5L4HA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with 5-(2-bromo-ethyl)-5-ethyl-pyrimidine-2,4,6-trione (brominated barbiturate)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
molecule keywords Proton-gated ion channel
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4hA01
3P4WA 2XNUA 5AFNA 4TNWA 5AFKA 4HQPA 2XQAA 2Y58A 4BFQA 4UM1A 2LM2A 4ZK1A 3UUBA 5HEUA 2BJ0A 3JAEA 4ZZBA 2ZJVA 5J5IA 4ZJSA 5J5FA 3SIOA 5KZUA 3WTKA 3JAFA 5JMEA 4HFDA 2BG9A 4PIRA 3RIFA 3SQ6A 3C79A 4AFTA 4EZ1A 5HEGA 2LLYA 2YOEA 3RI5A 2QC1B 2XYSA 3IGQA 5L47A 3SQ9A 4FRRA 5HEOA 2XNVA 2YMEA 3EI0A 5BW2A 4IL9A 1I9BA 1OEDB 5TVCA 4UM3S 4ILAA 4A97A 2BG9E 3LSVA 2BG9B 3U8NA 2LKGA 4HFCA 4A98A 4BQTA 4TWFA 2YKSA 3RHWA 3JADA 4NPPA 4TNVA 3UQ7A 2MAWA 2XZ5A 4Z90A 2BG9C 2X00D 4AFGA 5HEJA 5J0ZA 3ZKRA 3RIAA 3TLTA 5AFMA 5AFHA 5AINA 5AFLA 4QH5A 3WTNA 3ZDHA 4UXUA 3RQUA 5L4EA 4WV9A 4LMKA 2XQ7A 3TLVA 2XQ9A 3WTIA 4DBMA 4HFBA 4QAAA 3U8KA 2M6BA 2PGZA 2PH9A 4QH4A 2WNJA 1UW6A 2C9TA 3UU6A 4ILBA 5LXBA 3WTJA 3WIPA 1UX2A 4HFHA 3TLWA 4UY2A 3UQ4A 2XQ3A 2XYTA 2XQ6A 2XZ6A 2YN6A 5J5HA 4HFIA 4X5TA 2BYQA 2W8FA 4NZBA 2XNTA 5CFBA 2WNLA 4QACA 3WTOA 3T4MA 2X00A 3RQWA 2BYPA 4LMJA 2YMDA 4XK9A 2WZYA 2XQ8A 2BR8A 4HFEA 3SH1A 4AFHA 2BYRA 2XQ4A 5L4HA 3TLSA 4XHEA 3U8JA 5BP0A 2WN9A 4IL4A 2BYNA 2BR7A 4ALXA 3WTMA 3P50A 3UU5A 2Y56A 4ILCA 5LG3A 3UU8A 2BYSA 3GUAA 5HCMA 5KE4A 1OEDC 5HCJA 5AFJA 5SYOA 3WTLA 2Y54A 2ZJUA 4QH1A 3UU4A 4TWHA 2Y7YA 4LMLA 4ZK4A 4UM3A 2UZ6A 3PMZA 5BRXA 5FJVA 5CO5A 3U8LA 4ZRUA 4ZJTA 4ZR6A 4IREA 5J5GA 2KSRA 1OEDE 3C84A 3UU3A 2VL0A 2WNCA 4COFA 2M6IA 4D01A 3WTHA 4F8HA 5AFMB 3EAMA 3TLUA 2W8GA 2Y57A 3ZDGA 1UV6A 4Z91A 4ZZCA 4TWDA 4B5DA 4UM3P 5HEHA 3PEOA 5IUXA 2XQ5A 2LKHA 3U8MA 1OEDA 4QABA 3EHZA
chains in the Genus database with same CATH superfamily
2XNUA 4TNWA 3IA3A 2NWBA 3AVRA 2X0YA 4WZXA 2X67A 1SA0E 1XMQT 4P09A 5J5IA 1FEWA 3OTOT 3ZSTA 1WR0A 4H63V 3I1AA 5FXZA 4WBNE 2JRKA 4OX9T 5L47A 1N32T 5BW2A 4EYUA 4ZOLE 2XPKA 4A97A 1KEYA 2YEVC 5L3EB 1MIYA 2MAWA 4H9QC 2G0UA 5HEJA 2V7JA 4QWNB 1WFDA 4HE8A 3WTNA 2RPAA 4HFHA 3TLWA 2E5LT 4X65T 4HFIA 3KV5A 2ZM8A 3BK9A 1VCTA 4AQFA 2MBGA 1W09A 2W2UA 2XQ4A 2PFVA 5BP0A 3ZC0A 4AQGA 5LGUB 5L3GB 3P50A 1IJ5A 2BKOA 2NW7A 3H3MA 3CPZA 2VKDA 5CA0E 1XNRT 2MYSA 4DBQA 2CPTA 4TUYE 4TV9E 2M67A 3PE0A 4COFA 5HXSA 2D9DA 4DVDA 3EAMA 4ZI3D 5AQRB 2DWGA 2KWIB 2XQ5A 2Y8DA 4QXHB 5LHIB 3F2EA 2EHOD 3EDVA 4X64T 2J1DG 3MACA 2FBWA 5HWXA 3Q5DA 4MLKA 4HFDA 2VVSA 1GQEA 4AFTA 5JDFA 2BVLA 3J7Yq 2X68A 5HEGA 3NKZA 4EGWA 3N9MA 3RF1A 1U4QA 4O4JE 2K3WA 5TVCA 2BG9B 3GWHA 1CUNA 3C4ZA 2DI4A 3LBXB 1I94T 3UT5E 2X00D 3RYCE 4JI3T 4DUZT 5AINA 5AFLA 1JNZA 4LMKA 2UXDT 3LDQB 3TLVA 1MMAA 1D0YA 3AE4A 3MKDA 2ZM6T 4YT0A 4YSZA 4TX5A 5LXTE 2X00A 1ZEEA 2YMDA 5FY0A 4XZCA 2BR8A 4HWFA 1N36T 4JI4T 2V6YA 2AE9A 2XM2A 1T72A 5HCJA 5SYOA 1D0ZA 5LGTB 3U8LA 3T1YT 2HH7A 3PUQA 2M6IA 3CKDA 2PTFA 5DABA 1MMDA 4EIWA 2EHOA 3ZCJA 4X1KE 3FZFB 1I6ZA 4Z8XA 5F5WA 1W9RA 5HEUA 3P8CD 1T7SA 3SIOA 3RIUA 2BG9A 3C79A 1YKEB 2FJDA 3AXJB 2QC1B 2XYSA 4LF6T 4HWCA 4DR3T 4MFRA 1AJ3A 2KNDA 5JDNA 3VHLA 2WQYA 2XQYA 2W4XA 4UXNB 4UVCB 3BQKA 5AFHA 4PJJA 1SHZC 2LSGA 4IDQA 5BMVE 2WSSV 5JDGA 5ABFB 4PFOA 1J5WA 2W00A 1L0VA 1Z8UA 1MMGA 1T98A 2CE7A 3FZKB 3AECA 5HYAA 3CQXC 2V6XA 4QH1A 4TWHA 4QXBB 4WBOA 3PMZA 5ETWA 2W61A 4FI5A 5J5GA 3LK3B 1UX4A 3WTHA 3G06A 2V8SV 3KV6A 5HXRA 4WNKA 2KZ7B 4YHJA 4CN6A 4HN9A 2YU2A 5HXEA 4CN1A 4CQIA 1BR2A 2LM2A 2K48A 4EZHA 5KXJA 4U2YA 4ASKA 2WBLA 1OXZA 1U5PA 3N9NA 1HNXT 3HR0A 4IL9A 2ZLYA 4EZ4A 3ZMSB 2LKGA 2W66A 2YKSA 5AQVB 4DR4T 2LT3A 1YKHB 4MALA 3K3QC 5AQLB 3H3AA 1HX1B 4YFSA 2XQ7A 4E7ZA 3ZC1A 5LB7B 4V1Av 3AAAB 2FJEA 1FMVA 3KBTA 4IE5A 1O3XA 3ZYMA 2XZ6A 2W63A 4H63H 2K5BB 1SE7A 2XNTA 4M1PA 1ZV4X 1KFYA 4HWDA 2WMNA 4LMJA 4ZS3A 3ZT5A 3DJBA 3NZQA 4OHFA 2BYNA 4GYRA 3GN5B 3WTMA 2CRBA 2Y54A 5FXWA 4DR5T 4ZK4A 5ABEA 3RC8A 5L2LA 4DIDB 5FXVA 3ETVA 2XAHB 2W8GA 4EAHA 4GOUA 3LK2B 5AQOB 2V1DB 3QOFA 3IHRA 1Y64B 2E9XA 3FXEB 3EDUA 2NP9A 4CN4A 1X79A 4DV0T 2WAUA 5ADXL 2DL1A 3PUVF 2XZEA 2E9XC 4DV1T 2BVMA 4PIRA 4HKAA 3RRWA 2HN1A 3RI5A 4CI1B 4N78D 3GA8A 2YINA 3AEBA 5LJMA 2LHNA 3RYHE 2V5DA 2H7OA 3L3PA 5FYMA 3JADA 4ZEYA 4TNVA 3ABVA 4O4LE 4AFGA 3AB3B 2K24A 2BBJA 3KFWX 4IE0A 4WV9A 3RQUA 4EEBA 2NTYA 2PH9A 4QH4A 2HHHT 2XM1A 4PFPA 3VKHA 3SRZA 2V5CA 3RRCA 1S35A 2J4GA 3N9QA 1QSDA 3SS1A 4LF8T 3PJAJ 1BR1A 1B7TA 4PJLA 3TLSA 2X66A 4XHEA 3KV4A 1YXRA 3O1JA 3Q5XA 2WCAA 3QUJA 5LG3A 3P7IA 3FBZA 4P0BA 4JUYA 4XBFB 2BBHA 4A5XA 1KNZA 1NENA 1ZP0A 2A9UA 2XAGB 3AE9A 4WYVA 4G63A 4CXWA 5KMGP 2NW9A 1VCSA 2A3DA 2BZBA 4LF4T 3HKBE 5DQVA 2VQFT 1XZYA 4ISSA 1D1CA 3ZJ2A 4KUMB 3SQ6A 5AQUB 1XWMA 3F57A 4PK5A 2XNVA 4UM3S 5LBQB 1WYCA 4AISA 4EOZB 4Q25A 3N9OA 3C51A 5JRCA 5JR9B 1MIWA 4YXDA 1D1BA 2WZHA 4I43B 1ZHCA 5A1LA 3R84B 3N2OA 4DBMA 1HG5A 5LCYA 5JTGA 4ILBA 2X51A 3P4RA 4B3MT 2DWKA 5AQKB 3O9XA 2YN6A 5AQGB 4ZI3C 4EYYR 2VWAA 4AIUA 3FZMB 3RH3A 3KVAA 3QB5A 3L8RA 1HS7A 2JMHA 2V7IA 4DV4T 1OEDC 5BRXA 5CO5A 4ISTA 3PUWF 3K3OA 3L09A 3PUSA 3OJAA 2X9XA 3ZSSA 4DNDA 5AQQB 3B57A 4IIJE 2V6YB 4QABA 1WR6A 1UX5A 3P4WA 3E22E 2V26A 3F31A 5LGNB 1H7CA 1IAPA 1US7B 2H7VC 2HN2A 2EHOC 4AKGA 4YJ2E 3IGQA 4QX7B 3PV0F 3OYZA 2IDOB 3UTKA 3LSVA 4HGAA 3LJCA 2MOZA 3ESLA 3RC3A 1G73A 5J0ZA 4UR9A 3TLTA 3C50A 2EHOB 2XAQB 1HNWT 5CB4E 3KDSE 2BS3A 4ZI2D 2WU5A 1J5ET 2BYQA 4KHPT 2LRLA 1HCIA 5FNVE 3RKOA 3T4MA 4XK9A 2BDEA 5L3CB 5EZYE 1XDPA 3T8OA 4IL4A 3MK7C 3ZCIA 2X0HA 2LOSA 4X66T 2Q9QA 5KX5E 5JVDE 4JI6T 4CI3B 2IUBA 2R6GF 2LSIA 2Q9QB 3SOLA 2BKPA 3AA6B 3C98B 3PUZF 2LJLA 4DR1T 4YTNA 4QX8B 1T8BA 1MNEA 2FJBA 2CHNA 3MJXA 2Y58A 5ABFA 1UURA 3CX7B 4GKKT 2ZJVA 5C8YE 4UEMA 1HF8A 5JMEA 1Y01A 2VK9A 3W15B 3HKCE 4KI0F 4UVAB 2LLYA 2L8KA 3SQ9A 3OPCA 1OEDB 4OYKA 4PW8A 4ILAA 1LVFA 3N2GE 4JEUB 4DO0A 4AKIA 4PJNA 3ZN1B 3AE7A 4ILUA 4NUVA 1NWMX 3A7MA 2BG9C 4B3RT 4ANJA 3PUXF 4DV7T 4DR7T 2W62A 2Z6EA 5J1GA 4ZHQE 3CVRA 4P1NA 4UELA 3FZHB 1HTJF 5C3JA 4H9NC 4O2BE 3MA9A 4HWIB 1KK7A 1IJ6A 3HI2A 5CFBA 2WNLA 3WTOA 4DUYT 4KMCA 3K8PC 1VRBA 4GIWA 4HFEA 4CI2B 5JH7E 2I6HA 5LG4A 3SH1A 4DV6T 3NRXA 3K3NA 3N9LA 2ACZA 4X1IE 4LFCT 3UU4A 2SPCA 4UM3A 4J2CA 2VL0A 3ZT6A 4OK0A 2XHEB 3TLUA 3O1IA 3ONJA 3E0ZA 2JQHA 2BS4A 5LMUT 4AXPA 5HAXA 3ONXA 3UUBA 3FBLA 2XSBA 3NVOA 3KBUA 3ZJ1A 3RIFA 3AEFA 2CXDA 4FRRA 3GN5A 1E2AA 2Y48B 4DBRA 2VKHA 2YDQA 4O4IE 4BQTA 2QVAA 4CXYA 4AKRB 4X1YE 4IE6A 1WLXA 4IHJE 3ZMZB 3FHNA 3BQIA 5FL0A 2K9AA 2X0LB 4P0AA 1EZ3A 3LBXA 2E2AA 4F6RC 4L9IA 4PK4A 5LP6E 3WTIA 5JQGE 3U8KA 3FZLB 3PUAA 2YU1A 3Q5WA 4NXNT 2PBIA 3KVBA 2UXXB 4BJNA 4X5TA 2XY8B 4QHOA 4NZBA 2IAKA 4ZI2C 2L3LA 3AAEB 4GK0E 1W0BA 4NUUA 3U8JA 2WN9A 4ALXA 3Q5EA 3GUAA 1WCRA 4IE4A 5FXXA 2ZJUA 1DU2A 2BKNA 5KDMC 2YDSA 4LF7T 2RP4A 5JR9A 4LF9T 2X9YA 5GONE 4TWDA 4QXCB 5IWAT 4DMWA 4U7IA 2DNXA 3C4WA 2N9DA 3CQGB 2UUAT 4BFQA 4UM1A 2NTXA 4AKHA 3C64A 3ZMUB 3EVYA 4HFVA 5AQPB 5JRCB 3NZPA 2DCFA 4YSXA 4YY3T 2V7LA 2WZIA 4DR6T 3PJAA 5FL1A 3AE3A 1HR0T 2YDRA 3FB2A 2WWVA 2WDVA 2WB5A 4K0KT 2CLYB 3RHWA 3RPUA 2WY2A 3HA4A 2KT9A 5AQIB 4B3ST 2HPJA 3Q2MA 3ETUA 2Q9QD 3PU3A 1MNDA 3ZDHA 4UXUA 5L4EA 1M7KA 2XQ9A 3LG7A 4DV5T 2IIUA 2WNJA 5LXBA 1HNZT 2LSYA 5LA6E 2CXFA 4U31A 3E08A 2VKJA 3RYIE 2IHR1 2JQQA 2JIWA 2C5IT 2H89A 3SFDA 4ADZA 3ZYLA 3PDYA 4UVBB 1UGOA 4LF5T 3AE2A 4U7YA 3UU5A 4ILCA 2BYSA 3UFEA 4JI5T 5HCMA 3VRAA 5LHHB 5M4YA 2UU9T 4JYAT 3SWHA 1KNPA 3M65A 2ES0A 4IE7A 2JJ9A 2X9HA 2V7KA 5AFMB 2QGSA 2Y57A 5EK4A 2AXDS 4Z91A 3PUGA 4MHCA 4UM3P 4YSYA 2WDRA 3RGLA 1YQ3A 3ZEFB 2KWHA 4JEHB 5FY1A 1ZKEA 3WI3A 1IBKT 3HKEE 1JNRA 2VASA 4MBQA 3KV9A 3P4QA 4EZ1A 4DV3T 3U3IA 5HEOA 4ERRA 1I9BA 4QKNA 3AEEA 3HKDE 2VQET 4HFCA 4A98A 3AE1A 2H3RA 3SFEA 4NPPA 1MIVA 1IZNB 3P4SA 2IW5B 2WU2A 4XAXB 3RIAA 4HEAA 4QH5A 5JDQA 3I0QA 4IDPA 3O1HA 2UUBT 5ABGA 4U74A 1UW6A 2OLTA 2ZMAA 4UY2A 3UQ4A 5L3BB 3CWZB 1S94A 3FXDB 3RKGA 4IT4A 4AFHA 3S4UA 2JMKA 5LBMA 3PURA 4KBMB 2CXLA 1HG2A 3WTLA 1IBMT 1X9BA 1NEKA 4ZRUA 1E7PA 2VURA 3QC9A 4D01A 1XMOT 2IC9A 2N2NA 4ZI7E 2I0MA 3MXZA 4ZZCA 3B5MA 4UIGA 1WRDA 1OEDA 5LNKA 3K1SA 4O4HE 3C4XA 5FVKA 2BS2A 2X9WA 3QNUA 3X1DA 2CWYA 2DLRA 3UFGA 1HX8A 5DJQC 3ONLC 2VL8A 2JPFA 3AA1B 3N2KE 5EK3A 4UV9B 2UXBT 3QB5K 4LFAT 2YOEA 1N34T 2E8IA 2A2FX 2YMEA 3RYFE 4FJOA 3U8NA 4H9RC 3IF8B 3ANWB 3A8YC 4K0UA 2UXNB 2CM0A 4JI7T 4Z90A 4IGUA 1M62A 3ZKRA 2LOPA 2CWOA 2W67A 3CK6A 2M6BA 2WDQA 5JDLA 5LJNA 3WTJA 3WIPA 1KF6A 3OBVE 1E1HB 4OFZA 3WAJA 5H6QB 3O4XE 1W0AA 2FUPA 2VKOA 4PJMA 1LKXA 2WP9A 4EB6E 2BR7A 5AQTB 4CXXA 4NIQA 3EUHA 2WMOA 1ZOYA 3P4PA 4O8SA 5EK2A 1IBLT 4ZR6A 3C84A 4DV2T 1LRZA 4JLEA 4BA9A 4IDZA 4F8HA 2ODUA 3NWIA 4H9SE 3QK6A 5FKYA 3U8MA 2LRKA 4EEDA 2IMLA 2XAJB 2CEAA 2CCQA 4B6XA 5AFNA 1QUUA 4AQYT 4HQPA 5FP3A 4ZZBA 3IBPA 2LE8A 2CHOA 1BR0A 3UUXB 2HPLA 1UCUA 2D0TA 5LMNT 3AEAA 2L9QA 3MZKB 5L3DB 1Z0PA 5LOVE 4KP3C 3UQ7A 1KNRA 2XZ5A 2XJ7A 4I50E 3VR9A 3V5SA 3AEDA 3CX8B 2H88A 5FY7A 3H37A 4HFBA 1MMNA 2LEHA 2Y6XA 3JC6D 4UF0A 2XYTA 2XQ6A 1NAFA 5J5HA 5AQMB 2D0UA 4X62T 2WS3A 2W8FA 3CIRA 3RQWA 4UF0B 4GKJT 2XQ8A 3AE8A 3IEEA 5C2TA 4L0RA 3AAIA 2UUCT 2I59A 3UU8A 3UUNA 5KE4A 3LK42 2P9BA 3OKQA 3N5LA 4IREA 3AE6A 2WNCA 5AFUL 2E9XB 3V5UA 3ZYKA 2C0SA 1UV6A 4B5DA 5HEHA 3CQCB 4YLHA 5H6RB 5HWYA 3EHZA 5J2TE 5AFKA 4I0UA 3L39A 4EV6A 4ZK1A 4JI1T 2JQKA 3ZPOA 4C91A 4IDOA 2E5VA 4TN7B 3AVSA 3WTKA 3UUMA 4U33A 1FMWA 2C5JA 3Q9DA 2CA5A 2B76A 4DR2T 4IDNA 3D0TA 1J1JA 1XNQT 3AE5A 3VKGA 4AI6A 3VU7H 2NW8A 3HL6A 1YD8G 3I9WA 1FIOA 4WW0A 4YTPA 5AFMA 5FMNA 4GYSA 1G8XA 2KINB 2XTLA 3CMLA 1UX2A 2XQ3A 2MTQA 2N1GA 4TZ4C 2CMRA 3RLFF 4PK6A 2ODVA 2KXPB 2ZM2A 4AQFC 3PTRB 4L5GA 5L4HA 1SUMB 2LSJA 4JI8T 3NRYA 1VOMA 1WYBA 2NR4A 2D2SA 1XDOA 5FVLA 2UZ6A 2WWUA 1N33T 2W0GA 2LM9A 4KX6A 2OV9A 2LSKA 3UU3A 4H9OC 3R6NA 4X20E 3B13A 3ZDGA 4E7SA 3ZMTB 5L3FB 4NXMT 3T1HT 2OA5A 2RA1A 2XQAA 4JV5T 2Q9QC 3JAEA 5ABHA 2F4VT 3A5XA 5J5FA 5KZUA 4GK5E 4ZS2A 5LHGB 2VB6A 4O2AE 2A72A 5CGMA 3EI0A 4TV8E 2BG9E 3OVUA 2KMFA 3PUYF 3I9YA 5TAOA 2ACXA 5JREA 3AEGA 3ZT7A 4A56A 2JQ9A 3BQLA 3N9PA 4U2ZA 5HXCA 4B3TT 4YJ3E 4AKLA 4KHZF 4G2AA 4PNIA 2XSAA 2VVNA 5AQHB 4QAAA 4OYJA 2PGZA 3M3ZB 5F3JA 5AQNB 2GK9A 4PAGA 2XASB 3GMIA 1R8IA 4JI0T 4H9PC 5AQJB 5LYJE 4QACA 4C90A 3RIUC 3AA7B 3JC6C 2J47A 2BYRA 3AXJA 5CJ5A 3I0OA 4HWHA 1LVKA 5CA1E 2Y56A 3EABA 1FJGT 2NOXA 2J62A 5AQSB 2QYWA 4LMLA 5E0OA 4HTEA 3UULA 3ANWA 2B1EA 2PJQA 4ZJTA 1YQ4A 5HXHA 1D1AA 2KSRA 1OEDE 2D5UA 5JDHA 3OYXA 1QLBA 1UK5A 3PU8A 2PG8A 2E9XD 5IUXA 2LKHA 4I4TE 3VR8A 4DMVA 5JDMA 4JI2T 3TKLB 4YHHT 5IHYA 2BJ0A 4ZJSA 1BR4A 3NBXX 3JAFA 5J2UE 2V7MA 4EXTA 5IYZE 2IC6A 2ZM0A 3ZLIA 2KLQA 5DQWA 4I55E 4JBWF 4BJMA 5JR9C 3CX6B 4TWFA 4U3CA 1V9DA 2MPKA 4YTMA 3JCFA 1UUSA 2DHRA 2XAFB 3LFMA 2C5KT 3RX6A 2CLYC 4ZXLA 2QRXA 2C9TA 3UU6A 5AQFB 1CHUA 4CZZB 3DP7A 2UXCT 1D0XA 4U72A 3WAKA 4LFBT 2CBIA 2YK0A 3KINB 2BYPA 2WZYA 1OWAA 2QA7A 2CBJA 2XUEA 3DTOA 3AA0B 4BAYB 5AFJA 1HFAA 5F8PA 4UV8B 2Y7YA 3ZMVB 5FJVA 3J9X1 3U78A 1YW0A 3ZN0B 5BR8T 3VRBA 2LHRA 3PEOA 2WM9A 2FJAA
chains in the Genus database with same CATH topology
3P4WA 2XNUA 5AFNA 4TNWA 5AFKA 4HQPA 2XQAA 2Y58A 4BFQA 4UM1A 2LM2A 4ZK1A 3UUBA 5HEUA 2BJ0A 3JAEA 4ZZBA 2ZJVA 5J5IA 4ZJSA 5J5FA 3SIOA 5KZUA 3WTKA 3JAFA 5JMEA 4HFDA 2BG9A 4PIRA 3RIFA 3SQ6A 3C79A 4AFTA 4EZ1A 5HEGA 2LLYA 2YOEA 3RI5A 2QC1B 2XYSA 3IGQA 5L47A 3SQ9A 4FRRA 5HEOA 2XNVA 2YMEA 3EI0A 5BW2A 4IL9A 1I9BA 1OEDB 5TVCA 4UM3S 4ILAA 4A97A 2BG9E 3LSVA 2BG9B 3U8NA 2LKGA 4HFCA 4A98A 4BQTA 4TWFA 2YKSA 3RHWA 3JADA 4NPPA 4TNVA 3UQ7A 2MAWA 2XZ5A 4Z90A 2BG9C 2X00D 4AFGA 5HEJA 5J0ZA 3ZKRA 3RIAA 3TLTA 5AFMA 5AFHA 5AINA 5AFLA 4QH5A 3WTNA 3ZDHA 4UXUA 3RQUA 5L4EA 4WV9A 4LMKA 2XQ7A 3TLVA 2XQ9A 3WTIA 4DBMA 4HFBA 4QAAA 3U8KA 2M6BA 2PGZA 2PH9A 4QH4A 2WNJA 1UW6A 2C9TA 3UU6A 4ILBA 5LXBA 3WTJA 3WIPA 1UX2A 4HFHA 3TLWA 4UY2A 3UQ4A 2XQ3A 2XYTA 2XQ6A 2XZ6A 2YN6A 5J5HA 4HFIA 4X5TA 2BYQA 2W8FA 4NZBA 2XNTA 5CFBA 2WNLA 4QACA 3WTOA 3T4MA 2X00A 3RQWA 2BYPA 4LMJA 2YMDA 4XK9A 2WZYA 2XQ8A 2BR8A 4HFEA 3SH1A 4AFHA 2BYRA 2XQ4A 5L4HA 3TLSA 4XHEA 3U8JA 5BP0A 2WN9A 4IL4A 2BYNA 2BR7A 4ALXA 3WTMA 3P50A 3UU5A 2Y56A 4ILCA 5LG3A 3UU8A 2BYSA 3GUAA 5HCMA 5KE4A 1OEDC 5HCJA 5AFJA 5SYOA 3WTLA 2Y54A 2ZJUA 4QH1A 3UU4A 4TWHA 2Y7YA 4LMLA 4ZK4A 4UM3A 2UZ6A 3PMZA 5BRXA 5FJVA 5CO5A 3U8LA 4ZRUA 4ZJTA 4ZR6A 4IREA 5J5GA 2KSRA 1OEDE 3C84A 3UU3A 2VL0A 2WNCA 4COFA 2M6IA 4D01A 3WTHA 4F8HA 5AFMB 3EAMA 3TLUA 2W8GA 2Y57A 3ZDGA 1UV6A 4Z91A 4ZZCA 4TWDA 4B5DA 4UM3P 5HEHA 3PEOA 5IUXA 2XQ5A 2LKHA 3U8MA 1OEDA 4QABA 3EHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4W A;  2XNU A;  5AFN A;  4TNW A;  5AFK A;  4HQP A;  2XQA A;  2Y58 A;  4BFQ A;  4UM1 A;  2LM2 A;  4ZK1 A;  3UUB A;  5HEU A;  2BJ0 A;  3JAE A;  4ZZB A;  2ZJV A;  5J5I A;  4ZJS A;  5J5F A;  3SIO A;  5KZU A;  3WTK A;  3JAF A;  5JME A;  4HFD A;  2BG9 A;  4PIR A;  3RIF A;  3SQ6 A;  3C79 A;  4AFT A;  4EZ1 A;  5HEG A;  2LLY A;  2YOE A;  3RI5 A;  2QC1 B;  2XYS A;  3IGQ A;  5L47 A;  3SQ9 A;  4FRR A;  5HEO A;  2XNV A;  2YME A;  3EI0 A;  5BW2 A;  4IL9 A;  1I9B A;  1OED B;  5TVC A;  4UM3 S;  4ILA A;  4A97 A;  2BG9 E;  3LSV A;  2BG9 B;  3U8N A;  2LKG A;  4HFC A;  4A98 A;  4BQT A;  4TWF A;  2YKS A;  3RHW A;  3JAD A;  4NPP A;  4TNV A;  3UQ7 A;  2MAW A;  2XZ5 A;  4Z90 A;  2BG9 C;  2X00 D;  4AFG A;  5HEJ A;  5J0Z A;  3ZKR A;  3RIA A;  3TLT A;  5AFM A;  5AFH A;  5AIN A;  5AFL A;  4QH5 A;  3WTN A;  3ZDH A;  4UXU A;  3RQU A;  5L4E A;  4WV9 A;  4LMK A;  2XQ7 A;  3TLV A;  2XQ9 A;  3WTI A;  4DBM A;  4HFB A;  4QAA A;  3U8K A;  2M6B A;  2PGZ A;  2PH9 A;  4QH4 A;  2WNJ A;  1UW6 A;  2C9T A;  3UU6 A;  4ILB A;  5LXB A;  3WTJ A;  3WIP A;  1UX2 A;  4HFH A;  3TLW A;  4UY2 A;  3UQ4 A;  2XQ3 A;  2XYT A;  2XQ6 A;  2XZ6 A;  2YN6 A;  5J5H A;  4HFI A;  4X5T A;  2BYQ A;  2W8F A;  4NZB A;  2XNT A;  5CFB A;  2WNL A;  4QAC A;  3WTO A;  3T4M A;  2X00 A;  3RQW A;  2BYP A;  4LMJ A;  2YMD A;  4XK9 A;  2WZY A;  2XQ8 A;  2BR8 A;  4HFE A;  3SH1 A;  4AFH A;  2BYR A;  2XQ4 A;  5L4H A;  3TLS A;  4XHE A;  3U8J A;  5BP0 A;  2WN9 A;  4IL4 A;  2BYN A;  2BR7 A;  4ALX A;  3WTM A;  3P50 A;  3UU5 A;  2Y56 A;  4ILC A;  5LG3 A;  3UU8 A;  2BYS A;  3GUA A;  5HCM A;  5KE4 A;  1OED C;  5HCJ A;  5AFJ A;  5SYO A;  3WTL A;  2Y54 A;  2ZJU A;  4QH1 A;  3UU4 A;  4TWH A;  2Y7Y A;  4LML A;  4ZK4 A;  4UM3 A;  2UZ6 A;  3PMZ A;  5BRX A;  5FJV A;  5CO5 A;  3U8L A;  4ZRU A;  4ZJT A;  4ZR6 A;  4IRE A;  5J5G A;  2KSR A;  1OED E;  3C84 A;  3UU3 A;  2VL0 A;  2WNC A;  4COF A;  2M6I A;  4D01 A;  3WTH A;  4F8H A;  5AFM B;  3EAM A;  3TLU A;  2W8G A;  2Y57 A;  3ZDG A;  1UV6 A;  4Z91 A;  4ZZC A;  4TWD A;  4B5D A;  4UM3 P;  5HEH A;  3PEO A;  5IUX A;  2XQ5 A;  2LKH A;  3U8M A;  1OED A;  4QAB A;  3EHZ A; 
#chains in the Genus database with same CATH topology
 2XNU A;  4TNW A;  3IA3 A;  2NWB A;  3AVR A;  2X0Y A;  4WZX A;  2X67 A;  1SA0 E;  1XMQ T;  4P09 A;  5J5I A;  1FEW A;  3OTO T;  3ZST A;  1WR0 A;  4H63 V;  3I1A A;  5FXZ A;  4WBN E;  2JRK A;  4OX9 T;  5L47 A;  1N32 T;  5BW2 A;  4EYU A;  4ZOL E;  2XPK A;  4A97 A;  1KEY A;  2YEV C;  5L3E B;  1MIY A;  2MAW A;  4H9Q C;  2G0U A;  5HEJ A;  2V7J A;  4QWN B;  1WFD A;  4HE8 A;  3WTN A;  2RPA A;  4HFH A;  3TLW A;  2E5L T;  4X65 T;  4HFI A;  3KV5 A;  2ZM8 A;  3BK9 A;  1VCT A;  4AQF A;  2MBG A;  1W09 A;  2W2U A;  2XQ4 A;  2PFV A;  5BP0 A;  3ZC0 A;  4AQG A;  5LGU B;  5L3G B;  3P50 A;  1IJ5 A;  2BKO A;  2NW7 A;  3H3M A;  3CPZ A;  2VKD A;  5CA0 E;  1XNR T;  2MYS A;  4DBQ A;  2CPT A;  4TUY E;  4TV9 E;  2M67 A;  3PE0 A;  4COF A;  5HXS A;  2D9D A;  4DVD A;  3EAM A;  4ZI3 D;  5AQR B;  2DWG A;  2KWI B;  2XQ5 A;  2Y8D A;  4QXH B;  5LHI B;  3F2E A;  2EHO D;  3EDV A;  4X64 T;  2J1D G;  3MAC A;  2FBW A;  5HWX A;  3Q5D A;  4MLK A;  4HFD A;  2VVS A;  1GQE A;  4AFT A;  5JDF A;  2BVL A;  3J7Y q;  2X68 A;  5HEG A;  3NKZ A;  4EGW A;  3N9M A;  3RF1 A;  1U4Q A;  4O4J E;  2K3W A;  5TVC A;  2BG9 B;  3GWH A;  1CUN A;  3C4Z A;  2DI4 A;  3LBX B;  1I94 T;  3UT5 E;  2X00 D;  3RYC E;  4JI3 T;  4DUZ T;  5AIN A;  5AFL A;  1JNZ A;  4LMK A;  2UXD T;  3LDQ B;  3TLV A;  1MMA A;  1D0Y A;  3AE4 A;  3MKD A;  2ZM6 T;  4YT0 A;  4YSZ A;  4TX5 A;  5LXT E;  2X00 A;  1ZEE A;  2YMD A;  5FY0 A;  4XZC A;  2BR8 A;  4HWF A;  1N36 T;  4JI4 T;  2V6Y A;  2AE9 A;  2XM2 A;  1T72 A;  5HCJ A;  5SYO A;  1D0Z A;  5LGT B;  3U8L A;  3T1Y T;  2HH7 A;  3PUQ A;  2M6I A;  3CKD A;  2PTF A;  5DAB A;  1MMD A;  4EIW A;  2EHO A;  3ZCJ A;  4X1K E;  3FZF B;  1I6Z A;  4Z8X A;  5F5W A;  1W9R A;  5HEU A;  3P8C D;  1T7S A;  3SIO A;  3RIU A;  2BG9 A;  3C79 A;  1YKE B;  2FJD A;  3AXJ B;  2QC1 B;  2XYS A;  4LF6 T;  4HWC A;  4DR3 T;  4MFR A;  1AJ3 A;  2KND A;  5JDN A;  3VHL A;  2WQY A;  2XQY A;  2W4X A;  4UXN B;  4UVC B;  3BQK A;  5AFH A;  4PJJ A;  1SHZ C;  2LSG A;  4IDQ A;  5BMV E;  2WSS V;  5JDG A;  5ABF B;  4PFO A;  1J5W A;  2W00 A;  1L0V A;  1Z8U A;  1MMG A;  1T98 A;  2CE7 A;  3FZK B;  3AEC A;  5HYA A;  3CQX C;  2V6X A;  4QH1 A;  4TWH A;  4QXB B;  4WBO A;  3PMZ A;  5ETW A;  2W61 A;  4FI5 A;  5J5G A;  3LK3 B;  1UX4 A;  3WTH A;  3G06 A;  2V8S V;  3KV6 A;  5HXR A;  4WNK A;  2KZ7 B;  4YHJ A;  4CN6 A;  4HN9 A;  2YU2 A;  5HXE A;  4CN1 A;  4CQI A;  1BR2 A;  2LM2 A;  2K48 A;  4EZH A;  5KXJ A;  4U2Y A;  4ASK A;  2WBL A;  1OXZ A;  1U5P A;  3N9N A;  1HNX T;  3HR0 A;  4IL9 A;  2ZLY A;  4EZ4 A;  3ZMS B;  2LKG A;  2W66 A;  2YKS A;  5AQV B;  4DR4 T;  2LT3 A;  1YKH B;  4MAL A;  3K3Q C;  5AQL B;  3H3A A;  1HX1 B;  4YFS A;  2XQ7 A;  4E7Z A;  3ZC1 A;  5LB7 B;  4V1A v;  3AAA B;  2FJE A;  1FMV A;  3KBT A;  4IE5 A;  1O3X A;  3ZYM A;  2XZ6 A;  2W63 A;  4H63 H;  2K5B B;  1SE7 A;  2XNT A;  4M1P A;  1ZV4 X;  1KFY A;  4HWD A;  2WMN A;  4LMJ A;  4ZS3 A;  3ZT5 A;  3DJB A;  3NZQ A;  4OHF A;  2BYN A;  4GYR A;  3GN5 B;  3WTM A;  2CRB A;  2Y54 A;  5FXW A;  4DR5 T;  4ZK4 A;  5ABE A;  3RC8 A;  5L2L A;  4DID B;  5FXV A;  3ETV A;  2XAH B;  2W8G A;  4EAH A;  4GOU A;  3LK2 B;  5AQO B;  2V1D B;  3QOF A;  3IHR A;  1Y64 B;  2E9X A;  3FXE B;  3EDU A;  2NP9 A;  4CN4 A;  1X79 A;  4DV0 T;  2WAU A;  5ADX L;  2DL1 A;  3PUV F;  2XZE A;  2E9X C;  4DV1 T;  2BVM A;  4PIR A;  4HKA A;  3RRW A;  2HN1 A;  3RI5 A;  4CI1 B;  4N78 D;  3GA8 A;  2YIN A;  3AEB A;  5LJM A;  2LHN A;  3RYH E;  2V5D A;  2H7O A;  3L3P A;  5FYM A;  3JAD A;  4ZEY A;  4TNV A;  3ABV A;  4O4L E;  4AFG A;  3AB3 B;  2K24 A;  2BBJ A;  3KFW X;  4IE0 A;  4WV9 A;  3RQU A;  4EEB A;  2NTY A;  2PH9 A;  4QH4 A;  2HHH T;  2XM1 A;  4PFP A;  3VKH A;  3SRZ A;  2V5C A;  3RRC A;  1S35 A;  2J4G A;  3N9Q A;  1QSD A;  3SS1 A;  4LF8 T;  3PJA J;  1BR1 A;  1B7T A;  4PJL A;  3TLS A;  2X66 A;  4XHE A;  3KV4 A;  1YXR A;  3O1J A;  3Q5X A;  2WCA A;  3QUJ A;  5LG3 A;  3P7I A;  3FBZ A;  4P0B A;  4JUY A;  4XBF B;  2BBH A;  4A5X A;  1KNZ A;  1NEN A;  1ZP0 A;  2A9U A;  2XAG B;  3AE9 A;  4WYV A;  4G63 A;  4CXW A;  5KMG P;  2NW9 A;  1VCS A;  2A3D A;  2BZB A;  4LF4 T;  3HKB E;  5DQV A;  2VQF T;  1XZY A;  4ISS A;  1D1C A;  3ZJ2 A;  4KUM B;  3SQ6 A;  5AQU B;  1XWM A;  3F57 A;  4PK5 A;  2XNV A;  4UM3 S;  5LBQ B;  1WYC A;  4AIS A;  4EOZ B;  4Q25 A;  3N9O A;  3C51 A;  5JRC A;  5JR9 B;  1MIW A;  4YXD A;  1D1B A;  2WZH A;  4I43 B;  1ZHC A;  5A1L A;  3R84 B;  3N2O A;  4DBM A;  1HG5 A;  5LCY A;  5JTG A;  4ILB A;  2X51 A;  3P4R A;  4B3M T;  2DWK A;  5AQK B;  3O9X A;  2YN6 A;  5AQG B;  4ZI3 C;  4EYY R;  2VWA A;  4AIU A;  3FZM B;  3RH3 A;  3KVA A;  3QB5 A;  3L8R A;  1HS7 A;  2JMH A;  2V7I A;  4DV4 T;  1OED C;  5BRX A;  5CO5 A;  4IST A;  3PUW F;  3K3O A;  3L09 A;  3PUS A;  3OJA A;  2X9X A;  3ZSS A;  4DND A;  5AQQ B;  3B57 A;  4IIJ E;  2V6Y B;  4QAB A;  1WR6 A;  1UX5 A;  3P4W A;  3E22 E;  2V26 A;  3F31 A;  5LGN B;  1H7C A;  1IAP A;  1US7 B;  2H7V C;  2HN2 A;  2EHO C;  4AKG A;  4YJ2 E;  3IGQ A;  4QX7 B;  3PV0 F;  3OYZ A;  2IDO B;  3UTK A;  3LSV A;  4HGA A;  3LJC A;  2MOZ A;  3ESL A;  3RC3 A;  1G73 A;  5J0Z A;  4UR9 A;  3TLT A;  3C50 A;  2EHO B;  2XAQ B;  1HNW T;  5CB4 E;  3KDS E;  2BS3 A;  4ZI2 D;  2WU5 A;  1J5E T;  2BYQ A;  4KHP T;  2LRL A;  1HCI A;  5FNV E;  3RKO A;  3T4M A;  4XK9 A;  2BDE A;  5L3C B;  5EZY E;  1XDP A;  3T8O A;  4IL4 A;  3MK7 C;  3ZCI A;  2X0H A;  2LOS A;  4X66 T;  2Q9Q A;  5KX5 E;  5JVD E;  4JI6 T;  4CI3 B;  2IUB A;  2R6G F;  2LSI A;  2Q9Q B;  3SOL A;  2BKP A;  3AA6 B;  3C98 B;  3PUZ F;  2LJL A;  4DR1 T;  4YTN A;  4QX8 B;  1T8B A;  1MNE A;  2FJB A;  2CHN A;  3MJX A;  2Y58 A;  5ABF A;  1UUR A;  3CX7 B;  4GKK T;  2ZJV A;  5C8Y E;  4UEM A;  1HF8 A;  5JME A;  1Y01 A;  2VK9 A;  3W15 B;  3HKC E;  4KI0 F;  4UVA B;  2LLY A;  2L8K A;  3SQ9 A;  3OPC A;  1OED B;  4OYK A;  4PW8 A;  4ILA A;  1LVF A;  3N2G E;  4JEU B;  4DO0 A;  4AKI A;  4PJN A;  3ZN1 B;  3AE7 A;  4ILU A;  4NUV A;  1NWM X;  3A7M A;  2BG9 C;  4B3R T;  4ANJ A;  3PUX F;  4DV7 T;  4DR7 T;  2W62 A;  2Z6E A;  5J1G A;  4ZHQ E;  3CVR A;  4P1N A;  4UEL A;  3FZH B;  1HTJ F;  5C3J A;  4H9N C;  4O2B E;  3MA9 A;  4HWI B;  1KK7 A;  1IJ6 A;  3HI2 A;  5CFB A;  2WNL A;  3WTO A;  4DUY T;  4KMC A;  3K8P C;  1VRB A;  4GIW A;  4HFE A;  4CI2 B;  5JH7 E;  2I6H A;  5LG4 A;  3SH1 A;  4DV6 T;  3NRX A;  3K3N A;  3N9L A;  2ACZ A;  4X1I E;  4LFC T;  3UU4 A;  2SPC A;  4UM3 A;  4J2C A;  2VL0 A;  3ZT6 A;  4OK0 A;  2XHE B;  3TLU A;  3O1I A;  3ONJ A;  3E0Z A;  2JQH A;  2BS4 A;  5LMU T;  4AXP A;  5HAX A;  3ONX A;  3UUB A;  3FBL A;  2XSB A;  3NVO A;  3KBU A;  3ZJ1 A;  3RIF A;  3AEF A;  2CXD A;  4FRR A;  3GN5 A;  1E2A A;  2Y48 B;  4DBR A;  2VKH A;  2YDQ A;  4O4I E;  4BQT A;  2QVA A;  4CXY A;  4AKR B;  4X1Y E;  4IE6 A;  1WLX A;  4IHJ E;  3ZMZ B;  3FHN A;  3BQI A;  5FL0 A;  2K9A A;  2X0L B;  4P0A A;  1EZ3 A;  3LBX A;  2E2A A;  4F6R C;  4L9I A;  4PK4 A;  5LP6 E;  3WTI A;  5JQG E;  3U8K A;  3FZL B;  3PUA A;  2YU1 A;  3Q5W A;  4NXN T;  2PBI A;  3KVB A;  2UXX B;  4BJN A;  4X5T A;  2XY8 B;  4QHO A;  4NZB A;  2IAK A;  4ZI2 C;  2L3L A;  3AAE B;  4GK0 E;  1W0B A;  4NUU A;  3U8J A;  2WN9 A;  4ALX A;  3Q5E A;  3GUA A;  1WCR A;  4IE4 A;  5FXX A;  2ZJU A;  1DU2 A;  2BKN A;  5KDM C;  2YDS A;  4LF7 T;  2RP4 A;  5JR9 A;  4LF9 T;  2X9Y A;  5GON E;  4TWD A;  4QXC B;  5IWA T;  4DMW A;  4U7I A;  2DNX A;  3C4W A;  2N9D A;  3CQG B;  2UUA T;  4BFQ A;  4UM1 A;  2NTX A;  4AKH A;  3C64 A;  3ZMU B;  3EVY A;  4HFV A;  5AQP B;  5JRC B;  3NZP A;  2DCF A;  4YSX A;  4YY3 T;  2V7L A;  2WZI A;  4DR6 T;  3PJA A;  5FL1 A;  3AE3 A;  1HR0 T;  2YDR A;  3FB2 A;  2WWV A;  2WDV A;  2WB5 A;  4K0K T;  2CLY B;  3RHW A;  3RPU A;  2WY2 A;  3HA4 A;  2KT9 A;  5AQI B;  4B3S T;  2HPJ A;  3Q2M A;  3ETU A;  2Q9Q D;  3PU3 A;  1MND A;  3ZDH A;  4UXU A;  5L4E A;  1M7K A;  2XQ9 A;  3LG7 A;  4DV5 T;  2IIU A;  2WNJ A;  5LXB A;  1HNZ T;  2LSY A;  5LA6 E;  2CXF A;  4U31 A;  3E08 A;  2VKJ A;  3RYI E;  2IHR 1;  2JQQ A;  2JIW A;  2C5I T;  2H89 A;  3SFD A;  4ADZ A;  3ZYL A;  3PDY A;  4UVB B;  1UGO A;  4LF5 T;  3AE2 A;  4U7Y A;  3UU5 A;  4ILC A;  2BYS A;  3UFE A;  4JI5 T;  5HCM A;  3VRA A;  5LHH B;  5M4Y A;  2UU9 T;  4JYA T;  3SWH A;  1KNP A;  3M65 A;  2ES0 A;  4IE7 A;  2JJ9 A;  2X9H A;  2V7K A;  5AFM B;  2QGS A;  2Y57 A;  5EK4 A;  2AXD S;  4Z91 A;  3PUG A;  4MHC A;  4UM3 P;  4YSY A;  2WDR A;  3RGL A;  1YQ3 A;  3ZEF B;  2KWH A;  4JEH B;  5FY1 A;  1ZKE A;  3WI3 A;  1IBK T;  3HKE E;  1JNR A;  2VAS A;  4MBQ A;  3KV9 A;  3P4Q A;  4EZ1 A;  4DV3 T;  3U3I A;  5HEO A;  4ERR A;  1I9B A;  4QKN A;  3AEE A;  3HKD E;  2VQE T;  4HFC A;  4A98 A;  3AE1 A;  2H3R A;  3SFE A;  4NPP A;  1MIV A;  1IZN B;  3P4S A;  2IW5 B;  2WU2 A;  4XAX B;  3RIA A;  4HEA A;  4QH5 A;  5JDQ A;  3I0Q A;  4IDP A;  3O1H A;  2UUB T;  5ABG A;  4U74 A;  1UW6 A;  2OLT A;  2ZMA A;  4UY2 A;  3UQ4 A;  5L3B B;  3CWZ B;  1S94 A;  3FXD B;  3RKG A;  4IT4 A;  4AFH A;  3S4U A;  2JMK A;  5LBM A;  3PUR A;  4KBM B;  2CXL A;  1HG2 A;  3WTL A;  1IBM T;  1X9B A;  1NEK A;  4ZRU A;  1E7P A;  2VUR A;  3QC9 A;  4D01 A;  1XMO T;  2IC9 A;  2N2N A;  4ZI7 E;  2I0M A;  3MXZ A;  4ZZC A;  3B5M A;  4UIG A;  1WRD A;  1OED A;  5LNK A;  3K1S A;  4O4H E;  3C4X A;  5FVK A;  2BS2 A;  2X9W A;  3QNU A;  3X1D A;  2CWY A;  2DLR A;  3UFG A;  1HX8 A;  5DJQ C;  3ONL C;  2VL8 A;  2JPF A;  3AA1 B;  3N2K E;  5EK3 A;  4UV9 B;  2UXB T;  3QB5 K;  4LFA T;  2YOE A;  1N34 T;  2E8I A;  2A2F X;  2YME A;  3RYF E;  4FJO A;  3U8N A;  4H9R C;  3IF8 B;  3ANW B;  3A8Y C;  4K0U A;  2UXN B;  2CM0 A;  4JI7 T;  4Z90 A;  4IGU A;  1M62 A;  3ZKR A;  2LOP A;  2CWO A;  2W67 A;  3CK6 A;  2M6B A;  2WDQ A;  5JDL A;  5LJN A;  3WTJ A;  3WIP A;  1KF6 A;  3OBV E;  1E1H B;  4OFZ A;  3WAJ A;  5H6Q B;  3O4X E;  1W0A A;  2FUP A;  2VKO A;  4PJM A;  1LKX A;  2WP9 A;  4EB6 E;  2BR7 A;  5AQT B;  4CXX A;  4NIQ A;  3EUH A;  2WMO A;  1ZOY A;  3P4P A;  4O8S A;  5EK2 A;  1IBL T;  4ZR6 A;  3C84 A;  4DV2 T;  1LRZ A;  4JLE A;  4BA9 A;  4IDZ A;  4F8H A;  2ODU A;  3NWI A;  4H9S E;  3QK6 A;  5FKY A;  3U8M A;  2LRK A;  4EED A;  2IML A;  2XAJ B;  2CEA A;  2CCQ A;  4B6X A;  5AFN A;  1QUU A;  4AQY T;  4HQP A;  5FP3 A;  4ZZB A;  3IBP A;  2LE8 A;  2CHO A;  1BR0 A;  3UUX B;  2HPL A;  1UCU A;  2D0T A;  5LMN T;  3AEA A;  2L9Q A;  3MZK B;  5L3D B;  1Z0P A;  5LOV E;  4KP3 C;  3UQ7 A;  1KNR A;  2XZ5 A;  2XJ7 A;  4I50 E;  3VR9 A;  3V5S A;  3AED A;  3CX8 B;  2H88 A;  5FY7 A;  3H37 A;  4HFB A;  1MMN A;  2LEH A;  2Y6X A;  3JC6 D;  4UF0 A;  2XYT A;  2XQ6 A;  1NAF A;  5J5H A;  5AQM B;  2D0U A;  4X62 T;  2WS3 A;  2W8F A;  3CIR A;  3RQW A;  4UF0 B;  4GKJ T;  2XQ8 A;  3AE8 A;  3IEE A;  5C2T A;  4L0R A;  3AAI A;  2UUC T;  2I59 A;  3UU8 A;  3UUN A;  5KE4 A;  3LK4 2;  2P9B A;  3OKQ A;  3N5L A;  4IRE A;  3AE6 A;  2WNC A;  5AFU L;  2E9X B;  3V5U A;  3ZYK A;  2C0S A;  1UV6 A;  4B5D A;  5HEH A;  3CQC B;  4YLH A;  5H6R B;  5HWY A;  3EHZ A;  5J2T E;  5AFK A;  4I0U A;  3L39 A;  4EV6 A;  4ZK1 A;  4JI1 T;  2JQK A;  3ZPO A;  4C91 A;  4IDO A;  2E5V A;  4TN7 B;  3AVS A;  3WTK A;  3UUM A;  4U33 A;  1FMW A;  2C5J A;  3Q9D A;  2CA5 A;  2B76 A;  4DR2 T;  4IDN A;  3D0T A;  1J1J A;  1XNQ T;  3AE5 A;  3VKG A;  4AI6 A;  3VU7 H;  2NW8 A;  3HL6 A;  1YD8 G;  3I9W A;  1FIO A;  4WW0 A;  4YTP A;  5AFM A;  5FMN A;  4GYS A;  1G8X A;  2KIN B;  2XTL A;  3CML A;  1UX2 A;  2XQ3 A;  2MTQ A;  2N1G A;  4TZ4 C;  2CMR A;  3RLF F;  4PK6 A;  2ODV A;  2KXP B;  2ZM2 A;  4AQF C;  3PTR B;  4L5G A;  5L4H A;  1SUM B;  2LSJ A;  4JI8 T;  3NRY A;  1VOM A;  1WYB A;  2NR4 A;  2D2S A;  1XDO A;  5FVL A;  2UZ6 A;  2WWU A;  1N33 T;  2W0G A;  2LM9 A;  4KX6 A;  2OV9 A;  2LSK A;  3UU3 A;  4H9O C;  3R6N A;  4X20 E;  3B13 A;  3ZDG A;  4E7S A;  3ZMT B;  5L3F B;  4NXM T;  3T1H T;  2OA5 A;  2RA1 A;  2XQA A;  4JV5 T;  2Q9Q C;  3JAE A;  5ABH A;  2F4V T;  3A5X A;  5J5F A;  5KZU A;  4GK5 E;  4ZS2 A;  5LHG B;  2VB6 A;  4O2A E;  2A72 A;  5CGM A;  3EI0 A;  4TV8 E;  2BG9 E;  3OVU A;  2KMF A;  3PUY F;  3I9Y A;  5TAO A;  2ACX A;  5JRE A;  3AEG A;  3ZT7 A;  4A56 A;  2JQ9 A;  3BQL A;  3N9P A;  4U2Z A;  5HXC A;  4B3T T;  4YJ3 E;  4AKL A;  4KHZ F;  4G2A A;  4PNI A;  2XSA A;  2VVN A;  5AQH B;  4QAA A;  4OYJ A;  2PGZ A;  3M3Z B;  5F3J A;  5AQN B;  2GK9 A;  4PAG A;  2XAS B;  3GMI A;  1R8I A;  4JI0 T;  4H9P C;  5AQJ B;  5LYJ E;  4QAC A;  4C90 A;  3RIU C;  3AA7 B;  3JC6 C;  2J47 A;  2BYR A;  3AXJ A;  5CJ5 A;  3I0O A;  4HWH A;  1LVK A;  5CA1 E;  2Y56 A;  3EAB A;  1FJG T;  2NOX A;  2J62 A;  5AQS B;  2QYW A;  4LML A;  5E0O A;  4HTE A;  3UUL A;  3ANW A;  2B1E A;  2PJQ A;  4ZJT A;  1YQ4 A;  5HXH A;  1D1A A;  2KSR A;  1OED E;  2D5U A;  5JDH A;  3OYX A;  1QLB A;  1UK5 A;  3PU8 A;  2PG8 A;  2E9X D;  5IUX A;  2LKH A;  4I4T E;  3VR8 A;  4DMV A;  5JDM A;  4JI2 T;  3TKL B;  4YHH T;  5IHY A;  2BJ0 A;  4ZJS A;  1BR4 A;  3NBX X;  3JAF A;  5J2U E;  2V7M A;  4EXT A;  5IYZ E;  2IC6 A;  2ZM0 A;  3ZLI A;  2KLQ A;  5DQW A;  4I55 E;  4JBW F;  4BJM A;  5JR9 C;  3CX6 B;  4TWF A;  4U3C A;  1V9D A;  2MPK A;  4YTM A;  3JCF A;  1UUS A;  2DHR A;  2XAF B;  3LFM A;  2C5K T;  3RX6 A;  2CLY C;  4ZXL A;  2QRX A;  2C9T A;  3UU6 A;  5AQF B;  1CHU A;  4CZZ B;  3DP7 A;  2UXC T;  1D0X A;  4U72 A;  3WAK A;  4LFB T;  2CBI A;  2YK0 A;  3KIN B;  2BYP A;  2WZY A;  1OWA A;  2QA7 A;  2CBJ A;  2XUE A;  3DTO A;  3AA0 B;  4BAY B;  5AFJ A;  1HFA A;  5F8P A;  4UV8 B;  2Y7Y A;  3ZMV B;  5FJV A;  3J9X 1;  3U78 A;  1YW0 A;  3ZN0 B;  5BR8 T;  3VRB A;  2LHR A;  3PEO A;  2WM9 A;  2FJA A; 
#chains in the Genus database with same CATH homology
 3P4W A;  2XNU A;  5AFN A;  4TNW A;  5AFK A;  4HQP A;  2XQA A;  2Y58 A;  4BFQ A;  4UM1 A;  2LM2 A;  4ZK1 A;  3UUB A;  5HEU A;  2BJ0 A;  3JAE A;  4ZZB A;  2ZJV A;  5J5I A;  4ZJS A;  5J5F A;  3SIO A;  5KZU A;  3WTK A;  3JAF A;  5JME A;  4HFD A;  2BG9 A;  4PIR A;  3RIF A;  3SQ6 A;  3C79 A;  4AFT A;  4EZ1 A;  5HEG A;  2LLY A;  2YOE A;  3RI5 A;  2QC1 B;  2XYS A;  3IGQ A;  5L47 A;  3SQ9 A;  4FRR A;  5HEO A;  2XNV A;  2YME A;  3EI0 A;  5BW2 A;  4IL9 A;  1I9B A;  1OED B;  5TVC A;  4UM3 S;  4ILA A;  4A97 A;  2BG9 E;  3LSV A;  2BG9 B;  3U8N A;  2LKG A;  4HFC A;  4A98 A;  4BQT A;  4TWF A;  2YKS A;  3RHW A;  3JAD A;  4NPP A;  4TNV A;  3UQ7 A;  2MAW A;  2XZ5 A;  4Z90 A;  2BG9 C;  2X00 D;  4AFG A;  5HEJ A;  5J0Z A;  3ZKR A;  3RIA A;  3TLT A;  5AFM A;  5AFH A;  5AIN A;  5AFL A;  4QH5 A;  3WTN A;  3ZDH A;  4UXU A;  3RQU A;  5L4E A;  4WV9 A;  4LMK A;  2XQ7 A;  3TLV A;  2XQ9 A;  3WTI A;  4DBM A;  4HFB A;  4QAA A;  3U8K A;  2M6B A;  2PGZ A;  2PH9 A;  4QH4 A;  2WNJ A;  1UW6 A;  2C9T A;  3UU6 A;  4ILB A;  5LXB A;  3WTJ A;  3WIP A;  1UX2 A;  4HFH A;  3TLW A;  4UY2 A;  3UQ4 A;  2XQ3 A;  2XYT A;  2XQ6 A;  2XZ6 A;  2YN6 A;  5J5H A;  4HFI A;  4X5T A;  2BYQ A;  2W8F A;  4NZB A;  2XNT A;  5CFB A;  2WNL A;  4QAC A;  3WTO A;  3T4M A;  2X00 A;  3RQW A;  2BYP A;  4LMJ A;  2YMD A;  4XK9 A;  2WZY A;  2XQ8 A;  2BR8 A;  4HFE A;  3SH1 A;  4AFH A;  2BYR A;  2XQ4 A;  5L4H A;  3TLS A;  4XHE A;  3U8J A;  5BP0 A;  2WN9 A;  4IL4 A;  2BYN A;  2BR7 A;  4ALX A;  3WTM A;  3P50 A;  3UU5 A;  2Y56 A;  4ILC A;  5LG3 A;  3UU8 A;  2BYS A;  3GUA A;  5HCM A;  5KE4 A;  1OED C;  5HCJ A;  5AFJ A;  5SYO A;  3WTL A;  2Y54 A;  2ZJU A;  4QH1 A;  3UU4 A;  4TWH A;  2Y7Y A;  4LML A;  4ZK4 A;  4UM3 A;  2UZ6 A;  3PMZ A;  5BRX A;  5FJV A;  5CO5 A;  3U8L A;  4ZRU A;  4ZJT A;  4ZR6 A;  4IRE A;  5J5G A;  2KSR A;  1OED E;  3C84 A;  3UU3 A;  2VL0 A;  2WNC A;  4COF A;  2M6I A;  4D01 A;  3WTH A;  4F8H A;  5AFM B;  3EAM A;  3TLU A;  2W8G A;  2Y57 A;  3ZDG A;  1UV6 A;  4Z91 A;  4ZZC A;  4TWD A;  4B5D A;  4UM3 P;  5HEH A;  3PEO A;  5IUX A;  2XQ5 A;  2LKH A;  3U8M A;  1OED A;  4QAB A;  3EHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...