5L4HA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with 5-(2-bromo-ethyl)-5-ethyl-pyrimidine-2,4,6-trione (brominated barbiturate)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
source organism Gloeobacter violaceus (strain pcc 7421)
molecule tags Membrane protein, transport protein
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4hA01
2BYQA 3RQWA 2X00A 4HQPA 4ZRUA 2WNJA 2LKHA 2ZJUA 3WIPA 5HEOA 4AFGA 5SYOA 2XYSA 1I9BA 2PGZA 5AFMB 2YKSA 2BJ0A 3IGQA 3UU8A 2Y57A 2YN6A 4UM3A 5AFLA 3U8NA 4ZR6A 4LMJA 2VL0A 4HFEA 2XQ6A 3SQ9A 4ZZBA 2W8FA 4ZJTA 3LSVA 2XZ6A 2XNUA 3WTLA 5BP0A 2W8GA 5JMEA 4ILBA 2XYTA 3C79A 5J0ZA 3WTOA 1OEDB 4AFHA 4BQTA 4HFDA 2XQ7A 2BG9B 2ZJVA 4QABA 2M6IA 2YOEA 4ZZCA 2BYSA 2Y58A 3TLUA 4D01A 3TLSA 2XQ9A 3ZDHA 3RIAA 2XNTA 4UM1A 3U8LA 4LMLA 4ALXA 4AFTA 3TLTA 3EHZA 4HFIA 4ILCA 4NPPA 5AFNA 3UU4A 2X00D 3U8MA 5J5FA 3WTIA 2PH9A 5AINA 5CFBA 5KE4A 5J5GA 2C9TA 4COFA 5HCMA 5FJVA 3UU3A 5BW2A 3RQUA 3UU5A 2Y56A 1UX2A 3UUBA 4ZK4A 4TNVA 2BYNA 5HCJA 4TNWA 2KSRA 4Z91A 2BR7A 4QACA 5J5HA 2LM2A 5HEJA 3PEOA 3TLWA 2WN9A 4TWDA 3RIFA 2Y7YA 3TLVA 4DBMA 3SQ6A 4ZK1A 2M6BA 3WTJA 1OEDE 2WNLA 2MAWA 3JAFA 4QH4A 4X5TA 4UY2A 3UU6A 5J5IA 4PIRA 5AFHA 2BG9E 2YMEA 4F8HA 5LXBA 5AFKA 3JAEA 3WTNA 2LLYA 3UQ7A 4TWFA 2UZ6A 2WNCA 3UQ4A 2YMDA 4ILAA 4IREA 2WZYA 3EAMA 2BYPA 4UM3P 5L4HA 3P4WA 5L47A 4A98A 4QH5A 4NZBA 5HEHA 3PMZA 3ZKRA 3RI5A 2Y54A 4B5DA 2XQ8A 4UXUA 4HFBA 5AFJA 3GUAA 2XQAA 4XK9A 4ZJSA 5IUXA 5L4EA 3SIOA 3ZDGA 4EZ1A 4LMKA 4QH1A 4QAAA 2XNVA 4UM3S 3WTKA 3U8KA 2XQ3A 3JADA 5AFMA 4XHEA 2XQ5A 2XZ5A 1UW6A 2LKGA 4WV9A 5CO5A 4TWHA 3RHWA 3WTHA 4HFHA 1OEDC 2QC1B 3C84A 5KZUA 3EI0A 3WTMA 4FRRA 4IL9A 3P50A 2BG9C 2BR8A 4A97A 5BRXA 2XQ4A 5HEUA 2BYRA 3T4MA 1UV6A 5TVCA 5LG3A 4IL4A 1OEDA 4HFCA 4Z90A 5HEGA 3U8JA 3SH1A 2BG9A 4BFQA
chains in the Genus database with same CATH superfamily
2CA5A 1JNZA 2X00A 4YTMA 2LKHA 4UF0B 3ZLIA 3LK2B 2BS4A 5ABFA 3WAKA 2YKSA 3UU8A 2WDVA 2CBJA 3RYHE 2XQ6A 3N2OA 4IHJE 3AEFA 1SHZC 3RGLA 2ES0A 3PUGA 2XPKA 2MPKA 5HWXA 5L3FB 2L9QA 4JI0T 5CFBA 2LSJA 5JH7E 2UUCT 1ZV4X 5J1GA 3RQUA 5AQMB 2CPTA 3UUBA 4L9IA 4TNVA 3N9OA 3IF8B 2W2UA 2UU9T 4NXMT 3ZMTB 2ZM6T 2K24A 2C5JA 5AFHA 5ABFB 1MMAA 3QB5A 2V8SV 2UZ6A 4P1NA 3EAMA 1U5PA 4A98A 2ZM2A 1J1JA 3PU3A 2MOZA 1WR6A 4ZI2C 3ZSSA 3ONJA 4QHOA 2C5KT 2DWKA 3LFMA 1CHUA 4IL9A 5ABGA 5LP6E 1S94A 4H9NC 3O1HA 4YJ3E 4IDNA 1HG2A 2FBWA 2WWVA 2XYSA 2WCAA 4DNDA 3HKDE 1UUSA 3ZC0A 4IE4A 3RIUA 3SQ9A 2W8FA 4EGWA 4DV7T 5LHGB 1ZOYA 5J0ZA 1KEYA 4QABA 4HE8A 1MIYA 4PJMA 2E9XC 2LOPA 2W00A 3FZMB 3J9X1 2LM9A 3CKDA 4X66T 4TZ4C 2VKHA 3N9MA 1X9BA 3U8MA 5J2TE 2I6HA 3C4WA 4JI4T 3QOFA 2H3RA 4QACA 4UIGA 2W0GA 5AQGB 3KVBA 2X0LB 3KV4A 3NZQA 4JYAT 4QH4A 1OWAA 4UY2A 5JDGA 2YMEA 5LXBA 4H9PC 2CE7A 3I0QA 2XTLA 2ODUA 3UUXB 2XQ8A 4XK9A 3HR0A 2V5DA 2V7IA 4CI1B 3N2KE 4V1Av 4XHEA 2XQ5A 4DR6T 1OEDC 3NWIA 4QX8B 3CK6A 2BG9C 3AXJA 5AQOB 1UV6A 1W0AA 3GA8A 4P09A 3PUWF 5IYZE 1HNXT 5EK2A 1T72A 4DV3T 3EDUA 1I9BA 1VCSA 1ZHCA 4O4JE 4B3MT 4PJJA 3ZJ1A 4YTPA 5ADXL 3RC3A 2W61A 3JC6C 5JMEA 3C64A 1NWMX 2LSIA 3PU8A 2RA1A 4I4TE 4IE5A 1WRDA 3AAIA 2BYSA 4KUMB 2VKDA 2BZBA 4YY3T 3RRCA 3FXDB 2FJEA 1H7CA 1MMDA 1YW0A 2JJ9A 4U3CA 3ZMVB 3AXJB 4ZEYA 3Q5WA 4AQGA 4IGUA 1WR0A 2DWGA 2WN9A 2CXFA 3F2EA 4BJMA 4X65T 5L3BB 2WZYA 3PUVF 3P4RA 4U7YA 3UT5E 4DR2T 2Y54A 3RC8A 4HKAA 4B5DA 4H63H 2CM0A 4YHJA 3ZDGA 1L0VA 4UM3S 5A1LA 4WYVA 1IJ6A 4ISTA 4K0KT 2XZ5A 2ACXA 1UW6A 4UELA 3AA0B 2Q9QA 2XAHB 5TVCA 4LFAT 2DLRA 5AQQB 5GONE 3RH3A 2EHOC 2JMKA 2WWUA 2CMRA 4GKJT 5AFMB 3GN5A 2YN6A 2HHHT 2GK9A 2V5CA 2V1DB 4ZXLA 2V26A 3K8PC 3WTLA 3RKOA 4ZI3C 2CBIA 2WY2A 5BMVE 4BQTA 4K0UA 4AI6A 4O2AE 3FBLA 4D01A 5LYJE 3ZDHA 2CEAA 4I0UA 1D0ZA 4O2BE 2R6GF 1UGOA 2N2NA 1NAFA 4NPPA 3ESLA 5LHIB 5M4YA 3ZEFB 3UUNA 2N1GA 1HF8A 3SFDA 4TNWA 1BR2A 4X1YE 3TLWA 3HL6A 3C50A 3EVYA 3AE7A 3SQ6A 2M6BA 4HWHA 5ETWA 1E7PA 4E7SA 2I0MA 1MMNA 2CCQA 2FJDA 3GN5B 3QUJA 5JREA 3PUQA 2VVSA 3E0ZA 2WU5A 2NP9A 5L47A 3PTRB 4FJOA 1J5ET 3HI2A 1LVFA 3PUZF 2QVAA 3QB5K 2X9YA 4YT0A 3LBXB 2F4VT 4IE0A 2OLTA 3C4XA 1WFDA 4DV6T 2QC1B 2KWHA 4A97A 3K1SA 2XQ4A 3ZMUB 1MIVA 4EYUA 2LEHA 3FZLB 2A3DA 3RQWA 1SUMB 2H7OA 5AQUB 2DHRA 2UXNB 5FMNA 1GQEA 3F31A 3ZPOA 5BP0A 5TAOA 4ILBA 4AXPA 2VURA 4KP3C 2XSBA 2XQ7A 2K3WA 3OJAA 2J62A 1D1BA 1IBMT 5AQTB 3W15B 3B5MA 1YD8G 5LGNB 3SWHA 3I0OA 3QK6A 5F5WA 4EOZB 2YINA 5J5FA 5KE4A 1FEWA 2BKPA 3DJBA 1IZNB 2XAGB 2CWYA 4PK5A 3K3NA 1E1HB 4LF9T 4GK5E 2FUPA 4NIQA 3IBPA 2WNLA 4L5GA 4WZXA 4OYJA 3FHNA 4F8HA 1ZEEA 2BBHA 2XQYA 3OBVE 4TWFA 5LGTB 2V6XA 4IREA 4JI8T 4EEDA 5JR9C 1XZYA 4JI3T 5FVLA 2JRKA 4H63V 3O9XA 2WAUA 4ZS2A 2LOSA 3U8KA 4H9QC 4UF0A 3ZSTA 5AQHB 4ERRA 3PJAA 3OYZA 2XY8B 4U31A 4LFCT 2A9UA 5HWYA 4GK0E 2X0YA 3X1DA 2CLYB 2X51A 4HQPA 4PJLA 1M7KA 2XAJB 2Y57A 5CA0E 4WNKA 3AVRA 4OHFA 4OYKA 5HXHA 4GKKT 4ZHQE 2V7JA 3PDYA 4B3TT 1I94T 5LB7B 3P8CD 4AFTA 3HKEE 2WM9A 4LF5T 2L8KA 5DABA 3CX6B 1T8BA 4GYSA 1UX2A 1KNRA 2ZLYA 4H9SE 1S35A 3KDSE 4QXHB 2BVLA 3MJXA 4DBMA 2DNXA 4ISSA 1OEDE 3AEEA 1YKEB 1LVKA 2BG9E 2H88A 2NW9A 2WS3A 5EK3A 4WBNE 4QH5A 3ZCIA 4IIJE 3PMZA 2VL8A 2XHEB 3VR8A 3O1JA 5HXEA 4CXWA 3EUHA 3PJAJ 3N9NA 4DO0A 2IAKA 3P7IA 5FP3A 4EYYR 3RPUA 1N32T 4UVAB 3MACA 4WW0A 4LMKA 3WTKA 4CI3B 5LOVE 1WCRA 3ZN0B 2QA7A 3OYXA 5FY7A 2D5UA 4EB6E 3MK7C 4KMCA 3WAJA 2XSAA 1ZKEA 3I9WA 3WIPA 5CGMA 5LJNA 5FXVA 4J2CA 1KK7A 4EV6A 3IGQA 1O3XA 4UM3A 4UXNB 5LMNT 1IBKT 4UVBB 3PUXF 4JBWF 5KMGP 3WTOA 2BBJA 1HX1B 3NKZA 1G8XA 4I50E 1XWMA 4H9OC 5FYMA 5AQKB 4ALXA 2XJ7A 2XM1A 3ZN1B 4IT4A 4ADZA 2W63A 3P4QA 5DQWA 3V5UA 4MHCA 5FJVA 1HX8A 3UU5A 4LF4T 4ZK4A 2ZMAA 4P0BA 2XAQB 4Z91A 3B13A 2BR7A 4M1PA 3PUSA 1XMOT 4LF7T 2VB6A 4AQFA 2V6YA 2J47A 3U3IA 4PK6A 4DBRA 3I9YA 4UXUA 4FI5A 3PV0F 3AE4A 4WBOA 4E7ZA 2W67A 4CI2B 2YDRA 3AB3B 3ETUA 1WYBA 3ZCJA 2XQ3A 2WB5A 3PURA 4PK4A 1UX4A 4ZI7E 3H37A 1J5WA 4TV9E 4N78D 5HEUA 2K5BB 3UFGA 4BA9A 3CQCB 3ZT7A 4MFRA 2VQET 4U33A 3C51A 3U78A 3RYCE 4UV9B 5SYOA 4P0AA 4B6XA 4KHPT 1HNWT 1MIWA 4EXTA 3Q5EA 5JDFA 2V6YB 3U8NA 4YSZA 3ANWB 4ZI2D 2X9WA 5LJMA 2A2FX 3C79A 4EZ4A 2JQHA 3ZYLA 1ZP0A 2NW7A 5L3DB 3BQIA 3AEGA 2HH7A 3QC9A 3RIAA 4IDZA 4XZCA 2WMNA 3KV6A 3M65A 1D0XA 3AE8A 3VR9A 4OX9T 3UU3A 3NVOA 2AXDS 2Y6XA 3FZHB 4HWDA 3LG7A 3NRXA 1XMQT 2L3LA 4DR3T 3P4SA 3RX6A 3D0TA 2B76A 3UQ7A 2WNCA 4UM3P 2LSYA 2HPJA 4IDOA 4UEMA 3ZYMA 3T1YT 1HR0T 1UCUA 3CQXC 2Y48B 3AA7B 5HXRA 1VOMA 2XQAA 1IBLT 2QGSA 3EDVA 4EZ1A 3F57A 2XNVA 4DVDA 2V7MA 2Q9QC 4GYRA 5AFMA 5AQFB 3H3AA 2WMOA 3WTHA 3AEDA 3EI0A 4UR9A 4AISA 3AE2A 2LE8A 5BR8T 5JQGE 4IL4A 3S4UA 5HEGA 3SH1A 5CJ5A 2D0UA 2ZJUA 4PNIA 3UFEA 3BK9A 2PGZA 5AFLA 2YEVC 5LGUB 4TX5A 3LSVA 4ZJTA 3VU7H 2C0SA 2XM2A 1OEDB 2QRXA 1N34T 2BG9B 4YLHA 4ZZCA 2M67A 3TLSA 5F8PA 2XNTA 3TLTA 4TN7B 5H6QB 2LHNA 3PUAA 2PH9A 3KBTA 5LNKA 5HCMA 2YDSA 2CXDA 5HCJA 1YQ3A 3RF1A 2WDRA 3ABVA 1VRBA 2WDQA 4ZK1A 3LBXA 3ZMZB 2MAWA 4X5TA 4JI6T 4YHHT 3JC6D 2LLYA 2CRBA 1LKXA 4HEAA 3KFWX 4IE6A 4HFBA 2X9XA 3GUAA 3SIOA 4PFOA 2ZM8A 2PTFA 1HNZT 4CZZB 4JEUB 2FJAA 2KXPB 2EHOA 2LKGA 3NBXX 5LBQB 1KNPA 2W62A 4KI0F 4NUUA 5H6RB 2VASA 2SPCA 2IMLA 4JI7T 3U8JA 4DIDB 2YU1A 2BYQA 4I43B 5FXZA 4X1KE 5AQJB 4GIWA 2V7KA 1HTJF 5L3EB 3O1IA 2IDOB 5FXWA 2ACZA 4X1IE 2XASB 1HFAA 3E08A 3NRYA 2HN2A 1FIOA 4O4LE 5CA1E 3CIRA 2EHOB 3RLFF 2LT3A 1YXRA 4QWNB 5LA6E 1Y01A 2DCFA 4DV0T 2UXDT 2EHOD 2N9DA 5LXTE 4DBQA 3RIFA 3ONXA 3JAFA 3UU6A 5AQRB 4ANJA 3AECA 4EAHA 3DTOA 4DUYT 2YMDA 4ZI3D 2X9HA 3OTOT 1SE7A 1T7SA 2XZEA 3CQGB 3CWZB 4OK0A 4ZJSA 2PG8A 4DMWA 1X79A 3JADA 5FVKA 3ZT6A 1D1CA 3GMIA 2RPAA 4TWHA 5AQPB 4X20E 2UXXB 3PE0A 4FRRA 4DV1T 2J4GA 3E22E 1Y64B 3BQLA 3FBZA 4U7IA 1I6ZA 3SRZA 3FB2A 3L39A 5LMUT 3AE6A 4ZRUA 3AE1A 3FZFB 4PW8A 3FXEB 4MLKA 3MZKB 4I55E 4HFVA 2X0HA 4ZR6A 4LMJA 4HGAA 2E8IA 4AKIA 4ZZBA 4U2ZA 2XZ6A 4X62T 4A5XA 4ASKA 3H3MA 2CHNA 2V7LA 3AEBA 2ZJVA 2M6IA 2XQ9A 5HXSA 1UX5A 3TKLB 1W0BA 3C98B 4BJNA 3U8LA 4EIWA 4C91A 4XBFB 3FZKB 3LK3B 4YTNA 4L0RA 2JMHA 3VRBA 4COFA 3Q5XA 2Y56A 3R6NA 5L3GB 2E5VA 1YQ4A 3KBUA 3ZYKA 1MMGA 3JCFA 3LDQB 4DV5T 2LRLA 3K3QC 4HN9A 3WTNA 4XAXB 3GWHA 5CO5A 1SA0E 1US7B 4NZBA 5HEHA 3WI3A 2UXBT 3T8OA 4BAYB 4TUYE 4DV2T 2KZ7B 1QUUA 4QH1A 4QAAA 1IJ5A 4YJ2E 1NEKA 4DV4T 4NXNT 2K9AA 2X67A 3IA3A 4LF6T 5DQVA 3CX7B 4ZS3A 3HKCE 2JQ9A 5JR9B 5C3JA 4JI2T 2W4XA 4YSYA 3RKGA 2WNJA 2IC6A 1UK5A 4CN1A 5J2UE 3VRAA 1HG5A 3AE3A 4LF8T 3A5XA 3CX8B 4QX7B 4B3ST 3A7MA 2NWBA 2CXLA 3N9PA 2UUAT 2XYTA 3RYIE 5KX5E 5HXCA 2WSSV 2JPFA 3Q2MA 4IE7A 2E5LT 4JI5T 5LHHB 2Y58A 1Z0PA 1HCIA 3RIUC 5C8YE 4UM1A 2VWAA 5AQVB 2H7VC 4HFIA 2IIUA 4ILCA 2X00D 4DR4T 5AINA 2QYWA 5J5GA 2C9TA 1YKHB 5BW2A 4LFBT 3ZC1A 2DL1A 5FL0A 3ZJ2A 4A56A 1FMVA 4AQFC 2I59A 5AQNB 3TLVA 1OXZA 2LSKA 4UVCB 1Z8UA 2B1EA 3G06A 5AFKA 3JAEA 2MBGA 1V9DA 4NUVA 4CN4A 4B3RT 4TV8E 2FJBA 4QKNA 3N9LA 1M62A 3Q5DA 4CQIA 4HWFA 4JLEA 3R84B 1XNRT 2CHOA 4AIUA 4HFHA 3ANWA 3P50A 1IAPA 1WLXA 3AE5A 1U4QA 2Z6EA 3NZPA 1NENA 3N5LA 2VK9A 4HTEA 4U74A 1W09A 2A72A 2Y8DA 2VL0A 4HFEA 2ODVA 3SOLA 1G73A 3CPZA 3SS1A 2HN1A 2XNUA 4AKLA 2IUBA 4AFHA 4DMVA 5HAXA 3K3OA 4G2AA 3A8YC 2WBLA 4JEHB 3WTIA 2E9XA 2XUEA 3O4XE 2BS3A 2BYNA 2NOXA 2OV9A 5J5HA 4F6RC 4AQYT 3VKHA 3WTJA 2IW5B 5KDMC 5JDLA 2VVNA 4KBMB 1AJ3A 5FXXA 3V5SA 3RI5A 2RP4A 5CB4E 1BR4A 3EABA 4PFPA 2X68A 4H9RC 3J7Yq 2WQYA 2HPLA 2KLQA 3VHLA 1E2AA 2E9XB 3C84A 3WTMA 2NTYA 1BR1A 2BR8A 4MBQA 3M3ZB 1OEDA 2E9XD 1BR0A 5AFNA 3IEEA 2BG9A 4KHZF 4X64T 4BFQA 2LSGA 4Z8XA 2D2SA 5HEOA 2WU2A 1D0YA 5AFUL 5JDNA 1B7TA 4O4HE 2E2AA 3N9QA 5FKYA 4QXCB 4G63A 2LRKA 2KNDA 3ZT5A 3TLUA 4CXYA 5JDMA 2IC9A 3ZMSB 4AKHA 5JRCA 4YFSA 3MKDA 2JIWA 4JUYA 5EK4A 4EZHA 2JQQA 3RYFE 1N36T 1WYCA 2WZIA 3ONLC 5HYAA 2KWIB 4IDQA 2LM2A 2NW8A 2BVMA 5HEJA 1QLBA 3PEOA 4TWDA 2Y7YA 3SFEA 5J5IA 5EZYE 3MXZA 3AA6B 3I1AA 1MNEA 5L3CB 4ILUA 5L4HA 5L2LA 2PJQA 3CMLA 5AFJA 2G0UA 4KX6A 3DP7A 3KV9A 1XDPA 5JRCB 3PUYF 3KINB 5LBMA 2BDEA 3MA9A 1KNZA 3B57A 3L09A 5FY0A 3IHRA 1VCTA 3AVSA 5BRXA 2BYRA 4HWIB 3T4MA 2YDQA 4DUZT 5ABEA 1N33T 2X66A 2UXCT 2WP9A 4AFGA 3AA1B 5AQIB 3AEAA 2PBIA 1JNRA 4DR7T 2Q9QB 2PFVA 5JDHA 4MALA 4HFDA 2Q9QD 4O4IE 2KMFA 5AQLB 3T1HT 5IWAT 4LMLA 4OFZA 3EHZA 2NR4A 3VKGA 1KFYA 2VKOA 3KVAA 1KF6A 4PJNA 3OKQA 4HWCA 4DR1T 3L3PA 4Q25A 1XDOA 4UV8B 4U72A 2BKOA 3AAAB 3UQ4A 4ILAA 1T98A 2BYPA 4GOUA 3P4WA 3ETVA 2LHRA 3HA4A 4IDPA 5AQSB 2CLYC 3ZKRA 5FNVE 5DJQC 2YK0A 3L8RA 5IUXA 5L4EA 4U2YA 4EEBA 4CXXA 2W66A 3AAEB 4C90A 5KZUA 1DU2A 5E0OA 1UURA 1D1AA 5F3JA 3AE9A 3HKBE 4ZOLE 3RRWA 5KXJA 1W9RA 2YU2A 2CWOA 2BS2A 2LJLA 2BJ0A 1HS7A 2OA5A 3UUMA 2W8GA 1R8IA 2AE9A 2MTQA 4JI1T 2K48A 2J1DG 1FJGT 3OVUA 2YOEA 3LK42 1XNQT 3UULA 3UU4A 4QXBB 5JDQA 1QSDA 2JQKA 3P4PA 3OPCA 2VQFT 2D9DA 3QNUA 2KSRA 4AKGA 2MYSA 2ZM0A 3KV5A 3UTKA 4O8SA 1EZ3A 1CUNA 2UUBT 2IHR1 2NTXA 2P9BA 4PIRA 2WZHA 4PAGA 5ABHA 4JV5T 5C2TA 2KT9A 4DR5T 5LG4A 3BQKA 5FL1A 3C4ZA 2D0TA 2KINB 4YSXA 5JTGA 2H89A 5JR9A 4CN6A 1LRZA 4AKRB 3Q9DA 2XAFB 1MNDA 5LCYA 3LJCA 4WV9A 2DI4A 3RHWA 3N2GE 3CVRA 1FMWA 5LG3A 2C5IT 4YXDA 5FY1A 5IHYA 2BKNA 2VKJA 4HFCA 4Z90A 5JVDE
chains in the Genus database with same CATH topology
2BYQA 3RQWA 2X00A 4HQPA 4ZRUA 2WNJA 2LKHA 2ZJUA 3WIPA 5HEOA 4AFGA 5SYOA 2XYSA 1I9BA 2PGZA 5AFMB 2YKSA 2BJ0A 3IGQA 3UU8A 2Y57A 2YN6A 4UM3A 5AFLA 3U8NA 4ZR6A 4LMJA 2VL0A 4HFEA 2XQ6A 3SQ9A 4ZZBA 2W8FA 4ZJTA 3LSVA 2XZ6A 2XNUA 3WTLA 5BP0A 2W8GA 5JMEA 4ILBA 2XYTA 3C79A 5J0ZA 3WTOA 1OEDB 4AFHA 4BQTA 4HFDA 2XQ7A 2BG9B 2ZJVA 4QABA 2M6IA 2YOEA 4ZZCA 2BYSA 2Y58A 3TLUA 4D01A 3TLSA 2XQ9A 3ZDHA 3RIAA 2XNTA 4UM1A 3U8LA 4LMLA 4ALXA 4AFTA 3TLTA 3EHZA 4HFIA 4ILCA 4NPPA 5AFNA 3UU4A 2X00D 3U8MA 5J5FA 3WTIA 2PH9A 5AINA 5CFBA 5KE4A 5J5GA 2C9TA 4COFA 5HCMA 5FJVA 3UU3A 5BW2A 3RQUA 3UU5A 2Y56A 1UX2A 3UUBA 4ZK4A 4TNVA 2BYNA 5HCJA 4TNWA 2KSRA 4Z91A 2BR7A 4QACA 5J5HA 2LM2A 5HEJA 3PEOA 3TLWA 2WN9A 4TWDA 3RIFA 2Y7YA 3TLVA 4DBMA 3SQ6A 4ZK1A 2M6BA 3WTJA 1OEDE 2WNLA 2MAWA 3JAFA 4QH4A 4X5TA 4UY2A 3UU6A 5J5IA 4PIRA 5AFHA 2BG9E 2YMEA 4F8HA 5LXBA 5AFKA 3JAEA 3WTNA 2LLYA 3UQ7A 4TWFA 2UZ6A 2WNCA 3UQ4A 2YMDA 4ILAA 4IREA 2WZYA 3EAMA 2BYPA 4UM3P 5L4HA 3P4WA 5L47A 4A98A 4QH5A 4NZBA 5HEHA 3PMZA 3ZKRA 3RI5A 2Y54A 4B5DA 2XQ8A 4UXUA 4HFBA 5AFJA 3GUAA 2XQAA 4XK9A 4ZJSA 5IUXA 5L4EA 3SIOA 3ZDGA 4EZ1A 4LMKA 4QH1A 4QAAA 2XNVA 4UM3S 3WTKA 3U8KA 2XQ3A 3JADA 5AFMA 4XHEA 2XQ5A 2XZ5A 1UW6A 2LKGA 4WV9A 5CO5A 4TWHA 3RHWA 3WTHA 4HFHA 1OEDC 2QC1B 3C84A 5KZUA 3EI0A 3WTMA 4FRRA 4IL9A 3P50A 2BG9C 2BR8A 4A97A 5BRXA 2XQ4A 5HEUA 2BYRA 3T4MA 1UV6A 5TVCA 5LG3A 4IL4A 1OEDA 4HFCA 4Z90A 5HEGA 3U8JA 3SH1A 2BG9A 4BFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYQ A;  3RQW A;  2X00 A;  4HQP A;  4ZRU A;  2WNJ A;  2LKH A;  2ZJU A;  3WIP A;  5HEO A;  4AFG A;  5SYO A;  2XYS A;  1I9B A;  2PGZ A;  5AFM B;  2YKS A;  2BJ0 A;  3IGQ A;  3UU8 A;  2Y57 A;  2YN6 A;  4UM3 A;  5AFL A;  3U8N A;  4ZR6 A;  4LMJ A;  2VL0 A;  4HFE A;  2XQ6 A;  3SQ9 A;  4ZZB A;  2W8F A;  4ZJT A;  3LSV A;  2XZ6 A;  2XNU A;  3WTL A;  5BP0 A;  2W8G A;  5JME A;  4ILB A;  2XYT A;  3C79 A;  5J0Z A;  3WTO A;  1OED B;  4AFH A;  4BQT A;  4HFD A;  2XQ7 A;  2BG9 B;  2ZJV A;  4QAB A;  2M6I A;  2YOE A;  4ZZC A;  2BYS A;  2Y58 A;  3TLU A;  4D01 A;  3TLS A;  2XQ9 A;  3ZDH A;  3RIA A;  2XNT A;  4UM1 A;  3U8L A;  4LML A;  4ALX A;  4AFT A;  3TLT A;  3EHZ A;  4HFI A;  4ILC A;  4NPP A;  5AFN A;  3UU4 A;  2X00 D;  3U8M A;  5J5F A;  3WTI A;  2PH9 A;  5AIN A;  5CFB A;  5KE4 A;  5J5G A;  2C9T A;  4COF A;  5HCM A;  5FJV A;  3UU3 A;  5BW2 A;  3RQU A;  3UU5 A;  2Y56 A;  1UX2 A;  3UUB A;  4ZK4 A;  4TNV A;  2BYN A;  5HCJ A;  4TNW A;  2KSR A;  4Z91 A;  2BR7 A;  4QAC A;  5J5H A;  2LM2 A;  5HEJ A;  3PEO A;  3TLW A;  2WN9 A;  4TWD A;  3RIF A;  2Y7Y A;  3TLV A;  4DBM A;  3SQ6 A;  4ZK1 A;  2M6B A;  3WTJ A;  1OED E;  2WNL A;  2MAW A;  3JAF A;  4QH4 A;  4X5T A;  4UY2 A;  3UU6 A;  5J5I A;  4PIR A;  5AFH A;  2BG9 E;  2YME A;  4F8H A;  5LXB A;  5AFK A;  3JAE A;  3WTN A;  2LLY A;  3UQ7 A;  4TWF A;  2UZ6 A;  2WNC A;  3UQ4 A;  2YMD A;  4ILA A;  4IRE A;  2WZY A;  3EAM A;  2BYP A;  4UM3 P;  5L4H A;  3P4W A;  5L47 A;  4A98 A;  4QH5 A;  4NZB A;  5HEH A;  3PMZ A;  3ZKR A;  3RI5 A;  2Y54 A;  4B5D A;  2XQ8 A;  4UXU A;  4HFB A;  5AFJ A;  3GUA A;  2XQA A;  4XK9 A;  4ZJS A;  5IUX A;  5L4E A;  3SIO A;  3ZDG A;  4EZ1 A;  4LMK A;  4QH1 A;  4QAA A;  2XNV A;  4UM3 S;  3WTK A;  3U8K A;  2XQ3 A;  3JAD A;  5AFM A;  4XHE A;  2XQ5 A;  2XZ5 A;  1UW6 A;  2LKG A;  4WV9 A;  5CO5 A;  4TWH A;  3RHW A;  3WTH A;  4HFH A;  1OED C;  2QC1 B;  3C84 A;  5KZU A;  3EI0 A;  3WTM A;  4FRR A;  4IL9 A;  3P50 A;  2BG9 C;  2BR8 A;  4A97 A;  5BRX A;  2XQ4 A;  5HEU A;  2BYR A;  3T4M A;  1UV6 A;  5TVC A;  5LG3 A;  4IL4 A;  1OED A;  4HFC A;  4Z90 A;  5HEG A;  3U8J A;  3SH1 A;  2BG9 A;  4BFQ A; 
#chains in the Genus database with same CATH topology
 2CA5 A;  1JNZ A;  2X00 A;  4YTM A;  2LKH A;  4UF0 B;  3ZLI A;  3LK2 B;  2BS4 A;  5ABF A;  3WAK A;  2YKS A;  3UU8 A;  2WDV A;  2CBJ A;  3RYH E;  2XQ6 A;  3N2O A;  4IHJ E;  3AEF A;  1SHZ C;  3RGL A;  2ES0 A;  3PUG A;  2XPK A;  2MPK A;  5HWX A;  5L3F B;  2L9Q A;  4JI0 T;  5CFB A;  2LSJ A;  5JH7 E;  2UUC T;  1ZV4 X;  5J1G A;  3RQU A;  5AQM B;  2CPT A;  3UUB A;  4L9I A;  4TNV A;  3N9O A;  3IF8 B;  2W2U A;  2UU9 T;  4NXM T;  3ZMT B;  2ZM6 T;  2K24 A;  2C5J A;  5AFH A;  5ABF B;  1MMA A;  3QB5 A;  2V8S V;  2UZ6 A;  4P1N A;  3EAM A;  1U5P A;  4A98 A;  2ZM2 A;  1J1J A;  3PU3 A;  2MOZ A;  1WR6 A;  4ZI2 C;  3ZSS A;  3ONJ A;  4QHO A;  2C5K T;  2DWK A;  3LFM A;  1CHU A;  4IL9 A;  5ABG A;  5LP6 E;  1S94 A;  4H9N C;  3O1H A;  4YJ3 E;  4IDN A;  1HG2 A;  2FBW A;  2WWV A;  2XYS A;  2WCA A;  4DND A;  3HKD E;  1UUS A;  3ZC0 A;  4IE4 A;  3RIU A;  3SQ9 A;  2W8F A;  4EGW A;  4DV7 T;  5LHG B;  1ZOY A;  5J0Z A;  1KEY A;  4QAB A;  4HE8 A;  1MIY A;  4PJM A;  2E9X C;  2LOP A;  2W00 A;  3FZM B;  3J9X 1;  2LM9 A;  3CKD A;  4X66 T;  4TZ4 C;  2VKH A;  3N9M A;  1X9B A;  3U8M A;  5J2T E;  2I6H A;  3C4W A;  4JI4 T;  3QOF A;  2H3R A;  4QAC A;  4UIG A;  2W0G A;  5AQG B;  3KVB A;  2X0L B;  3KV4 A;  3NZQ A;  4JYA T;  4QH4 A;  1OWA A;  4UY2 A;  5JDG A;  2YME A;  5LXB A;  4H9P C;  2CE7 A;  3I0Q A;  2XTL A;  2ODU A;  3UUX B;  2XQ8 A;  4XK9 A;  3HR0 A;  2V5D A;  2V7I A;  4CI1 B;  3N2K E;  4V1A v;  4XHE A;  2XQ5 A;  4DR6 T;  1OED C;  3NWI A;  4QX8 B;  3CK6 A;  2BG9 C;  3AXJ A;  5AQO B;  1UV6 A;  1W0A A;  3GA8 A;  4P09 A;  3PUW F;  5IYZ E;  1HNX T;  5EK2 A;  1T72 A;  4DV3 T;  3EDU A;  1I9B A;  1VCS A;  1ZHC A;  4O4J E;  4B3M T;  4PJJ A;  3ZJ1 A;  4YTP A;  5ADX L;  3RC3 A;  2W61 A;  3JC6 C;  5JME A;  3C64 A;  1NWM X;  2LSI A;  3PU8 A;  2RA1 A;  4I4T E;  4IE5 A;  1WRD A;  3AAI A;  2BYS A;  4KUM B;  2VKD A;  2BZB A;  4YY3 T;  3RRC A;  3FXD B;  2FJE A;  1H7C A;  1MMD A;  1YW0 A;  2JJ9 A;  4U3C A;  3ZMV B;  3AXJ B;  4ZEY A;  3Q5W A;  4AQG A;  4IGU A;  1WR0 A;  2DWG A;  2WN9 A;  2CXF A;  3F2E A;  4BJM A;  4X65 T;  5L3B B;  2WZY A;  3PUV F;  3P4R A;  4U7Y A;  3UT5 E;  4DR2 T;  2Y54 A;  3RC8 A;  4HKA A;  4B5D A;  4H63 H;  2CM0 A;  4YHJ A;  3ZDG A;  1L0V A;  4UM3 S;  5A1L A;  4WYV A;  1IJ6 A;  4IST A;  4K0K T;  2XZ5 A;  2ACX A;  1UW6 A;  4UEL A;  3AA0 B;  2Q9Q A;  2XAH B;  5TVC A;  4LFA T;  2DLR A;  5AQQ B;  5GON E;  3RH3 A;  2EHO C;  2JMK A;  2WWU A;  2CMR A;  4GKJ T;  5AFM B;  3GN5 A;  2YN6 A;  2HHH T;  2GK9 A;  2V5C A;  2V1D B;  4ZXL A;  2V26 A;  3K8P C;  3WTL A;  3RKO A;  4ZI3 C;  2CBI A;  2WY2 A;  5BMV E;  4BQT A;  4K0U A;  4AI6 A;  4O2A E;  3FBL A;  4D01 A;  5LYJ E;  3ZDH A;  2CEA A;  4I0U A;  1D0Z A;  4O2B E;  2R6G F;  1UGO A;  2N2N A;  1NAF A;  4NPP A;  3ESL A;  5LHI B;  5M4Y A;  3ZEF B;  3UUN A;  2N1G A;  1HF8 A;  3SFD A;  4TNW A;  1BR2 A;  4X1Y E;  3TLW A;  3HL6 A;  3C50 A;  3EVY A;  3AE7 A;  3SQ6 A;  2M6B A;  4HWH A;  5ETW A;  1E7P A;  4E7S A;  2I0M A;  1MMN A;  2CCQ A;  2FJD A;  3GN5 B;  3QUJ A;  5JRE A;  3PUQ A;  2VVS A;  3E0Z A;  2WU5 A;  2NP9 A;  5L47 A;  3PTR B;  4FJO A;  1J5E T;  3HI2 A;  1LVF A;  3PUZ F;  2QVA A;  3QB5 K;  2X9Y A;  4YT0 A;  3LBX B;  2F4V T;  4IE0 A;  2OLT A;  3C4X A;  1WFD A;  4DV6 T;  2QC1 B;  2KWH A;  4A97 A;  3K1S A;  2XQ4 A;  3ZMU B;  1MIV A;  4EYU A;  2LEH A;  3FZL B;  2A3D A;  3RQW A;  1SUM B;  2H7O A;  5AQU B;  2DHR A;  2UXN B;  5FMN A;  1GQE A;  3F31 A;  3ZPO A;  5BP0 A;  5TAO A;  4ILB A;  4AXP A;  2VUR A;  4KP3 C;  2XSB A;  2XQ7 A;  2K3W A;  3OJA A;  2J62 A;  1D1B A;  1IBM T;  5AQT B;  3W15 B;  3B5M A;  1YD8 G;  5LGN B;  3SWH A;  3I0O A;  3QK6 A;  5F5W A;  4EOZ B;  2YIN A;  5J5F A;  5KE4 A;  1FEW A;  2BKP A;  3DJB A;  1IZN B;  2XAG B;  2CWY A;  4PK5 A;  3K3N A;  1E1H B;  4LF9 T;  4GK5 E;  2FUP A;  4NIQ A;  3IBP A;  2WNL A;  4L5G A;  4WZX A;  4OYJ A;  3FHN A;  4F8H A;  1ZEE A;  2BBH A;  2XQY A;  3OBV E;  4TWF A;  5LGT B;  2V6X A;  4IRE A;  4JI8 T;  4EED A;  5JR9 C;  1XZY A;  4JI3 T;  5FVL A;  2JRK A;  4H63 V;  3O9X A;  2WAU A;  4ZS2 A;  2LOS A;  3U8K A;  4H9Q C;  4UF0 A;  3ZST A;  5AQH B;  4ERR A;  3PJA A;  3OYZ A;  2XY8 B;  4U31 A;  4LFC T;  2A9U A;  5HWY A;  4GK0 E;  2X0Y A;  3X1D A;  2CLY B;  2X51 A;  4HQP A;  4PJL A;  1M7K A;  2XAJ B;  2Y57 A;  5CA0 E;  4WNK A;  3AVR A;  4OHF A;  4OYK A;  5HXH A;  4GKK T;  4ZHQ E;  2V7J A;  3PDY A;  4B3T T;  1I94 T;  5LB7 B;  3P8C D;  4AFT A;  3HKE E;  2WM9 A;  4LF5 T;  2L8K A;  5DAB A;  3CX6 B;  1T8B A;  4GYS A;  1UX2 A;  1KNR A;  2ZLY A;  4H9S E;  1S35 A;  3KDS E;  4QXH B;  2BVL A;  3MJX A;  4DBM A;  2DNX A;  4ISS A;  1OED E;  3AEE A;  1YKE B;  1LVK A;  2BG9 E;  2H88 A;  2NW9 A;  2WS3 A;  5EK3 A;  4WBN E;  4QH5 A;  3ZCI A;  4IIJ E;  3PMZ A;  2VL8 A;  2XHE B;  3VR8 A;  3O1J A;  5HXE A;  4CXW A;  3EUH A;  3PJA J;  3N9N A;  4DO0 A;  2IAK A;  3P7I A;  5FP3 A;  4EYY R;  3RPU A;  1N32 T;  4UVA B;  3MAC A;  4WW0 A;  4LMK A;  3WTK A;  4CI3 B;  5LOV E;  1WCR A;  3ZN0 B;  2QA7 A;  3OYX A;  5FY7 A;  2D5U A;  4EB6 E;  3MK7 C;  4KMC A;  3WAJ A;  2XSA A;  1ZKE A;  3I9W A;  3WIP A;  5CGM A;  5LJN A;  5FXV A;  4J2C A;  1KK7 A;  4EV6 A;  3IGQ A;  1O3X A;  4UM3 A;  4UXN B;  5LMN T;  1IBK T;  4UVB B;  3PUX F;  4JBW F;  5KMG P;  3WTO A;  2BBJ A;  1HX1 B;  3NKZ A;  1G8X A;  4I50 E;  1XWM A;  4H9O C;  5FYM A;  5AQK B;  4ALX A;  2XJ7 A;  2XM1 A;  3ZN1 B;  4IT4 A;  4ADZ A;  2W63 A;  3P4Q A;  5DQW A;  3V5U A;  4MHC A;  5FJV A;  1HX8 A;  3UU5 A;  4LF4 T;  4ZK4 A;  2ZMA A;  4P0B A;  2XAQ B;  4Z91 A;  3B13 A;  2BR7 A;  4M1P A;  3PUS A;  1XMO T;  4LF7 T;  2VB6 A;  4AQF A;  2V6Y A;  2J47 A;  3U3I A;  4PK6 A;  4DBR A;  3I9Y A;  4UXU A;  4FI5 A;  3PV0 F;  3AE4 A;  4WBO A;  4E7Z A;  2W67 A;  4CI2 B;  2YDR A;  3AB3 B;  3ETU A;  1WYB A;  3ZCJ A;  2XQ3 A;  2WB5 A;  3PUR A;  4PK4 A;  1UX4 A;  4ZI7 E;  3H37 A;  1J5W A;  4TV9 E;  4N78 D;  5HEU A;  2K5B B;  3UFG A;  4BA9 A;  3CQC B;  3ZT7 A;  4MFR A;  2VQE T;  4U33 A;  3C51 A;  3U78 A;  3RYC E;  4UV9 B;  5SYO A;  4P0A A;  4B6X A;  4KHP T;  1HNW T;  1MIW A;  4EXT A;  3Q5E A;  5JDF A;  2V6Y B;  3U8N A;  4YSZ A;  3ANW B;  4ZI2 D;  2X9W A;  5LJM A;  2A2F X;  3C79 A;  4EZ4 A;  2JQH A;  3ZYL A;  1ZP0 A;  2NW7 A;  5L3D B;  3BQI A;  3AEG A;  2HH7 A;  3QC9 A;  3RIA A;  4IDZ A;  4XZC A;  2WMN A;  3KV6 A;  3M65 A;  1D0X A;  3AE8 A;  3VR9 A;  4OX9 T;  3UU3 A;  3NVO A;  2AXD S;  2Y6X A;  3FZH B;  4HWD A;  3LG7 A;  3NRX A;  1XMQ T;  2L3L A;  4DR3 T;  3P4S A;  3RX6 A;  3D0T A;  2B76 A;  3UQ7 A;  2WNC A;  4UM3 P;  2LSY A;  2HPJ A;  4IDO A;  4UEM A;  3ZYM A;  3T1Y T;  1HR0 T;  1UCU A;  3CQX C;  2Y48 B;  3AA7 B;  5HXR A;  1VOM A;  2XQA A;  1IBL T;  2QGS A;  3EDV A;  4EZ1 A;  3F57 A;  2XNV A;  4DVD A;  2V7M A;  2Q9Q C;  4GYR A;  5AFM A;  5AQF B;  3H3A A;  2WMO A;  3WTH A;  3AED A;  3EI0 A;  4UR9 A;  4AIS A;  3AE2 A;  2LE8 A;  5BR8 T;  5JQG E;  4IL4 A;  3S4U A;  5HEG A;  3SH1 A;  5CJ5 A;  2D0U A;  2ZJU A;  4PNI A;  3UFE A;  3BK9 A;  2PGZ A;  5AFL A;  2YEV C;  5LGU B;  4TX5 A;  3LSV A;  4ZJT A;  3VU7 H;  2C0S A;  2XM2 A;  1OED B;  2QRX A;  1N34 T;  2BG9 B;  4YLH A;  4ZZC A;  2M67 A;  3TLS A;  5F8P A;  2XNT A;  3TLT A;  4TN7 B;  5H6Q B;  2LHN A;  3PUA A;  2PH9 A;  3KBT A;  5LNK A;  5HCM A;  2YDS A;  2CXD A;  5HCJ A;  1YQ3 A;  3RF1 A;  2WDR A;  3ABV A;  1VRB A;  2WDQ A;  4ZK1 A;  3LBX A;  3ZMZ B;  2MAW A;  4X5T A;  4JI6 T;  4YHH T;  3JC6 D;  2LLY A;  2CRB A;  1LKX A;  4HEA A;  3KFW X;  4IE6 A;  4HFB A;  2X9X A;  3GUA A;  3SIO A;  4PFO A;  2ZM8 A;  2PTF A;  1HNZ T;  4CZZ B;  4JEU B;  2FJA A;  2KXP B;  2EHO A;  2LKG A;  3NBX X;  5LBQ B;  1KNP A;  2W62 A;  4KI0 F;  4NUU A;  5H6R B;  2VAS A;  2SPC A;  2IML A;  4JI7 T;  3U8J A;  4DID B;  2YU1 A;  2BYQ A;  4I43 B;  5FXZ A;  4X1K E;  5AQJ B;  4GIW A;  2V7K A;  1HTJ F;  5L3E B;  3O1I A;  2IDO B;  5FXW A;  2ACZ A;  4X1I E;  2XAS B;  1HFA A;  3E08 A;  3NRY A;  2HN2 A;  1FIO A;  4O4L E;  5CA1 E;  3CIR A;  2EHO B;  3RLF F;  2LT3 A;  1YXR A;  4QWN B;  5LA6 E;  1Y01 A;  2DCF A;  4DV0 T;  2UXD T;  2EHO D;  2N9D A;  5LXT E;  4DBQ A;  3RIF A;  3ONX A;  3JAF A;  3UU6 A;  5AQR B;  4ANJ A;  3AEC A;  4EAH A;  3DTO A;  4DUY T;  2YMD A;  4ZI3 D;  2X9H A;  3OTO T;  1SE7 A;  1T7S A;  2XZE A;  3CQG B;  3CWZ B;  4OK0 A;  4ZJS A;  2PG8 A;  4DMW A;  1X79 A;  3JAD A;  5FVK A;  3ZT6 A;  1D1C A;  3GMI A;  2RPA A;  4TWH A;  5AQP B;  4X20 E;  2UXX B;  3PE0 A;  4FRR A;  4DV1 T;  2J4G A;  3E22 E;  1Y64 B;  3BQL A;  3FBZ A;  4U7I A;  1I6Z A;  3SRZ A;  3FB2 A;  3L39 A;  5LMU T;  3AE6 A;  4ZRU A;  3AE1 A;  3FZF B;  4PW8 A;  3FXE B;  4MLK A;  3MZK B;  4I55 E;  4HFV A;  2X0H A;  4ZR6 A;  4LMJ A;  4HGA A;  2E8I A;  4AKI A;  4ZZB A;  4U2Z A;  2XZ6 A;  4X62 T;  4A5X A;  4ASK A;  3H3M A;  2CHN A;  2V7L A;  3AEB A;  2ZJV A;  2M6I A;  2XQ9 A;  5HXS A;  1UX5 A;  3TKL B;  1W0B A;  3C98 B;  4BJN A;  3U8L A;  4EIW A;  4C91 A;  4XBF B;  3FZK B;  3LK3 B;  4YTN A;  4L0R A;  2JMH A;  3VRB A;  4COF A;  3Q5X A;  2Y56 A;  3R6N A;  5L3G B;  2E5V A;  1YQ4 A;  3KBU A;  3ZYK A;  1MMG A;  3JCF A;  3LDQ B;  4DV5 T;  2LRL A;  3K3Q C;  4HN9 A;  3WTN A;  4XAX B;  3GWH A;  5CO5 A;  1SA0 E;  1US7 B;  4NZB A;  5HEH A;  3WI3 A;  2UXB T;  3T8O A;  4BAY B;  4TUY E;  4DV2 T;  2KZ7 B;  1QUU A;  4QH1 A;  4QAA A;  1IJ5 A;  4YJ2 E;  1NEK A;  4DV4 T;  4NXN T;  2K9A A;  2X67 A;  3IA3 A;  4LF6 T;  5DQV A;  3CX7 B;  4ZS3 A;  3HKC E;  2JQ9 A;  5JR9 B;  5C3J A;  4JI2 T;  2W4X A;  4YSY A;  3RKG A;  2WNJ A;  2IC6 A;  1UK5 A;  4CN1 A;  5J2U E;  3VRA A;  1HG5 A;  3AE3 A;  4LF8 T;  3A5X A;  3CX8 B;  4QX7 B;  4B3S T;  3A7M A;  2NWB A;  2CXL A;  3N9P A;  2UUA T;  2XYT A;  3RYI E;  5KX5 E;  5HXC A;  2WSS V;  2JPF A;  3Q2M A;  4IE7 A;  2E5L T;  4JI5 T;  5LHH B;  2Y58 A;  1Z0P A;  1HCI A;  3RIU C;  5C8Y E;  4UM1 A;  2VWA A;  5AQV B;  2H7V C;  4HFI A;  2IIU A;  4ILC A;  2X00 D;  4DR4 T;  5AIN A;  2QYW A;  5J5G A;  2C9T A;  1YKH B;  5BW2 A;  4LFB T;  3ZC1 A;  2DL1 A;  5FL0 A;  3ZJ2 A;  4A56 A;  1FMV A;  4AQF C;  2I59 A;  5AQN B;  3TLV A;  1OXZ A;  2LSK A;  4UVC B;  1Z8U A;  2B1E A;  3G06 A;  5AFK A;  3JAE A;  2MBG A;  1V9D A;  4NUV A;  4CN4 A;  4B3R T;  4TV8 E;  2FJB A;  4QKN A;  3N9L A;  1M62 A;  3Q5D A;  4CQI A;  4HWF A;  4JLE A;  3R84 B;  1XNR T;  2CHO A;  4AIU A;  4HFH A;  3ANW A;  3P50 A;  1IAP A;  1WLX A;  3AE5 A;  1U4Q A;  2Z6E A;  3NZP A;  1NEN A;  3N5L A;  2VK9 A;  4HTE A;  4U74 A;  1W09 A;  2A72 A;  2Y8D A;  2VL0 A;  4HFE A;  2ODV A;  3SOL A;  1G73 A;  3CPZ A;  3SS1 A;  2HN1 A;  2XNU A;  4AKL A;  2IUB A;  4AFH A;  4DMV A;  5HAX A;  3K3O A;  4G2A A;  3A8Y C;  2WBL A;  4JEH B;  3WTI A;  2E9X A;  2XUE A;  3O4X E;  2BS3 A;  2BYN A;  2NOX A;  2OV9 A;  5J5H A;  4F6R C;  4AQY T;  3VKH A;  3WTJ A;  2IW5 B;  5KDM C;  5JDL A;  2VVN A;  4KBM B;  1AJ3 A;  5FXX A;  3V5S A;  3RI5 A;  2RP4 A;  5CB4 E;  1BR4 A;  3EAB A;  4PFP A;  2X68 A;  4H9R C;  3J7Y q;  2WQY A;  2HPL A;  2KLQ A;  3VHL A;  1E2A A;  2E9X B;  3C84 A;  3WTM A;  2NTY A;  1BR1 A;  2BR8 A;  4MBQ A;  3M3Z B;  1OED A;  2E9X D;  1BR0 A;  5AFN A;  3IEE A;  2BG9 A;  4KHZ F;  4X64 T;  4BFQ A;  2LSG A;  4Z8X A;  2D2S A;  5HEO A;  2WU2 A;  1D0Y A;  5AFU L;  5JDN A;  1B7T A;  4O4H E;  2E2A A;  3N9Q A;  5FKY A;  4QXC B;  4G63 A;  2LRK A;  2KND A;  3ZT5 A;  3TLU A;  4CXY A;  5JDM A;  2IC9 A;  3ZMS B;  4AKH A;  5JRC A;  4YFS A;  3MKD A;  2JIW A;  4JUY A;  5EK4 A;  4EZH A;  2JQQ A;  3RYF E;  1N36 T;  1WYC A;  2WZI A;  3ONL C;  5HYA A;  2KWI B;  4IDQ A;  2LM2 A;  2NW8 A;  2BVM A;  5HEJ A;  1QLB A;  3PEO A;  4TWD A;  2Y7Y A;  3SFE A;  5J5I A;  5EZY E;  3MXZ A;  3AA6 B;  3I1A A;  1MNE A;  5L3C B;  4ILU A;  5L4H A;  5L2L A;  2PJQ A;  3CML A;  5AFJ A;  2G0U A;  4KX6 A;  3DP7 A;  3KV9 A;  1XDP A;  5JRC B;  3PUY F;  3KIN B;  5LBM A;  2BDE A;  3MA9 A;  1KNZ A;  3B57 A;  3L09 A;  5FY0 A;  3IHR A;  1VCT A;  3AVS A;  5BRX A;  2BYR A;  4HWI B;  3T4M A;  2YDQ A;  4DUZ T;  5ABE A;  1N33 T;  2X66 A;  2UXC T;  2WP9 A;  4AFG A;  3AA1 B;  5AQI B;  3AEA A;  2PBI A;  1JNR A;  4DR7 T;  2Q9Q B;  2PFV A;  5JDH A;  4MAL A;  4HFD A;  2Q9Q D;  4O4I E;  2KMF A;  5AQL B;  3T1H T;  5IWA T;  4LML A;  4OFZ A;  3EHZ A;  2NR4 A;  3VKG A;  1KFY A;  2VKO A;  3KVA A;  1KF6 A;  4PJN A;  3OKQ A;  4HWC A;  4DR1 T;  3L3P A;  4Q25 A;  1XDO A;  4UV8 B;  4U72 A;  2BKO A;  3AAA B;  3UQ4 A;  4ILA A;  1T98 A;  2BYP A;  4GOU A;  3P4W A;  3ETV A;  2LHR A;  3HA4 A;  4IDP A;  5AQS B;  2CLY C;  3ZKR A;  5FNV E;  5DJQ C;  2YK0 A;  3L8R A;  5IUX A;  5L4E A;  4U2Y A;  4EEB A;  4CXX A;  2W66 A;  3AAE B;  4C90 A;  5KZU A;  1DU2 A;  5E0O A;  1UUR A;  1D1A A;  5F3J A;  3AE9 A;  3HKB E;  4ZOL E;  3RRW A;  5KXJ A;  1W9R A;  2YU2 A;  2CWO A;  2BS2 A;  2LJL A;  2BJ0 A;  1HS7 A;  2OA5 A;  3UUM A;  2W8G A;  1R8I A;  2AE9 A;  2MTQ A;  4JI1 T;  2K48 A;  2J1D G;  1FJG T;  3OVU A;  2YOE A;  3LK4 2;  1XNQ T;  3UUL A;  3UU4 A;  4QXB B;  5JDQ A;  1QSD A;  2JQK A;  3P4P A;  3OPC A;  2VQF T;  2D9D A;  3QNU A;  2KSR A;  4AKG A;  2MYS A;  2ZM0 A;  3KV5 A;  3UTK A;  4O8S A;  1EZ3 A;  1CUN A;  2UUB T;  2IHR 1;  2NTX A;  2P9B A;  4PIR A;  2WZH A;  4PAG A;  5ABH A;  4JV5 T;  5C2T A;  2KT9 A;  4DR5 T;  5LG4 A;  3BQK A;  5FL1 A;  3C4Z A;  2D0T A;  2KIN B;  4YSX A;  5JTG A;  2H89 A;  5JR9 A;  4CN6 A;  1LRZ A;  4AKR B;  3Q9D A;  2XAF B;  1MND A;  5LCY A;  3LJC A;  4WV9 A;  2DI4 A;  3RHW A;  3N2G E;  3CVR A;  1FMW A;  5LG3 A;  2C5I T;  4YXD A;  5FY1 A;  5IHY A;  2BKN A;  2VKJ A;  4HFC A;  4Z90 A;  5JVD E; 
#chains in the Genus database with same CATH homology
 2BYQ A;  3RQW A;  2X00 A;  4HQP A;  4ZRU A;  2WNJ A;  2LKH A;  2ZJU A;  3WIP A;  5HEO A;  4AFG A;  5SYO A;  2XYS A;  1I9B A;  2PGZ A;  5AFM B;  2YKS A;  2BJ0 A;  3IGQ A;  3UU8 A;  2Y57 A;  2YN6 A;  4UM3 A;  5AFL A;  3U8N A;  4ZR6 A;  4LMJ A;  2VL0 A;  4HFE A;  2XQ6 A;  3SQ9 A;  4ZZB A;  2W8F A;  4ZJT A;  3LSV A;  2XZ6 A;  2XNU A;  3WTL A;  5BP0 A;  2W8G A;  5JME A;  4ILB A;  2XYT A;  3C79 A;  5J0Z A;  3WTO A;  1OED B;  4AFH A;  4BQT A;  4HFD A;  2XQ7 A;  2BG9 B;  2ZJV A;  4QAB A;  2M6I A;  2YOE A;  4ZZC A;  2BYS A;  2Y58 A;  3TLU A;  4D01 A;  3TLS A;  2XQ9 A;  3ZDH A;  3RIA A;  2XNT A;  4UM1 A;  3U8L A;  4LML A;  4ALX A;  4AFT A;  3TLT A;  3EHZ A;  4HFI A;  4ILC A;  4NPP A;  5AFN A;  3UU4 A;  2X00 D;  3U8M A;  5J5F A;  3WTI A;  2PH9 A;  5AIN A;  5CFB A;  5KE4 A;  5J5G A;  2C9T A;  4COF A;  5HCM A;  5FJV A;  3UU3 A;  5BW2 A;  3RQU A;  3UU5 A;  2Y56 A;  1UX2 A;  3UUB A;  4ZK4 A;  4TNV A;  2BYN A;  5HCJ A;  4TNW A;  2KSR A;  4Z91 A;  2BR7 A;  4QAC A;  5J5H A;  2LM2 A;  5HEJ A;  3PEO A;  3TLW A;  2WN9 A;  4TWD A;  3RIF A;  2Y7Y A;  3TLV A;  4DBM A;  3SQ6 A;  4ZK1 A;  2M6B A;  3WTJ A;  1OED E;  2WNL A;  2MAW A;  3JAF A;  4QH4 A;  4X5T A;  4UY2 A;  3UU6 A;  5J5I A;  4PIR A;  5AFH A;  2BG9 E;  2YME A;  4F8H A;  5LXB A;  5AFK A;  3JAE A;  3WTN A;  2LLY A;  3UQ7 A;  4TWF A;  2UZ6 A;  2WNC A;  3UQ4 A;  2YMD A;  4ILA A;  4IRE A;  2WZY A;  3EAM A;  2BYP A;  4UM3 P;  5L4H A;  3P4W A;  5L47 A;  4A98 A;  4QH5 A;  4NZB A;  5HEH A;  3PMZ A;  3ZKR A;  3RI5 A;  2Y54 A;  4B5D A;  2XQ8 A;  4UXU A;  4HFB A;  5AFJ A;  3GUA A;  2XQA A;  4XK9 A;  4ZJS A;  5IUX A;  5L4E A;  3SIO A;  3ZDG A;  4EZ1 A;  4LMK A;  4QH1 A;  4QAA A;  2XNV A;  4UM3 S;  3WTK A;  3U8K A;  2XQ3 A;  3JAD A;  5AFM A;  4XHE A;  2XQ5 A;  2XZ5 A;  1UW6 A;  2LKG A;  4WV9 A;  5CO5 A;  4TWH A;  3RHW A;  3WTH A;  4HFH A;  1OED C;  2QC1 B;  3C84 A;  5KZU A;  3EI0 A;  3WTM A;  4FRR A;  4IL9 A;  3P50 A;  2BG9 C;  2BR8 A;  4A97 A;  5BRX A;  2XQ4 A;  5HEU A;  2BYR A;  3T4M A;  1UV6 A;  5TVC A;  5LG3 A;  4IL4 A;  1OED A;  4HFC A;  4Z90 A;  5HEG A;  3U8J A;  3SH1 A;  2BG9 A;  4BFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...