5L4HA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with 5-(2-bromo-ethyl)-5-ethyl-pyrimidine-2,4,6-trione (brominated barbiturate)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4hA01
2BG9E 4AFGA 5AFKA 5BRXA 4NZBA 3WTKA 2W8FA 3U8KA 5L47A 2C9TA 4ZZBA 3WIPA 4QH1A 5LG3A 3EHZA 3P50A 5CO5A 4HFIA 5J5GA 2YN6A 3C79A 3P4WA 4LMKA 5AFHA 5HEGA 4LMJA 3RIFA 4AFHA 3U8MA 2M6BA 4UY2A 4XHEA 2XQ9A 3SQ9A 2QC1B 3UU6A 2X00A 4F8HA 4ALXA 4HQPA 5AINA 4PIRA 4ZZCA 2BR8A 2PGZA 2BG9A 2XQ4A 3RQUA 4COFA 4A97A 2LKHA 3EI0A 2KSRA 2BJ0A 4UM1A 5TVCA 5HCJA 4QH5A 4IREA 2X00D 2YMEA 5HEHA 3U8LA 5J5IA 2Y56A 3UQ4A 5HEJA 1UV6A 5J5FA 2BYPA 2PH9A 4UM3S 1I9BA 5AFNA 4UXUA 2LKGA 2BR7A 4HFBA 2YOEA 3UQ7A 4UM3P 2XZ5A 2LM2A 4ZR6A 4QH4A 2XNVA 2MAWA 3TLTA 3UUBA 5L4HA 4HFDA 2BG9C 3WTNA 3ZDGA 4HFCA 4TWFA 1UX2A 2Y54A 4HFHA 3RHWA 5AFMA 5SYOA 4ZRUA 1OEDB 3EAMA 4Z91A 5LXBA 3TLSA 3WTLA 2BYRA 3U8NA 2XQ8A 4ILBA 2Y57A 2YMDA 2XNUA 2XYTA 2UZ6A 3UU8A 4BQTA 4X5TA 5HEOA 5L4EA 4EZ1A 5HEUA 2W8GA 4A98A 5BP0A 2ZJVA 4ZK1A 2XZ6A 3JADA 5FJVA 5HCMA 4XK9A 4UM3A 3U8JA 2XQ3A 3WTMA 2LLYA 3PEOA 4ZJSA 3PMZA 2Y58A 4Z90A 5J5HA 5BW2A 3TLUA 4DBMA 3SIOA 2M6IA 5JMEA 2BG9B 4HFEA 4NPPA 1OEDE 2BYQA 4ILAA 4IL9A 2WNJA 1OEDC 3T4MA 4B5DA 3WTJA 3WTIA 3TLVA 3ZKRA 2WNLA 5KE4A 1UW6A 5CFBA 3JAEA 4AFTA 4TWHA 3GUAA 2WNCA 4D01A 2XNTA 3ZDHA 4ZJTA 4TNWA 5AFJA 2BYNA 2VL0A 3UU5A 2XYSA 3LSVA 2XQ5A 4TWDA 3RQWA 3SH1A 4FRRA 3SQ6A 4BFQA 2YKSA 5KZUA 2Y7YA 4ZK4A 4IL4A 3UU4A 2ZJUA 4WV9A 4QAAA 5AFLA 2XQ7A 4QABA 4QACA 3WTOA 3UU3A 3JAFA 2XQ6A 2BYSA 1OEDA 3TLWA 4TNVA 2WN9A 3WTHA 5AFMB 2XQAA 3IGQA 5IUXA 3RI5A 4LMLA 3RIAA 2WZYA 4ILCA 3C84A 5J0ZA
chains in the Genus database with same CATH superfamily
3NZPA 3BQKA 4DR6T 3OVUA 3JCFA 4I0UA 5HXRA 4QKNA 2G0UA 4DV4T 2BS3A 3ZCJA 5AFUL 2KXPB 4E7SA 2VKOA 3K3OA 4YHJA 3J7Yq 1XMQT 4ZZCA 4X62T 2I59A 2LKHA 2UU9T 2IUBA 2YU1A 5HEHA 4HEAA 2H7VC 2DCFA 4U7IA 1I9BA 4I50E 4TUYE 4HN9A 5LMNT 4GOUA 2LOPA 2B1EA 5FY0A 4EYYR 1HTJF 1SA0E 3MACA 2W4XA 1ZEEA 2UXNB 1UUSA 1UK5A 4JI1T 5F8PA 1WLXA 4PJMA 3ZLIA 2YMDA 3OJAA 3HKEE 3UT5E 3VU7H 3LBXB 4EZ1A 1IBKT 3H37A 5ABHA 3ZCIA 5J5HA 4B3ST 1U4QA 5KXJA 2HH7A 3OYXA 1OEDE 2WNJA 3N9PA 4HGAA 2KLQA 2H3RA 2Y48B 4ZI3D 4B3RT 3SQ6A 4YSXA 3N2KE 2H88A 4QABA 1W09A 3CPZA 2XQ6A 3ONJA 4L0RA 4TNVA 2MYSA 5J2UE 2V7JA 4PJNA 4XAXB 3A7MA 5FXWA 4O2AE 5CGMA 1N32T 5CO5A 3P4WA 4Z8XA 3CX7B 3RIFA 3ZYLA 5KX5E 2QC1B 4U7YA 4HWFA 1I94T 2WZHA 5JRCB 3ZT6A 5EZYE 2LKGA 2XASB 4K0UA 4U72A 3FZMB 2VURA 2E9XC 2NW9A 4JI6T 2DWKA 5EK3A 3TLSA 1LVKA 4U74A 2LSYA 1HX8A 1JNRA 4LF8T 5L4EA 2W8GA 1US7B 5FJVA 2CWOA 3N9MA 3UUXB 4ZJSA 4YTMA 4CN6A 4HFVA 4EZ4A 5FL1A 3SIOA 4HFEA 4ILAA 2Y6XA 2X9XA 3QOFA 3VR8A 4CI1B 2J62A 4AFTA 1SHZC 2FBWA 4BFQA 2WWVA 4IL4A 4QAAA 3M3ZB 4X64T 4UVBB 3KINB 1HF8A 4L5GA 4LMLA 4GYSA 2CCQA 4ILCA 1NEKA 3AVSA 2IW5B 2HN2A 2J47A 3PUAA 3SFDA 2N2NA 1HG5A 2I0MA 3WIPA 1J5ET 2YN6A 3AE5A 4LMJA 3MA9A 5KDMC 3ESLA 5JDMA 2C5JA 1YQ3A 4IDQA 4EEDA 4AI6A 2Q9QC 2JPFA 3AA6B 5TVCA 2CRBA 2X51A 2V7IA 1X79A 3HKCE 5DQVA 2BVMA 3AE2A 2UXDT 4QH4A 2WSSV 3NZQA 5C3JA 2BBHA 3C4ZA 2XTLA 2LSJA 3F57A 1OEDB 1D1BA 2BKNA 2UXXB 5LP6E 1R8IA 4UVCB 1HCIA 2NP9A 3ZT7A 1MMGA 4NUVA 5LB7B 1BR2A 4LF9T 4AQFC 1IJ6A 1FMWA 2D2SA 1U5PA 4TZ4C 4C90A 1O3XA 2BG9B 2E9XD 1QLBA 4IL9A 4KBMB 5LHHB 4JI0T 3OYZA 3N2OA 2Y7YA 4ANJA 4KP3C 2X9WA 4WV9A 3AE7A 2XQ7A 4AQFA 3ANWB 4AKHA 5LXTE 3RKOA 4DO0A 3FXDB 4WW0A 4DBQA 2DI4A 2V7KA 2Q9QB 4X66T 2WB5A 3TKLB 2XZ6A 1EZ3A 2X9YA 2ZMAA 3G06A 2C0SA 4NXNT 5AFHA 5LBQB 1M7KA 2XUEA 3U8MA 4UY2A 2A2FX 2NTXA 4ZI2D 2VASA 4HQPA 3KV4A 3I9YA 3EI0A 2WAUA 4N78D 3WAKA 3MXZA 4DV2T 3LG7A 4KUMB 3UQ7A 4ZI3C 5LJMA 3K8PC 4ZR6A 3UUBA 2K48A 2IC9A 2NW8A 4G2AA 4PJJA 2BKOA 2IC6A 5LXBA 3LBXA 2XQ8A 3AAIA 5FMNA 4PNIA 1WCRA 5AQLB 2Y8DA 2WDVA 1I6ZA 4FJOA 5FY1A 1YD8G 5CJ5A 1KEYA 3OBVE 4JUYA 1KNRA 3DP7A 2D5UA 5BW2A 5IYZE 3N9OA 1BR1A 3UFEA 4TN7B 1GQEA 2AXDS 1IJ5A 3IA3A 3FZKB 2Q9QD 2NTYA 4WYVA 4B6XA 5JREA 2BYNA 3EABA 3UU5A 4DNDA 3SH1A 4J2CA 2MOZA 4F6RC 1YQ4A 4IGUA 1KF6A 4CXYA 3E0ZA 1T98A 4ZS2A 3GN5B 4PAGA 2CM0A 5DABA 3VKHA 5HWXA 1WRDA 4GK5E 4YSYA 2CEAA 3U8KA 4XBFB 2FJEA 4MHCA 2W61A 3EHZA 4YFSA 2ACZA 2ZLYA 3N5LA 4DMVA 3C79A 2XM2A 5AQVB 1V9DA 2V5CA 3LJCA 4X1IE 4XHEA 4IDZA 2CXFA 3P4RA 2BR8A 2XAFB 4H9NC 2OV9A 1N33T 1VCTA 4EV6A 2QA7A 5LHIB 4EGWA 3K3QC 2QRXA 3QUJA 4HFDA 3AEGA 5AFMA 1Y64B 2W0GA 4YTNA 4G63A 2BYRA 3CQCB 2H89A 3Q9DA 1W0BA 3U3IA 3I0OA 3A8YC 3RKGA 2C5KT 1D0XA 2KMFA 2IDOB 3ETUA 3RRCA 3WTMA 1XWMA 2Y58A 4Z90A 4PFPA 3UTKA 3B5MA 1ZHCA 1UW6A 1G73A 2LE8A 4TNWA 2XSAA 3FB2A 3LK2B 2PTFA 4H63V 5FVLA 2AE9A 4HWDA 3GN5A 5LGTB 2YDRA 3TLWA 3DTOA 4GKJT 5AFMB 5LHGB 1VOMA 5L3GB 2EHOA 4E7ZA 4EXTA 4YLHA 2BS4A 5JDQA 2PBIA 3AA0B 5ABFA 4LF7T 3ZSSA 5LG3A 3OKQA 3PURA 3L3PA 3NVOA 2JQHA 5EK2A 3U78A 4CN1A 2Z6EA 3C64A 3GWHA 2X00A 5J2TE 2A3DA 4AKGA 5JR9C 3RC8A 4COFA 4A97A 4QH5A 5HCJA 3RLFF 2A72A 4JI7T 2JQ9A 2A9UA 2VKHA 2E9XB 4UM3S 2BZBA 2XZ5A 2BS2A 5LCYA 5L4HA 2K5BB 3RC3A 3HL6A 2LEHA 4EOZB 4MBQA 2Y57A 1WYBA 2V6YA 2CBJA 3PUVF 2UZ6A 5HEOA 5AQOB 5BP0A 2ZJVA 2FJDA 3JADA 4EB6E 1UURA 1NENA 3LK3B 3PJAJ 3FZLB 2NW7A 4A56A 5AQFB 5FKYA 5AQMB 1W0AA 4DBMA 5JMEA 4Q25A 4MALA 1OEDC 3FBZA 5LG4A 3Q2MA 3ZDHA 5AFJA 5FYMA 4FRRA 3PUZF 5KZUA 4U31A 3UU4A 3T1HT 3WTOA 2BVLA 5LMUT 4QWNB 5JDGA 2LSGA 4LF5T 3O9XA 3CX6B 3CX8B 3AB3B 5AQNB 3NRYA 4JEHB 4BJMA 2CXDA 3KVAA 4U2YA 3C4XA 4O2BE 2CHOA 4HWCA 4UVAB 4ZOLE 5F5WA 2M6BA 2XQ9A 3SWHA 2R6GF 2WCAA 5KMGP 2BG9A 3SS1A 2BJ0A 2V7LA 1T72A 1NWMX 4NXMT 2WDQA 4DR4T 2ZM8A 1YKEB 3HA4A 3PUQA 2PG8A 3QB5A 2XNVA 4O8SA 3AE1A 4LF4T 2CMRA 2MBGA 2CA5A 5JRCA 5LOVE 2W2UA 5BMVE 3EAMA 3WTLA 3PJAA 3U8NA 5CA1E 2WU5A 2LSIA 3AAEB 2XNUA 4CQIA 5H6QB 3UU8A 4X5TA 2WU2A 4KI0F 3KBUA 3ANWA 4P1NA 2XQ3A 4O4IE 5HWYA 3SOLA 3PMZA 2X66A 4X1KE 3N2GE 2WP9A 2ES0A 4NPPA 4PFOA 2VL8A 3TLVA 4H9PC 4EAHA 2VL0A 5JDFA 2VQET 4ZK4A 1MNEA 2WS3A 4OYJA 3I9WA 2XPKA 4A5XA 5AFLA 3UU3A 2V8SV 4DMWA 5FY7A 1UX5A 5M4YA 3T1YT 4CZZB 3ZT5A 5BRXA 4GIWA 4ZZBA 4IE0A 2MTQA 4KHPT 3VR9A 2JMKA 5JDHA 2F4VT 1T8BA 1Z8UA 2L9QA 4F8HA 3R6NA 3NWIA 2XJ7A 3AE3A 3RQUA 3EUHA 4JYAT 2LJLA 4IREA 2YMEA 4OHFA 3E22E 3A5XA 2XAQB 1D0ZA 2VVSA 2YOEA 4P09A 3VKGA 4UXNB 4QHOA 4IE6A 5LGNB 3ZN1B 4HFHA 4Z91A 3QNUA 3PUSA 2DWGA 4BAYB 3AEAA 3P8CD 4TX5A 4JI8T 4ZK1A 2XAHB 4HKAA 2WDRA 2WQYA 4TV8E 3L09A 3F31A 3ONLC 3ZMVB 4YJ3E 5CB4E 2NR4A 3W15B 2BYQA 5FXVA 4MLKA 2JRKA 3WTIA 2WNLA 5KE4A 2EHOC 4AXPA 4ZJTA 4GYRA 3LSVA 3Q5EA 1MMAA 3LFMA 1VCSA 2JMHA 5LYJE 2LRLA 1L0VA 2RA1A 4O4HE 2VKJA 1CUNA 3BK9A 3K3NA 4YTPA 1KNZA 3HI2A 1NAFA 5AINA 3V5UA 2J4GA 2UUAT 2BBJA 2PJQA 3B13A 2CLYB 1ZKEA 3OTOT 1T7SA 3AXJA 4QXHB 3RYFE 4UM1A 2X68A 5HEJA 2D0UA 5J5FA 3AEDA 2PH9A 1HNWT 3ZC0A 2IAKA 3GA8A 5ABEA 2ODVA 3PUWF 2CXLA 2E8IA 2MAWA 3TLTA 1X9BA 1E7PA 4TWFA 3FXEB 3MZKB 4ZEYA 2LSKA 2D0TA 3AAAB 1WR0A 1JNZA 2ZM2A 5A1LA 3SFEA 4H63H 3FZHB 2ZM0A 3H3AA 1MIVA 2ODUA 1XDPA 3PDYA 2LLYA 4OYKA 2VKDA 3UULA 4DIDB 4LFBT 1FIOA 1MIYA 3KV9A 3EVYA 3AE4A 5AQGB 2XNTA 3O1HA 2JIWA 4TWDA 2YKSA 5JDLA 2BDEA 3FBLA 1OWAA 3PU3A 4QACA 2CWYA 3PV0F 2KWIB 4JBWF 3F2EA 4ZI2C 4I55E 2KZ7B 1S94A 3O4XE 4NZBA 4OFZA 1KNPA 4GKKT 4LMKA 3ZPOA 2VK9A 5HXCA 5AQJB 5AQSB 5HXHA 3ZMUB 4PIRA 3ZN0B 2DLRA 2LT3A 3UQ4A 4LF6T 2ZM6T 4P0AA 4KMCA 3N9QA 4U33A 5H6RB 3R84B 1UX2A 3N9NA 2Y54A 5JDNA 4DV3T 5FXXA 2CHNA 4NIQA 4A98A 5HCMA 3CQXC 3I0QA 2HPJA 4L9IA 2CE7A 1LRZA 3L8RA 4ZI7E 1S35A 5GONE 4B5DA 3T4MA 3N9LA 2WNCA 2XYSA 3ABVA 4YHHT 3IEEA 3MKDA 5DJQC 2YEVC 3EDUA 4TV9E 4DR3T 2CLYC 4JV5T 3UUNA 4WBOA 4AFGA 3S4UA 2V7MA 2W8FA 4JI4T 4HFIA 5J5GA 1HR0T 1Z0PA 3WAJA 4H9OC 2XQYA 1MMDA 5FVKA 4JI3T 5AQHB 3HKBE 3IBPA 4CI3B 3AA1B 2X00D 2X9HA 2SPCA 4XZCA 5AQTB 3J9X1 4CN4A 4ILUA 5LA6E 2H7OA 4HFCA 2ACXA 2L8KA 4ISTA 5FP3A 1KK7A 4K0KT 2NWBA 1Y01A 3AEBA 5L2LA 5L3CB 5ABFB 3ONXA 3K1SA 4ASKA 4UM3A 2K9AA 4UELA 1HFAA 4DR2T 3CQGB 2X0HA 3ZKRA 2LHRA 4TWHA 4D01A 2JQKA 1HNZT 2ZJUA 1XDOA 1WFDA 1QUUA 3AEEA 4AKIA 2N1GA 2YDQA 3RI5A 3RIAA 4EYUA 2LOSA 1LVFA 3KV6A 3C84A 5J0ZA 2WMOA 5BR8T 4NUUA 4CXXA 3P50A 2N9DA 4YXDA 2IIUA 4LFAT 4IE5A 3PUXF 4AFHA 2XM1A 3SQ9A 1D0YA 4IDNA 3UU6A 2VB6A 4ALXA 2KT9A 1UX4A 5ABGA 1SUMB 4IIJE 2WY2A 5ADXL 2YK0A 3X1DA 4I43B 5LJNA 4HFBA 4ZXLA 5DQWA 5HXSA 3ZMZB 2YDSA 4P0BA 2BG9C 5JTGA 3ZDGA 2XHEB 1BR4A 3LDQB 3RHWA 3AA7B 2K3WA 5HAXA 5FXZA 4UV8B 4DR5T 5EK4A 2XYTA 4IT4A 5HEUA 2I6HA 2XAGB 1WYCA 4EEBA 3RRWA 4QXBB 2W00A 2E5VA 4H9SE 5IHYA 5JQGE 2C5IT 1ZV4X 1MMNA 1KFYA 1W9RA 3IHRA 2QVAA 1DU2A 1MNDA 2X67A 4PJLA 4DVDA 5HXEA 4UR9A 3RQWA 3P4SA 3M65A 4ISSA 1HNXT 5AQUB 5CA0E 3AXJB 3JC6D 3JC6C 2BYSA 1J5WA 2BKPA 3DJBA 1XZYA 3AECA 3OPCA 2W63A 2RPAA 1YXRA 1BR0A 3RYIE 5AFKA 3NKZA 4YY3T 2WBLA 4I4TE 3AE6A 2HPLA 3C98B 3I1AA 4O4JE 2CPTA 2NOXA 3ZJ1A 4DBRA 4QXCB 4ERRA 2FUPA 4AKLA 2J1DG 2W62A 3Q5WA 2PGZA 4YJ2E 5LGUB 1XNQT 4B3TT 2B76A 2Y56A 2BYPA 4DR1T 3CK6A 2HN1A 2LM2A 1LKXA 3NRXA 4IE7A 3WTNA 5E0OA 4CXWA 3UUMA 2UXBT 5SYOA 5L3DB 1VRBA 3AVRA 3CWZB 4UEMA 3PE0A 4ILBA 2EHOB 4DV7T 1YKHB 5FNVE 4U2ZA 4H9RC 3VRAA 2VQFT 2V26A 2FJAA 4UF0B 3BQIA 3TLUA 3KFWX 3P4PA 1D1CA 4JI5T 1HS7A 3WTJA 3JAEA 4OX9T 4HTEA 2XQ5A 2XY8B 3NBXX 2PFVA 1G8XA 3FHNA 4AQYT 4EZHA 4ZHQE 4HWHA 4IHJE 3JAFA 4IDPA 3CIRA 2E2AA 4WNKA 5AQRB 3RIUA 5L47A 3KDSE 1YW0A 3V5SA 2XAJB 4HWIB 2UXCT 4O4LE 4PK6A 3IF8B 2CBIA 3RYCE 4LFCT 5AQQB 2V6YB 2XQ4A 5AQKB 3U8LA 5J5IA 3RPUA 2QGSA 5AFNA 4UXUA 1WR6A 1J1JA 3CKDA 4BJNA 2M67A 3ZYKA 2KINB 2WZIA 3RF1A 2UUBT 3RIUC 3RH3A 2OLTA 3RGLA 2DNXA 2IHR1 2E9XA 5LBMA 4ZRUA 1IBMT 4KHZF 2XZEA 4GK0E 2K24A 5AQIB 2VVNA 4BQTA 1SE7A 4QX7B 4XK9A 4OK0A 1XNRT 2LHNA 3UFGA 1FJGT 4DUZT 3PEOA 3P4QA 2DHRA 3KV5A 1FEWA 2X0LB 4WZXA 2WMNA 2X0YA 3P7IA 3AE8A 1ZP0A 3MK7C 1UGOA 4DV1T 3AE9A 3C51A 2IMLA 3FZFB 4AQGA 2V1DB 4JI2T 3ETVA 2EHOD 1IAPA 2WN9A 4M1PA 2Q9QA 3LK42 2KWHA 4IE4A 5FL0A 3C50A 3T8OA 2BG9E 4AISA 3WTKA 1XMOT 4X65T 3L39A 4QX8B 5L3FB 2YU2A 1IZNB 3ZMSB 4C91A 2WM9A 1N36T 5AQPB 1FMVA 4U3CA 2VWAA 5J1GA 2LM9A 3ZYMA 1OXZA 1M62A 3HKDE 2BR7A 3H3MA 5ETWA 3Q5DA 4JLEA 2FJBA 4UIGA 4X20E 4B3MT 4ZS3A 3CMLA 3Q5XA 3D0TA 3ZMTB 2V6XA 4EIWA 3RYHE 2DL1A 3PTRB 4AIUA 3U8JA 2KNDA 1CHUA 3HR0A 5IWAT 3B57A 3PUYF 3VRBA 1AJ3A 5HYAA 3CVRA 3ZEFB 1H7CA 2HHHT 3VHLA 4H9QC 3GUAA 5JR9A 4AKRB 4DV5T 2MPKA 3ZC1A 4IDOA 3ZJ2A 1OEDA 4DV6T 3WTHA 5IUXA 3E08A 2WZYA 4YSZA 4DV0T 4ADZA 2JJ9A 1HX1B 2RP4A 1MIWA 4CI2B 2C9TA 4X1YE 4UV9B 5JR9B 4QH1A 1E1HB 5C2TA 5HEGA 4KX6A 2V5DA 2WWUA 3ZSTA 3KBTA 5L3EB 5LNKA 3WI3A 4YT0A 4PK4A 4HE8A 2KSRA 3EDVA 1E2AA 4PW8A 2OA5A 2GK9A 1ZOYA 1UV6A 4FI5A 3RX6A 3C4WA 4V1Av 2UUCT 3O1IA 4DR7T 5JVDE 2L3LA 4UM3P 3MJXA 5JH7E 1QSDA 2LRKA 4JEUB 3QC9A 3GMIA 3PU8A 1B7TA 3QB5K 4PK5A 4MFRA 2QYWA 1HG2A 2YINA 3PUGA 2W66A 2E5LT 3KVBA 2W67A 3O1JA 3AEFA 3BQLA 3QK6A 2M6IA 1UCUA 5TAOA 5C8YE 2XSBA 5CFBA 5F3JA 5L3BB 2JQQA 1IBLT 2P9BA 2D9DA 4WBNE 4DUYT 4UF0A 1D1AA 2XQAA 1N34T 4BA9A 3IGQA 3SRZA
chains in the Genus database with same CATH topology
2BG9E 4AFGA 5AFKA 5BRXA 4NZBA 3WTKA 2W8FA 3U8KA 5L47A 2C9TA 4ZZBA 3WIPA 4QH1A 5LG3A 3EHZA 3P50A 5CO5A 4HFIA 5J5GA 2YN6A 3C79A 3P4WA 4LMKA 5AFHA 5HEGA 4LMJA 3RIFA 4AFHA 3U8MA 2M6BA 4UY2A 4XHEA 2XQ9A 3SQ9A 2QC1B 3UU6A 2X00A 4F8HA 4ALXA 4HQPA 5AINA 4PIRA 4ZZCA 2BR8A 2PGZA 2BG9A 2XQ4A 3RQUA 4COFA 4A97A 2LKHA 3EI0A 2KSRA 2BJ0A 4UM1A 5TVCA 5HCJA 4QH5A 4IREA 2X00D 2YMEA 5HEHA 3U8LA 5J5IA 2Y56A 3UQ4A 5HEJA 1UV6A 5J5FA 2BYPA 2PH9A 4UM3S 1I9BA 5AFNA 4UXUA 2LKGA 2BR7A 4HFBA 2YOEA 3UQ7A 4UM3P 2XZ5A 2LM2A 4ZR6A 4QH4A 2XNVA 2MAWA 3TLTA 3UUBA 5L4HA 4HFDA 2BG9C 3WTNA 3ZDGA 4HFCA 4TWFA 1UX2A 2Y54A 4HFHA 3RHWA 5AFMA 5SYOA 4ZRUA 1OEDB 3EAMA 4Z91A 5LXBA 3TLSA 3WTLA 2BYRA 3U8NA 2XQ8A 4ILBA 2Y57A 2YMDA 2XNUA 2XYTA 2UZ6A 3UU8A 4BQTA 4X5TA 5HEOA 5L4EA 4EZ1A 5HEUA 2W8GA 4A98A 5BP0A 2ZJVA 4ZK1A 2XZ6A 3JADA 5FJVA 5HCMA 4XK9A 4UM3A 3U8JA 2XQ3A 3WTMA 2LLYA 3PEOA 4ZJSA 3PMZA 2Y58A 4Z90A 5J5HA 5BW2A 3TLUA 4DBMA 3SIOA 2M6IA 5JMEA 2BG9B 4HFEA 4NPPA 1OEDE 2BYQA 4ILAA 4IL9A 2WNJA 1OEDC 3T4MA 4B5DA 3WTJA 3WTIA 3TLVA 3ZKRA 2WNLA 5KE4A 1UW6A 5CFBA 3JAEA 4AFTA 4TWHA 3GUAA 2WNCA 4D01A 2XNTA 3ZDHA 4ZJTA 4TNWA 5AFJA 2BYNA 2VL0A 3UU5A 2XYSA 3LSVA 2XQ5A 4TWDA 3RQWA 3SH1A 4FRRA 3SQ6A 4BFQA 2YKSA 5KZUA 2Y7YA 4ZK4A 4IL4A 3UU4A 2ZJUA 4WV9A 4QAAA 5AFLA 2XQ7A 4QABA 4QACA 3WTOA 3UU3A 3JAFA 2XQ6A 2BYSA 1OEDA 3TLWA 4TNVA 2WN9A 3WTHA 5AFMB 2XQAA 3IGQA 5IUXA 3RI5A 4LMLA 3RIAA 2WZYA 4ILCA 3C84A 5J0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG9 E;  4AFG A;  5AFK A;  5BRX A;  4NZB A;  3WTK A;  2W8F A;  3U8K A;  5L47 A;  2C9T A;  4ZZB A;  3WIP A;  4QH1 A;  5LG3 A;  3EHZ A;  3P50 A;  5CO5 A;  4HFI A;  5J5G A;  2YN6 A;  3C79 A;  3P4W A;  4LMK A;  5AFH A;  5HEG A;  4LMJ A;  3RIF A;  4AFH A;  3U8M A;  2M6B A;  4UY2 A;  4XHE A;  2XQ9 A;  3SQ9 A;  2QC1 B;  3UU6 A;  2X00 A;  4F8H A;  4ALX A;  4HQP A;  5AIN A;  4PIR A;  4ZZC A;  2BR8 A;  2PGZ A;  2BG9 A;  2XQ4 A;  3RQU A;  4COF A;  4A97 A;  2LKH A;  3EI0 A;  2KSR A;  2BJ0 A;  4UM1 A;  5TVC A;  5HCJ A;  4QH5 A;  4IRE A;  2X00 D;  2YME A;  5HEH A;  3U8L A;  5J5I A;  2Y56 A;  3UQ4 A;  5HEJ A;  1UV6 A;  5J5F A;  2BYP A;  2PH9 A;  4UM3 S;  1I9B A;  5AFN A;  4UXU A;  2LKG A;  2BR7 A;  4HFB A;  2YOE A;  3UQ7 A;  4UM3 P;  2XZ5 A;  2LM2 A;  4ZR6 A;  4QH4 A;  2XNV A;  2MAW A;  3TLT A;  3UUB A;  5L4H A;  4HFD A;  2BG9 C;  3WTN A;  3ZDG A;  4HFC A;  4TWF A;  1UX2 A;  2Y54 A;  4HFH A;  3RHW A;  5AFM A;  5SYO A;  4ZRU A;  1OED B;  3EAM A;  4Z91 A;  5LXB A;  3TLS A;  3WTL A;  2BYR A;  3U8N A;  2XQ8 A;  4ILB A;  2Y57 A;  2YMD A;  2XNU A;  2XYT A;  2UZ6 A;  3UU8 A;  4BQT A;  4X5T A;  5HEO A;  5L4E A;  4EZ1 A;  5HEU A;  2W8G A;  4A98 A;  5BP0 A;  2ZJV A;  4ZK1 A;  2XZ6 A;  3JAD A;  5FJV A;  5HCM A;  4XK9 A;  4UM3 A;  3U8J A;  2XQ3 A;  3WTM A;  2LLY A;  3PEO A;  4ZJS A;  3PMZ A;  2Y58 A;  4Z90 A;  5J5H A;  5BW2 A;  3TLU A;  4DBM A;  3SIO A;  2M6I A;  5JME A;  2BG9 B;  4HFE A;  4NPP A;  1OED E;  2BYQ A;  4ILA A;  4IL9 A;  2WNJ A;  1OED C;  3T4M A;  4B5D A;  3WTJ A;  3WTI A;  3TLV A;  3ZKR A;  2WNL A;  5KE4 A;  1UW6 A;  5CFB A;  3JAE A;  4AFT A;  4TWH A;  3GUA A;  2WNC A;  4D01 A;  2XNT A;  3ZDH A;  4ZJT A;  4TNW A;  5AFJ A;  2BYN A;  2VL0 A;  3UU5 A;  2XYS A;  3LSV A;  2XQ5 A;  4TWD A;  3RQW A;  3SH1 A;  4FRR A;  3SQ6 A;  4BFQ A;  2YKS A;  5KZU A;  2Y7Y A;  4ZK4 A;  4IL4 A;  3UU4 A;  2ZJU A;  4WV9 A;  4QAA A;  5AFL A;  2XQ7 A;  4QAB A;  4QAC A;  3WTO A;  3UU3 A;  3JAF A;  2XQ6 A;  2BYS A;  1OED A;  3TLW A;  4TNV A;  2WN9 A;  3WTH A;  5AFM B;  2XQA A;  3IGQ A;  5IUX A;  3RI5 A;  4LML A;  3RIA A;  2WZY A;  4ILC A;  3C84 A;  5J0Z A; 
#chains in the Genus database with same CATH topology
 3NZP A;  3BQK A;  4DR6 T;  3OVU A;  3JCF A;  4I0U A;  5HXR A;  4QKN A;  2G0U A;  4DV4 T;  2BS3 A;  3ZCJ A;  5AFU L;  2KXP B;  4E7S A;  2VKO A;  3K3O A;  4YHJ A;  3J7Y q;  1XMQ T;  4ZZC A;  4X62 T;  2I59 A;  2LKH A;  2UU9 T;  2IUB A;  2YU1 A;  5HEH A;  4HEA A;  2H7V C;  2DCF A;  4U7I A;  1I9B A;  4I50 E;  4TUY E;  4HN9 A;  5LMN T;  4GOU A;  2LOP A;  2B1E A;  5FY0 A;  4EYY R;  1HTJ F;  1SA0 E;  3MAC A;  2W4X A;  1ZEE A;  2UXN B;  1UUS A;  1UK5 A;  4JI1 T;  5F8P A;  1WLX A;  4PJM A;  3ZLI A;  2YMD A;  3OJA A;  3HKE E;  3UT5 E;  3VU7 H;  3LBX B;  4EZ1 A;  1IBK T;  3H37 A;  5ABH A;  3ZCI A;  5J5H A;  4B3S T;  1U4Q A;  5KXJ A;  2HH7 A;  3OYX A;  1OED E;  2WNJ A;  3N9P A;  4HGA A;  2KLQ A;  2H3R A;  2Y48 B;  4ZI3 D;  4B3R T;  3SQ6 A;  4YSX A;  3N2K E;  2H88 A;  4QAB A;  1W09 A;  3CPZ A;  2XQ6 A;  3ONJ A;  4L0R A;  4TNV A;  2MYS A;  5J2U E;  2V7J A;  4PJN A;  4XAX B;  3A7M A;  5FXW A;  4O2A E;  5CGM A;  1N32 T;  5CO5 A;  3P4W A;  4Z8X A;  3CX7 B;  3RIF A;  3ZYL A;  5KX5 E;  2QC1 B;  4U7Y A;  4HWF A;  1I94 T;  2WZH A;  5JRC B;  3ZT6 A;  5EZY E;  2LKG A;  2XAS B;  4K0U A;  4U72 A;  3FZM B;  2VUR A;  2E9X C;  2NW9 A;  4JI6 T;  2DWK A;  5EK3 A;  3TLS A;  1LVK A;  4U74 A;  2LSY A;  1HX8 A;  1JNR A;  4LF8 T;  5L4E A;  2W8G A;  1US7 B;  5FJV A;  2CWO A;  3N9M A;  3UUX B;  4ZJS A;  4YTM A;  4CN6 A;  4HFV A;  4EZ4 A;  5FL1 A;  3SIO A;  4HFE A;  4ILA A;  2Y6X A;  2X9X A;  3QOF A;  3VR8 A;  4CI1 B;  2J62 A;  4AFT A;  1SHZ C;  2FBW A;  4BFQ A;  2WWV A;  4IL4 A;  4QAA A;  3M3Z B;  4X64 T;  4UVB B;  3KIN B;  1HF8 A;  4L5G A;  4LML A;  4GYS A;  2CCQ A;  4ILC A;  1NEK A;  3AVS A;  2IW5 B;  2HN2 A;  2J47 A;  3PUA A;  3SFD A;  2N2N A;  1HG5 A;  2I0M A;  3WIP A;  1J5E T;  2YN6 A;  3AE5 A;  4LMJ A;  3MA9 A;  5KDM C;  3ESL A;  5JDM A;  2C5J A;  1YQ3 A;  4IDQ A;  4EED A;  4AI6 A;  2Q9Q C;  2JPF A;  3AA6 B;  5TVC A;  2CRB A;  2X51 A;  2V7I A;  1X79 A;  3HKC E;  5DQV A;  2BVM A;  3AE2 A;  2UXD T;  4QH4 A;  2WSS V;  3NZQ A;  5C3J A;  2BBH A;  3C4Z A;  2XTL A;  2LSJ A;  3F57 A;  1OED B;  1D1B A;  2BKN A;  2UXX B;  5LP6 E;  1R8I A;  4UVC B;  1HCI A;  2NP9 A;  3ZT7 A;  1MMG A;  4NUV A;  5LB7 B;  1BR2 A;  4LF9 T;  4AQF C;  1IJ6 A;  1FMW A;  2D2S A;  1U5P A;  4TZ4 C;  4C90 A;  1O3X A;  2BG9 B;  2E9X D;  1QLB A;  4IL9 A;  4KBM B;  5LHH B;  4JI0 T;  3OYZ A;  3N2O A;  2Y7Y A;  4ANJ A;  4KP3 C;  2X9W A;  4WV9 A;  3AE7 A;  2XQ7 A;  4AQF A;  3ANW B;  4AKH A;  5LXT E;  3RKO A;  4DO0 A;  3FXD B;  4WW0 A;  4DBQ A;  2DI4 A;  2V7K A;  2Q9Q B;  4X66 T;  2WB5 A;  3TKL B;  2XZ6 A;  1EZ3 A;  2X9Y A;  2ZMA A;  3G06 A;  2C0S A;  4NXN T;  5AFH A;  5LBQ B;  1M7K A;  2XUE A;  3U8M A;  4UY2 A;  2A2F X;  2NTX A;  4ZI2 D;  2VAS A;  4HQP A;  3KV4 A;  3I9Y A;  3EI0 A;  2WAU A;  4N78 D;  3WAK A;  3MXZ A;  4DV2 T;  3LG7 A;  4KUM B;  3UQ7 A;  4ZI3 C;  5LJM A;  3K8P C;  4ZR6 A;  3UUB A;  2K48 A;  2IC9 A;  2NW8 A;  4G2A A;  4PJJ A;  2BKO A;  2IC6 A;  5LXB A;  3LBX A;  2XQ8 A;  3AAI A;  5FMN A;  4PNI A;  1WCR A;  5AQL B;  2Y8D A;  2WDV A;  1I6Z A;  4FJO A;  5FY1 A;  1YD8 G;  5CJ5 A;  1KEY A;  3OBV E;  4JUY A;  1KNR A;  3DP7 A;  2D5U A;  5BW2 A;  5IYZ E;  3N9O A;  1BR1 A;  3UFE A;  4TN7 B;  1GQE A;  2AXD S;  1IJ5 A;  3IA3 A;  3FZK B;  2Q9Q D;  2NTY A;  4WYV A;  4B6X A;  5JRE A;  2BYN A;  3EAB A;  3UU5 A;  4DND A;  3SH1 A;  4J2C A;  2MOZ A;  4F6R C;  1YQ4 A;  4IGU A;  1KF6 A;  4CXY A;  3E0Z A;  1T98 A;  4ZS2 A;  3GN5 B;  4PAG A;  2CM0 A;  5DAB A;  3VKH A;  5HWX A;  1WRD A;  4GK5 E;  4YSY A;  2CEA A;  3U8K A;  4XBF B;  2FJE A;  4MHC A;  2W61 A;  3EHZ A;  4YFS A;  2ACZ A;  2ZLY A;  3N5L A;  4DMV A;  3C79 A;  2XM2 A;  5AQV B;  1V9D A;  2V5C A;  3LJC A;  4X1I E;  4XHE A;  4IDZ A;  2CXF A;  3P4R A;  2BR8 A;  2XAF B;  4H9N C;  2OV9 A;  1N33 T;  1VCT A;  4EV6 A;  2QA7 A;  5LHI B;  4EGW A;  3K3Q C;  2QRX A;  3QUJ A;  4HFD A;  3AEG A;  5AFM A;  1Y64 B;  2W0G A;  4YTN A;  4G63 A;  2BYR A;  3CQC B;  2H89 A;  3Q9D A;  1W0B A;  3U3I A;  3I0O A;  3A8Y C;  3RKG A;  2C5K T;  1D0X A;  2KMF A;  2IDO B;  3ETU A;  3RRC A;  3WTM A;  1XWM A;  2Y58 A;  4Z90 A;  4PFP A;  3UTK A;  3B5M A;  1ZHC A;  1UW6 A;  1G73 A;  2LE8 A;  4TNW A;  2XSA A;  3FB2 A;  3LK2 B;  2PTF A;  4H63 V;  5FVL A;  2AE9 A;  4HWD A;  3GN5 A;  5LGT B;  2YDR A;  3TLW A;  3DTO A;  4GKJ T;  5AFM B;  5LHG B;  1VOM A;  5L3G B;  2EHO A;  4E7Z A;  4EXT A;  4YLH A;  2BS4 A;  5JDQ A;  2PBI A;  3AA0 B;  5ABF A;  4LF7 T;  3ZSS A;  5LG3 A;  3OKQ A;  3PUR A;  3L3P A;  3NVO A;  2JQH A;  5EK2 A;  3U78 A;  4CN1 A;  2Z6E A;  3C64 A;  3GWH A;  2X00 A;  5J2T E;  2A3D A;  4AKG A;  5JR9 C;  3RC8 A;  4COF A;  4A97 A;  4QH5 A;  5HCJ A;  3RLF F;  2A72 A;  4JI7 T;  2JQ9 A;  2A9U A;  2VKH A;  2E9X B;  4UM3 S;  2BZB A;  2XZ5 A;  2BS2 A;  5LCY A;  5L4H A;  2K5B B;  3RC3 A;  3HL6 A;  2LEH A;  4EOZ B;  4MBQ A;  2Y57 A;  1WYB A;  2V6Y A;  2CBJ A;  3PUV F;  2UZ6 A;  5HEO A;  5AQO B;  5BP0 A;  2ZJV A;  2FJD A;  3JAD A;  4EB6 E;  1UUR A;  1NEN A;  3LK3 B;  3PJA J;  3FZL B;  2NW7 A;  4A56 A;  5AQF B;  5FKY A;  5AQM B;  1W0A A;  4DBM A;  5JME A;  4Q25 A;  4MAL A;  1OED C;  3FBZ A;  5LG4 A;  3Q2M A;  3ZDH A;  5AFJ A;  5FYM A;  4FRR A;  3PUZ F;  5KZU A;  4U31 A;  3UU4 A;  3T1H T;  3WTO A;  2BVL A;  5LMU T;  4QWN B;  5JDG A;  2LSG A;  4LF5 T;  3O9X A;  3CX6 B;  3CX8 B;  3AB3 B;  5AQN B;  3NRY A;  4JEH B;  4BJM A;  2CXD A;  3KVA A;  4U2Y A;  3C4X A;  4O2B E;  2CHO A;  4HWC A;  4UVA B;  4ZOL E;  5F5W A;  2M6B A;  2XQ9 A;  3SWH A;  2R6G F;  2WCA A;  5KMG P;  2BG9 A;  3SS1 A;  2BJ0 A;  2V7L A;  1T72 A;  1NWM X;  4NXM T;  2WDQ A;  4DR4 T;  2ZM8 A;  1YKE B;  3HA4 A;  3PUQ A;  2PG8 A;  3QB5 A;  2XNV A;  4O8S A;  3AE1 A;  4LF4 T;  2CMR A;  2MBG A;  2CA5 A;  5JRC A;  5LOV E;  2W2U A;  5BMV E;  3EAM A;  3WTL A;  3PJA A;  3U8N A;  5CA1 E;  2WU5 A;  2LSI A;  3AAE B;  2XNU A;  4CQI A;  5H6Q B;  3UU8 A;  4X5T A;  2WU2 A;  4KI0 F;  3KBU A;  3ANW A;  4P1N A;  2XQ3 A;  4O4I E;  5HWY A;  3SOL A;  3PMZ A;  2X66 A;  4X1K E;  3N2G E;  2WP9 A;  2ES0 A;  4NPP A;  4PFO A;  2VL8 A;  3TLV A;  4H9P C;  4EAH A;  2VL0 A;  5JDF A;  2VQE T;  4ZK4 A;  1MNE A;  2WS3 A;  4OYJ A;  3I9W A;  2XPK A;  4A5X A;  5AFL A;  3UU3 A;  2V8S V;  4DMW A;  5FY7 A;  1UX5 A;  5M4Y A;  3T1Y T;  4CZZ B;  3ZT5 A;  5BRX A;  4GIW A;  4ZZB A;  4IE0 A;  2MTQ A;  4KHP T;  3VR9 A;  2JMK A;  5JDH A;  2F4V T;  1T8B A;  1Z8U A;  2L9Q A;  4F8H A;  3R6N A;  3NWI A;  2XJ7 A;  3AE3 A;  3RQU A;  3EUH A;  4JYA T;  2LJL A;  4IRE A;  2YME A;  4OHF A;  3E22 E;  3A5X A;  2XAQ B;  1D0Z A;  2VVS A;  2YOE A;  4P09 A;  3VKG A;  4UXN B;  4QHO A;  4IE6 A;  5LGN B;  3ZN1 B;  4HFH A;  4Z91 A;  3QNU A;  3PUS A;  2DWG A;  4BAY B;  3AEA A;  3P8C D;  4TX5 A;  4JI8 T;  4ZK1 A;  2XAH B;  4HKA A;  2WDR A;  2WQY A;  4TV8 E;  3L09 A;  3F31 A;  3ONL C;  3ZMV B;  4YJ3 E;  5CB4 E;  2NR4 A;  3W15 B;  2BYQ A;  5FXV A;  4MLK A;  2JRK A;  3WTI A;  2WNL A;  5KE4 A;  2EHO C;  4AXP A;  4ZJT A;  4GYR A;  3LSV A;  3Q5E A;  1MMA A;  3LFM A;  1VCS A;  2JMH A;  5LYJ E;  2LRL A;  1L0V A;  2RA1 A;  4O4H E;  2VKJ A;  1CUN A;  3BK9 A;  3K3N A;  4YTP A;  1KNZ A;  3HI2 A;  1NAF A;  5AIN A;  3V5U A;  2J4G A;  2UUA T;  2BBJ A;  2PJQ A;  3B13 A;  2CLY B;  1ZKE A;  3OTO T;  1T7S A;  3AXJ A;  4QXH B;  3RYF E;  4UM1 A;  2X68 A;  5HEJ A;  2D0U A;  5J5F A;  3AED A;  2PH9 A;  1HNW T;  3ZC0 A;  2IAK A;  3GA8 A;  5ABE A;  2ODV A;  3PUW F;  2CXL A;  2E8I A;  2MAW A;  3TLT A;  1X9B A;  1E7P A;  4TWF A;  3FXE B;  3MZK B;  4ZEY A;  2LSK A;  2D0T A;  3AAA B;  1WR0 A;  1JNZ A;  2ZM2 A;  5A1L A;  3SFE A;  4H63 H;  3FZH B;  2ZM0 A;  3H3A A;  1MIV A;  2ODU A;  1XDP A;  3PDY A;  2LLY A;  4OYK A;  2VKD A;  3UUL A;  4DID B;  4LFB T;  1FIO A;  1MIY A;  3KV9 A;  3EVY A;  3AE4 A;  5AQG B;  2XNT A;  3O1H A;  2JIW A;  4TWD A;  2YKS A;  5JDL A;  2BDE A;  3FBL A;  1OWA A;  3PU3 A;  4QAC A;  2CWY A;  3PV0 F;  2KWI B;  4JBW F;  3F2E A;  4ZI2 C;  4I55 E;  2KZ7 B;  1S94 A;  3O4X E;  4NZB A;  4OFZ A;  1KNP A;  4GKK T;  4LMK A;  3ZPO A;  2VK9 A;  5HXC A;  5AQJ B;  5AQS B;  5HXH A;  3ZMU B;  4PIR A;  3ZN0 B;  2DLR A;  2LT3 A;  3UQ4 A;  4LF6 T;  2ZM6 T;  4P0A A;  4KMC A;  3N9Q A;  4U33 A;  5H6R B;  3R84 B;  1UX2 A;  3N9N A;  2Y54 A;  5JDN A;  4DV3 T;  5FXX A;  2CHN A;  4NIQ A;  4A98 A;  5HCM A;  3CQX C;  3I0Q A;  2HPJ A;  4L9I A;  2CE7 A;  1LRZ A;  3L8R A;  4ZI7 E;  1S35 A;  5GON E;  4B5D A;  3T4M A;  3N9L A;  2WNC A;  2XYS A;  3ABV A;  4YHH T;  3IEE A;  3MKD A;  5DJQ C;  2YEV C;  3EDU A;  4TV9 E;  4DR3 T;  2CLY C;  4JV5 T;  3UUN A;  4WBO A;  4AFG A;  3S4U A;  2V7M A;  2W8F A;  4JI4 T;  4HFI A;  5J5G A;  1HR0 T;  1Z0P A;  3WAJ A;  4H9O C;  2XQY A;  1MMD A;  5FVK A;  4JI3 T;  5AQH B;  3HKB E;  3IBP A;  4CI3 B;  3AA1 B;  2X00 D;  2X9H A;  2SPC A;  4XZC A;  5AQT B;  3J9X 1;  4CN4 A;  4ILU A;  5LA6 E;  2H7O A;  4HFC A;  2ACX A;  2L8K A;  4IST A;  5FP3 A;  1KK7 A;  4K0K T;  2NWB A;  1Y01 A;  3AEB A;  5L2L A;  5L3C B;  5ABF B;  3ONX A;  3K1S A;  4ASK A;  4UM3 A;  2K9A A;  4UEL A;  1HFA A;  4DR2 T;  3CQG B;  2X0H A;  3ZKR A;  2LHR A;  4TWH A;  4D01 A;  2JQK A;  1HNZ T;  2ZJU A;  1XDO A;  1WFD A;  1QUU A;  3AEE A;  4AKI A;  2N1G A;  2YDQ A;  3RI5 A;  3RIA A;  4EYU A;  2LOS A;  1LVF A;  3KV6 A;  3C84 A;  5J0Z A;  2WMO A;  5BR8 T;  4NUU A;  4CXX A;  3P50 A;  2N9D A;  4YXD A;  2IIU A;  4LFA T;  4IE5 A;  3PUX F;  4AFH A;  2XM1 A;  3SQ9 A;  1D0Y A;  4IDN A;  3UU6 A;  2VB6 A;  4ALX A;  2KT9 A;  1UX4 A;  5ABG A;  1SUM B;  4IIJ E;  2WY2 A;  5ADX L;  2YK0 A;  3X1D A;  4I43 B;  5LJN A;  4HFB A;  4ZXL A;  5DQW A;  5HXS A;  3ZMZ B;  2YDS A;  4P0B A;  2BG9 C;  5JTG A;  3ZDG A;  2XHE B;  1BR4 A;  3LDQ B;  3RHW A;  3AA7 B;  2K3W A;  5HAX A;  5FXZ A;  4UV8 B;  4DR5 T;  5EK4 A;  2XYT A;  4IT4 A;  5HEU A;  2I6H A;  2XAG B;  1WYC A;  4EEB A;  3RRW A;  4QXB B;  2W00 A;  2E5V A;  4H9S E;  5IHY A;  5JQG E;  2C5I T;  1ZV4 X;  1MMN A;  1KFY A;  1W9R A;  3IHR A;  2QVA A;  1DU2 A;  1MND A;  2X67 A;  4PJL A;  4DVD A;  5HXE A;  4UR9 A;  3RQW A;  3P4S A;  3M65 A;  4ISS A;  1HNX T;  5AQU B;  5CA0 E;  3AXJ B;  3JC6 D;  3JC6 C;  2BYS A;  1J5W A;  2BKP A;  3DJB A;  1XZY A;  3AEC A;  3OPC A;  2W63 A;  2RPA A;  1YXR A;  1BR0 A;  3RYI E;  5AFK A;  3NKZ A;  4YY3 T;  2WBL A;  4I4T E;  3AE6 A;  2HPL A;  3C98 B;  3I1A A;  4O4J E;  2CPT A;  2NOX A;  3ZJ1 A;  4DBR A;  4QXC B;  4ERR A;  2FUP A;  4AKL A;  2J1D G;  2W62 A;  3Q5W A;  2PGZ A;  4YJ2 E;  5LGU B;  1XNQ T;  4B3T T;  2B76 A;  2Y56 A;  2BYP A;  4DR1 T;  3CK6 A;  2HN1 A;  2LM2 A;  1LKX A;  3NRX A;  4IE7 A;  3WTN A;  5E0O A;  4CXW A;  3UUM A;  2UXB T;  5SYO A;  5L3D B;  1VRB A;  3AVR A;  3CWZ B;  4UEM A;  3PE0 A;  4ILB A;  2EHO B;  4DV7 T;  1YKH B;  5FNV E;  4U2Z A;  4H9R C;  3VRA A;  2VQF T;  2V26 A;  2FJA A;  4UF0 B;  3BQI A;  3TLU A;  3KFW X;  3P4P A;  1D1C A;  4JI5 T;  1HS7 A;  3WTJ A;  3JAE A;  4OX9 T;  4HTE A;  2XQ5 A;  2XY8 B;  3NBX X;  2PFV A;  1G8X A;  3FHN A;  4AQY T;  4EZH A;  4ZHQ E;  4HWH A;  4IHJ E;  3JAF A;  4IDP A;  3CIR A;  2E2A A;  4WNK A;  5AQR B;  3RIU A;  5L47 A;  3KDS E;  1YW0 A;  3V5S A;  2XAJ B;  4HWI B;  2UXC T;  4O4L E;  4PK6 A;  3IF8 B;  2CBI A;  3RYC E;  4LFC T;  5AQQ B;  2V6Y B;  2XQ4 A;  5AQK B;  3U8L A;  5J5I A;  3RPU A;  2QGS A;  5AFN A;  4UXU A;  1WR6 A;  1J1J A;  3CKD A;  4BJN A;  2M67 A;  3ZYK A;  2KIN B;  2WZI A;  3RF1 A;  2UUB T;  3RIU C;  3RH3 A;  2OLT A;  3RGL A;  2DNX A;  2IHR 1;  2E9X A;  5LBM A;  4ZRU A;  1IBM T;  4KHZ F;  2XZE A;  4GK0 E;  2K24 A;  5AQI B;  2VVN A;  4BQT A;  1SE7 A;  4QX7 B;  4XK9 A;  4OK0 A;  1XNR T;  2LHN A;  3UFG A;  1FJG T;  4DUZ T;  3PEO A;  3P4Q A;  2DHR A;  3KV5 A;  1FEW A;  2X0L B;  4WZX A;  2WMN A;  2X0Y A;  3P7I A;  3AE8 A;  1ZP0 A;  3MK7 C;  1UGO A;  4DV1 T;  3AE9 A;  3C51 A;  2IML A;  3FZF B;  4AQG A;  2V1D B;  4JI2 T;  3ETV A;  2EHO D;  1IAP A;  2WN9 A;  4M1P A;  2Q9Q A;  3LK4 2;  2KWH A;  4IE4 A;  5FL0 A;  3C50 A;  3T8O A;  2BG9 E;  4AIS A;  3WTK A;  1XMO T;  4X65 T;  3L39 A;  4QX8 B;  5L3F B;  2YU2 A;  1IZN B;  3ZMS B;  4C91 A;  2WM9 A;  1N36 T;  5AQP B;  1FMV A;  4U3C A;  2VWA A;  5J1G A;  2LM9 A;  3ZYM A;  1OXZ A;  1M62 A;  3HKD E;  2BR7 A;  3H3M A;  5ETW A;  3Q5D A;  4JLE A;  2FJB A;  4UIG A;  4X20 E;  4B3M T;  4ZS3 A;  3CML A;  3Q5X A;  3D0T A;  3ZMT B;  2V6X A;  4EIW A;  3RYH E;  2DL1 A;  3PTR B;  4AIU A;  3U8J A;  2KND A;  1CHU A;  3HR0 A;  5IWA T;  3B57 A;  3PUY F;  3VRB A;  1AJ3 A;  5HYA A;  3CVR A;  3ZEF B;  1H7C A;  2HHH T;  3VHL A;  4H9Q C;  3GUA A;  5JR9 A;  4AKR B;  4DV5 T;  2MPK A;  3ZC1 A;  4IDO A;  3ZJ2 A;  1OED A;  4DV6 T;  3WTH A;  5IUX A;  3E08 A;  2WZY A;  4YSZ A;  4DV0 T;  4ADZ A;  2JJ9 A;  1HX1 B;  2RP4 A;  1MIW A;  4CI2 B;  2C9T A;  4X1Y E;  4UV9 B;  5JR9 B;  4QH1 A;  1E1H B;  5C2T A;  5HEG A;  4KX6 A;  2V5D A;  2WWU A;  3ZST A;  3KBT A;  5L3E B;  5LNK A;  3WI3 A;  4YT0 A;  4PK4 A;  4HE8 A;  2KSR A;  3EDV A;  1E2A A;  4PW8 A;  2OA5 A;  2GK9 A;  1ZOY A;  1UV6 A;  4FI5 A;  3RX6 A;  3C4W A;  4V1A v;  2UUC T;  3O1I A;  4DR7 T;  5JVD E;  2L3L A;  4UM3 P;  3MJX A;  5JH7 E;  1QSD A;  2LRK A;  4JEU B;  3QC9 A;  3GMI A;  3PU8 A;  1B7T A;  3QB5 K;  4PK5 A;  4MFR A;  2QYW A;  1HG2 A;  2YIN A;  3PUG A;  2W66 A;  2E5L T;  3KVB A;  2W67 A;  3O1J A;  3AEF A;  3BQL A;  3QK6 A;  2M6I A;  1UCU A;  5TAO A;  5C8Y E;  2XSB A;  5CFB A;  5F3J A;  5L3B B;  2JQQ A;  1IBL T;  2P9B A;  2D9D A;  4WBN E;  4DUY T;  4UF0 A;  1D1A A;  2XQA A;  1N34 T;  4BA9 A;  3IGQ A;  3SRZ A; 
#chains in the Genus database with same CATH homology
 2BG9 E;  4AFG A;  5AFK A;  5BRX A;  4NZB A;  3WTK A;  2W8F A;  3U8K A;  5L47 A;  2C9T A;  4ZZB A;  3WIP A;  4QH1 A;  5LG3 A;  3EHZ A;  3P50 A;  5CO5 A;  4HFI A;  5J5G A;  2YN6 A;  3C79 A;  3P4W A;  4LMK A;  5AFH A;  5HEG A;  4LMJ A;  3RIF A;  4AFH A;  3U8M A;  2M6B A;  4UY2 A;  4XHE A;  2XQ9 A;  3SQ9 A;  2QC1 B;  3UU6 A;  2X00 A;  4F8H A;  4ALX A;  4HQP A;  5AIN A;  4PIR A;  4ZZC A;  2BR8 A;  2PGZ A;  2BG9 A;  2XQ4 A;  3RQU A;  4COF A;  4A97 A;  2LKH A;  3EI0 A;  2KSR A;  2BJ0 A;  4UM1 A;  5TVC A;  5HCJ A;  4QH5 A;  4IRE A;  2X00 D;  2YME A;  5HEH A;  3U8L A;  5J5I A;  2Y56 A;  3UQ4 A;  5HEJ A;  1UV6 A;  5J5F A;  2BYP A;  2PH9 A;  4UM3 S;  1I9B A;  5AFN A;  4UXU A;  2LKG A;  2BR7 A;  4HFB A;  2YOE A;  3UQ7 A;  4UM3 P;  2XZ5 A;  2LM2 A;  4ZR6 A;  4QH4 A;  2XNV A;  2MAW A;  3TLT A;  3UUB A;  5L4H A;  4HFD A;  2BG9 C;  3WTN A;  3ZDG A;  4HFC A;  4TWF A;  1UX2 A;  2Y54 A;  4HFH A;  3RHW A;  5AFM A;  5SYO A;  4ZRU A;  1OED B;  3EAM A;  4Z91 A;  5LXB A;  3TLS A;  3WTL A;  2BYR A;  3U8N A;  2XQ8 A;  4ILB A;  2Y57 A;  2YMD A;  2XNU A;  2XYT A;  2UZ6 A;  3UU8 A;  4BQT A;  4X5T A;  5HEO A;  5L4E A;  4EZ1 A;  5HEU A;  2W8G A;  4A98 A;  5BP0 A;  2ZJV A;  4ZK1 A;  2XZ6 A;  3JAD A;  5FJV A;  5HCM A;  4XK9 A;  4UM3 A;  3U8J A;  2XQ3 A;  3WTM A;  2LLY A;  3PEO A;  4ZJS A;  3PMZ A;  2Y58 A;  4Z90 A;  5J5H A;  5BW2 A;  3TLU A;  4DBM A;  3SIO A;  2M6I A;  5JME A;  2BG9 B;  4HFE A;  4NPP A;  1OED E;  2BYQ A;  4ILA A;  4IL9 A;  2WNJ A;  1OED C;  3T4M A;  4B5D A;  3WTJ A;  3WTI A;  3TLV A;  3ZKR A;  2WNL A;  5KE4 A;  1UW6 A;  5CFB A;  3JAE A;  4AFT A;  4TWH A;  3GUA A;  2WNC A;  4D01 A;  2XNT A;  3ZDH A;  4ZJT A;  4TNW A;  5AFJ A;  2BYN A;  2VL0 A;  3UU5 A;  2XYS A;  3LSV A;  2XQ5 A;  4TWD A;  3RQW A;  3SH1 A;  4FRR A;  3SQ6 A;  4BFQ A;  2YKS A;  5KZU A;  2Y7Y A;  4ZK4 A;  4IL4 A;  3UU4 A;  2ZJU A;  4WV9 A;  4QAA A;  5AFL A;  2XQ7 A;  4QAB A;  4QAC A;  3WTO A;  3UU3 A;  3JAF A;  2XQ6 A;  2BYS A;  1OED A;  3TLW A;  4TNV A;  2WN9 A;  3WTH A;  5AFM B;  2XQA A;  3IGQ A;  5IUX A;  3RI5 A;  4LML A;  3RIA A;  2WZY A;  4ILC A;  3C84 A;  5J0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...