5L4HA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with 5-(2-bromo-ethyl)-5-ethyl-pyrimidine-2,4,6-trione (brominated barbiturate)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4hA01
3ZDHA 2XYSA 2X00A 3U8KA 3T4MA 4BFQA 4X5TA 2XYTA 2XNTA 5HCJA 4QH5A 5TVCA 2BYQA 2BYPA 2LKGA 1UV6A 3WTOA 4IREA 2BR7A 5L4EA 2Y56A 4Z90A 4ZZCA 2YOEA 2ZJVA 2BYNA 4AFGA 2M6IA 2YN6A 2BJ0A 3SH1A 3JAEA 3RQUA 3JAFA 4LMKA 4TWDA 3UU3A 2BR8A 4ILAA 2XQ5A 5KZUA 4ILBA 3TLTA 2LLYA 4HFBA 4HFHA 4IL4A 4TNWA 5SYOA 4ZK1A 5AINA 4EZ1A 3TLVA 2XNVA 2BG9A 4DBMA 3EHZA 2QC1B 4QAAA 2Y54A 5LG3A 2ZJUA 4BQTA 2LKHA 3WTIA 3UUBA 2X00D 5L47A 2KSRA 3TLWA 3PMZA 3WTHA 3RHWA 5HEJA 3U8JA 4UY2A 4QABA 4HFDA 5AFJA 1I9BA 2Y7YA 1UW6A 4ZJTA 4UM3A 4ZRUA 3ZDGA 3IGQA 2XQ7A 4ILCA 3PEOA 2XQ8A 4A97A 5IUXA 5JMEA 2YMEA 1OEDA 3EI0A 4WV9A 5AFLA 5J5FA 2BG9E 2XQ9A 4QH1A 4TWHA 5CFBA 3UU8A 3WTJA 3SIOA 3U8NA 2C9TA 3TLSA 3P4WA 4F8HA 4QACA 2YMDA 5HEHA 4AFHA 3C84A 2BG9C 3SQ9A 4Z91A 2XQ6A 2WZYA 2M6BA 2PGZA 4NZBA 2PH9A 2XZ6A 5HEUA 3C79A 5LXBA 5FJVA 3JADA 2BG9B 5J5GA 3RI5A 3EAMA 5KE4A 3U8LA 4UM3S 4LMJA 3ZKRA 3WIPA 4D01A 3UU5A 1OEDE 4HFEA 4FRRA 4PIRA 3WTKA 4TWFA 3LSVA 5AFMA 3TLUA 1UX2A 1OEDC 2XNUA 4HFCA 3U8MA 4B5DA 5BW2A 3RQWA 5AFKA 4HQPA 1OEDB 5J5HA 2BYRA 2WN9A 4AFTA 5J0ZA 5HCMA 4LMLA 4A98A 4XHEA 2WNCA 3UU6A 4HFIA 4XK9A 3WTLA 5J5IA 3P50A 3UQ7A 2W8FA 5AFHA 2MAWA 5L4HA 4NPPA 4ALXA 5HEGA 3RIFA 2XQ4A 5BP0A 2Y58A 4ZR6A 5HEOA 4IL9A 3UQ4A 4ZZBA 5CO5A 3RIAA 4COFA 2XQAA 2LM2A 4ZJSA 2W8GA 3GUAA 2Y57A 3SQ6A 3WTMA 2UZ6A 5AFNA 5BRXA 2VL0A 4UXUA 2XQ3A 4TNVA 4UM3P 4UM1A 2WNJA 3WTNA 4ZK4A 5AFMB 2BYSA 3UU4A 2WNLA 4QH4A 2XZ5A 2YKSA
chains in the Genus database with same CATH superfamily
3VRAA 4JI2T 2PG8A 3ONXA 1X9BA 2JRKA 4KHPT 1YKEB 3VU7H 3WTOA 3Q9DA 4ISTA 2ZJVA 2V7MA 1IBKT 2YN6A 3NZPA 2BKNA 4JUYA 3CK6A 2EHOD 2WAUA 4CZZB 5BR8T 3UUMA 5JDHA 4CN6A 5J2UE 5JQGE 5JDGA 2X68A 5FNVE 4JI7T 2LSKA 4UEMA 3N9PA 3ZN1B 5HWYA 3RKGA 2MBGA 4DR1T 3PEOA 4DV2T 3AE3A 3PU3A 4PJMA 3U8NA 4QACA 4OYKA 4IDQA 4NZBA 3N9OA 2XZ6A 5LHHB 1VCTA 3JADA 4V1Av 3RRWA 4UM3S 4YT0A 2JQHA 4EB6E 2WMNA 2N2NA 3KV4A 3OKQA 4AFTA 2A9UA 3C4XA 3PTRB 3CQGB 3P4SA 2XAHB 3M65A 2XHEB 2IC6A 3HI2A 3ETVA 3FBLA 2WMOA 5M4YA 2QYWA 5AQTB 5AQJB 3WTNA 1MIWA 5DABA 3RPUA 2DLRA 1NEKA 3ZEFB 2V7LA 2XYSA 4AI6A 3U8KA 4XBFB 3JCFA 4H9PC 2DWKA 5AQFB 4DV3T 4EYUA 1J5ET 2BYNA 5BMVE 2KINB 2D0TA 3JAEA 1T8BA 3TLTA 4GIWA 4HKAA 4YTMA 2LKHA 2H7OA 2ZM0A 2LSGA 2XQYA 3OYXA 4KP3C 2I6HA 3H37A 2Z6EA 3AAEB 3ZYKA 2WDQA 3PV0F 3UU8A 3BQLA 5FL1A 4HE8A 3J7Yq 4MALA 4AQFC 2JQQA 4B3RT 1FMVA 1VOMA 1D1CA 3QOFA 2H3RA 1ZEEA 4DV4T 4HFEA 3BK9A 5KDMC 5CGMA 4EZHA 5AQSB 3C51A 2LT3A 4HFIA 3DJBA 1MMGA 3PJAJ 5HEGA 2IHR1 2FJEA 2MYSA 4L5GA 4IE4A 4AISA 3GUAA 5JDNA 4JEHB 4LF4T 5KX5E 3B5MA 5JH7E 3SWHA 3MXZA 2CRBA 5FVKA 3ZDHA 2LOPA 5JR9A 3RIUA 1WR6A 2BVLA 4U2YA 4BJNA 4ZI2C 3UUNA 3QNUA 4KX6A 1UV6A 4U74A 4U7YA 4UV9B 2V6XA 1E2AA 3I0OA 4A56A 3K1SA 2KZ7B 5LHIB 1J1JA 1KF6A 2M6IA 4IE6A 3L3PA 2LSJA 1CHUA 3MZKB 3SH1A 2CM0A 3RYCE 4JLEA 2VWAA 4YXDA 2J1DG 1T98A 1GQEA 1JNZA 2V7IA 4MFRA 1WRDA 2OLTA 2XM2A 5ABFA 2IC9A 5L47A 4AXPA 5LBMA 4FJOA 3QUJA 1LVKA 5CB4E 4UM3A 2L8KA 1US7B 5LMUT 5CFBA 4GK5E 4PK6A 4O8SA 2KT9A 3ZMTB 5A1LA 3PURA 5HEUA 2BG9B 5LBQB 3RI5A 3AE4A 2LRKA 3U3IA 2PJQA 4PJNA 1KNZA 2M67A 1NAFA 5FYMA 5HCMA 4XHEA 2A2FX 1YD8G 3I0QA 4HWHA 4PJLA 4IHJE 5HEOA 4I55E 1FJGT 4EEBA 4B3MT 4UXUA 1AJ3A 4IDNA 5AFUL 4H9OC 5LB7B 2WNLA 3AXJA 1VCSA 3HKDE 4G2AA 3H3MA 2V26A 3KVAA 4AQFA 4DMWA 4ZI3D 2QA7A 3GN5A 3T1YT 2Y8DA 3U78A 2EHOB 1XNRT 1YW0A 3UFEA 3ONJA 3OPCA 4ZK1A 5KMGP 4HN9A 3CIRA 3LBXB 2X00D 1IBLT 5H6RB 5LJMA 1IJ5A 2X9WA 2E9XA 4TWHA 3WTJA 3N9MA 2XUEA 1X79A 1BR4A 5JDFA 2M6BA 4DR5T 3N9NA 3NWIA 4UVCB 2V7KA 2XAJB 1UX5A 1MMAA 1KFYA 5AQKB 3LSVA 5AFMA 4C91A 1HNZT 4HFCA 3RGLA 3RX6A 1BR2A 1OEDB 5J5HA 1N33T 4KUMB 4XK9A 5AFHA 2CXDA 2QRXA 5L4HA 1XNQT 4F6RC 4O4IE 5CO5A 4BA9A 2UZ6A 2LOSA 3BQKA 2WNJA 3FBZA 3UU4A 2VK9A 4QH4A 3ZJ1A 3PUWF 3AEFA 4QH5A 1Z0PA 3PDYA 4PJJA 4H9RC 4DV7T 2YU1A 3O1JA 3SFEA 2HN1A 3TKLB 2PFVA 3ZC1A 3MA9A 2OA5A 1HX1B 4TNWA 4YSYA 5LHGB 4TV8E 2YDSA 3K3QC 2WS3A 4HFDA 2RA1A 1IAPA 3ZC0A 4A97A 4X1YE 4HWCA 4EOZB 2BG9E 2XQ9A 4CI2B 3VRBA 2V6YA 3TLSA 3A5XA 1UUSA 5JVDE 3DTOA 4JBWF 2BG9C 1YQ4A 3ZPOA 3AE2A 3AE9A 2YDQA 1HFAA 4M1PA 1XMQT 2H88A 3KDSE 3RRCA 3SFDA 2J47A 3LDQB 4G63A 4B5DA 5F8PA 5AFKA 4GKJT 3OJAA 4IE0A 2CBIA 5HWXA 3N2GE 5FXWA 2Q9QC 1WYCA 2UUAT 5ABHA 1R8IA 2K24A 4YY3T 1KK7A 4AKHA 4ZJSA 2IUBA 4EIWA 2VL0A 4O4HE 2FUPA 3VHLA 1FEWA 1B7TA 3I1AA 2BYSA 3K8PC 2BYPA 5L4EA 1OXZA 4ZZCA 1WFDA 1W0AA 2BJ0A 3ESLA 2AE9A 4TWDA 4ILBA 2LM9A 3NKZA 4DR7T 2ZM6T 4UF0A 5AINA 4EZ1A 5JRCB 2WDRA 1FMWA 4QAAA 2ZJUA 1XMOT 2YU2A 5H6QB 2CHNA 4NUUA 4DV5T 3RKOA 5GONE 3PJAA 4U2ZA 4ANJA 2YEVC 2C9TA 4LF5T 3SQ9A 4OHFA 3ANWA 5LA6E 3LK3B 1OEDE 5LGUB 3WTKA 3H3AA 3KINB 3ZSTA 1OEDC 5JREA 2X9YA 3ZT6A 1MNDA 5J5IA 3T8OA 3CQXC 4A5XA 5HXSA 4ALXA 3QK6A 4C90A 2HN2A 5L3DB 4DNDA 2WM9A 4ZR6A 4IL9A 1T7SA 1MNEA 2E5LT 4NXNT 5BRXA 5HYAA 3B57A 3S4UA 3D0TA 5DJQC 3AE1A 4DMVA 3T4MA 4LFBT 2KWHA 5LCYA 2LKGA 5L3EB 2VURA 1XWMA 3C98B 2IW5B 2GK9A 3JAFA 3GA8A 4LMKA 2BR8A 3HKBE 5EK3A 5KZUA 2IMLA 4Z8XA 1XZYA 2V5CA 2Q9QA 2CPTA 2QC1B 1J5WA 5AQIB 2X66A 2XY8B 1HNXT 3FHNA 3MK7C 3WTHA 4TX5A 2IAKA 2WSSV 4QABA 4AKLA 2DL1A 1T72A 2JIWA 5JDLA 1I9BA 1D1AA 4ILCA 1CUNA 3KV6A 3IA3A 2WP9A 5IWAT 4I50E 2CE7A 4P09A 5FJVA 5L3FB 4H63H 3R6NA 4EXTA 3C4ZA 4KBMB 4DUYT 1JNRA 3R84B 2PBIA 4QXBB 3ZJ2A 4ZI7E 5IYZE 4I0UA 3C64A 2ODUA 3OBVE 3VR8A 4K0UA 5BP0A 4ZZBA 5LYJE 2BBHA 2WY2A 1D0XA 2QVAA 1W0BA 2X0LB 4OYJA 3PUYF 5LG4A 2XYTA 5TVCA 1S35A 3QB5K 4UIGA 2NW7A 3ZT7A 2LSYA 2CWYA 2W00A 3UULA 2YOEA 4ZEYA 3K3NA 2VQFT 3PUXF 3UUXB 4OFZA 2XQ5A 3SOLA 2LLYA 4QX7B 4IE5A 4E7ZA 2LSIA 4DR6T 2CWOA 4HWIB 3OVUA 5AQLB 2N1GA 5FXZA 3UUBA 3PMZA 3MACA 3Q5DA 2F4VT 3ZN0B 5JMEA 2YMEA 5FVLA 1UX4A 4ZS3A 2XM1A 4MLKA 4HGAA 4TV9E 3RLFF 2HPJA 2PGZA 5LXBA 5J5GA 5KE4A 3ZMUB 3U8LA 4YSXA 2BDEA 4YLHA 4FRRA 3VKGA 3AEDA 3AVSA 5BW2A 5J0ZA 2C5JA 2W8FA 2D0UA 2MAWA 2CBJA 4O4JE 2E9XD 4EZ4A 2WZHA 3CQCB 2D9DA 3AE6A 5JTGA 1OWAA 3SQ6A 5AFNA 3RC8A 1IBMT 3CWZB 5LMNT 4P0AA 3SRZA 3F31A 1Y01A 3RYHE 2JMHA 2L3LA 2VVSA 4ZI3C 4DBRA 2XZ5A 2D2SA 4EEDA 1SUMB 3FZMB 1SA0E 2VASA 4PK4A 3NRYA 4CXXA 2X9HA 3T1HT 1IZNB 4BAYB 3IBPA 2KLQA 4X1KE 2FBWA 4B6XA 4HFBA 4HFHA 2UUCT 5SYOA 3A7MA 2KNDA 2WCAA 2CMRA 2JQ9A 4BQTA 3WTIA 3EVYA 3U8JA 2FJAA 2G0UA 4CN4A 2ODVA 3AEGA 3P4RA 4O2BE 4AKIA 1Z8UA 2E8IA 2WBLA 4WV9A 5J5FA 4DR2T 4GKKT 3CX8B 3IF8B 1LRZA 3N2KE 2HPLA 2IDOB 4YHHT 3AA0B 3WIPA 3A8YC 3UU5A 3HL6A 2UXCT 2Y48B 2UXNB 3BQIA 3P4PA 2XPKA 3AA1B 3LFMA 3WI3A 5EK2A 5L3BB 4NIQA 3ONLC 3X1DA 3UU6A 1ZHCA 1KNPA 3P50A 3HR0A 2MTQA 5HAXA 4NPPA 2NW8A 1W9RA 2HH7A 3AA7B 3FZKB 2X67A 3RIAA 5EK4A 2E5VA 2XQ3A 4UM1A 4WNKA 4ADZA 3PE0A 2K3WA 4IT4A 3NZQA 2XZEA 5ABGA 1ZV4X 2K48A 5HCJA 5CA0E 3RF1A 4P1NA 2L9QA 2BZBA 1DU2A 3W15B 3PUAA 1FIOA 1E7PA 4ERRA 1HTJF 3ZMZB 4CI1B 2XSBA 5JR9B 4JEUB 2XNVA 2B1EA 5LG3A 3O1IA 3ETUA 2RP4A 4B3ST 2UXXB 2ES0A 2FJDA 2WDVA 3NBXX 1MMNA 3CX6B 2LRLA 2W67A 3IHRA 2NOXA 4PW8A 5ABFB 2ZMAA 4U31A 4U33A 3C4WA 4LF7T 5FL0A 2D5UA 3TLUA 4TUYE 3AEAA 4EYYR 2XNUA 2LJLA 4QXCB 2W2UA 4GYSA 3EUHA 2XSAA 3PUZF 5LP6E 1O3XA 5DQVA 4IIJE 4I4TE 2KMFA 3IEEA 4JI3T 2WQYA 3RIFA 3AAIA 2Y58A 3UQ4A 3LG7A 4EV6A 4N78D 4X66T 4DIDB 2W0GA 3Q5WA 4AIUA 4B3TT 3L8RA 5LOVE 4U7IA 4BFQA 2BYQA 2BVMA 2JQKA 4Q25A 3JC6D 5ETWA 2ACXA 4Z90A 2YINA 2DNXA 2RPAA 2JJ9A 1LKXA 5AQNB 3HKCE 3WAKA 4YFSA 3PUVF 3QC9A 3AXJB 2E2AA 3O4XE 3KFWX 4HWDA 4LF8T 2BS3A 1QUUA 2CCQA 2P9BA 1UGOA 2EHOC 3GN5B 3ZT5A 3I9WA 3M3ZB 2BBJA 3F2EA 1YXRA 2XQ8A 3SS1A 2VB6A 4WBOA 3CVRA 2KXPB 3VKHA 4YHJA 3C84A 2WWUA 1L0VA 3C79A 2K5BB 1W09A 3ZCIA 2NWBA 3EAMA 2MOZA 5E0OA 2Q9QD 3ZKRA 5AQVB 2VKDA 2X0HA 4TWFA 4NXMT 3RH3A 2A72A 1HG5A 4HQPA 4TN7B 2BYRA 2E9XB 1QLBA 4LMLA 4HFVA 4A98A 1D1BA 1S94A 3WTLA 2AXDS 2CEAA 1YKHB 2VKJA 2X9XA 4U3CA 4OX9T 3AEEA 4X62T 2NTYA 2V7JA 4QHOA 4YJ3E 3ZYMA 4KI0F 1KNRA 1I94T 3LK42 4TNVA 4LFCT 5AFMB 4YTPA 2UXBT 4QXHB 1HF8A 3ZMSB 3G06A 5C3JA 4WBNE 3PUGA 1H7CA 4CXYA 2WU5A 2XAGB 3LK2B 4ILUA 1I6ZA 3L09A 3ABVA 2UUBT 4KMCA 1UK5A 2VL8A 2C5IT 2H7VC 3FZFB 3FXEB 3UU3A 5JR9C 3RIUC 5F3JA 3E0ZA 3UTKA 5FY0A 2BS4A 4ZS2A 2BG9A 4JYAT 3RHWA 3FZLB 1WYBA 5AFJA 4YTNA 3P7IA 3EDUA 4ZJTA 4QKNA 4LF9T 2WZIA 2X51A 5L2LA 3QB5A 4PK5A 1VRBA 4AQYT 2ZM2A 2YMDA 1U4QA 4Z91A 2XQ6A 3NVOA 2WZYA 2PH9A 3B13A 2DI4A 4LMJA 2QGSA 2C5KT 1UX2A 3AEBA 5LGNB 3U8MA 3K3OA 4DVDA 4NUVA 1N34T 4UVAB 5AQRB 2V6YB 2ZLYA 4IDOA 4YJ2E 4K0KT 2XQ4A 2W4XA 3AB3B 4H9NC 2EHOA 4L0RA 2YDRA 2XQAA 3WTMA 2IIUA 2Y57A 2B76A 3WAJA 3KV9A 5ABEA 4ZK4A 2FJBA 2J4GA 1YQ3A 1WR0A 3C50A 2HHHT 5TAOA 2C0SA 2W62A 5AQOB 2XNTA 4XAXB 3LBXA 2BR7A 1KEYA 4P0BA 1HS7A 1Y64B 1D0ZA 2W66A 4JI1T 4U72A 3ZMVB 4OK0A 3RQUA 5EZYE 5AQUB 4EGWA 2VKHA 5AQGB 2WB5A 2VQET 4IL4A 3TLVA 4X20E 2I0MA 2Y54A 4CI3B 2DHRA 4JI0T 4DR4T 3N9QA 3ZLIA 4IE7A 4PFPA 3VR9A 5C2TA 1OEDA 5HXHA 1M7KA 4X1IE 4DR3T 3FXDB 1QSDA 4UF0B 2R6GF 5LXTE 1D0YA 4D01A 4DBQA 3FB2A 3V5SA 5FXVA 2UU9T 2E9XC 2A3DA 4AQGA 2V5DA 5FKYA 2WNCA 1HNWT 4PNIA 2NR4A 2N9DA 1NENA 4H63V 5HXRA 2XAQB 3ANWB 2V1DB 3NRXA 3J9X1 4WYVA 3Q5XA 3ZCJA 3MJXA 2CHOA 3E22E 5CA1E 1SE7A 3CKDA 2CLYB 2BKPA 4PFOA 1HCIA 1MMDA 4X5TA 5JDQA 4CXWA 4HEAA 2VVNA 4YSZA 4MBQA 4ZI2D 4BJMA 5LGTB 2YK0A 3I9YA 3EDVA 1N36T 2UXDT 4DO0A 4XZCA 1HR0T 4TZ4C 2LHRA 3TLWA 4LFAT 5AQMB 3ZSSA 4ASKA 4DUZT 4IGUA 3ZDGA 5KXJA 2WU2A 5FXXA 2WWVA 3O1HA 3UFGA 5AQPB 2K9AA 4MHCA 1ZOYA 3SIOA 5FY7A 3GWHA 5HEHA 3RYIE 4O2AE 4UELA 1BR0A 4UXNB 2KWIB 4PAGA 2Q9QB 1V9DA 3E08A 1BR1A 4CQIA 1NWMX 3Q5EA 3KBUA 2V8SV 2I59A 5AQHB 2LEHA 3RQWA 2WN9A 4GYRA 5F5WA 1HX8A 5IHYA 1M62A 3KBTA 4I43B 1IJ6A 3AE7A 4AKGA 2W8GA 1WCRA 4UM3P 3P4QA 2ACZA 5JRCA 3AE8A 5ADXL 4JI5T 2CA5A 5AQQB 2JMKA 3HKEE 3AECA 1EZ3A 1MIYA 4QWNB 4JI8T 1UURA 1SHZC 4JI6T 3OTOT 1N32T 3PU8A 3EABA 4HWFA 3AVRA 5FMNA 2KSRA 3Q2MA 4ZRUA 5IUXA 4H9SE 3F57A 5AFLA 3KV5A 2CXLA 4QX8B 3ZYLA 3V5UA 4AKRB 2XAFB 5L3GB 3RC3A 2H89A 1WLXA 2LE8A 4PIRA 5LNKA 4E7SA 4DV6T 3KVBA 4GOUA 2NW9A 2DCFA 3RYFE 1U5PA 3L39A 2CXFA 2NTXA 3CMLA 3UQ7A 1HG2A 2MPKA 3PUSA 3O9XA 4WW0A 4DV1T 4GK0E 4JV5T 3HA4A 4J2CA 5C8YE 5CJ5A 2CLYC 3AAAB 1LVFA 2YKSA 2Y6XA 3AE5A 3JC6C 2X00A 3N9LA 4FI5A 4X64T 4ISSA 2OV9A 2W63A 4DV0T 2SPCA 3N2OA 4IREA 1G8XA 2Y56A 4HTEA 1MIVA 3CX7B 4AFGA 2BKOA 3FZHB 2X0YA 2XJ7A 4ILAA 4WZXA 4LF6T 4ZOLE 4DBMA 3EHZA 5DQWA 2ZM8A 4KHZF 1UCUA 2BS2A 4ZHQE 5J2TE 4UV8B 5JDMA 4H9QC 5HEJA 5LJNA 4UY2A 2Y7YA 2VKOA 1UW6A 2NP9A 3IGQA 2XQ7A 1E1HB 3MKDA 4JI4T 3EI0A 3OYZA 4QH1A 4X65T 3CPZA 3DP7A 4F8HA 3P4WA 5FP3A 4CN1A 4AFHA 3P8CD 3AA6B 4EAHA 3GMIA 5HXCA 2LHNA 2XASB 3PUQA 1XDOA 2PTFA 2XTLA 3LJCA 5FY1A 5L3CB 5HXEA 1G73A 2JPFA 1ZKEA 4IDPA 1XDPA 4L9IA 4O4LE 5J1GA 3N5LA 3UT5E 4UR9A 4UVBB 4COFA 2LM2A 4IDZA 1ZP0A 2DWGA 2W61A 2J62A 4ZXLA
chains in the Genus database with same CATH topology
3ZDHA 2XYSA 2X00A 3U8KA 3T4MA 4BFQA 4X5TA 2XYTA 2XNTA 5HCJA 4QH5A 5TVCA 2BYQA 2BYPA 2LKGA 1UV6A 3WTOA 4IREA 2BR7A 5L4EA 2Y56A 4Z90A 4ZZCA 2YOEA 2ZJVA 2BYNA 4AFGA 2M6IA 2YN6A 2BJ0A 3SH1A 3JAEA 3RQUA 3JAFA 4LMKA 4TWDA 3UU3A 2BR8A 4ILAA 2XQ5A 5KZUA 4ILBA 3TLTA 2LLYA 4HFBA 4HFHA 4IL4A 4TNWA 5SYOA 4ZK1A 5AINA 4EZ1A 3TLVA 2XNVA 2BG9A 4DBMA 3EHZA 2QC1B 4QAAA 2Y54A 5LG3A 2ZJUA 4BQTA 2LKHA 3WTIA 3UUBA 2X00D 5L47A 2KSRA 3TLWA 3PMZA 3WTHA 3RHWA 5HEJA 3U8JA 4UY2A 4QABA 4HFDA 5AFJA 1I9BA 2Y7YA 1UW6A 4ZJTA 4UM3A 4ZRUA 3ZDGA 3IGQA 2XQ7A 4ILCA 3PEOA 2XQ8A 4A97A 5IUXA 5JMEA 2YMEA 1OEDA 3EI0A 4WV9A 5AFLA 5J5FA 2BG9E 2XQ9A 4QH1A 4TWHA 5CFBA 3UU8A 3WTJA 3SIOA 3U8NA 2C9TA 3TLSA 3P4WA 4F8HA 4QACA 2YMDA 5HEHA 4AFHA 3C84A 2BG9C 3SQ9A 4Z91A 2XQ6A 2WZYA 2M6BA 2PGZA 4NZBA 2PH9A 2XZ6A 5HEUA 3C79A 5LXBA 5FJVA 3JADA 2BG9B 5J5GA 3RI5A 3EAMA 5KE4A 3U8LA 4UM3S 4LMJA 3ZKRA 3WIPA 4D01A 3UU5A 1OEDE 4HFEA 4FRRA 4PIRA 3WTKA 4TWFA 3LSVA 5AFMA 3TLUA 1UX2A 1OEDC 2XNUA 4HFCA 3U8MA 4B5DA 5BW2A 3RQWA 5AFKA 4HQPA 1OEDB 5J5HA 2BYRA 2WN9A 4AFTA 5J0ZA 5HCMA 4LMLA 4A98A 4XHEA 2WNCA 3UU6A 4HFIA 4XK9A 3WTLA 5J5IA 3P50A 3UQ7A 2W8FA 5AFHA 2MAWA 5L4HA 4NPPA 4ALXA 5HEGA 3RIFA 2XQ4A 5BP0A 2Y58A 4ZR6A 5HEOA 4IL9A 3UQ4A 4ZZBA 5CO5A 3RIAA 4COFA 2XQAA 2LM2A 4ZJSA 2W8GA 3GUAA 2Y57A 3SQ6A 3WTMA 2UZ6A 5AFNA 5BRXA 2VL0A 4UXUA 2XQ3A 4TNVA 4UM3P 4UM1A 2WNJA 3WTNA 4ZK4A 5AFMB 2BYSA 3UU4A 2WNLA 4QH4A 2XZ5A 2YKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDH A;  2XYS A;  2X00 A;  3U8K A;  3T4M A;  4BFQ A;  4X5T A;  2XYT A;  2XNT A;  5HCJ A;  4QH5 A;  5TVC A;  2BYQ A;  2BYP A;  2LKG A;  1UV6 A;  3WTO A;  4IRE A;  2BR7 A;  5L4E A;  2Y56 A;  4Z90 A;  4ZZC A;  2YOE A;  2ZJV A;  2BYN A;  4AFG A;  2M6I A;  2YN6 A;  2BJ0 A;  3SH1 A;  3JAE A;  3RQU A;  3JAF A;  4LMK A;  4TWD A;  3UU3 A;  2BR8 A;  4ILA A;  2XQ5 A;  5KZU A;  4ILB A;  3TLT A;  2LLY A;  4HFB A;  4HFH A;  4IL4 A;  4TNW A;  5SYO A;  4ZK1 A;  5AIN A;  4EZ1 A;  3TLV A;  2XNV A;  2BG9 A;  4DBM A;  3EHZ A;  2QC1 B;  4QAA A;  2Y54 A;  5LG3 A;  2ZJU A;  4BQT A;  2LKH A;  3WTI A;  3UUB A;  2X00 D;  5L47 A;  2KSR A;  3TLW A;  3PMZ A;  3WTH A;  3RHW A;  5HEJ A;  3U8J A;  4UY2 A;  4QAB A;  4HFD A;  5AFJ A;  1I9B A;  2Y7Y A;  1UW6 A;  4ZJT A;  4UM3 A;  4ZRU A;  3ZDG A;  3IGQ A;  2XQ7 A;  4ILC A;  3PEO A;  2XQ8 A;  4A97 A;  5IUX A;  5JME A;  2YME A;  1OED A;  3EI0 A;  4WV9 A;  5AFL A;  5J5F A;  2BG9 E;  2XQ9 A;  4QH1 A;  4TWH A;  5CFB A;  3UU8 A;  3WTJ A;  3SIO A;  3U8N A;  2C9T A;  3TLS A;  3P4W A;  4F8H A;  4QAC A;  2YMD A;  5HEH A;  4AFH A;  3C84 A;  2BG9 C;  3SQ9 A;  4Z91 A;  2XQ6 A;  2WZY A;  2M6B A;  2PGZ A;  4NZB A;  2PH9 A;  2XZ6 A;  5HEU A;  3C79 A;  5LXB A;  5FJV A;  3JAD A;  2BG9 B;  5J5G A;  3RI5 A;  3EAM A;  5KE4 A;  3U8L A;  4UM3 S;  4LMJ A;  3ZKR A;  3WIP A;  4D01 A;  3UU5 A;  1OED E;  4HFE A;  4FRR A;  4PIR A;  3WTK A;  4TWF A;  3LSV A;  5AFM A;  3TLU A;  1UX2 A;  1OED C;  2XNU A;  4HFC A;  3U8M A;  4B5D A;  5BW2 A;  3RQW A;  5AFK A;  4HQP A;  1OED B;  5J5H A;  2BYR A;  2WN9 A;  4AFT A;  5J0Z A;  5HCM A;  4LML A;  4A98 A;  4XHE A;  2WNC A;  3UU6 A;  4HFI A;  4XK9 A;  3WTL A;  5J5I A;  3P50 A;  3UQ7 A;  2W8F A;  5AFH A;  2MAW A;  5L4H A;  4NPP A;  4ALX A;  5HEG A;  3RIF A;  2XQ4 A;  5BP0 A;  2Y58 A;  4ZR6 A;  5HEO A;  4IL9 A;  3UQ4 A;  4ZZB A;  5CO5 A;  3RIA A;  4COF A;  2XQA A;  2LM2 A;  4ZJS A;  2W8G A;  3GUA A;  2Y57 A;  3SQ6 A;  3WTM A;  2UZ6 A;  5AFN A;  5BRX A;  2VL0 A;  4UXU A;  2XQ3 A;  4TNV A;  4UM3 P;  4UM1 A;  2WNJ A;  3WTN A;  4ZK4 A;  5AFM B;  2BYS A;  3UU4 A;  2WNL A;  4QH4 A;  2XZ5 A;  2YKS A; 
#chains in the Genus database with same CATH topology
 3VRA A;  4JI2 T;  2PG8 A;  3ONX A;  1X9B A;  2JRK A;  4KHP T;  1YKE B;  3VU7 H;  3WTO A;  3Q9D A;  4IST A;  2ZJV A;  2V7M A;  1IBK T;  2YN6 A;  3NZP A;  2BKN A;  4JUY A;  3CK6 A;  2EHO D;  2WAU A;  4CZZ B;  5BR8 T;  3UUM A;  5JDH A;  4CN6 A;  5J2U E;  5JQG E;  5JDG A;  2X68 A;  5FNV E;  4JI7 T;  2LSK A;  4UEM A;  3N9P A;  3ZN1 B;  5HWY A;  3RKG A;  2MBG A;  4DR1 T;  3PEO A;  4DV2 T;  3AE3 A;  3PU3 A;  4PJM A;  3U8N A;  4QAC A;  4OYK A;  4IDQ A;  4NZB A;  3N9O A;  2XZ6 A;  5LHH B;  1VCT A;  3JAD A;  4V1A v;  3RRW A;  4UM3 S;  4YT0 A;  2JQH A;  4EB6 E;  2WMN A;  2N2N A;  3KV4 A;  3OKQ A;  4AFT A;  2A9U A;  3C4X A;  3PTR B;  3CQG B;  3P4S A;  2XAH B;  3M65 A;  2XHE B;  2IC6 A;  3HI2 A;  3ETV A;  3FBL A;  2WMO A;  5M4Y A;  2QYW A;  5AQT B;  5AQJ B;  3WTN A;  1MIW A;  5DAB A;  3RPU A;  2DLR A;  1NEK A;  3ZEF B;  2V7L A;  2XYS A;  4AI6 A;  3U8K A;  4XBF B;  3JCF A;  4H9P C;  2DWK A;  5AQF B;  4DV3 T;  4EYU A;  1J5E T;  2BYN A;  5BMV E;  2KIN B;  2D0T A;  3JAE A;  1T8B A;  3TLT A;  4GIW A;  4HKA A;  4YTM A;  2LKH A;  2H7O A;  2ZM0 A;  2LSG A;  2XQY A;  3OYX A;  4KP3 C;  2I6H A;  3H37 A;  2Z6E A;  3AAE B;  3ZYK A;  2WDQ A;  3PV0 F;  3UU8 A;  3BQL A;  5FL1 A;  4HE8 A;  3J7Y q;  4MAL A;  4AQF C;  2JQQ A;  4B3R T;  1FMV A;  1VOM A;  1D1C A;  3QOF A;  2H3R A;  1ZEE A;  4DV4 T;  4HFE A;  3BK9 A;  5KDM C;  5CGM A;  4EZH A;  5AQS B;  3C51 A;  2LT3 A;  4HFI A;  3DJB A;  1MMG A;  3PJA J;  5HEG A;  2IHR 1;  2FJE A;  2MYS A;  4L5G A;  4IE4 A;  4AIS A;  3GUA A;  5JDN A;  4JEH B;  4LF4 T;  5KX5 E;  3B5M A;  5JH7 E;  3SWH A;  3MXZ A;  2CRB A;  5FVK A;  3ZDH A;  2LOP A;  5JR9 A;  3RIU A;  1WR6 A;  2BVL A;  4U2Y A;  4BJN A;  4ZI2 C;  3UUN A;  3QNU A;  4KX6 A;  1UV6 A;  4U74 A;  4U7Y A;  4UV9 B;  2V6X A;  1E2A A;  3I0O A;  4A56 A;  3K1S A;  2KZ7 B;  5LHI B;  1J1J A;  1KF6 A;  2M6I A;  4IE6 A;  3L3P A;  2LSJ A;  1CHU A;  3MZK B;  3SH1 A;  2CM0 A;  3RYC E;  4JLE A;  2VWA A;  4YXD A;  2J1D G;  1T98 A;  1GQE A;  1JNZ A;  2V7I A;  4MFR A;  1WRD A;  2OLT A;  2XM2 A;  5ABF A;  2IC9 A;  5L47 A;  4AXP A;  5LBM A;  4FJO A;  3QUJ A;  1LVK A;  5CB4 E;  4UM3 A;  2L8K A;  1US7 B;  5LMU T;  5CFB A;  4GK5 E;  4PK6 A;  4O8S A;  2KT9 A;  3ZMT B;  5A1L A;  3PUR A;  5HEU A;  2BG9 B;  5LBQ B;  3RI5 A;  3AE4 A;  2LRK A;  3U3I A;  2PJQ A;  4PJN A;  1KNZ A;  2M67 A;  1NAF A;  5FYM A;  5HCM A;  4XHE A;  2A2F X;  1YD8 G;  3I0Q A;  4HWH A;  4PJL A;  4IHJ E;  5HEO A;  4I55 E;  1FJG T;  4EEB A;  4B3M T;  4UXU A;  1AJ3 A;  4IDN A;  5AFU L;  4H9O C;  5LB7 B;  2WNL A;  3AXJ A;  1VCS A;  3HKD E;  4G2A A;  3H3M A;  2V26 A;  3KVA A;  4AQF A;  4DMW A;  4ZI3 D;  2QA7 A;  3GN5 A;  3T1Y T;  2Y8D A;  3U78 A;  2EHO B;  1XNR T;  1YW0 A;  3UFE A;  3ONJ A;  3OPC A;  4ZK1 A;  5KMG P;  4HN9 A;  3CIR A;  3LBX B;  2X00 D;  1IBL T;  5H6R B;  5LJM A;  1IJ5 A;  2X9W A;  2E9X A;  4TWH A;  3WTJ A;  3N9M A;  2XUE A;  1X79 A;  1BR4 A;  5JDF A;  2M6B A;  4DR5 T;  3N9N A;  3NWI A;  4UVC B;  2V7K A;  2XAJ B;  1UX5 A;  1MMA A;  1KFY A;  5AQK B;  3LSV A;  5AFM A;  4C91 A;  1HNZ T;  4HFC A;  3RGL A;  3RX6 A;  1BR2 A;  1OED B;  5J5H A;  1N33 T;  4KUM B;  4XK9 A;  5AFH A;  2CXD A;  2QRX A;  5L4H A;  1XNQ T;  4F6R C;  4O4I E;  5CO5 A;  4BA9 A;  2UZ6 A;  2LOS A;  3BQK A;  2WNJ A;  3FBZ A;  3UU4 A;  2VK9 A;  4QH4 A;  3ZJ1 A;  3PUW F;  3AEF A;  4QH5 A;  1Z0P A;  3PDY A;  4PJJ A;  4H9R C;  4DV7 T;  2YU1 A;  3O1J A;  3SFE A;  2HN1 A;  3TKL B;  2PFV A;  3ZC1 A;  3MA9 A;  2OA5 A;  1HX1 B;  4TNW A;  4YSY A;  5LHG B;  4TV8 E;  2YDS A;  3K3Q C;  2WS3 A;  4HFD A;  2RA1 A;  1IAP A;  3ZC0 A;  4A97 A;  4X1Y E;  4HWC A;  4EOZ B;  2BG9 E;  2XQ9 A;  4CI2 B;  3VRB A;  2V6Y A;  3TLS A;  3A5X A;  1UUS A;  5JVD E;  3DTO A;  4JBW F;  2BG9 C;  1YQ4 A;  3ZPO A;  3AE2 A;  3AE9 A;  2YDQ A;  1HFA A;  4M1P A;  1XMQ T;  2H88 A;  3KDS E;  3RRC A;  3SFD A;  2J47 A;  3LDQ B;  4G63 A;  4B5D A;  5F8P A;  5AFK A;  4GKJ T;  3OJA A;  4IE0 A;  2CBI A;  5HWX A;  3N2G E;  5FXW A;  2Q9Q C;  1WYC A;  2UUA T;  5ABH A;  1R8I A;  2K24 A;  4YY3 T;  1KK7 A;  4AKH A;  4ZJS A;  2IUB A;  4EIW A;  2VL0 A;  4O4H E;  2FUP A;  3VHL A;  1FEW A;  1B7T A;  3I1A A;  2BYS A;  3K8P C;  2BYP A;  5L4E A;  1OXZ A;  4ZZC A;  1WFD A;  1W0A A;  2BJ0 A;  3ESL A;  2AE9 A;  4TWD A;  4ILB A;  2LM9 A;  3NKZ A;  4DR7 T;  2ZM6 T;  4UF0 A;  5AIN A;  4EZ1 A;  5JRC B;  2WDR A;  1FMW A;  4QAA A;  2ZJU A;  1XMO T;  2YU2 A;  5H6Q B;  2CHN A;  4NUU A;  4DV5 T;  3RKO A;  5GON E;  3PJA A;  4U2Z A;  4ANJ A;  2YEV C;  2C9T A;  4LF5 T;  3SQ9 A;  4OHF A;  3ANW A;  5LA6 E;  3LK3 B;  1OED E;  5LGU B;  3WTK A;  3H3A A;  3KIN B;  3ZST A;  1OED C;  5JRE A;  2X9Y A;  3ZT6 A;  1MND A;  5J5I A;  3T8O A;  3CQX C;  4A5X A;  5HXS A;  4ALX A;  3QK6 A;  4C90 A;  2HN2 A;  5L3D B;  4DND A;  2WM9 A;  4ZR6 A;  4IL9 A;  1T7S A;  1MNE A;  2E5L T;  4NXN T;  5BRX A;  5HYA A;  3B57 A;  3S4U A;  3D0T A;  5DJQ C;  3AE1 A;  4DMV A;  3T4M A;  4LFB T;  2KWH A;  5LCY A;  2LKG A;  5L3E B;  2VUR A;  1XWM A;  3C98 B;  2IW5 B;  2GK9 A;  3JAF A;  3GA8 A;  4LMK A;  2BR8 A;  3HKB E;  5EK3 A;  5KZU A;  2IML A;  4Z8X A;  1XZY A;  2V5C A;  2Q9Q A;  2CPT A;  2QC1 B;  1J5W A;  5AQI B;  2X66 A;  2XY8 B;  1HNX T;  3FHN A;  3MK7 C;  3WTH A;  4TX5 A;  2IAK A;  2WSS V;  4QAB A;  4AKL A;  2DL1 A;  1T72 A;  2JIW A;  5JDL A;  1I9B A;  1D1A A;  4ILC A;  1CUN A;  3KV6 A;  3IA3 A;  2WP9 A;  5IWA T;  4I50 E;  2CE7 A;  4P09 A;  5FJV A;  5L3F B;  4H63 H;  3R6N A;  4EXT A;  3C4Z A;  4KBM B;  4DUY T;  1JNR A;  3R84 B;  2PBI A;  4QXB B;  3ZJ2 A;  4ZI7 E;  5IYZ E;  4I0U A;  3C64 A;  2ODU A;  3OBV E;  3VR8 A;  4K0U A;  5BP0 A;  4ZZB A;  5LYJ E;  2BBH A;  2WY2 A;  1D0X A;  2QVA A;  1W0B A;  2X0L B;  4OYJ A;  3PUY F;  5LG4 A;  2XYT A;  5TVC A;  1S35 A;  3QB5 K;  4UIG A;  2NW7 A;  3ZT7 A;  2LSY A;  2CWY A;  2W00 A;  3UUL A;  2YOE A;  4ZEY A;  3K3N A;  2VQF T;  3PUX F;  3UUX B;  4OFZ A;  2XQ5 A;  3SOL A;  2LLY A;  4QX7 B;  4IE5 A;  4E7Z A;  2LSI A;  4DR6 T;  2CWO A;  4HWI B;  3OVU A;  5AQL B;  2N1G A;  5FXZ A;  3UUB A;  3PMZ A;  3MAC A;  3Q5D A;  2F4V T;  3ZN0 B;  5JME A;  2YME A;  5FVL A;  1UX4 A;  4ZS3 A;  2XM1 A;  4MLK A;  4HGA A;  4TV9 E;  3RLF F;  2HPJ A;  2PGZ A;  5LXB A;  5J5G A;  5KE4 A;  3ZMU B;  3U8L A;  4YSX A;  2BDE A;  4YLH A;  4FRR A;  3VKG A;  3AED A;  3AVS A;  5BW2 A;  5J0Z A;  2C5J A;  2W8F A;  2D0U A;  2MAW A;  2CBJ A;  4O4J E;  2E9X D;  4EZ4 A;  2WZH A;  3CQC B;  2D9D A;  3AE6 A;  5JTG A;  1OWA A;  3SQ6 A;  5AFN A;  3RC8 A;  1IBM T;  3CWZ B;  5LMN T;  4P0A A;  3SRZ A;  3F31 A;  1Y01 A;  3RYH E;  2JMH A;  2L3L A;  2VVS A;  4ZI3 C;  4DBR A;  2XZ5 A;  2D2S A;  4EED A;  1SUM B;  3FZM B;  1SA0 E;  2VAS A;  4PK4 A;  3NRY A;  4CXX A;  2X9H A;  3T1H T;  1IZN B;  4BAY B;  3IBP A;  2KLQ A;  4X1K E;  2FBW A;  4B6X A;  4HFB A;  4HFH A;  2UUC T;  5SYO A;  3A7M A;  2KND A;  2WCA A;  2CMR A;  2JQ9 A;  4BQT A;  3WTI A;  3EVY A;  3U8J A;  2FJA A;  2G0U A;  4CN4 A;  2ODV A;  3AEG A;  3P4R A;  4O2B E;  4AKI A;  1Z8U A;  2E8I A;  2WBL A;  4WV9 A;  5J5F A;  4DR2 T;  4GKK T;  3CX8 B;  3IF8 B;  1LRZ A;  3N2K E;  2HPL A;  2IDO B;  4YHH T;  3AA0 B;  3WIP A;  3A8Y C;  3UU5 A;  3HL6 A;  2UXC T;  2Y48 B;  2UXN B;  3BQI A;  3P4P A;  2XPK A;  3AA1 B;  3LFM A;  3WI3 A;  5EK2 A;  5L3B B;  4NIQ A;  3ONL C;  3X1D A;  3UU6 A;  1ZHC A;  1KNP A;  3P50 A;  3HR0 A;  2MTQ A;  5HAX A;  4NPP A;  2NW8 A;  1W9R A;  2HH7 A;  3AA7 B;  3FZK B;  2X67 A;  3RIA A;  5EK4 A;  2E5V A;  2XQ3 A;  4UM1 A;  4WNK A;  4ADZ A;  3PE0 A;  2K3W A;  4IT4 A;  3NZQ A;  2XZE A;  5ABG A;  1ZV4 X;  2K48 A;  5HCJ A;  5CA0 E;  3RF1 A;  4P1N A;  2L9Q A;  2BZB A;  1DU2 A;  3W15 B;  3PUA A;  1FIO A;  1E7P A;  4ERR A;  1HTJ F;  3ZMZ B;  4CI1 B;  2XSB A;  5JR9 B;  4JEU B;  2XNV A;  2B1E A;  5LG3 A;  3O1I A;  3ETU A;  2RP4 A;  4B3S T;  2UXX B;  2ES0 A;  2FJD A;  2WDV A;  3NBX X;  1MMN A;  3CX6 B;  2LRL A;  2W67 A;  3IHR A;  2NOX A;  4PW8 A;  5ABF B;  2ZMA A;  4U31 A;  4U33 A;  3C4W A;  4LF7 T;  5FL0 A;  2D5U A;  3TLU A;  4TUY E;  3AEA A;  4EYY R;  2XNU A;  2LJL A;  4QXC B;  2W2U A;  4GYS A;  3EUH A;  2XSA A;  3PUZ F;  5LP6 E;  1O3X A;  5DQV A;  4IIJ E;  4I4T E;  2KMF A;  3IEE A;  4JI3 T;  2WQY A;  3RIF A;  3AAI A;  2Y58 A;  3UQ4 A;  3LG7 A;  4EV6 A;  4N78 D;  4X66 T;  4DID B;  2W0G A;  3Q5W A;  4AIU A;  4B3T T;  3L8R A;  5LOV E;  4U7I A;  4BFQ A;  2BYQ A;  2BVM A;  2JQK A;  4Q25 A;  3JC6 D;  5ETW A;  2ACX A;  4Z90 A;  2YIN A;  2DNX A;  2RPA A;  2JJ9 A;  1LKX A;  5AQN B;  3HKC E;  3WAK A;  4YFS A;  3PUV F;  3QC9 A;  3AXJ B;  2E2A A;  3O4X E;  3KFW X;  4HWD A;  4LF8 T;  2BS3 A;  1QUU A;  2CCQ A;  2P9B A;  1UGO A;  2EHO C;  3GN5 B;  3ZT5 A;  3I9W A;  3M3Z B;  2BBJ A;  3F2E A;  1YXR A;  2XQ8 A;  3SS1 A;  2VB6 A;  4WBO A;  3CVR A;  2KXP B;  3VKH A;  4YHJ A;  3C84 A;  2WWU A;  1L0V A;  3C79 A;  2K5B B;  1W09 A;  3ZCI A;  2NWB A;  3EAM A;  2MOZ A;  5E0O A;  2Q9Q D;  3ZKR A;  5AQV B;  2VKD A;  2X0H A;  4TWF A;  4NXM T;  3RH3 A;  2A72 A;  1HG5 A;  4HQP A;  4TN7 B;  2BYR A;  2E9X B;  1QLB A;  4LML A;  4HFV A;  4A98 A;  1D1B A;  1S94 A;  3WTL A;  2AXD S;  2CEA A;  1YKH B;  2VKJ A;  2X9X A;  4U3C A;  4OX9 T;  3AEE A;  4X62 T;  2NTY A;  2V7J A;  4QHO A;  4YJ3 E;  3ZYM A;  4KI0 F;  1KNR A;  1I94 T;  3LK4 2;  4TNV A;  4LFC T;  5AFM B;  4YTP A;  2UXB T;  4QXH B;  1HF8 A;  3ZMS B;  3G06 A;  5C3J A;  4WBN E;  3PUG A;  1H7C A;  4CXY A;  2WU5 A;  2XAG B;  3LK2 B;  4ILU A;  1I6Z A;  3L09 A;  3ABV A;  2UUB T;  4KMC A;  1UK5 A;  2VL8 A;  2C5I T;  2H7V C;  3FZF B;  3FXE B;  3UU3 A;  5JR9 C;  3RIU C;  5F3J A;  3E0Z A;  3UTK A;  5FY0 A;  2BS4 A;  4ZS2 A;  2BG9 A;  4JYA T;  3RHW A;  3FZL B;  1WYB A;  5AFJ A;  4YTN A;  3P7I A;  3EDU A;  4ZJT A;  4QKN A;  4LF9 T;  2WZI A;  2X51 A;  5L2L A;  3QB5 A;  4PK5 A;  1VRB A;  4AQY T;  2ZM2 A;  2YMD A;  1U4Q A;  4Z91 A;  2XQ6 A;  3NVO A;  2WZY A;  2PH9 A;  3B13 A;  2DI4 A;  4LMJ A;  2QGS A;  2C5K T;  1UX2 A;  3AEB A;  5LGN B;  3U8M A;  3K3O A;  4DVD A;  4NUV A;  1N34 T;  4UVA B;  5AQR B;  2V6Y B;  2ZLY A;  4IDO A;  4YJ2 E;  4K0K T;  2XQ4 A;  2W4X A;  3AB3 B;  4H9N C;  2EHO A;  4L0R A;  2YDR A;  2XQA A;  3WTM A;  2IIU A;  2Y57 A;  2B76 A;  3WAJ A;  3KV9 A;  5ABE A;  4ZK4 A;  2FJB A;  2J4G A;  1YQ3 A;  1WR0 A;  3C50 A;  2HHH T;  5TAO A;  2C0S A;  2W62 A;  5AQO B;  2XNT A;  4XAX B;  3LBX A;  2BR7 A;  1KEY A;  4P0B A;  1HS7 A;  1Y64 B;  1D0Z A;  2W66 A;  4JI1 T;  4U72 A;  3ZMV B;  4OK0 A;  3RQU A;  5EZY E;  5AQU B;  4EGW A;  2VKH A;  5AQG B;  2WB5 A;  2VQE T;  4IL4 A;  3TLV A;  4X20 E;  2I0M A;  2Y54 A;  4CI3 B;  2DHR A;  4JI0 T;  4DR4 T;  3N9Q A;  3ZLI A;  4IE7 A;  4PFP A;  3VR9 A;  5C2T A;  1OED A;  5HXH A;  1M7K A;  4X1I E;  4DR3 T;  3FXD B;  1QSD A;  4UF0 B;  2R6G F;  5LXT E;  1D0Y A;  4D01 A;  4DBQ A;  3FB2 A;  3V5S A;  5FXV A;  2UU9 T;  2E9X C;  2A3D A;  4AQG A;  2V5D A;  5FKY A;  2WNC A;  1HNW T;  4PNI A;  2NR4 A;  2N9D A;  1NEN A;  4H63 V;  5HXR A;  2XAQ B;  3ANW B;  2V1D B;  3NRX A;  3J9X 1;  4WYV A;  3Q5X A;  3ZCJ A;  3MJX A;  2CHO A;  3E22 E;  5CA1 E;  1SE7 A;  3CKD A;  2CLY B;  2BKP A;  4PFO A;  1HCI A;  1MMD A;  4X5T A;  5JDQ A;  4CXW A;  4HEA A;  2VVN A;  4YSZ A;  4MBQ A;  4ZI2 D;  4BJM A;  5LGT B;  2YK0 A;  3I9Y A;  3EDV A;  1N36 T;  2UXD T;  4DO0 A;  4XZC A;  1HR0 T;  4TZ4 C;  2LHR A;  3TLW A;  4LFA T;  5AQM B;  3ZSS A;  4ASK A;  4DUZ T;  4IGU A;  3ZDG A;  5KXJ A;  2WU2 A;  5FXX A;  2WWV A;  3O1H A;  3UFG A;  5AQP B;  2K9A A;  4MHC A;  1ZOY A;  3SIO A;  5FY7 A;  3GWH A;  5HEH A;  3RYI E;  4O2A E;  4UEL A;  1BR0 A;  4UXN B;  2KWI B;  4PAG A;  2Q9Q B;  1V9D A;  3E08 A;  1BR1 A;  4CQI A;  1NWM X;  3Q5E A;  3KBU A;  2V8S V;  2I59 A;  5AQH B;  2LEH A;  3RQW A;  2WN9 A;  4GYR A;  5F5W A;  1HX8 A;  5IHY A;  1M62 A;  3KBT A;  4I43 B;  1IJ6 A;  3AE7 A;  4AKG A;  2W8G A;  1WCR A;  4UM3 P;  3P4Q A;  2ACZ A;  5JRC A;  3AE8 A;  5ADX L;  4JI5 T;  2CA5 A;  5AQQ B;  2JMK A;  3HKE E;  3AEC A;  1EZ3 A;  1MIY A;  4QWN B;  4JI8 T;  1UUR A;  1SHZ C;  4JI6 T;  3OTO T;  1N32 T;  3PU8 A;  3EAB A;  4HWF A;  3AVR A;  5FMN A;  2KSR A;  3Q2M A;  4ZRU A;  5IUX A;  4H9S E;  3F57 A;  5AFL A;  3KV5 A;  2CXL A;  4QX8 B;  3ZYL A;  3V5U A;  4AKR B;  2XAF B;  5L3G B;  3RC3 A;  2H89 A;  1WLX A;  2LE8 A;  4PIR A;  5LNK A;  4E7S A;  4DV6 T;  3KVB A;  4GOU A;  2NW9 A;  2DCF A;  3RYF E;  1U5P A;  3L39 A;  2CXF A;  2NTX A;  3CML A;  3UQ7 A;  1HG2 A;  2MPK A;  3PUS A;  3O9X A;  4WW0 A;  4DV1 T;  4GK0 E;  4JV5 T;  3HA4 A;  4J2C A;  5C8Y E;  5CJ5 A;  2CLY C;  3AAA B;  1LVF A;  2YKS A;  2Y6X A;  3AE5 A;  3JC6 C;  2X00 A;  3N9L A;  4FI5 A;  4X64 T;  4ISS A;  2OV9 A;  2W63 A;  4DV0 T;  2SPC A;  3N2O A;  4IRE A;  1G8X A;  2Y56 A;  4HTE A;  1MIV A;  3CX7 B;  4AFG A;  2BKO A;  3FZH B;  2X0Y A;  2XJ7 A;  4ILA A;  4WZX A;  4LF6 T;  4ZOL E;  4DBM A;  3EHZ A;  5DQW A;  2ZM8 A;  4KHZ F;  1UCU A;  2BS2 A;  4ZHQ E;  5J2T E;  4UV8 B;  5JDM A;  4H9Q C;  5HEJ A;  5LJN A;  4UY2 A;  2Y7Y A;  2VKO A;  1UW6 A;  2NP9 A;  3IGQ A;  2XQ7 A;  1E1H B;  3MKD A;  4JI4 T;  3EI0 A;  3OYZ A;  4QH1 A;  4X65 T;  3CPZ A;  3DP7 A;  4F8H A;  3P4W A;  5FP3 A;  4CN1 A;  4AFH A;  3P8C D;  3AA6 B;  4EAH A;  3GMI A;  5HXC A;  2LHN A;  2XAS B;  3PUQ A;  1XDO A;  2PTF A;  2XTL A;  3LJC A;  5FY1 A;  5L3C B;  5HXE A;  1G73 A;  2JPF A;  1ZKE A;  4IDP A;  1XDP A;  4L9I A;  4O4L E;  5J1G A;  3N5L A;  3UT5 E;  4UR9 A;  4UVB B;  4COF A;  2LM2 A;  4IDZ A;  1ZP0 A;  2DWG A;  2W61 A;  2J62 A;  4ZXL A; 
#chains in the Genus database with same CATH homology
 3ZDH A;  2XYS A;  2X00 A;  3U8K A;  3T4M A;  4BFQ A;  4X5T A;  2XYT A;  2XNT A;  5HCJ A;  4QH5 A;  5TVC A;  2BYQ A;  2BYP A;  2LKG A;  1UV6 A;  3WTO A;  4IRE A;  2BR7 A;  5L4E A;  2Y56 A;  4Z90 A;  4ZZC A;  2YOE A;  2ZJV A;  2BYN A;  4AFG A;  2M6I A;  2YN6 A;  2BJ0 A;  3SH1 A;  3JAE A;  3RQU A;  3JAF A;  4LMK A;  4TWD A;  3UU3 A;  2BR8 A;  4ILA A;  2XQ5 A;  5KZU A;  4ILB A;  3TLT A;  2LLY A;  4HFB A;  4HFH A;  4IL4 A;  4TNW A;  5SYO A;  4ZK1 A;  5AIN A;  4EZ1 A;  3TLV A;  2XNV A;  2BG9 A;  4DBM A;  3EHZ A;  2QC1 B;  4QAA A;  2Y54 A;  5LG3 A;  2ZJU A;  4BQT A;  2LKH A;  3WTI A;  3UUB A;  2X00 D;  5L47 A;  2KSR A;  3TLW A;  3PMZ A;  3WTH A;  3RHW A;  5HEJ A;  3U8J A;  4UY2 A;  4QAB A;  4HFD A;  5AFJ A;  1I9B A;  2Y7Y A;  1UW6 A;  4ZJT A;  4UM3 A;  4ZRU A;  3ZDG A;  3IGQ A;  2XQ7 A;  4ILC A;  3PEO A;  2XQ8 A;  4A97 A;  5IUX A;  5JME A;  2YME A;  1OED A;  3EI0 A;  4WV9 A;  5AFL A;  5J5F A;  2BG9 E;  2XQ9 A;  4QH1 A;  4TWH A;  5CFB A;  3UU8 A;  3WTJ A;  3SIO A;  3U8N A;  2C9T A;  3TLS A;  3P4W A;  4F8H A;  4QAC A;  2YMD A;  5HEH A;  4AFH A;  3C84 A;  2BG9 C;  3SQ9 A;  4Z91 A;  2XQ6 A;  2WZY A;  2M6B A;  2PGZ A;  4NZB A;  2PH9 A;  2XZ6 A;  5HEU A;  3C79 A;  5LXB A;  5FJV A;  3JAD A;  2BG9 B;  5J5G A;  3RI5 A;  3EAM A;  5KE4 A;  3U8L A;  4UM3 S;  4LMJ A;  3ZKR A;  3WIP A;  4D01 A;  3UU5 A;  1OED E;  4HFE A;  4FRR A;  4PIR A;  3WTK A;  4TWF A;  3LSV A;  5AFM A;  3TLU A;  1UX2 A;  1OED C;  2XNU A;  4HFC A;  3U8M A;  4B5D A;  5BW2 A;  3RQW A;  5AFK A;  4HQP A;  1OED B;  5J5H A;  2BYR A;  2WN9 A;  4AFT A;  5J0Z A;  5HCM A;  4LML A;  4A98 A;  4XHE A;  2WNC A;  3UU6 A;  4HFI A;  4XK9 A;  3WTL A;  5J5I A;  3P50 A;  3UQ7 A;  2W8F A;  5AFH A;  2MAW A;  5L4H A;  4NPP A;  4ALX A;  5HEG A;  3RIF A;  2XQ4 A;  5BP0 A;  2Y58 A;  4ZR6 A;  5HEO A;  4IL9 A;  3UQ4 A;  4ZZB A;  5CO5 A;  3RIA A;  4COF A;  2XQA A;  2LM2 A;  4ZJS A;  2W8G A;  3GUA A;  2Y57 A;  3SQ6 A;  3WTM A;  2UZ6 A;  5AFN A;  5BRX A;  2VL0 A;  4UXU A;  2XQ3 A;  4TNV A;  4UM3 P;  4UM1 A;  2WNJ A;  3WTN A;  4ZK4 A;  5AFM B;  2BYS A;  3UU4 A;  2WNL A;  4QH4 A;  2XZ5 A;  2YKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...