A 2ZRLA 2A3RA 1ZVQA 5FPYA 4XWOA 4UNNA 1Q1QA 5F9FA 4MRVA 1EFTA 3A8TA 3RVBA 4Q21A 2QM8A 4XVRA 4HSEA 1BS1A 3LO5A 5L3VA 5TDHA 2REOA 4DDVA 4KYUA 1KAGA 3WBJA 4YMVA 2KBEA 3GLGB 4LHXA 2GEDA 2WICA 2PEYA 2CCKA 3A1VA 4OQFA 1BH2A 4YDSA 5F2EA 3I3SR 4D4JA 1YZUA 3B82A 4PO9A 2RHMA 3EC1A 3KXKA 3AP3A 4PAQA 2EFHB 3HR8A 5JWOA 1XPOA 2ZR9A 2ZQ5A 1W49A 1M6NA 1XEWY 4OQXA 5JI2E 1ZC3A 1YZTA 3R9IA 1US8B 2IS1A 3CNNA 3VHXA 4PHTA 2IUSA 3K0FB 3HYTA 1Z0KA 1T4GA 1NN1A 3NH9A 2WZQA 4QBHA 5TV2A 1F48A 1P60A 1WF3A 2ZSDA 4BLQA 5KNDA 5KPJA 2J46A 4HI0E 5FTNA 1XEWX 3CRQA 4H1UA 1JAHA 4ZKEA 3RANA 3LBIA 3QENA 2C77A 4AD8A 1RFLA 2O0JA 3M0EA 4WZ6A 2IWHA 3SYKA 1G5RA 2B21A 4JLNA 5DE3A 3DOEA 4MKIA 4TLBA 1XXHE 3TR5A 1C4OA 1U8ZA 4JBXA 3LW7A 2P2LA 2V55B 1AGPA 3X1WA 1COWA 1G6HA 1XPUA 1T6NA 4EFNA 1VG1A 2YC2C 5FPSA 3KZ1E 4A9AA 5FTKA 4PSAA 1X8JA 4YQFA 2PJRA 2OHFA 3THOA 3UK6A 3EWAA 2ZM5A 1AQYA 1L2TA 3SFVA 3NIBA 4YC7A 3GJXC 4A8JA 4G1UC 2ZSAA 3IIJA 1SVWA 1FOEB 4TTPA 1NLZA 3OESA 1RPZA 2QGZA 4QXAA 1IY1A 4OHYA 4RFSB 5DLQC 2YVUA 5KSZA 4CZ2A 2OAP1 1FX0B 1AA9A 2XJ9A 1R0ZA 2WAYA 1FL9A 1MOZA 1IXSB 2ZJ8A 3QPUA 4KITB 3ZS9A 4GOJA 1QHNA 3GEEA 2GF0A 1W4RA 5HZKA 1WA5A 4G0NA 2XTMA 5DO9A 1R7RA 2HF8A 1G20E 1NBME 5EP1A 1DG3A 4B6FA 4TL6A 4LYHA 2QPOA 4KHZA 4DZZA 5DHAA 4LHYA 1GL7A 3C5HA 1CBUA 1GTVA 1ZNZA 1E79D 1UBFA 2W2VA 5EQTA 4OI1A 1XRJA 5JECA 2ZROA 2HV8A 3NVAA 3EAQA 2FH5B 1KMHA 3K0AB 4B43A 2IC5A 2O5VA 2UZIR 3CPEA 4Q01A 1LVGA 3ETLA 2FG5A 1N5KA 2XZPA 4OK6A 4V0ME 1CJMA 2JDID 4PC7A 4DB4A 3GLGE 1P72A 2NO1A 4DRZA 1BO6A 1NF3A 3K70D 4DSNA 1W5TA 2AR7A 2WJGA 3IEUA 4O0MA 4PZLA 5HCIA 5CJ2A 3U4QA 621PA 5FUYA 3RS0A 1W4CA 2JGNA 4A0FA 3FHCB 4B73A 1YR7A 3MWKA 3FHTA 3KB1A 2BMFA 1EFCA 1IXRC 2G88A 5FL7A 3AVPA 4E5UA 2F1JA 4HZUA 1J2JA 3IILA 3L0IB 4LJ4A 2KSQA 4HAWA 5J5CA 1JR3E 4DCTA 1R4AA 2A9KA 3LWNA 1E9DA 1R10A 4CEIB 4E07A 1II8A 4TLCA 4O2RA 1SVIA 2MSCB 1ZU4A 1J90A 4DCSA 3SN6A 4EPRA 5JHHB 2FPMA 3EZ6A 1G8PA 5HKKA 4DLUA 3EZFA 2OESA 3Q7PA 4BRUA 4D0LB 1II9A 3WY9A 1E2DA 1JAIA 3QBTA 3CWZA 4KSCA 1ZD1A 2NZJA 4NZYA 2J41A 1KO5A 3E70C 4W7SA 1AQUA 3VR5A 2J87A 4MQBA 3T1QA 4AKEA 4KV9A 3NKVA 3K9NA 3RRNA 4M1WA 2B8TA 2FFBA 2J3EA 4Q4HA 1DAGA 1E9RA 4OYHA 3U44B 3CIOA 1YE8A 3AVYA 1XB2A 3MFYA 2WSMA 2WJYA 2Z43A 2O8CB 1TAGA 4HAVA 2OSBA 3UMRA 3TK1A 4A36A 3EARA 1CIPA 1KSFX 4E22A 3T35A 4URZR 4YMUA 2IHBA 4U02A 2QY9A 1OH7A 1IY0A 3WP0A 2J7KA 5SZJA 3LRPA 5KYKA 1SKQA 1E9FA 2RGDA 1KNQA 1E1QD 3RLFA 1T3HA 3CNLA 3K0CA 3RC3A 3C14C 1Z0IA 1CR1A 3SBEA 1TL7C 3BS4A 3RWMB 2VHTA 4PZZA 2IBMA 4YXWD 3ONWA 5AUPB 2NO9A 4LJYA 3W5JA 4EQ6A 3HP1A 3DMDA 2I3BA 3BK7A 1J7KA 2GZAA 4Q1EA 1XMIA 5JSZA 5CB6A 2FWRA 2E1RA 5DN6D 4EPTA 5L3RA 4BLPA 5FBLB 4P4SA 2WWHA 3TE6A 4PAOA 3FGNA 1DAMA 1OXXK 1SXJA 2XAUA 2AK2A 2RGBA 2FPKA 1OXTA 5GJCA 5J4VA 2QRNA 3CUEF 3BB3A 3EWSA 3BFVA 1KOFA 3ZQ6A 3C7KA 2J1LA 3AVTA 3RABA 4DLZA 1ZD9A 4HDCA 1DADA 2V1UA 4XD7D 1NLFA 5KSOA 1KGDA 4UNRA 2O8BA 1JI0A 4OHWA 5C18A 1JQJC 2GJAA 3IIKA 4OI4A 1WMSA 2R9VA 1IN4A 5FPKA 1UKEA 1G4AE 4A0RA 4QG7A 1G16A 1CJKC 2CHGA 2ZRKA 1MO6A 3R8FA 3EZ9A 1CS4C 3B1WA 5H68A 1IJFA 4M9ZA 1CTQA 4DVGA 1JR6A 4RCZA 3TW8B 2J5XA 2BKUA 4PSKA 5EZ5A 3H86A 1RRCA 4BE7B 4C0KA 2OAQ1 1MRSA 4AK9A 4DIDA 2ZREA 4DC9A 2A30A 2WJIA 4X8OA 1W36D 4TZ0A 1KDTA 2NOAA 4EPYA 2OG2A 2WIAA 3IKJA 5HE8A 2AHOA 1ZIPA 2IYRA 2BJWA 2PJZA 5BN5A 3K70B 2FU5C 4QC2A 2GTPA 2KBFA 1D8TA 2QTHA 1XJQA 5AJWA 3FDIA 721PA 4NE2A 1EK0A 4HLCA 5HZHA 2O8EA 1VG9B 3B78A 3SFZA 1OKKD 2DFLA 2C78A 3LAWA 1MABA 3LW8A 1E94E 2VHCA 1NSFA 1XFAA 4Q48A 2X19A 3I62A 4JYCA 3WYAA 4CT5A 1GRRA 5B64A 2ZRIA 1QG4A 4CGZA 3BIFA 3AKCA 2E87A 1KAOA 4IXNA 1MO4A 4TQAA 2W58A 2GNOA 3TVTA 3AVVA 4TT3A 3FPAA 3CONA 3FHOA 5FI0B 2C03A 1T8TA 1XJ0A 4KVAA 3MD0A 4A2WA 1T0JB 2N1BA 3SU8A 1N6RA 3KKPA 4HDOB 3SHWA 2RGGA 3QJYA 4BASA 1P5ZB 2VP6A 4R7ZA 4TLDA 1U0LA 3VKWA 1P7CA 3QEJA 3TR0A 5CITA 2UVQA 4NBSA 1E9CA 4N3NA 4JLKA 2IW3A 2PL3A 2XSZA 1OW3B 2CJWA 4RCYA 3CKLA 2XZLA 1NNEA 2PT5A 3WMEA 1TADA 1D2EA 4QOSA 5EUQB 1OYWA 2DBYA 3TUZC 5D3MB 1IJEA 5IF9A 3DVLA 1ZM2A 4UNQA 5AJVB 4ASUD 1Q12A 4EAQA 3VNVA 1TUEA 3U61B 3SYLA 4Q7JB 1KKMA 4Q4JB 2VQSA 2O8FB 4FCVA 4NYMR 4CIDA 3R8CA 4NTZA 4G5OA 3TW4A 2C95A 4Q1FA 4YMSA 4M1MA 3OFNA 1IN5A 1U0JA 2J0UA 1A1VA 3I8XA 4HAUA 2ZETA 4MKFA 1XBTA 3REFA 3MLEA 1KI3A 4MGYR 4RD2A 1VCNA 1G4UR 4B75A 4LJ6A 4GSYA 2Z0MA 1ZNXA 3B5JA 4C0LA 4U5XA 1R5NA 5FUVA 3MMPA 1IY2A 2CMKA 4F4JA 3B1XA 1DAKA 3THXB 3RHFA 5BYJA 4R9UC 1QHYA 4X8MA 4D4LA 4C0BA 4JSYA 3PCRB 4JLPA 1L8QA 2ZRNA 4URVR 1P62B 1G3RA 4Q9HA 2Y8EA 1VCMA 5J4LA 2D7DA 2NO7A 4GL2A 5JFGA 3B1VA 3KB2A 1XP8A 2CVFA 4LZZA 1XXHA 3J81k 2A78A 1J99A 2BDTA 1FPMA 2QP3A 5EZ6B 1ZM4A 2AFIE 2EFEB 2XNDD 4MRPA 5JCPA 4D0GA 5FTLA 4NL4H 1GILA 2RHDA 3H2YA 4Q4AA 4L15A 4M53A 4ON9A 5AUQA 3UMFA 1KI9A 4AIIA 4BFVA 3AF3A 2CXXA 4DWJA 3ADKA 3GLIA 2PCJA 3C15C 2JJ8A 4LUCA 1OXVA 4PZYA 1FUKA 4EJSB 5TMPA 2AL7A 3ZS8A 4CT4B 1WQ1R 1E2HA 2QZ4A 3CZPA 4RD1A 4US0R 5TVKA 3X1XA 2GAOA 2MSDB 1E2KA 3L0SA 4MITA 1W36B 5HR5A 1AKYA 1ZIOA 4FI3C 3NXSA 1ZNYA 4IDPA 2QSYA 3A4LA 2ZU0C 4RZXA 5FBWB 4OJQA 1VDZA 4XJXA 2CK3D 3VU9B 3FMPB 4RSGA 3B1ZA 5KPDA 1W0JA 4GRAA 2I1VB 4GDFA 1NBMA 2OLKA 1GAJA 2XNSA 3QG1A 4QHTA 4CRWB 3RDPA 4ZDJA 4DCUA 2RGNA 2YYZA 2MMGA 3PR1A 1X8KA 4PPGA 2EW1A 3DKPA 1ETUA 1KO4A 1QVAA 1P4SA 1S1MA 1GVNB 1DPFA 1T5IA 4D26A 3OIVA 1FFHA 1XCGB 3FFBA 4RD0A 5AJZA 3VX3A 1N2CE 2HXYA 2D06A 3HU1A 1ZCBA 1EX7A 2DCUA 3B13B 4PO1A 4V0MA 3UG6A 3GLGA 2IYSA 4PQYA 1W0KA 5BYKA 3F5FA 1XTJA 4QJ4A 4US2R 2BKEA 4JVLA 5CLQA 4MYCA 4V0LA 5DH9A 4A8JC 3HPQA 3ZVNA 1CEEA 4TMVA 1C9KA 2NGRA 5DISB 4EPXA 1KDOA 3T1VA 1DOAA 4QRHA 1L4YA 1XEXB 3QXSA 3EG5A 2IYZA 4M9QA 1US8A 1F2TB 4QHSA 4IFBA 1D2NA 4IDNA 3BXZA 3TKLA 2F55A 4CW7A 3K0FA 1JR3A 1OFIA 5L3SB 3VKGA 4D25A 1KJWA 1NSTA 5JBQA 2V7QD 3NEYA 2BHRA 1GITA 3KJEA 2O0KA 3PXGA 4A6PA 4L9WA 1CP2A 3LD9A 4NCNA 4ACAA 1KSGA 1G8FA 1NN0A 1FQKA 1SXJE 1TF5A 4XSHA 3EZ2A 2EVWX 3AUYA 5JWHA 3GJ6A 3LQQA 4JVMA 5G41A 5G40A 2YWFA 2QRZA 5J4HA 4M1SA 2AX4A 3GLFB 3I61A 1L4UA 3RS3A 4B32A 4GOXA 2PEZA 1NIJA 2BMDA 1Z29A 1HTWA 2ZIAA 1H8HD 4HDQB 2ZRPA 521PA 2V9PA 2X2EA 1OIXA 2IL1A 3MWJA 3EASA 1E98A 3A1SA 4EIWA 4HYYA 1E2NA 1MKYA 2C2HA 3U7GA 4GT1A 3I4LA 3Q8XB 2RGAA 2Q6TA 3RRZA 3TNFA 1RE0A 4AC9A 4LV8B 4AURA 4JVSB 5K8LA 2KE5A 1OHHA 3KQHA 3OAAD 2JLZA 2QROA 1S2MA 2ZJ2A 2GCNA 4PHGA 3L43A 1JEEA 3LBHA 1JB1A 1AIPA 1KK0A 1TF7A 5EXPA 3I1FA 3I5XA 4MKGA 2FF7A 2FZ4A 4WXRA 1E0SA 2QMUA 3T61A 5DNYB 2GXAA 1FX0A 4DT1A 2WMOB 5G3YA 5CM9C 5KNBA 3UKDA 3AVXA 3CF6R 2JIZA 4HAYA 1MV5A 3CWQA 3IBYA 4JIMA 5F9HA 4PTLA 1N5JA 2P6UA 4HUQB 1VPLA 3PITA 4LDJA 2W00A 2EWWA 2XX3A 1KI4A 2Z4SA 2GZHA 4MA4A 4L5BA 3AGPA 1E9AA 4A2QA 2QU8A 5CIWA 5LBIA 4QM7A 5KNCA 1EFUA 3K0AA 3SDZA 2FSIA 3QEOA 1YR8A 1T0HB 2QAGB 4KODA 2P3SA 1E3MA 1O3YA 1F6BA 4DLXA 1M1YE 1WBDA 1CR4A 1QHHB 5EE9A 3H84A 3ZDQA 4B76A 3BOSA 1HYQA 3GEHA 1PUIA 5L8VA 4Z8XA 4TLAA 5JS8A 3ZVRA 4KBFA 2FSFA 2ZAOA 3WBKA 4BFSA 3FFAA 5TB5A 2AKAB 4KI0A 1UF9A 5AUOB 4LC1A 3OZXA 4IXMA 4A15A 5KU1A 1BMFD 5C1BA 3AVQA 1KMQA 3FE2A 3K0CC 4MRSA 2IF0A 4FMBB 2IK8A 4EFMA 2HXSA 2NPIA 4Q7KA 1N0WA 3EIEA 2CLCX 3KFVA 4KLZA 4PFSA 1Z0JA 3LQRA 3V4RA 4M0LA 4Q9LA 4BFYA 3ZIAD 4AKIA 3WNBA 2G0NA 5E7MA 3TH5A 4LBWA 3IDQA 1BIFA 1ZUHA 3T12A 4Z54A 2J0SA 2RH5A 2IXGA 2FEOA 1G3MA 2QA5A 3OEED 4FW9A 3ADDA 2QBYB 1VHTA 4HAXA 1SXJC 1RRFA 1P9WA 2W6ID 2ECKA 4URYR 1GKYA 2F1HA 3O8BA 4JKYA 2EFGA 3GJ0A 1E4YA 2ZTSA 4P0TA 1YRBA 4KJZA 1ZM3A 3KDSE 1YZNA 3DZ8A 4ZCLA 2FJUA 5EXXA 3VMFA 1KI8A 1OH8A 1NKTA 4M1OA 1ONBA 4DSOA 3GLFE 5E95A 1SHZA 2GEUA 3THYB 3SQWA 3GJ3A 1KKLA 4MRRA 4NHOA 5DSZA 2C9CA 5LB4A 2W6JD 3U44A 4URUR 2J0QA 2GJ9A 2O8CA 4B34A 1GIAA 4U00A 3D8BA 3BRWD 4AYTA 1DAEA 3ZVLA 5BN3A 3B8HA 2VP9A 1RIFA 2BBWA 3NC1C 2QORA 1W5SA 3LLUA 3NH6A 1TMKA 2REXB 1NG1A 4EJSC 1FTNA 1SULA 1D6JA 2HYDA 3JVVA 4TYWA 2HUPA 2O0HA 3K9HA 1GUAA 1FQJA 2BC9A 2GA8A 2C99A 4HZIA 4ZKDA 3G82C 4FXPA 3RC8A 4ARZB 3NDPA 1W36C 4ZDIA 2JLXA 4DIEA 3PV0A 2OBLA 2JLSA 4IHQA 1UAAA 1M7HA 2WAXA 1E9EA 2JAQA 2OXCA 1YRAA 2W2TA 4BZQA 4ERNA 4LJ8A 2KB0A 2NPFA 1Z0DA 4Q1AA 4TMWA 2EWVA 5JZVA 5SZHB 4JL8A 2GAAA 1XMSA 2ODNA 1T8UA 3MCAA 4KFTA 3SJBA 4NCIA 2GVZC 3W8NA 3U6KA 4ACBA 2ZRBA 3IGFA 2DWPA 3K0SA 1X8LA 3GMTA 2YOHA 2OV2A 2FE4A 2CL0X 3P20A 3BFKA 4DDUA 5K8IA 3GLIE 3ZYCA 2HF9A 3A1WA 4YDHB 2XZOA 1OIWA 2LWIA 3M4YA 3MJHA 4B2PA 4NDZA 4BFZA 2N46A 1EESA 2A5FA 3EX7C 1W2GA 5E7IA 1XTQA 3QXXA 4LHWA 3Q72A 2A5JA 3AP1A 1MT0A 3C5CA 1X1RA 1GNQA 3QXCA 1VCIA 4Z8YA 3K09A 2VP0A 2Q9CA 4KYIB 1NLYA 2A5DA 1DARA 3MAAC 3QQ5A 3Q85A 3WHLA 3GFPA 1KYIA 2OO7A 1GSIA 2ZRMA 3QKSB 1AS3A 5AR1A 3RSLA 1Z47A 5DHFA 5F98A 4C9BA 2UZ3A 3U3RA 4QM6A 4NONA 2FN4A 2F1RA 3NBXX 4IEIA 3QSYA 4US1R 1E79A 4DCVA 4R71A 5TY0A 4TYYA 2PLRA 2QN6A 4JL6A 4MDFA 3AP2A 3T1OA 1X3SA 2W0MA 4AG6A 1A7JA 4LBZA 3AF1A 1W4AA 4UNPA 3VX4A 1Q20A 4AG5A 1IN8A 3FMFA 4Z51A 1KY3A 2JDIA 4B74A 4DB2A 1DE0A 5FFMA 4IOJA 2EFCB 4C0SA 3RAPR 5JEEA 4P4UA 2HLDD 4I1VA 1E99A 1N6KA 5JJIA 1ZUNB 4DSUA 2FOLA 3PG5A 5FI1B 2OBMA 4ITRC 1DO0A 1Z07A 4JJKA 4C0AC 3R7WB 1NP6A 3CNOA 1EWRA 2G83A 2R62A 4D4KA 2R6DA 2NZ8A 2ZVQX 3CRRA 3W6OA 4Q00A 3QKUA 4IOLA 4KU4A 5GJVC 2CVHA 1CKEA 2ANCA 2H57A 4NPHA 3AB3A 4Q19A 5DI9A 1RRGA 5GVRA 1TQ4A 3LNCA 2FPLA 3TMKA 3BAFA 2P6NA 1PLKA 4HLQB 3CM0A 3A4NA 1RYFA 4KSBA 4PC6A 3L0PA 2XOKD 4KBGA 3WP1B 1NVVQ 2F3RA 2Z83A 2OLJA 5KO2A 4IKEA 4D6PA 4MUBA 1D9XA 2AFHE 2ODBA 1P75A 4TL8A 3K9GA 3BH6A 5C46F 3W3AA 2D2EA 2WMNB 5FL3A 4M2LA 2KWIA 2RMKA 4JT2A 4JLBA 2F43B 3L2OB 3SS8A 1H65A 3GPLA 1IXZA 3K53A 2OFXA 2A5GA 2WOJA 5SZIA 2JLWA 2ZSFA 1YZQA 1N25A 4XVUA 3P4YA 4M1TA 2VSFA 1HURA 4GZLA 4Q5IA 5BXQC 5FOXA 2IYQA 4L8GA 3GD7A 1E2GA 1X1SA 3OIYA 1OLOA 4LBVA 1M7BA 1GKIA 3TSOA 2Q21A 4PPFA 4KCGA 2H17A 1XTIA 1JBKA 5D3MA 4QJ5A 4XWKA 2OXRA 1LW7A 5EP4A 4UQOA 4A2PA 1H8EA 1S8FA 2Z6VA 2B7BA 3DL0A 2G0TA 4Q4JA 1G18A 2O8FA 3ZZUA 4JMPA 2GWHA 3BH7A 5HKKD 3RS4A 1G7SA 2PLFA 1U98A 2B7CA 2NO6A 4FMCB 4HB4A 1XEFA 3UMSA 1DELA 4A4DA 1HY3A 4HB2A 4TN1A 3LX8A 1TUIA 4NMMA 2VA8A 1NMXA 4KLNA 5LD2B 4TYQA 1AM4D 4WA7A 4Z1MD 1Q1BA 2QT1A 4IW3B 1G3UA 2GHIA 4X8LA 5DN6A 1E1RD 3ADCA 3HPRA 1KSJA 1BYUA 2WOOA 1TQDA 4NH0A 1P9NA 4AKHA 2N42A 3EA5A 3GCGA 4F91B 2XEXA 3B6EA 2FFHA 5FTMA 1JEDA 2BM0A 2PMKA 2CEAA 1LS6A 1S1CA 2R2AA 2F9LA 4LK2A 3IEVA 1KTVA 3TGPA 2BM1A 2RGNC 2DFKB 3CW2A 2G9NA 5E3HA 2HT1A 3NG1A 3PEWA 1ZM9A 3SZRA 3CX8A 5EJEA 2QL6A 1SVSA 4TQUS 5FUWA 4PX9A 1NG9A 3FKSD 3T5DA 1VHLA 2H18A 2H7VA 3I32A 1KK1A 4MYTA 4RKFA 4XTRA 1KI7A 3ZVMA 2OM2A 3GFOA 5DYIA 1OT3A 4RVCA 1VIAA 3CO5A 1SVKA 2ZANA 2BCGY 3BD9A 2BIFA 5KSYA 1DAIA 4HLUC 5CB8A 3KUCA 2Q0HA 2ONKA 3SE0A 1UDWA 3FOZA 2C5LA 3IPYA 4EJSA 2ONJA 4BLRA 2F9MA 2DHRA 4Q1DA 3Q3JB 2I4IA 2ODWA 2OE2A 3THWA 4DHEA 2BCJQ 2G1JA 1D2MA 3GJ5A 4GBMA 4U7DA 5DI3B 4CEHB 1VECA 1G17A 1N5IA 5G53C 1Z3IX 1JXMA 4B2LA 3L0OA
chains in the Genus database with same CATH superfamily
5IMBA 4GM1A 1C80A 5HG0A 4X3PA 5DYGA 5E4FA 1J39A 3E1GA 1LI4A 1RC1A 3KT3A 4Q16A 1E61A 1Z6QA 2I55A 4UUPA 2FGKA 2BTEA 4EB3A 1Z28A 4CMCA 2ERYA 4RU1A 1VZ2A 1Z5WA 2PRKA 4RHFA 5JVDB 2YC4C 4BQPA 5IZCC 4AF8A 4F3RA 3RS8A 3NZEA 3EIQA 2OFWA 1ZI8A 4JX9A 3VM6A 5FRDA 5C7IO 1Y3AA 1CE8B 4GGMX 4QU9A 3JAMA 1P5FA 2XW6A 3EVTA 3PX2A 3P8ZA 4MEJA 1FF9A 2WMDA 4UPEA 1J8VA 1P2VA 1OI4A 4CM4B 4D8XA 2UUOA 5KJEA 5KYWA 2EKZA 2E7ZA 1I0LA 1I3KA 5E6SB 1U2PA 2PX5A 2HO5A 2VHZA 1Y6ZA 4LGMA 5E4JA 3VA7A 2X40A 1QRAA 1K4MA 1U3WA 1XQYA 1NMSA 1OYYA 5K2MA 2VSOA 4B6QA 2X1HA 4LYAA 1X9IA 2RGEA 1KH2A 1VLLA 3KJGA 1OFTA 2E4AA 3R6DA 3C39A 3ZGYA 1ID1A 2JFHA 3I2GA 4W8OA 1TZJA 3HVUA 1YXMA 3BMOA 4XGNA 3GFQA 3T5AA 4LQ4A 1V6SA 2ZBGA 3NKFA 3Q7TA 2FCAA 3AX6A 5C8YB 4CLDA 1IUPA 4RORA 3FFTA 3PQ7A 4P08A 1WZUA 4R41A 3LVRE 5DCLA 5L3SA 1AMNA 1T2UA 4ZV4A 5EJ6A 1G291 5FOQA 1F4VA 4RPCA 3CIFA 1ANKA 1VIMA 3RSOA 1D7AA 2X0FA 3NTRA 4FYXA 1JJBA 1YL5A 2WJWA 5J40A 2B4KA 3KFLA 4IIJF 1V7ZA 4ZODA 3ROXA 2CVOA 2IOHA 3ZKWA 4DDHA 2ASVA 1TTQB 4JI5B 3ODGA 4ZGBA 3MW8A 1M34E 3BHMA 4LXGA 1WY5A 4OL0A 5BSHA 1O77A 5G1OA 2Q2NA 3KXPA 4LZOA 4TWZA 2GUGA 1H0RA 2XRZA 2VJOA 1ZK2A 3GO4A 1R3DA 4D79A 4U7FA 5EWJB 2PZBA 4KP7A 2LBPA 2Q4TA 3EUEA 2Q5EA 3MA0A 4Z49A 3R5KA 4AKGA 3OUZA 1G3QA 1IU9A 3R7DA 4LY6A 2UVDA 3W8DA 2UUAB 3ZNPA 2I2CA 2JBAA 1SQSA 1HFJA 3PX3A 2G77B 1EZZA 3AR4A 1F3OA 4QYIB 3LOQA 4XGRA 4GH5A 4DLLA 4FE7A 3I34X 1C2YA 2P4EA 4LWPA 4B44A 4EG3A 3RYIB 2C9YA 3E8MA 2F62A 2FPPB 5U4QA 5IARA 4W7HA 2IBTA 3VI3B 1N8NA 3JD1A 3IXMA 4GYWA 4I1RA 5LB2A 3U3JA 4HN9A 4CFZA 5IVHA 3FGOA 4KFSA 3EGOA 3IURA 1H22A 4E5SA 5I7SA 5ESRA 2I3GA 3ZE7A 1YOBA 4FNOA 2ZIGA 3RVSA 2GK7A 2OWDA 1Z2CA 1TPZA 2AUMA 3TX2A 3T15A 3ZHTA 5IK2D 1EWYA 1FTSA 2WP0A 3O7MA 1EFKA 4ICIA 4MCAA 4DWOA 4LF5B 4CIXA 2ZE8A 4UASA 4U7PB 2FZKA 4K6FA 3AVWA 2GJSA 3WIBA 4PSCA 3ILVA 2JFXA 4EB8A 1M74A 5DIFA 1R5JA 1DS6A 2BR4A 2GCPA 1GZ7A 5JY6A 5L9AA 1U8XX 2R6FA 3GQBB 4BJ5A 2FFQA 3LUKA 2XCSB 2D3TA 3KYCA 1YU9A 2FK7A 1KZ7B 3HL0A 3N3AC 4FI3F 4MV8A 5JISA 5LOVB 4Z4IA 3LVQE 3MJRA 3FDJA 4JBYA 4K6GA 4WECA 3KKZA 6Q21A 1PT9A 1S96A 3HU5A 2QAGA 1O6ZA 3FN4A 4YUVA 4DJTA 1IZ7A 1N2IA 2X8AA 3T7DA 2JL1A 5ALXA 3VHQA 4JEIA 4FNAA 3N07A 1SKYB 4HWKA 4B35A 3H16A 1JIXA 3OJLA 4H35A 4MUYA 4WPGA 1U9IC 3TXYA 3MBIA 3TLKA 2J5BA 5SYMA 3IYLW 1MDBA 3TDKA 1QM5A 4L2IB 3I30X 4MB6A 1N6OA 1K5GA 2VHJA 3A36A 1YR9A 3LUJA 2AD1A 3UT5A 5FBRB 3ZDBA 3SYTA 4FLEA 3LT4A 5I7OA 1S3GA 3EH1A 1O9GA 4PPQA 4NULA 1FDOA 2WJHA 3CVUA 4C7OB 1FMCA 3GOQA 4RMJA 2RB4A 1WPQA 2YV5A 5FOWA 4O0LA 4DARA 2VI5A 2AXNA 3ZK9A 4J91A 3NEAA 3OCWA 1GGFA 1EVQA 1XNJA 2ORWA 3ZY3A 2GK3A 2JGJA 1Z4IA 3MTDA 5ESWA 3W2HA 4FC6A 2PUJA 1M1ZA 5FTJA 4EX6A 1DAFA 2G1KA 1QVWA 2CNOA 3OX2A 3CBQA 1GZ5A 2JLVA 3CGWA 3K1AA 1AD2A 1GTZA 3DE2X 4LVOA 4ZTBA 3UMBA 4RKEA 3N75A 2ZUFA 4N0EA 4LOIA 1UJMA 2P69A 1FW8A 2DQ4A 1ADJA 3QIVA 2IPOA 1H5QA 4HFJA 4QQFA 2W6CX 3RF6A 4AJNA 4EJFA 3RTBA 3Q9LA 2Q1XA 2Y0BA 4OLFA 4FEGA 5B58T 3WI7A 5L3ZA 4DNPA 3EDMA 2N9UA 3OUUA 4IUYA 6REQB 1IRIA 1TKCA 5K9ZA 4JJ7A 9ATCA 3PJEA 2QLTA 3R77A 3EFEA 2WTUA 4O59O 1T6YA 1K88A 4OQNA 3G0GA 5CB0A 3DF9A 2WUEA 2WWWA 2ZPTX 3C5VA 3HABA 4L4UA 4RY8A 3F3YA 2IHYA 3QBDA 5CLLA 4XWYA 1K5DA 1R4NB 1Z7YA 3NV7A 3TFWA 2CVQA 3TR6A 5EUBA 4UHFA 3A1TA 1AN0A 2V7QA 4P2GA 3PTLA 1AO0A 1MTOA 3REOA 4XB6B 5AK0A 1KFJB 4D57A 5CCEA 2JI9A 5JY1A 2I2DA 2VDUE 4DSTA 4C78A 3CVYA 3QI7A 4BUZA 3M82A 3T7KA 3SHVA 4QPPA 4BJ1A 1EVKA 1OT5A 3WMFA 2YHIB 4HQFA 4LTNA 4CQLA 5JAZA 2ZRHA 4BVAA 1QIDA 1U0EA 2P9FA 1HBJA 3BJRA 5CJJA 4D9NA 4ES6A 3FZNA 4JK3A 4MHTA 5FV4A 3IT2A 5L95A 2HA4A 1NBEA 4O4JA 1XD8A 5EKDA 1E58A 2PUBA 1KU6A 3SZ3A 1E1NA 5KX5B 1TT5B 4G1MB 1ZLXA 2P6RA 3A9RA 4KUHA 3OHMA 3TZBA 2BLLA 1UKBA 1BXRA 2XVXA 3CY6A 4TLMB 4Q05A 2X0RA 2C8JA 3NAGA 3OEHA 3BCSA 1VE1A 1QH8B 1C0EA 2PANA 3M5WA 3WYCA 1G2PA 2FDXA 4QU5A 4CCYB 1E2EA 3O4VA 5FAXA 2QMZA 2AV6A 2W2QA 1GL6A 5JMTA 1PSWA 1ZSVA 5M5BA 1VGRA 3FVQA 1FE8A 4I46A 3RS2A 3KIPA 2RD2A 3FWHA 5C4MA 2HJHA 3V46A 4ZHQB 4I3HA 1JIKA 3DDHA 4B3XA 3EFBA 5GZ3A 2IDZA 1O0SA 3D02A 3DFMA 2C8KA 2VAWA 1DINA 1OBVA 3EE6A 2V7UA 3O1HB 3N70A 4LE1A 1LDGA 2C3YA 4WFQA 1TNDA 2FR8C 4A6DA 5ADWA 4BZZA 3HVIA 3PHCA 4PHHA 2JFNA 1GG9A 1U2QA 4UTNA 4RGVA 5D01A 5EQFA 5KUTA 4RPJA 3KZVA 4H1HA 4DBVO 4CF7A 4RVNA 1UKAA 3LHKA 2AQHA 3G2MA 4BMVA 4ZO7A 3VGJA 5L4SA 1I1HA 4KE8A 3H9BA 4DUPA 3L8ZA 1S2DA 3F4LA 1L8LA 4G3XA 4IYRA 4TPKA 4A10A 1NXXA 3KQTA 3V33A 4ZO6A 2G67A 3R23A 3DE5X 3CURA 3DHYA 1GN8A 1Q1ZA 3QOWA 1OJLA 1DUIA 1JZTA 2BFBB 3QY0A 1P44A 3TSZA 2FX2A 3SQXA 4DNOA 2HZ7A 3ND9A 4D42A 1E0AA 1ZC4A 4DWWA 3RWOA 1TZBA 4O1IA 4Q15A 2ZEJA 3JD2A 3WRYA 1QHGA 2C04A 4LQCA 421PA 2Z04A 3GPBA 2HWUA 3NASA 1ZUNA 4HNAB 3ZWYA 4BO6A 2J7PA 3WWEA 4LGCA 4F5YA 5B3KA 5GTDA 2YXNA 4Q9IA 4HH0A 1BMFA 1HE5A 1IY8A 4JKIA 4XTCS 1E7RA 2EU8A 2WM3A 3CH4B 3DMNA 4W5WA 4MRNA 1Z82A 2C3UA 2W70A 1M8PA 2CUNA 2EAUA 3GFGA 3P9QA 1XHLA 4QIHA 4RESA 5JRDS 2NXCA 4RYLA 3AM1A 3AUUA 3ROTA 5HZHA 5E4TA 1R0XA 3LBYA 1HRKA 3Q2OA 4WEOA 5T64A 1AGRA 2GO1A 2P9GA 2XUPA 1TMOA 4OJKA 4OQZA 4WRRA 3S2YA 2D1YA 2OQIA 3AK4A 5K3BA 2FX5A 5KNCD 5DM4A 5AK4A 5AHRA 1B16A 3WADA 3I2HA 1NRXA 1WXQA 3AETB 4EF5A 4FZRA 1CS0A 5LR6A 1QIKA 3H1TA 1DNPA 3HY6A 4DA0A 1D4FA 4HN2A 1I13A 1KK3A 1U9YA 4CHTA 3IERA 4DTCA 5AWFC 1NFRA 2XUIA 2ZRQA 4L16A 3FCYA 3GJ8A 3HWSA 4OL9A 3QUSA 4E1AA 3ANTA 1E66A 4TL9A 5KOYA 1B2LA 1QO0A 1UXGA 4Q03A 1E2QA 2R1ZA 2W6JA 2QRJA 2I54A 5JTUA 4BBZA 2OZPA 1IDN1 4GX2A 3PNLA 1IWOA 4M89A 1K4YA 2XAAA 3AEKB 5CHEA 2WD9A 1F12A 1VZ3A 3NHFA 4NU0A 5FPTA 4JLAA 3D7MA 1Z45A 5EVJA 4C0WA 1BOFA 2BP7B 4I1SA 4RLQA 4X6YA 1Z4PX 2QV0A 1M6EX 4CDNA 7MHTA 1J0XO 3Q7QA 1JFSA 1K8QA 4G1EB 1Z0UA 4XJSA 5J2UF 3QPCA 2O2GA 4ZCMA 3LNTA 3IALA 3MTIA 2HCRA 1MO2A 4GKBA 4LV5B 4Q1BA 4X92A 4BFUA 4OUDA 1GP2A 2AMFA 4W9MC 1CUYA 1ZPDA 3ENVA 3TLYA 5JYBA 1D2GA 3VKFA 2ECQA 2B8NA 1UUFA 3UG7A 1JEQB 5JNUA 1XCBA 2CCGA 2DWQA 1IIRA 2FEMA 3KZNA 3H1PA 3X2FA 3IS3A 3QFFA 3RC2A 1I2ZA 3P32A 4MS4B 2OQVA 2P5UA 2F7SA 3OJCA 4OEHA 5MGBA 2ISCA 3ZUGA 1K6MA 2ZUBA 2XH8A 5EPUA 3DL7A 3HUUA 3DGFC 4R1MA 4H15A 5H82A 4ER7A 3HXOA 4RBNA 2CSUA 2PDAA 4ZZ2A 3S99A 2IUYA 2EZTA 2WTMA 4INOA 4PPNA 1ZHHA 3DM9B 1CJCA 4MIEA 2GBCA 1H2EA 4TQ9A 3S2UA 5A4IS 1ZRHA 4OBEA 3T3HA 1GRNA 4J0GA 2VZ0A 3SHQA 3RLIA 4JT4A 4NNJA 3OY2A 2QQ0A 4Y0NA 2FN3A 4XCQA 3FSGA 4PNPA 4RIGA 2J3KA 3BSYA 4ALKA 5JARA 1RU3A 1LNSA 3PIIA 5D3QA 1UBRS 2QSZA 5JNLA 3P2KA 4NU6A 1N6NA 2BSQA 5ETJA 2GCEA 3FIUA 2FDRA 4LMBA 4PR0A 1M5RA 5C7YA 2CE2X 4BRZA 3NYQA 1KC1A 2PZGA 1ZQ1A 1Q3TA 2ATVA 2HLNA 2NN3C 5IWCA 2X7JA 1MR3F 3IUPA 4GR4A 4L7VA 3TIXB 3I83A 4YRZA 3U7HB 2CDAA 1M2NA 1XLTC 1B0ZA 2EZ8A 1FXWF 1ZICA 2IOQA 1J56A 5DB4A 5FBKA 1IG0A 1XTSA 1XYVA 2FV8A 3R3HA 3VR1A 8OHMA 5FFNA 2YMMA 4DCGA 4OXYA 1VB5A 3ABZA 2P75A 1T25A 2X3YA 1FLDA 3I6ZA 5EJMA 4ZU1X 1ZAYA 2D7CA 3KPYA 4KR7A 1GA4A 3G6WA 3LUGA 2DR3A 1EA5A 2EBHX 4PG6A 4Q02A 3N6RA 3HKDA 3JVUA 4WCFC 1W9HA 3TPCA 1C3OB 1J0CA 1WP4A 2EF1A 1RC0A 2J45A 3JWHA 5ALZA 2KJQA 3CB4A 3USCS 3WAKA 3NTUA 2GCOB 4PZDA 4ZOLA 2UYOA 3VZBA 1UBJS 3LDFA 3CN7A 2ZS8A 1A4XA 5CDFE 4OXIA 4XLLA 1G63A 1T4MA 3KEGA 3OKAA 1DU4A 1KI1A 2ZI5A 1RS0A 2IWRA 4MA5A 1EFHA 3PIRA 2V0NA 1PQWA 5AKKA 4RKQA 3QVGB 3KWLA 3SLRA 1OILA 3TI9A 3LQ2A 3A9SA 1S6YA 4H7PA 2XVAA 2O06A 2MU1A 4OJNA 1CCWA 3U56A 4TYPA 4LZAA 1OFUX 2QTFA 2XUFA 3RU2A 2GBLC 5HBRA 2G7ZA 4A0SA 5L45A 1MD9A 1TQ6A 2OCPA 2AQIA 4IINA 4LSWA 5JVDA 5J47A 2QRQA 4ZAYA 1L8OA 4CTKA 3MT7A 3GGJA 1U2RA 3T3IA 2LUOA 4ZJZA 1ZIDA 4YYZA 3QGMA 4G5FA 4QXMA 1BTOA 4UHHA 3DUFB 2HSZA 3BM5A 1RC8A 4HKTA 3LK7A 3E61A 1RZ3A 3TTYA 4F21A 3K1TA 2J4FA 5F1KA 4ZT5A 4AJEA 2JRLA 4HXEB 1RBZA 1GNLA 3LCUA 4CM4A 1B1CA 1RLIA 3MTBA 2GM3A 1V5IA 1LB1B 5E6SA 2HXGA 2GARA 4YY3B 1PR6A 1U8YA 5CLIA 2PZMA 2YHSA 5JBIA 4C14A 4RS3A 2ZAGA 3UTDA 1JALA 3C70A 2AJDA 2P5SA 5DNAA 2HW8A 5KJFA 4NP6A 1CLEA 1U1EA 4GZ6A 4JWKA 4NBRA 4WACA 5K3EA 2A9JA 1VG8A 3TQTA 1FRNA 1H2FA 1EDOA 1UODA 4HB0A 1YU6A 2QVZX 5C8YA 2A4MA 4EUNA 1SCNE 2Z08A 2ASEA 3EZYA 3TO5A 3ORFA 2H1RA 1VBFA 1LTHR 1QF9A 4PZAA 2GB4A 3ADOA 4CF3A 4DEXA 5AVZA 2NSYA 4F6RA 1X1DA 5TIIA 2DAPA 3R9XA 4IJ6A 2HNBA 5GZ6A 1OH5A 5CLJA 3WGTA 1XLUA 4GLOA 5CDYA 2H9IA 2MINB 3LY5A 1XTUA 1PT5A 1Y5RA 2AD5A 3IP7A 1Y9AA 4OFZA 1R8SA 1NT2A 3TRHA 3UWKA 1GAWA 4IIVA 4LXXA 1JH8A 1U8EA 3OE5A 3WJAA 2OQ2A 3SVTA 2W0SA 3FNHA 1KZGB 4RMNA 2J9RA 1E1QA 4NE7A 2XQVA 1NW5A 5EWJA 4ZT4A 2DFDA 3M5PA 3DV2A 2VRNA 3F7TA 2PUDA 4MMZB 1K6EA 1B23P 1DC5A 3LLMA 1BEUB 5AK5A 2CL6X 2IXDA 3CPHA 3B52X 3D8UA 3JQQA 4P98A 5CVUA 2R6AA 4AYXA 2CHQA 4HFMA 2YDXA 4OYLA 3RG2A 1H9CA 1P2UA 4B6EA 5ICEA 4EB0A 3SQDA 4EMSA 1NC1A 3CN9A 2NIPA 5FOVA 4Z6KA 3H97A 4YT4A 2AEMA 2R1VB 4HWOA 2A3NA 2IIPA 3GJ4A 2WU8A 5AHWA 3VHXB 5A5GA 1N33B 4IMJB 1UADA 2V96A 4NBKA 4S12A 2COKA 1MJHA 5AXDA 1OE0A 3U13A 1YO6A 4BMDA 5LIRA 2DP4E 3O7WA 1NRIA 1UOEA 2ODQA 2R7KA 4YLEA 4J7CA 1QCYA 1AZLA 4MDHA 5UKDA 1QZUA 3CZ5A 4G89A 4I55F 4MUAA 3O4FA 2BJVA 2C97A 3RS7A 2JGDB 3KB6A 2DQZA 2JW5A 4KQHA 1AKVA 3EQ9A 4REMA 1JHZA 1Z35A 4YV7A 2HDWA 3QVLA 1GJRA 4HMQA 4MHSA 1IE3A 4C07A 3E15A 3H3JA 4EATA 1SUIA 1N2OA 1G7RA 3HV0A 3GQBA 3JRXA 4DV6B 1GQSA 2J3HA 2NSJA 4M1YA 5T4BA 2A5YB 2ODPA 3PGKA 3MAGA 1BJTA 3A25A 3ABIA 3U4IA 5LOVA 1XMJA 2DLNA 3OZVA 1ZA2A 3D0OA 4CQMD 2BFMA 1Q44A 5KZMB 2AG6A 2JAHA 2ZJ3A 5CX1A 3EUWA 4OSOA 4PW0A 4RQBA 4TYNA 3ND5A 1F8GA 3QBJA 2HRZA 2VOEA 4ZJPA 3RRJA 4PQGA 4FNGA 1NBHA 2ZXFA 4AL4A 5HSGA 2FW8A 1QGOA 2E5FA 3RSHA 1ULHA 3X1DA 2J9ZB 4LDAA 1NVWQ 1FUEA 2NUPB 4QUJA 2CE7A 4Y9TA 3R8XA 3W78A 3WTBA 5IKPA 5JQWA 3W6ZA 4TXHA 4EHNA 1IH8A 3PUVA 3TZEA 3WC4A 3CEAA 3HKEA 2QMOA 2ZSIA 2JI7A 3GLUA 1G9TA 4JASB 4L2IA 1DPGA 3KOOA 3QVTA 4F5WA 1VLHA 3BA6A 1EJ0A 4J0QA 3ABQB 3IMFA 2HSDA 4F4UA 3HC7A 4C7OA 2IYTA 2E5LB 3R09A 3VJKA 2XGMA 1WKCA 1GLGA 1HEIA 5JU6A 2A57A 2ADOA 3E81A 4WA8A 4ZYZA 3VYVA 3NBZC 2P0AA 2PGNA 1R0WA 5B3JC 3A3NA 2QJRA 1BX1A 3OPYB 1JG1A 2ZJOA 1QPGA 5DNEA 1EK5A 1J2EA 3NRJA 1CNMA 3CSDA 1EP1B 1ZONA 1J0DA 4KO2S 1PV2A 2ZJYA 2ZITA 1FDTA 5CK5A 1TTTA 2DJIA 3GZJA 2B8EA 3MQFA 4KX5A 4MO2A 4WHMA 1NSYA 3EG9B 3IQXA 4XZ3A 5FPHA 3X1ZA 1G8SA 1BSVA 1NJSA 5AJYA 5HEKA 5J59A 2GFIA 4EW6A 4AECA 1A97A 2VAVA 1VSUA 1KAQA 1NJ8A 2QNRA 1VHWA 3RQSA 1KO1A 1SZDA 4FSDA 2EDAA 3ITKA 4IL5A 1PNOA 2IIVA 4IQ0A 3WHPA 6REQA 2R8RA 4UUNA 5DBIA 3TKYA 4Y2HA 1B0UA 1G64A 4YVFA 1O95D 3BVPA 2IUUA 3ZN2A 2V6JA 2FB9A 3R44A 2ANBA 4M7PA 5HF5A 1O6FA 1U0GA 1OC2A 4LCBA 1R4NA 4AI6A 3DXZA 1EDDA 2RKWA 1CSEE 8AT1A 4EJMA 2GN0A 3N3BC 2B83A 4QYTA 1Y7TA 2JFGA 2ZPAA 1VBKA 1T8YA 2P3LA 2DMRA 3T1HB 1L4LA 3RIMA 3VH1A 4WBSA 2BH9A 2A33A 4RJLA 1B42A 1GV1A 5JDCC 4ZVPA 4DMLA 3RUEA 2OMEA 1MB0A 3IQWA 2BZSA 3ZV3A 5JI3E 1IUNA 4XWGA 3H2GA 2JFFA 1NW3A 1AUVA 1ESMA 3DEFA 3CRMA 1TW3A 1PRYA 1LK7A 5T4FA 1UJ5A 4LMPA 2HRCA 5HK9A 2WZCA 5GMOA 2P8SA 3KKNA 4BOYA 2JVJA 3NNNA 4H1WA 2DFTA 4URXR 5TC4A 1SNYA 1KORA 2YHIA 3KUDA 2IU3A 3GUCA 4UXIA 3W34A 3IPCA 3PLAE 4K7JA 4RY2A 3C8MA 4O25A 2IZOA 1JWBB 1RNLA 2Q4BA 2OCGA 4I36A 3BA1A 3GRFA 1PHRA 5IC6A 1TT5A 4NYIR 3PIDA 5IABA 3ADPA 1JS1X 4MPJA 3SF8B 3I39X 2Z2ZA 4FQ8A 2VK4A 1QH8A 4D96A 4ENUA 1M2KA 2ZBDA 3VPCA 1FNMA 1BU5A 1CX9B 1NA5A 3PFWO 3R7SA 3FB4A 3PUYA 1SOMA 1UEIA 1Z5ZA 2II6A 2PM8A 2VLIA 4POAA 3CYFA 3CEJA 3T9BA 5EWLB 5IBCA 3UAXA 3EPLA 2FJPA 3JYLA 2ILVA 4FZ5A 4BCDA 2XMZA 1B93A 1ZG3A 3PWZA 1PJCA 3DFIA 4XVHA 5IK2A 2VVTA 3PFNA 4EM6A 3COYA 1X7XA 2IITA 3QOYA 4YDRA 5JJLA 2ZJ4A 1SGWA 3DO6A 1W8IA 2C0PA 3W9BA 3FKJA 1FDVA 5JALA 2ZAYA 4M21A 4O4IB 4W1SA 5JAQA 1T91A 1UJ6A 1Z06A 3OU7A 2EYQA 2H31A 1MX3A 4LI0A 3IAXA 4RK0A 5EHNA 1ZN2A 1PGJA 3KU4A 4JI6B 2HK9A 3W8EA 1FVXA 2OCAA 3ZTYA 1SHJA 2A1IA 4W5JA 4ETNA 1SIBE 4R8SA 2PA3A 3V48A 5IDYA 4G5QA 3N8GA 2XUAA 4KRGA 4TUYF 1A77A 2GO7A 1L1EA 4FTWA 5K01A 2XXJA 3NHSA 2PV7A 5F3DA 4GUAA 4I5EA 5K8UA 3FOEC 4CQJA 2BFBA 1GHTA 1ZK0A 3K4QA 2UYYA 3FXAA 1W96A 4ZALA 3R75A 3AIMA 5CK4A 2P2GA 3KFXA 1F38A 2HCBA 1EM8B 4N0DA 2PUVA 3O3NB 2ZUDA 4HNAA 4WFJA 3R40A 1Z4LA 4TKLA 1QORA 4UUOA 1IBMB 2REQB 4BWYA 1XPRA 1X0VA 2EOAA 3CNQS 1EVLA 1UMDB 2CB9A 2NMVA 1TCUA 4KQEA 1DC4A 5AVKA 2Q3FA 2GPYA 3DDWA 4D4MA 4KE9A 3TEMA 4DIMA 4EMUA 2O8BB 1HFWA 1RM0A 2IA5A 4HPXB 3TQOA 4F96A 5BUCA 2XUZA 4OM7A 4YP5A 4C4ZA 5IXYA 4HNHA 4UAUA 4WDRA 4C3OB 4I1YA 4IJMA 5HIIA 3FYSA 4NU8X 2RIPA 4D6YA 2XQJA 3V1TC 4DY6A 2YKGA 3TRFA 3GGGA 1T6XA 1JH9A 3ETDA 4W7IA 4UFNA 1L8XA 5C3UA 2ICAA 5IEJA 5CVVA 1QVVA 2XGSA 1CF9A 4HZGA 5DOZA 2GSDA 3UB2A 5IVIA 3LXRA 2OBYA 1IM8A 2C96A 3JQ6A 1IULA 3AETA 5DXFA 4BRWA 4OD0A 5CDFA 1JDTA 1JIJA 3QXGA 1QFSA 5KTYA 4WKGA 2NVBA 3V7NA 4DCCA 3ZD8A 4E3ZA 1XROA 1RPAA 1RWXA 1RTKA 3A6LA 2BKLA 3N58A 2F4VB 2YZ7A 1AXGA 1H2XA 3OQOA 3QFTA 1ILWA 3IHLA 4Q47A 3CF2A 1EWKA 1Q0SA 4V39A 5EIWA 1GKLA 2L0XA 4UQPA 3TIFA 1YDFA 3OA0A 3SDSA 2QJFA 1O5IA 3IDSA 1OAAA 5CBPB 4OBWA 2CHVA 4NMHA 3G23A 4QBGB 5E8JA 4RE5A 1XNHA 5DZSA 4K0KB 3AXSA 4RFVA 3GEIA 3AEKA 2FOIA 2IS4A 4Z0PA 3K9CA 2XOXA 3CEPB 2QTLA 1G6OA 4OH1A 4QSMA 2P7HA 2WZBA 2W6ZA 5H3HA 2BP7A 4HAZA 2VNAA 1X7ZB 2DR0A 3ESRA 1M1YB 2YFYA 3BXPA 2ZT7A 3A4MA 1LJUA 5ARDA 2BZGA 3DLTA 4FDTA 4GW3A 4LTDA 2DSNA 3NFYA 3OFSA 4BRSA 2EC5A 5EMJA 3E5RA 1MB9A 1QHSA 2NT3A 2TMKA 3HYRA 4ZCPA 2VO1A 2AUTA 1CHDA 3S4YA 1ZM7A 1WX1A 2C83A 1JEQA 2YJ4A 1JAXA 3DMHA 2OZLB 3KEQA 2R7NA 3S68A 4NYJR 1P74A 4MS4A 4D6XA 4JJ8A 4EW1A 4GE0A 2ZUWA 5BSFA 5HBGA 3TQFA 2GLUA 4E7OA 1TZ2A 2CEKA 4HDNB 2FMKA 5AW4A 4EKDA 4RA6A 2Z4RA 1Q2XA 4RAQA 5CVTA 2FNAA 3GJQA 5IUNC 3A9WA 1A9XB 1QGAA 2ACKA 4MKZA 4BKMA 2G9UA 1XZQA 1VMEA 2C2GA 3IR6A 3PVZA 4PO8A 1RRPA 3OD1A 5ELXA 1RD4A 5JTTA 4MUEA 3TJMA 3MJDA 1IVSA 3BWDD 3EXAA 4NEQA 1ND6A 2DY1A 3BWEA 1ZH2A 2HQRA 3B9QA 4XIIA 1HA3A 2YZ2A 2OV1A 3AV3A 3QTTA 5F3WB 3OFKA 2COUA 2H1CA 3OQ1A 3DJFA 1NXTA 5FO0A 3LHIA 1JEYB 2DBRA 4YLGA 3U44B 3I6YA 2O7SA 2QT0A 3PEYA 5EE3A 2FUG1 3N86A 2P3OA 2YHUA 3S3TA 1IBLB 2AVDA 3V1NA 1PZNA 3RARA 3VPBA 3F4BA 3AGQA 4HVTA 2OOSA 4JFRA 3TAUA 4DA7A 1HZZC 3FH0A 3DS8A 1RXEA 3QIAA 1OTYA 1SU6A 5C34B 4BL5A 4XB2A 4LY0A 3O31A 5IH7A 3ICEA 2MSLA 1SU8A 2J0UB 3KEFA 1AUXA 1XPJA 4G5RA 5F5NA 5DULA 4M9CA 3B38A 1N75A 2GHTA 1X7HA 2PXCA 3AR3A 1ZRMA 2XMPA 4JUCA 2WWXA 1JYFA 1GV0A 4MLPA 2AOVA 1IEQA 1PZFA 2OC9A 4N5LA 4O2AB 3RC9A 5H1YA 4B87A 1NJFA 3T3OA 2FRXA 3GGPA 1C3OA 1GR0A 1CDEA 1XV5A 2VSYA 4R0VA 1WBBA 1FJGB 2GCOA 4BE9A 4C2TA 4HYEA 1EPUA 1BNCA 3WK6A 1ND5A 1JLMA 1T0IA 4EABA 2GDJA 1KAHA 4KPYA 1ONNA 2L17A 5K51A 2WLSA 1FRFS 3WYGA 4LHEA 4O1MA 5AW2A 3LCRA 1MJ5A 2CLOB 2PH1A 3GUVA 3I52A 4JI0B 1MH1A 4N9WA 2O8DA 4N8DA 4UBOA 4IKPA 1TB4A 5J4KA 3QVGA 1NRJB 3ZD7A 2AKYA 3RRMA 2BMJA 1JXOA 3AQ4A 3HO6A 4L02A 1LBHA 5B58C 1W44A 2MSWA 4X94A 4QVGA 2E2WA 2VYFA 2EJWA 3BB4A 3MRSA 4HPWA 3BD6A 3QXHA 3ML1A 3HXPA 2PX2A 3WLNA 3ZE1B 2Y05A 1NPTO 3ASVA 1UAGA 4IO0A 1NI4B 3BTSA 3DMTA 2IYYA 4Q4AB 3DV0B 4E5MA 5M34A 2POCA 3H9EO 1QANA 1A8HA 1LPSA 2AJLI 4MQLA 4R8LA 2C0CA 1DV1A 2IFTA 2ZE5A 3DUFA 3GLIB 4DV3B 4N41A 2WSBA 4BIMA 3SEAA 2PE5A 3KL4A 1O9HA 5LMNB 2XCIA 3CNHA 3JX9A 1XG5A 2ZKLA 3H1BA 3OQ6A 3DOFA 3AF0A 4MGHA 4C0HA 4ADSG 3NWOA 3DDOA 3Q0EA 5DM1A 1QRUA 1KP2A 5BW8A 3DTTA 1TZMA 2SHKA 4XE5A 1FNCA 1S89A 2W6IA 2VF2A 3STHA 3HB9A 3E7WA 3SAJA 4CM1A 1R9MA 4BB9A 3JSXA 1ZU5A 2DF8A 5KNDH 1DC8A 4WOKA 1ABEA 4NS1A 5DGIA 4MW9A 1A50B 1E2PA 2NX2A 2NVWA 4LZWA 3TN7A 3U2QA 4PQRA 4DDWA 3KSBC 2FYTA 2GZDA 4MI6A 3UGTA 3BWMA 1WZIA 2CL7X 3A6FA 3ND6A 1ORRA 3FDXA 4E21A 3TCKA 1B0AA 1YQTA 2R3SA 5F2OA 3OE7D 5ICFA 1AB5A 1E7QA 1MO5A 2Q3DA 3R5XA 3LT0A 4IP0A 5JCXA 4ZVSA 1YQXA 2ZRLA 5I7UA 1IJBA 2A3RA 1ZVQA 2A0YA 1PFGA 3A14A 3ER6A 3RYIA 1XZFA 5KSWB 5FUMA 1B8PA 2RK4A 5KVCA 5B2FA 1U63A 4ZOQI 2Q5IA 3I8OA 2MINA 3NUGA 4W4TA 3T7SA 4ZRDA 3I9MA 4IIXA 3MHPA 4HAIA 1KAGA 1J33A 2P0YA 3KELA 4I9HA 2PAAA 1BQ3A 2KBEA 4XLZA 4YMVA 1DHTA 3GLGB 2RE8A 2D6FA 3OMLA 3MS2A 2Q4DA 4ZD6A 3RGWS 1CJBA 2KX7A 2CCKA 2Z1DA 2YCBA 3LCVB 4OQFA 5F2EA 3I3SR 2EGGA 4WN3A 3RUIA 1SB9A 5D2CA 5TJ9A 1GPJA 3CLRD 4PO9A 2UXCB 3GGOA 3EGEA 3AP3A 5D7BA 2Q45A 3MM4A 3HR8A 3G2NA 2OHXA 2ZR9A 3SD7A 2I4MA 3V8EA 1M6NA 3L8MA 4FHGA 1QAQA 4OQXA 1GD1O 3ZCXA 2R1VA 1ZRSA 3EQ8A 3TWOA 2W93A 4P4LA 4LDNA 1T1GA 4Q4DA 4LJKA 3VHXA 4BV9A 2V0GA 3USZA 4YGYA 3T7JA 4YUZA 4QBHA 2WZQA 1UFOA 2R25B 2BGJA 3QVKA 3VZSA 4QPDA 3BK2A 1SUAA 2FSVC 3HCEA 4JXZA 4YGXB 2DC1A 4X3CA 1K97A 2JGMA 1VKRA 2AFHB 5FTNA 3VZQA 5EZYF 2Q6LA 4DMUB 1Z4NA 5DYTA 3I9V1 4ZKEA 3RANA 4E2WA 2JGDA 3LBIA 3HO1A 3ANNA 4EYOA 2NUTB 4AD8A 2R00A 1QUEA 3P0JA 4ND4A 2C7PA 4PLWA 2DY0A 2B37A 1G5RA 3ZU3A 2E37A 3DNMA 5KOIA 4J1QA 5KCZA 3CRNA 4NR0A 2O2JA 5IUKC 5DE3A 3JZDA 3CJQA 1SCUB 4ER0A 1XWWA 1U8ZA 2HU5A 1ODLA 5IDQA 5DM70 3T7AA 1FJ2A 3X1WA 3PXDA 4XFJA 3LQ1A 4JA2A 5U4XA 3T0IA 4UVDA 4CKXA 3F6RA 3KHSA 1TO1E 3WKCA 2VF5X 3OZWA 4BY9E 4LAFA 1TTPB 4MNTA 5LP6B 3R76A 3AZOA 5FI3A 2AMYA 4MQEA 4PSAA 2PJRA 2NP6A 2YVQA 2HNAA 1JT2A 2NUPA 2QUAA 4IH4A 2NYVA 3SFVA 3D6VA 1CWUA 2OVFA 1M2EA 4RA9B 4NOLA 4XQCA 1SD2A 2X9NA 5LQJA 1W6UA 2PMCA 4KDFA 2C2OA 3G2PA 5TEVA 5TPWB 5KJCA 2XBLA 2DXIA 1N32B 1TZCA 1U80A 2O0LA 1VL1A 2R97A 1IY1A 3AI7A 5F12A 3P9CA 4RFSB 1YTLA 1P80A 2XVMA 4F8EA 2OAP1 2I6SA 1EK6A 4IX1A 1R0ZA 1AF7A 3LT2A 1FL9A 2ZJ8A 3QPUA 4GMFA 4KITB 2WV7A 2XUDA 4GOJA 1N2EA 1NQOA 1QHNA 1E5QA 1W4RA 1WDLA 2GF0A 4MJ7A 4Q9AA 1V95A 3DWFA 4RHTA 5DBEX 3VTZA 3IR5A 4FT4A 3W3AH 1R7RA 4HNGA 4FDMA 1MAWA 1QFMA 2ZJ0A 3OPYA 5CRIA 4YRIA 3GBVA 1MXHA 3QX7A 4TL6A 5I4BA 2E4YA 4B4VA 4KHZA 4DZZA 5DHAA 3M3DA 4IMIB 4LHYA 4QUHA 3UXEA 3C5HA 1Q17A 1E79D 5KWEA 4YJ2F 5G1NA 1U8FO 2CHUA 1CZUA 4HRXA 2PGOA 5HF8A 3EG9A 5ULLA 4B43A 2ONZA 4D3FA 4Q01A 3L7BA 1ECFA 3NBUA 4R01A 5SY6A 1LVGA 2HNKA 4DWVA 1V0JA 5T6MA 4W5OA 1N5KA 2XZPA 4OK6A 3SSAA 1EBFA 4DB4A 4I9NA 4Y6GB 1RSZA 1Y7HA 1P72A 2I3AA 2QGFA 3GLGE 5I7HA 4HLNA 3BGVA 3F7NA 5AOVA 2R87A 4DSNA 4HD8A 4JYMA 2H1HA 5DSTA 5AK6A 4UULA 3IEUA 2PBZA 3WL8A 4TM8A 1C9YA 1ZEJA 3GD5A 5FUYA 2JGNA 3RS0A 2MT9A 1JHQA 5EIOA 4A0FA 1J42A 1GZ3A 4DV1B 5I8WA 3WO0A 3H8WA 2CZCA 1EFCA 3SVZA 3BAZA 1YS2X 1JG7A 4OB8A 5F7OA 1WW2A 2CLKB 3U1TA 1KH1A 1U2GC 1YBMA 4IO1A 3L0IB 1LRJA 2ZBUA 1H5NA 2VHWA 4FGLA 4LJ4A 4HAWA 4NF2A 4DDMA 4FXOA 4ZQIA