5L4HA

X-ray structure of the 2-22' locally-closed mutant of glic in complex with 5-(2-bromo-ethyl)-5-ethyl-pyrimidine-2,4,6-trione (brominated barbiturate)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton-gated ion channel
molecule tags Membrane protein, transport protein
source organism Gloeobacter violaceus (strain pcc 7421)
publication title Barbiturates Bind in the GLIC Ion Channel Pore and Cause Inhibition by Stabilizing a Closed State.
pubmed doi rcsb
total genus 90
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 5l4hA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5l4hA01
2XNTA 2YN6A 4QH1A 2Y56A 2ZJVA 4Z91A 2BYQA 4UY2A 4WV9A 4TNVA 5HEOA 5IUXA 5SYOA 3UU6A 5BRXA 4COFA 3C79A 4X5TA 4IL4A 3TLWA 4UM3A 2W8GA 3UU8A 5HCMA 5AFLA 4HFHA 2XQ8A 4XHEA 4F8HA 4AFGA 3U8NA 2Y7YA 4HFIA 5HCJA 3SH1A 4AFTA 5FJVA 4UXUA 2WNCA 3RQUA 1I9BA 3C84A 3TLTA 2LLYA 4A97A 2LKGA 5CO5A 5L4HA 5AFNA 3RQWA 2BYSA 5LG3A 3UU5A 2BG9C 5L47A 4ILCA 4QACA 3U8JA 3U8KA 3WTKA 4B5DA 3TLUA 2YOEA 3WTMA 4Z90A 4DBMA 2BYNA 3SIOA 4UM3S 1OEDE 2YKSA 2XZ5A 2XQ3A 2XZ6A 3ZDHA 5BW2A 2WNLA 2XQ4A 4IREA 5LXBA 3U8MA 3UU4A 4TNWA 2KSRA 4HFCA 2XYTA 2MAWA 3JAFA 3WTIA 3EHZA 4AFHA 4QAAA 2XQ6A 4ZZCA 4QH5A 5HEHA 4LMLA 4TWDA 2M6IA 2UZ6A 3PEOA 2XQAA 1OEDB 3JAEA 4UM3P 2QC1B 5AINA 5JMEA 5HEJA 5HEGA 3RI5A 2XNVA 3WTJA 3RIFA 2YMEA 2BR7A 1UW6A 5J0ZA 2WN9A 2XYSA 2Y54A 2X00A 3PMZA 3RIAA 4ZR6A 3P50A 3SQ9A 2BG9E 3EAMA 2BYPA 3ZDGA 4QABA 4HFBA 2XQ7A 3UQ4A 3T4MA 4BFQA 5AFHA 4IL9A 3U8LA 5BP0A 4FRRA 5J5GA 2XQ9A 4ZJSA 4NPPA 4ZJTA 3SQ6A 2BR8A 3WTOA 2PH9A 2XQ5A 5AFKA 2PGZA 5KE4A 4UM1A 5J5FA 5TVCA 4TWFA 5KZUA 3IGQA 5J5IA 4ZRUA 4ZK4A 3WTHA 5J5HA 4HFDA 4ILAA 5AFMB 3WTLA 3UUBA 5L4EA 5AFMA 4BQTA 4PIRA 3EI0A 3WIPA 4XK9A 4A98A 4TWHA 1OEDC 3UU3A 3GUAA 5AFJA 2X00D 4EZ1A 4QH4A 2BJ0A 2W8FA 2M6BA 1UX2A 4ZZBA 2YMDA 3LSVA 2VL0A 2Y58A 3RHWA 2C9TA 2Y57A 2BYRA 3JADA 2WNJA 4NZBA 5HEUA 4ZK1A 1OEDA 4HQPA 4ALXA 5CFBA 4D01A 2ZJUA 3WTNA 4LMJA 3P4WA 4ILBA 2LM2A 1UV6A 2WZYA 3TLVA 3TLSA 3UQ7A 2XNUA 4HFEA 2BG9B 3ZKRA 2BG9A 4LMKA 2LKHA
chains in the Genus database with same CATH superfamily
3LJCA 4QH1A 5JRCA 3LK42 1J5WA 4COFA 2BDEA 3F31A 1H7CA 4HFHA 3N2OA 3FZHB 3P4RA 2XASB 1KFYA 4TZ4C 4IHJE 4YSZA 1S35A 2NW9A 3UU5A 3ZT5A 3VRBA 2BZBA 2XZ6A 2XQ4A 2VKHA 4QKNA 4KHPT 3KBTA 3NWIA 3OYZA 4TN7B 5HEJA 2E9XB 3CQGB 3KVBA 1HX8A 4DV4T 3C98B 3UULA 5LJNA 1UX5A 1IZNB 4IE7A 5JR9C 4HFBA 3T4MA 2JQHA 3ONXA 5ABHA 3SQ6A 4ZXLA 3I1AA 2IC9A 2MPKA 3C4WA 1WYCA 2W61A 4KHZF 4PK4A 3C4ZA 4TWHA 4C90A 3JC6C 4UELA 1QUUA 1T98A 3L39A 1HCIA 3IF8B 2BKPA 2VL0A 2CXLA 2CMRA 5AQTB 3NZQA 5FY7A 2NP9A 2K48A 1D1BA 4QXBB 2WZYA 2WM9A 2BG9A 4PFPA 4FI5A 3AE2A 4UIGA 2BS4A 1O3XA 2YDSA 2JPFA 4X64T 2VKOA 4AQFC 2K5BB 5TAOA 1WRDA 4HGAA 3AE1A 2LKGA 1ZV4X 5L47A 3NBXX 2H89A 3WTMA 4ZHQE 4LF9T 2ZM6T 1KF6A 3AA0B 3HR0A 2UUCT 2X9XA 2WAUA 3BQKA 4X66T 3GN5B 3VR8A 4TWDA 3RF1A 3JAEA 4YY3T 3O4XE 4X1YE 4ANJA 2MYSA 2V1DB 4I55E 5LB7B 3ZPOA 2BVLA 2C5IT 2V6XA 4GKJT 4KX6A 1KEYA 5CB4E 1MMGA 2G0UA 4U74A 4CN6A 2DWKA 3SOLA 2XAGB 4YT0A 1SUMB 3PUSA 5L4EA 1T7SA 2IC6A 2L3LA 3W15B 4MALA 1HX1B 1NEKA 2X9WA 4NZBA 4JI2T 3HKDE 4DBRA 4H9NC 3QC9A 3TLSA 2Y6XA 2ODUA 2A72A 2Y56A 2ACZA 5BRXA 4G2AA 4EEDA 1FMVA 3UU8A 1VRBA 4TV9E 4PJMA 4CZZB 5FJVA 3PUQA 3C50A 5AQGB 5L4HA 2NW8A 3P4PA 4EZHA 2YOEA 4CXWA 1G73A 5IHYA 2WMOA 4JV5T 4DBMA 3ABVA 4TX5A 4UM3S 2XAFB 3GMIA 3P4QA 3U8MA 4PFOA 2CEAA 3FB2A 4AISA 5AFUL 2DNXA 2XQAA 4DMWA 2WB5A 2XYSA 2D2SA 3VU7H 3X1DA 1BR1A 5CA1E 3AAAB 3PMZA 3DTOA 1D1AA 2WBLA 4UV8B 1UGOA 4P1NA 2JRKA 3ZSTA 1HNZT 3ZC1A 1J1JA 4J2CA 4YHJA 4ASKA 3C51A 3F57A 2LRLA 3BQLA 3PU8A 5TVCA 5LYJE 3WTHA 1X79A 4ILAA 1BR2A 3WTLA 1XMQT 2IHR1 3UU3A 3ZMZB 2W00A 3AB3B 4H63V 2Q9QD 1ZHCA 4DNDA 2H3RA 3C64A 2IUBA 5LA6E 3ZJ2A 2QVAA 4X5TA 4YLHA 5L3DB 2WZHA 5HCJA 2WZIA 4DV1T 5GONE 2RA1A 3FBZA 3A8YC 2BG9C 3U8JA 2ODVA 1LRZA 2ZM0A 1QSDA 3CKDA 2XJ7A 3SS1A 4PJLA 3MA9A 3ZJ1A 1XZYA 2XYTA 3JAFA 2A9UA 3AA1B 4K0UA 5BR8T 3OTOT 4LMLA 2KZ7B 3UUNA 3RI5A 2ZLYA 3I9WA 3PUAA 5IWAT 1DU2A 3IA3A 4ZR6A 3AEBA 2J47A 1BR0A 2XQ7A 5A1LA 4FRRA 4ZJSA 1SA0E 2YEVC 2KWHA 2XQ5A 2NTYA 2PGZA 5AFMB 3PU3A 4P0BA 1IBKT 3ZT6A 1WFDA 5HXSA 4L0RA 4EOZB 4JI8T 5AQUB 4EZ1A 4HWIB 3O1IA 3Q2MA 3U3IA 4IE5A 4EAHA 1GQEA 4B3TT 2JQ9A 4ERRA 1OEDA 4HQPA 4D01A 2VL8A 2CBJA 3O9XA 3RKOA 2CBIA 4EIWA 2VASA 3PJAJ 4ZI2C 4H9RC 2QGSA 2UXDT 1W0AA 4KMCA 1HG2A 2XPKA 2CHOA 4X65T 3RQWA 4ILCA 5F8PA 1KNZA 1WCRA 4V1Av 2BYNA 2JQQA 2KNDA 1OEDE 4NXMT 3A7MA 4JI7T 5ABFB 4DUZT 2W63A 3P8CD 5LXBA 3RH3A 2X9YA 3EHZA 3FBLA 3K3NA 3KINB 4CI2B 3UUXB 1VCSA 1YW0A 1Y64B 2N9DA 3PUVF 2HPJA 3AVRA 1XDOA 5L3CB 2LHRA 4IIJE 4YSYA 5JDHA 5AFHA 1YXRA 5BP0A 2BKOA 1HF8A 2Y48B 5J5GA 4IT4A 5AQPB 4DV2T 2WCAA 4IE6A 2RP4A 4ZK4A 4HWFA 5FKYA 5J5HA 3BK9A 4DV6T 4CXXA 3RRCA 1CHUA 4BJMA 1I6ZA 5L2LA 2LSIA 2W66A 3PV0F 4M1PA 4MHCA 2BYRA 2CM0A 5LHHB 4FJOA 2YU1A 2VQET 4WNKA 3RX6A 2D0TA 1NAFA 3LK2B 4JI6T 5FXZA 3HI2A 2E8IA 2OLTA 4UXUA 2XAJB 1I9BA 4HTEA 2V7JA 3I9YA 4B5DA 5AQOB 3ONJA 2X0LB 3N2KE 3SIOA 2LEHA 5J2UE 1MIVA 4HFCA 2C5KT 2L9QA 4ZS2A 2DI4A 4UM3P 3TKLB 1MNEA 1J5ET 4DR2T 4U2ZA 1LKXA 4PK5A 2J4GA 3AEGA 4IDZA 4EV6A 2NTXA 4TUYE 3K3QC 2J1DG 3RIAA 2CA5A 5BMVE 3UQ4A 5FYMA 1N33T 3L3PA 2YDQA 4K0KT 2E2AA 4E7SA 3CX7B 3GN5A 5J5IA 2PBIA 3HA4A 4DR4T 2EHOB 2E9XA 3CQXC 3CMLA 2N1GA 3SFDA 4LFBT 5JRCB 4O4HE 4UV9B 5LP6E 4QH4A 4ADZA 2M6BA 5JDQA 1UX2A 3I0QA 3CK6A 2LSJA 2A2FX 4QWNB 3VRAA 3H3MA 4ZK1A 5CFBA 3ZEFB 2LM2A 3N9NA 1FJGT 1R8IA 2BG9B 5AQNB 1N34T 2XAQB 2XNTA 3RPUA 5HXCA 2ZJVA 2LOSA 3PDYA 4WV9A 2FJBA 2LJLA 2CXDA 2PG8A 5C2TA 4AQFA 4AFGA 3VKGA 4HFIA 5JR9A 1NWMX 1S94A 1UURA 2IIUA 5HXEA 3PJAA 2LLYA 1YQ4A 3N9MA 2D0UA 2VKJA 4IGUA 3MK7C 2LSKA 3FZKB 5LJMA 4UVAB 1G8XA 1UCUA 2WY2A 2YKSA 4JEHB 2XZ5A 3ZDHA 2NOXA 3AE5A 1V9DA 2MAWA 4PJNA 4QAAA 5F3JA 1XDPA 3CIRA 5JMEA 4LF7T 3UT5E 1WR6A 4BJNA 3EVYA 3SQ9A 4MFRA 5FXXA 4U31A 3V5UA 2ZM2A 3ZCIA 2OV9A 4UVCB 3RGLA 1UX4A 1JNRA 4X1IE 2JIWA 5L3EB 2EHOD 5ADXL 4YTPA 5KZUA 3WAKA 4YTMA 2LRKA 3ZC0A 2GK9A 3T8OA 2LM9A 3QNUA 2OA5A 4XK9A 1Z0PA 3NKZA 2X0YA 3GUAA 2X00D 2K9AA 2ZM8A 1E2AA 3E08A 1YD8G 3UFEA 3RHWA 1WYBA 5FVLA 2MOZA 4ISSA 4I4TE 4I50E 3RC3A 3ZKRA 2IMLA 2VB6A 4HN9A 1HNXT 1W0BA 3UU6A 4IL4A 3LBXB 2W8GA 3UFGA 1IAPA 5EK3A 3OPCA 4JI3T 3RIUA 3PE0A 2XAHB 2FJEA 4A97A 4OYJA 2UUBT 3D0TA 4EYUA 3TLUA 2XUEA 2AE9A 2H7VC 5CJ5A 2UXNB 3AE4A 4IDPA 2UXCT 3ETUA 4AFHA 5JDFA 5KXJA 3Q5WA 3FHNA 3FXEB 5HXHA 2CRBA 3T1YT 4B3MT 3KDSE 3AA6B 5CA0E 4AQGA 4AXPA 3EAMA 2BYPA 3RC8A 4DV7T 3CX6B 5JVDE 4HKAA 3VR9A 3UTKA 4ZOLE 1XMOT 4AI6A 2P9BA 2UUAT 3NZPA 4YFSA 5AQHB 4GOUA 5FXVA 2KWIB 3EI0A 5H6RB 1T72A 2KLQA 2VVNA 1HNWT 2MBGA 2W8FA 2V7IA 4P0AA 2E9XC 2X66A 5LG4A 2K24A 2XY8B 2YMDA 4DR7T 2HN2A 5ABEA 4JI5T 2V7LA 2WU2A 2W62A 2XZEA 2WNJA 4YTNA 2HH7A 1WLXA 4HE8A 4LMJA 4ILBA 5L3FB 4DR6T 3UQ7A 4B3RT 3PURA 2YN6A 5LOVE 1VOMA 4BAYB 2VKDA 2BYQA 4UY2A 2V5DA 5JREA 3AXJA 5J2TE 2XHEB 2ZMAA 2F4VT 2WNCA 4YJ2E 4PK6A 4QHOA 2WS3A 1IJ5A 1LVKA 3VKHA 2LT3A 2VVSA 4IREA 2KSRA 1HTJF 2XQ6A 4ZZCA 4ILUA 1OEDB 3LDQB 2Y54A 4GKKT 2FJAA 3FZLB 2Q9QB 2FJDA 3RYCE 2E5VA 2V6YB 2RPAA 4L5GA 2XQ9A 3L8RA 3LBXA 1FEWA 3M3ZB 4QX7B 2CLYB 4KBMB 4CXYA 4U3CA 2PH9A 2WSSV 5DQWA 4AKIA 3AEFA 5LXTE 1ZOYA 2C5JA 4OK0A 3AEDA 3OJAA 4PIRA 4U33A 4LFCT 1X9BA 3MZKB 1L0VA 2BS3A 2LSYA 1MMAA 3K8PC 2X9HA 4AIUA 2WQYA 2W0GA 2H88A 3WTNA 3P4WA 5KX5E 3TLVA 4DMVA 4MBQA 4GYSA 4UR9A 4HWCA 2BBHA 3SFEA 2CXFA 1HR0T 2L8KA 3ETVA 4DV3T 5HCMA 4YHHT 2LOPA 3U78A 3RLFF 5EK2A 3FZFB 1U5PA 1WR0A 3TLTA 4GIWA 1U4QA 2YINA 2KINB 2LE8A 3EABA 3FZMB 1EZ3A 3L09A 3KV9A 4DV0T 5AQVB 4PW8A 3KBUA 5HWYA 4NUVA 5AQSB 4AKRB 2Z6EA 3EUHA 3UUMA 1W9RA 2XNVA 4OYKA 3N9LA 5DJQC 5C8YE 3WTJA 3ZT7A 4QX8B 4H9OC 2B76A 4MLKA 5FP3A 3ZMVB 4BFQA 3KV5A 4B3ST 3U8LA 1FMWA 3Q5XA 3RYIE 3SRZA 4NPPA 2KT9A 2VQFT 4IDOA 4WZXA 4UM1A 3WAJA 2NWBA 2HHHT 2ACXA 2WP9A 2DWGA 1XWMA 5AQFB 1W09A 1D0YA 2XM1A 2XSBA 3H3AA 5AQIB 4U7IA 2HPLA 3N9QA 4UF0B 4O8SA 3OVUA 3PUZF 1YKEB 3RYFE 4HFEA 5FY0A 4JYAT 3CPZA 4WBOA 1VCTA 4UM3A 5AFLA 5LGTB 1MMDA 3SH1A 4YSXA 4EGWA 5FNVE 4QXHB 4F6RC 4DR3T 4CN1A 5LG3A 2CHNA 3U8KA 3WTKA 2QYWA 3AAEB 5LMNT 4ZS3A 5FXWA 3V5SA 2X0HA 3ESLA 2EHOC 4DV5T 5HEHA 2WU5A 2D5UA 3ANWB 5LGUB 2V7MA 4AKHA 3ZSSA 4H9PC 4GK5E 2FBWA 3P4SA 1IBLT 5DQVA 5LBMA 5AFKA 4DBQA 4P09A 3IGQA 2X51A 4HFDA 4NIQA 3UUBA 4JI4T 3WIPA 3J7Yq 3PUWF 1ZKEA 3Q9DA 2N2NA 5FY1A 3Q5DA 1OXZA 4AKGA 4O2BE 3AVSA 5LHIB 4UVBB 4XAXB 2YDRA 2XNUA 2UU9T 4LMKA 5FVKA 2E5LT 1M62A 1YKHB 4H9QC 5LNKA 3ZYMA 3MACA 4JI0T 4DR5T 3C4XA 2I59A 5HYAA 1MIYA 3JC6D 4LF6T 1I94T 1YQ3A 3RRWA 2WDRA 4ZI3C 3ZYLA 5HAXA 4O4JE 4LF8T 4ZI3D 2WWVA 1NENA 2XQ3A 3CWZB 1KK7A 2WNLA 2V8SV 3KV4A 2CLYC 5LBQB 4I43B 2UZ6A 3HL6A 1AJ3A 2XQYA 2BR7A 2WN9A 2X00A 3EDVA 2JJ9A 3NRXA 4JBWF 4NXNT 3BQIA 3QB5K 3K1SA 4DIDB 3N5LA 2V6YA 3AXJB 4ZJTA 4C91A 4WBNE 3B13A 5LGNB 3GA8A 4ISTA 2X67A 5E0OA 2Y8DA 1D0XA 3AE7A 3OBVE 4Z8XA 2YK0A 3JCFA 3AE8A 5JDLA 2WDVA 1MNDA 1Y01A 3LG7A 4ZZBA 2V26A 3H37A 5JR9B 4EEBA 4ALXA 3ZMSB 3HKBE 2ZJUA 4KUMB 3Q5EA 3KVAA 4TV8E 2DHRA 2NW7A 2KXPB 4JEUB 5SYOA 2CWYA 2XQ8A 2B1EA 3RQUA 1E1HB 3IHRA 3C84A 1D1CA 3PUXF 5AFNA 3PTRB 3VHLA 3SWHA 2H7OA 5JQGE 4XBFB 5H6QB 4CQIA 2V5CA 1Z8UA 5BW2A 1B7TA 3UU4A 4TNWA 5FL0A 3O1JA 3LFMA 3ANWA 4HFVA 2YMEA 1FIOA 1HFAA 2FUPA 3KFWX 2WMNA 3RKGA 4E7ZA 4QABA 5EK4A 2R6GF 4QXCB 4O4IE 4U2YA 5JDGA 2A3DA 5J5FA 3ZLIA 3IBPA 3E0ZA 4Q25A 3N9OA 4B6XA 4H9SE 2BVMA 1OEDC 2XTLA 5AFJA 3ZN0B 4PJJA 2Y58A 4WW0A 3ONLC 2W4XA 2M67A 2WWUA 3M65A 2W67A 1KNRA 5FL1A 3K3OA 3B57A 4HEAA 3RIUC 1UV6A 5HXRA 2HN1A 3AE9A 4IE0A 1M7KA 4TNVA 5JDMA 3NRYA 3AEEA 3C79A 3EDUA 3TLWA 4IDQA 4XHEA 3AE6A 4X62T 1ZEEA 2Y7YA 3QB5A 4AFTA 3AE3A 4X1KE 4GYRA 3G06A 1D0ZA 3AA7B 3QOFA 2BYSA 2CWOA 4QACA 4ZI7E 3N2GE 4A5XA 2VWAA 1SHZC 2JMHA 1US7B 2ES0A 3AEAA 5AQQB 3DJBA 2QA7A 5AQMB 2QRXA 4U7YA 2M6IA 2IW5B 1MIWA 4NUUA 2QC1B 2C0SA 3ZN1B 5AQJB 3S4UA 4JLEA 1UW6A 3R84B 3AECA 1HS7A 3P50A 2BG9E 3CX8B 3ZDGA 3RYHE 3J9X1 5LMUT 2NR4A 2LSGA 3DP7A 3WTOA 1N36T 5KE4A 1IBMT 3KV6A 1HG5A 2SPCA 4I0UA 2DCFA 5LHGB 1UUSA 5JH7E 2DL1A 3O1HA 3CQCB 4EXTA 4AKLA 5ABFA 1JNZA 4KI0F 2C9TA 3T1HT 3JADA 2JQKA 1XNQT 3ZYKA 2BKNA 4A56A 5FMNA 5HEOA 2PFVA 4CI1B 1T8BA 2AXDS 4WYVA 5C3JA 2YU2A 3AAIA 2I0MA 3U8NA 4N78D 2CPTA 3MKDA 2I6HA 5CO5A 3I0OA 4OX9T 4PNIA 2Q9QA 3ZCJA 3OKQA 3HKCE 4Z90A 3WI3A 4CN4A 2V7KA 2DLRA 5J1GA 4DVDA 3IEEA 3N9PA 5L3GB 4UXNB 3NVOA 3MXZA 4L9IA 3PEOA 2BBJA 3FXDB 3RIFA 3F2EA 5J0ZA 5ABGA 1E7PA 1UK5A 2LHNA 3ZMTB 4LFAT 3MJXA 5AQLB 4LF5T 2XM2A 4TWFA 4XZCA 5AFMA 4BQTA 5KMGP 2PJQA 4A98A 4JUYA 2X68A 4PAGA 4IE4A 3R6NA 1XNRT 3LSVA 3E22E 4O4LE 4ZEYA 3A5XA 1N32T 2Y57A 4ZI2D 4DO0A 5HEUA 2WDQA 2IAKA 4U72A 5HWXA 2UXBT 2LKHA 5AQRB 4DR1T 2E9XD 4Z91A 2KMFA 2BS2A 5IUXA 3HKEE 4O2AE 2K3WA 3QK6A 5IYZE 2UXXB 5JDNA 4YJ3E 4DUYT 4F8HA 5M4YA 5KDMC 1CUNA 2VURA 4JI1T 5DABA 4BA9A 5ETWA 5LCYA 3PUYF 2MTQA 5AQKB 3OYXA 2Q9QC 3QUJA 2JMKA 2CCQA 3ZMUB 4AQYT 3B5MA 3WTIA 1KNPA 4IDNA 1IJ6A 4QH5A 4OHFA 5JTGA 5EZYE 5AINA 5HEGA 3LK3B 4LF4T 2IDOB 5F5WA 1BR4A 2PTFA 4IL9A 4X20E 1ZP0A 2BR8A 4HWHA 4GK0E 3GWHA 4G63A 4CI3B 4EB6E 3P7IA 5CGMA 4UF0A 4ZRUA 5L3BB 4UEMA 2D9DA 4H63H 2J62A 4OFZA 2VK9A 1MMNA 2W2UA 2BJ0A 3CVRA 2CE7A 3PUGA 1LVFA 1QLBA 1OWAA 4EZ4A 1SE7A 4HWDA 4EYYR 4KP3C 2EHOA 4YXDA 2XSAA
chains in the Genus database with same CATH topology
2XNTA 2YN6A 4QH1A 2Y56A 2ZJVA 4Z91A 2BYQA 4UY2A 4WV9A 4TNVA 5HEOA 5IUXA 5SYOA 3UU6A 5BRXA 4COFA 3C79A 4X5TA 4IL4A 3TLWA 4UM3A 2W8GA 3UU8A 5HCMA 5AFLA 4HFHA 2XQ8A 4XHEA 4F8HA 4AFGA 3U8NA 2Y7YA 4HFIA 5HCJA 3SH1A 4AFTA 5FJVA 4UXUA 2WNCA 3RQUA 1I9BA 3C84A 3TLTA 2LLYA 4A97A 2LKGA 5CO5A 5L4HA 5AFNA 3RQWA 2BYSA 5LG3A 3UU5A 2BG9C 5L47A 4ILCA 4QACA 3U8JA 3U8KA 3WTKA 4B5DA 3TLUA 2YOEA 3WTMA 4Z90A 4DBMA 2BYNA 3SIOA 4UM3S 1OEDE 2YKSA 2XZ5A 2XQ3A 2XZ6A 3ZDHA 5BW2A 2WNLA 2XQ4A 4IREA 5LXBA 3U8MA 3UU4A 4TNWA 2KSRA 4HFCA 2XYTA 2MAWA 3JAFA 3WTIA 3EHZA 4AFHA 4QAAA 2XQ6A 4ZZCA 4QH5A 5HEHA 4LMLA 4TWDA 2M6IA 2UZ6A 3PEOA 2XQAA 1OEDB 3JAEA 4UM3P 2QC1B 5AINA 5JMEA 5HEJA 5HEGA 3RI5A 2XNVA 3WTJA 3RIFA 2YMEA 2BR7A 1UW6A 5J0ZA 2WN9A 2XYSA 2Y54A 2X00A 3PMZA 3RIAA 4ZR6A 3P50A 3SQ9A 2BG9E 3EAMA 2BYPA 3ZDGA 4QABA 4HFBA 2XQ7A 3UQ4A 3T4MA 4BFQA 5AFHA 4IL9A 3U8LA 5BP0A 4FRRA 5J5GA 2XQ9A 4ZJSA 4NPPA 4ZJTA 3SQ6A 2BR8A 3WTOA 2PH9A 2XQ5A 5AFKA 2PGZA 5KE4A 4UM1A 5J5FA 5TVCA 4TWFA 5KZUA 3IGQA 5J5IA 4ZRUA 4ZK4A 3WTHA 5J5HA 4HFDA 4ILAA 5AFMB 3WTLA 3UUBA 5L4EA 5AFMA 4BQTA 4PIRA 3EI0A 3WIPA 4XK9A 4A98A 4TWHA 1OEDC 3UU3A 3GUAA 5AFJA 2X00D 4EZ1A 4QH4A 2BJ0A 2W8FA 2M6BA 1UX2A 4ZZBA 2YMDA 3LSVA 2VL0A 2Y58A 3RHWA 2C9TA 2Y57A 2BYRA 3JADA 2WNJA 4NZBA 5HEUA 4ZK1A 1OEDA 4HQPA 4ALXA 5CFBA 4D01A 2ZJUA 3WTNA 4LMJA 3P4WA 4ILBA 2LM2A 1UV6A 2WZYA 3TLVA 3TLSA 3UQ7A 2XNUA 4HFEA 2BG9B 3ZKRA 2BG9A 4LMKA 2LKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNT A;  2YN6 A;  4QH1 A;  2Y56 A;  2ZJV A;  4Z91 A;  2BYQ A;  4UY2 A;  4WV9 A;  4TNV A;  5HEO A;  5IUX A;  5SYO A;  3UU6 A;  5BRX A;  4COF A;  3C79 A;  4X5T A;  4IL4 A;  3TLW A;  4UM3 A;  2W8G A;  3UU8 A;  5HCM A;  5AFL A;  4HFH A;  2XQ8 A;  4XHE A;  4F8H A;  4AFG A;  3U8N A;  2Y7Y A;  4HFI A;  5HCJ A;  3SH1 A;  4AFT A;  5FJV A;  4UXU A;  2WNC A;  3RQU A;  1I9B A;  3C84 A;  3TLT A;  2LLY A;  4A97 A;  2LKG A;  5CO5 A;  5L4H A;  5AFN A;  3RQW A;  2BYS A;  5LG3 A;  3UU5 A;  2BG9 C;  5L47 A;  4ILC A;  4QAC A;  3U8J A;  3U8K A;  3WTK A;  4B5D A;  3TLU A;  2YOE A;  3WTM A;  4Z90 A;  4DBM A;  2BYN A;  3SIO A;  4UM3 S;  1OED E;  2YKS A;  2XZ5 A;  2XQ3 A;  2XZ6 A;  3ZDH A;  5BW2 A;  2WNL A;  2XQ4 A;  4IRE A;  5LXB A;  3U8M A;  3UU4 A;  4TNW A;  2KSR A;  4HFC A;  2XYT A;  2MAW A;  3JAF A;  3WTI A;  3EHZ A;  4AFH A;  4QAA A;  2XQ6 A;  4ZZC A;  4QH5 A;  5HEH A;  4LML A;  4TWD A;  2M6I A;  2UZ6 A;  3PEO A;  2XQA A;  1OED B;  3JAE A;  4UM3 P;  2QC1 B;  5AIN A;  5JME A;  5HEJ A;  5HEG A;  3RI5 A;  2XNV A;  3WTJ A;  3RIF A;  2YME A;  2BR7 A;  1UW6 A;  5J0Z A;  2WN9 A;  2XYS A;  2Y54 A;  2X00 A;  3PMZ A;  3RIA A;  4ZR6 A;  3P50 A;  3SQ9 A;  2BG9 E;  3EAM A;  2BYP A;  3ZDG A;  4QAB A;  4HFB A;  2XQ7 A;  3UQ4 A;  3T4M A;  4BFQ A;  5AFH A;  4IL9 A;  3U8L A;  5BP0 A;  4FRR A;  5J5G A;  2XQ9 A;  4ZJS A;  4NPP A;  4ZJT A;  3SQ6 A;  2BR8 A;  3WTO A;  2PH9 A;  2XQ5 A;  5AFK A;  2PGZ A;  5KE4 A;  4UM1 A;  5J5F A;  5TVC A;  4TWF A;  5KZU A;  3IGQ A;  5J5I A;  4ZRU A;  4ZK4 A;  3WTH A;  5J5H A;  4HFD A;  4ILA A;  5AFM B;  3WTL A;  3UUB A;  5L4E A;  5AFM A;  4BQT A;  4PIR A;  3EI0 A;  3WIP A;  4XK9 A;  4A98 A;  4TWH A;  1OED C;  3UU3 A;  3GUA A;  5AFJ A;  2X00 D;  4EZ1 A;  4QH4 A;  2BJ0 A;  2W8F A;  2M6B A;  1UX2 A;  4ZZB A;  2YMD A;  3LSV A;  2VL0 A;  2Y58 A;  3RHW A;  2C9T A;  2Y57 A;  2BYR A;  3JAD A;  2WNJ A;  4NZB A;  5HEU A;  4ZK1 A;  1OED A;  4HQP A;  4ALX A;  5CFB A;  4D01 A;  2ZJU A;  3WTN A;  4LMJ A;  3P4W A;  4ILB A;  2LM2 A;  1UV6 A;  2WZY A;  3TLV A;  3TLS A;  3UQ7 A;  2XNU A;  4HFE A;  2BG9 B;  3ZKR A;  2BG9 A;  4LMK A;  2LKH A; 
#chains in the Genus database with same CATH topology
 3LJC A;  4QH1 A;  5JRC A;  3LK4 2;  1J5W A;  4COF A;  2BDE A;  3F31 A;  1H7C A;  4HFH A;  3N2O A;  3FZH B;  3P4R A;  2XAS B;  1KFY A;  4TZ4 C;  4IHJ E;  4YSZ A;  1S35 A;  2NW9 A;  3UU5 A;  3ZT5 A;  3VRB A;  2BZB A;  2XZ6 A;  2XQ4 A;  2VKH A;  4QKN A;  4KHP T;  3KBT A;  3NWI A;  3OYZ A;  4TN7 B;  5HEJ A;  2E9X B;  3CQG B;  3KVB A;  1HX8 A;  4DV4 T;  3C98 B;  3UUL A;  5LJN A;  1UX5 A;  1IZN B;  4IE7 A;  5JR9 C;  4HFB A;  3T4M A;  2JQH A;  3ONX A;  5ABH A;  3SQ6 A;  4ZXL A;  3I1A A;  2IC9 A;  2MPK A;  3C4W A;  1WYC A;  2W61 A;  4KHZ F;  4PK4 A;  3C4Z A;  4TWH A;  4C90 A;  3JC6 C;  4UEL A;  1QUU A;  1T98 A;  3L39 A;  1HCI A;  3IF8 B;  2BKP A;  2VL0 A;  2CXL A;  2CMR A;  5AQT B;  3NZQ A;  5FY7 A;  2NP9 A;  2K48 A;  1D1B A;  4QXB B;  2WZY A;  2WM9 A;  2BG9 A;  4PFP A;  4FI5 A;  3AE2 A;  4UIG A;  2BS4 A;  1O3X A;  2YDS A;  2JPF A;  4X64 T;  2VKO A;  4AQF C;  2K5B B;  5TAO A;  1WRD A;  4HGA A;  3AE1 A;  2LKG A;  1ZV4 X;  5L47 A;  3NBX X;  2H89 A;  3WTM A;  4ZHQ E;  4LF9 T;  2ZM6 T;  1KF6 A;  3AA0 B;  3HR0 A;  2UUC T;  2X9X A;  2WAU A;  3BQK A;  4X66 T;  3GN5 B;  3VR8 A;  4TWD A;  3RF1 A;  3JAE A;  4YY3 T;  3O4X E;  4X1Y E;  4ANJ A;  2MYS A;  2V1D B;  4I55 E;  5LB7 B;  3ZPO A;  2BVL A;  2C5I T;  2V6X A;  4GKJ T;  4KX6 A;  1KEY A;  5CB4 E;  1MMG A;  2G0U A;  4U74 A;  4CN6 A;  2DWK A;  3SOL A;  2XAG B;  4YT0 A;  1SUM B;  3PUS A;  5L4E A;  1T7S A;  2IC6 A;  2L3L A;  3W15 B;  4MAL A;  1HX1 B;  1NEK A;  2X9W A;  4NZB A;  4JI2 T;  3HKD E;  4DBR A;  4H9N C;  3QC9 A;  3TLS A;  2Y6X A;  2ODU A;  2A72 A;  2Y56 A;  2ACZ A;  5BRX A;  4G2A A;  4EED A;  1FMV A;  3UU8 A;  1VRB A;  4TV9 E;  4PJM A;  4CZZ B;  5FJV A;  3PUQ A;  3C50 A;  5AQG B;  5L4H A;  2NW8 A;  3P4P A;  4EZH A;  2YOE A;  4CXW A;  1G73 A;  5IHY A;  2WMO A;  4JV5 T;  4DBM A;  3ABV A;  4TX5 A;  4UM3 S;  2XAF B;  3GMI A;  3P4Q A;  3U8M A;  4PFO A;  2CEA A;  3FB2 A;  4AIS A;  5AFU L;  2DNX A;  2XQA A;  4DMW A;  2WB5 A;  2XYS A;  2D2S A;  3VU7 H;  3X1D A;  1BR1 A;  5CA1 E;  3AAA B;  3PMZ A;  3DTO A;  1D1A A;  2WBL A;  4UV8 B;  1UGO A;  4P1N A;  2JRK A;  3ZST A;  1HNZ T;  3ZC1 A;  1J1J A;  4J2C A;  4YHJ A;  4ASK A;  3C51 A;  3F57 A;  2LRL A;  3BQL A;  3PU8 A;  5TVC A;  5LYJ E;  3WTH A;  1X79 A;  4ILA A;  1BR2 A;  3WTL A;  1XMQ T;  2IHR 1;  3UU3 A;  3ZMZ B;  2W00 A;  3AB3 B;  4H63 V;  2Q9Q D;  1ZHC A;  4DND A;  2H3R A;  3C64 A;  2IUB A;  5LA6 E;  3ZJ2 A;  2QVA A;  4X5T A;  4YLH A;  5L3D B;  2WZH A;  5HCJ A;  2WZI A;  4DV1 T;  5GON E;  2RA1 A;  3FBZ A;  3A8Y C;  2BG9 C;  3U8J A;  2ODV A;  1LRZ A;  2ZM0 A;  1QSD A;  3CKD A;  2XJ7 A;  3SS1 A;  4PJL A;  3MA9 A;  3ZJ1 A;  1XZY A;  2XYT A;  3JAF A;  2A9U A;  3AA1 B;  4K0U A;  5BR8 T;  3OTO T;  4LML A;  2KZ7 B;  3UUN A;  3RI5 A;  2ZLY A;  3I9W A;  3PUA A;  5IWA T;  1DU2 A;  3IA3 A;  4ZR6 A;  3AEB A;  2J47 A;  1BR0 A;  2XQ7 A;  5A1L A;  4FRR A;  4ZJS A;  1SA0 E;  2YEV C;  2KWH A;  2XQ5 A;  2NTY A;  2PGZ A;  5AFM B;  3PU3 A;  4P0B A;  1IBK T;  3ZT6 A;  1WFD A;  5HXS A;  4L0R A;  4EOZ B;  4JI8 T;  5AQU B;  4EZ1 A;  4HWI B;  3O1I A;  3Q2M A;  3U3I A;  4IE5 A;  4EAH A;  1GQE A;  4B3T T;  2JQ9 A;  4ERR A;  1OED A;  4HQP A;  4D01 A;  2VL8 A;  2CBJ A;  3O9X A;  3RKO A;  2CBI A;  4EIW A;  2VAS A;  3PJA J;  4ZI2 C;  4H9R C;  2QGS A;  2UXD T;  1W0A A;  4KMC A;  1HG2 A;  2XPK A;  2CHO A;  4X65 T;  3RQW A;  4ILC A;  5F8P A;  1KNZ A;  1WCR A;  4V1A v;  2BYN A;  2JQQ A;  2KND A;  1OED E;  4NXM T;  3A7M A;  4JI7 T;  5ABF B;  4DUZ T;  2W63 A;  3P8C D;  5LXB A;  3RH3 A;  2X9Y A;  3EHZ A;  3FBL A;  3K3N A;  3KIN B;  4CI2 B;  3UUX B;  1VCS A;  1YW0 A;  1Y64 B;  2N9D A;  3PUV F;  2HPJ A;  3AVR A;  1XDO A;  5L3C B;  2LHR A;  4IIJ E;  4YSY A;  5JDH A;  5AFH A;  1YXR A;  5BP0 A;  2BKO A;  1HF8 A;  2Y48 B;  5J5G A;  4IT4 A;  5AQP B;  4DV2 T;  2WCA A;  4IE6 A;  2RP4 A;  4ZK4 A;  4HWF A;  5FKY A;  5J5H A;  3BK9 A;  4DV6 T;  4CXX A;  3RRC A;  1CHU A;  4BJM A;  1I6Z A;  5L2L A;  2LSI A;  2W66 A;  3PV0 F;  4M1P A;  4MHC A;  2BYR A;  2CM0 A;  5LHH B;  4FJO A;  2YU1 A;  2VQE T;  4WNK A;  3RX6 A;  2D0T A;  1NAF A;  3LK2 B;  4JI6 T;  5FXZ A;  3HI2 A;  2E8I A;  2OLT A;  4UXU A;  2XAJ B;  1I9B A;  4HTE A;  2V7J A;  3I9Y A;  4B5D A;  5AQO B;  3ONJ A;  2X0L B;  3N2K E;  3SIO A;  2LEH A;  5J2U E;  1MIV A;  4HFC A;  2C5K T;  2L9Q A;  4ZS2 A;  2DI4 A;  4UM3 P;  3TKL B;  1MNE A;  1J5E T;  4DR2 T;  4U2Z A;  1LKX A;  4PK5 A;  2J4G A;  3AEG A;  4IDZ A;  4EV6 A;  2NTX A;  4TUY E;  3K3Q C;  2J1D G;  3RIA A;  2CA5 A;  5BMV E;  3UQ4 A;  5FYM A;  1N33 T;  3L3P A;  2YDQ A;  4K0K T;  2E2A A;  4E7S A;  3CX7 B;  3GN5 A;  5J5I A;  2PBI A;  3HA4 A;  4DR4 T;  2EHO B;  2E9X A;  3CQX C;  3CML A;  2N1G A;  3SFD A;  4LFB T;  5JRC B;  4O4H E;  4UV9 B;  5LP6 E;  4QH4 A;  4ADZ A;  2M6B A;  5JDQ A;  1UX2 A;  3I0Q A;  3CK6 A;  2LSJ A;  2A2F X;  4QWN B;  3VRA A;  3H3M A;  4ZK1 A;  5CFB A;  3ZEF B;  2LM2 A;  3N9N A;  1FJG T;  1R8I A;  2BG9 B;  5AQN B;  1N34 T;  2XAQ B;  2XNT A;  3RPU A;  5HXC A;  2ZJV A;  2LOS A;  3PDY A;  4WV9 A;  2FJB A;  2LJL A;  2CXD A;  2PG8 A;  5C2T A;  4AQF A;  4AFG A;  3VKG A;  4HFI A;  5JR9 A;  1NWM X;  1S94 A;  1UUR A;  2IIU A;  5HXE A;  3PJA A;  2LLY A;  1YQ4 A;  3N9M A;  2D0U A;  2VKJ A;  4IGU A;  3MK7 C;  2LSK A;  3FZK B;  5LJM A;  4UVA B;  1G8X A;  1UCU A;  2WY2 A;  2YKS A;  4JEH B;  2XZ5 A;  3ZDH A;  2NOX A;  3AE5 A;  1V9D A;  2MAW A;  4PJN A;  4QAA A;  5F3J A;  1XDP A;  3CIR A;  5JME A;  4LF7 T;  3UT5 E;  1WR6 A;  4BJN A;  3EVY A;  3SQ9 A;  4MFR A;  5FXX A;  4U31 A;  3V5U A;  2ZM2 A;  3ZCI A;  2OV9 A;  4UVC B;  3RGL A;  1UX4 A;  1JNR A;  4X1I E;  2JIW A;  5L3E B;  2EHO D;  5ADX L;  4YTP A;  5KZU A;  3WAK A;  4YTM A;  2LRK A;  3ZC0 A;  2GK9 A;  3T8O A;  2LM9 A;  3QNU A;  2OA5 A;  4XK9 A;  1Z0P A;  3NKZ A;  2X0Y A;  3GUA A;  2X00 D;  2K9A A;  2ZM8 A;  1E2A A;  3E08 A;  1YD8 G;  3UFE A;  3RHW A;  1WYB A;  5FVL A;  2MOZ A;  4ISS A;  4I4T E;  4I50 E;  3RC3 A;  3ZKR A;  2IML A;  2VB6 A;  4HN9 A;  1HNX T;  1W0B A;  3UU6 A;  4IL4 A;  3LBX B;  2W8G A;  3UFG A;  1IAP A;  5EK3 A;  3OPC A;  4JI3 T;  3RIU A;  3PE0 A;  2XAH B;  2FJE A;  4A97 A;  4OYJ A;  2UUB T;  3D0T A;  4EYU A;  3TLU A;  2XUE A;  2AE9 A;  2H7V C;  5CJ5 A;  2UXN B;  3AE4 A;  4IDP A;  2UXC T;  3ETU A;  4AFH A;  5JDF A;  5KXJ A;  3Q5W A;  3FHN A;  3FXE B;  5HXH A;  2CRB A;  3T1Y T;  4B3M T;  3KDS E;  3AA6 B;  5CA0 E;  4AQG A;  4AXP A;  3EAM A;  2BYP A;  3RC8 A;  4DV7 T;  3CX6 B;  5JVD E;  4HKA A;  3VR9 A;  3UTK A;  4ZOL E;  1XMO T;  4AI6 A;  2P9B A;  2UUA T;  3NZP A;  4YFS A;  5AQH B;  4GOU A;  5FXV A;  2KWI B;  3EI0 A;  5H6R B;  1T72 A;  2KLQ A;  2VVN A;  1HNW T;  2MBG A;  2W8F A;  2V7I A;  4P0A A;  2E9X C;  2X66 A;  5LG4 A;  2K24 A;  2XY8 B;  2YMD A;  4DR7 T;  2HN2 A;  5ABE A;  4JI5 T;  2V7L A;  2WU2 A;  2W62 A;  2XZE A;  2WNJ A;  4YTN A;  2HH7 A;  1WLX A;  4HE8 A;  4LMJ A;  4ILB A;  5L3F B;  4DR6 T;  3UQ7 A;  4B3R T;  3PUR A;  2YN6 A;  5LOV E;  1VOM A;  4BAY B;  2VKD A;  2BYQ A;  4UY2 A;  2V5D A;  5JRE A;  3AXJ A;  5J2T E;  2XHE B;  2ZMA A;  2F4V T;  2WNC A;  4YJ2 E;  4PK6 A;  4QHO A;  2WS3 A;  1IJ5 A;  1LVK A;  3VKH A;  2LT3 A;  2VVS A;  4IRE A;  2KSR A;  1HTJ F;  2XQ6 A;  4ZZC A;  4ILU A;  1OED B;  3LDQ B;  2Y54 A;  4GKK T;  2FJA A;  3FZL B;  2Q9Q B;  2FJD A;  3RYC E;  2E5V A;  2V6Y B;  2RPA A;  4L5G A;  2XQ9 A;  3L8R A;  3LBX A;  1FEW A;  3M3Z B;  4QX7 B;  2CLY B;  4KBM B;  4CXY A;  4U3C A;  2PH9 A;  2WSS V;  5DQW A;  4AKI A;  3AEF A;  5LXT E;  1ZOY A;  2C5J A;  4OK0 A;  3AED A;  3OJA A;  4PIR A;  4U33 A;  4LFC T;  1X9B A;  3MZK B;  1L0V A;  2BS3 A;  2LSY A;  1MMA A;  3K8P C;  2X9H A;  4AIU A;  2WQY A;  2W0G A;  2H88 A;  3WTN A;  3P4W A;  5KX5 E;  3TLV A;  4DMV A;  4MBQ A;  4GYS A;  4UR9 A;  4HWC A;  2BBH A;  3SFE A;  2CXF A;  1HR0 T;  2L8K A;  3ETV A;  4DV3 T;  5HCM A;  4YHH T;  2LOP A;  3U78 A;  3RLF F;  5EK2 A;  3FZF B;  1U5P A;  1WR0 A;  3TLT A;  4GIW A;  1U4Q A;  2YIN A;  2KIN B;  2LE8 A;  3EAB A;  3FZM B;  1EZ3 A;  3L09 A;  3KV9 A;  4DV0 T;  5AQV B;  4PW8 A;  3KBU A;  5HWY A;  4NUV A;  5AQS B;  4AKR B;  2Z6E A;  3EUH A;  3UUM A;  1W9R A;  2XNV A;  4OYK A;  3N9L A;  5DJQ C;  5C8Y E;  3WTJ A;  3ZT7 A;  4QX8 B;  4H9O C;  2B76 A;  4MLK A;  5FP3 A;  3ZMV B;  4BFQ A;  3KV5 A;  4B3S T;  3U8L A;  1FMW A;  3Q5X A;  3RYI E;  3SRZ A;  4NPP A;  2KT9 A;  2VQF T;  4IDO A;  4WZX A;  4UM1 A;  3WAJ A;  2NWB A;  2HHH T;  2ACX A;  2WP9 A;  2DWG A;  1XWM A;  5AQF B;  1W09 A;  1D0Y A;  2XM1 A;  2XSB A;  3H3A A;  5AQI B;  4U7I A;  2HPL A;  3N9Q A;  4UF0 B;  4O8S A;  3OVU A;  3PUZ F;  1YKE B;  3RYF E;  4HFE A;  5FY0 A;  4JYA T;  3CPZ A;  4WBO A;  1VCT A;  4UM3 A;  5AFL A;  5LGT B;  1MMD A;  3SH1 A;  4YSX A;  4EGW A;  5FNV E;  4QXH B;  4F6R C;  4DR3 T;  4CN1 A;  5LG3 A;  2CHN A;  3U8K A;  3WTK A;  2QYW A;  3AAE B;  5LMN T;  4ZS3 A;  5FXW A;  3V5S A;  2X0H A;  3ESL A;  2EHO C;  4DV5 T;  5HEH A;  2WU5 A;  2D5U A;  3ANW B;  5LGU B;  2V7M A;  4AKH A;  3ZSS A;  4H9P C;  4GK5 E;  2FBW A;  3P4S A;  1IBL T;  5DQV A;  5LBM A;  5AFK A;  4DBQ A;  4P09 A;  3IGQ A;  2X51 A;  4HFD A;  4NIQ A;  3UUB A;  4JI4 T;  3WIP A;  3J7Y q;  3PUW F;  1ZKE A;  3Q9D A;  2N2N A;  5FY1 A;  3Q5D A;  1OXZ A;  4AKG A;  4O2B E;  3AVS A;  5LHI B;  4UVB B;  4XAX B;  2YDR A;  2XNU A;  2UU9 T;  4LMK A;  5FVK A;  2E5L T;  1M62 A;  1YKH B;  4H9Q C;  5LNK A;  3ZYM A;  3MAC A;  4JI0 T;  4DR5 T;  3C4X A;  2I59 A;  5HYA A;  1MIY A;  3JC6 D;  4LF6 T;  1I94 T;  1YQ3 A;  3RRW A;  2WDR A;  4ZI3 C;  3ZYL A;  5HAX A;  4O4J E;  4LF8 T;  4ZI3 D;  2WWV A;  1NEN A;  2XQ3 A;  3CWZ B;  1KK7 A;  2WNL A;  2V8S V;  3KV4 A;  2CLY C;  5LBQ B;  4I43 B;  2UZ6 A;  3HL6 A;  1AJ3 A;  2XQY A;  2BR7 A;  2WN9 A;  2X00 A;  3EDV A;  2JJ9 A;  3NRX A;  4JBW F;  4NXN T;  3BQI A;  3QB5 K;  3K1S A;  4DID B;  3N5L A;  2V6Y A;  3AXJ B;  4ZJT A;  4C91 A;  4WBN E;  3B13 A;  5LGN B;  3GA8 A;  4IST A;  2X67 A;  5E0O A;  2Y8D A;  1D0X A;  3AE7 A;  3OBV E;  4Z8X A;  2YK0 A;  3JCF A;  3AE8 A;  5JDL A;  2WDV A;  1MND A;  1Y01 A;  3LG7 A;  4ZZB A;  2V26 A;  3H37 A;  5JR9 B;  4EEB A;  4ALX A;  3ZMS B;  3HKB E;  2ZJU A;  4KUM B;  3Q5E A;  3KVA A;  4TV8 E;  2DHR A;  2NW7 A;  2KXP B;  4JEU B;  5SYO A;  2CWY A;  2XQ8 A;  2B1E A;  3RQU A;  1E1H B;  3IHR A;  3C84 A;  1D1C A;  3PUX F;  5AFN A;  3PTR B;  3VHL A;  3SWH A;  2H7O A;  5JQG E;  4XBF B;  5H6Q B;  4CQI A;  2V5C A;  1Z8U A;  5BW2 A;  1B7T A;  3UU4 A;  4TNW A;  5FL0 A;  3O1J A;  3LFM A;  3ANW A;  4HFV A;  2YME A;  1FIO A;  1HFA A;  2FUP A;  3KFW X;  2WMN A;  3RKG A;  4E7Z A;  4QAB A;  5EK4 A;  2R6G F;  4QXC B;  4O4I E;  4U2Y A;  5JDG A;  2A3D A;  5J5F A;  3ZLI A;  3IBP A;  3E0Z A;  4Q25 A;  3N9O A;  4B6X A;  4H9S E;  2BVM A;  1OED C;  2XTL A;  5AFJ A;  3ZN0 B;  4PJJ A;  2Y58 A;  4WW0 A;  3ONL C;  2W4X A;  2M67 A;  2WWU A;  3M65 A;  2W67 A;  1KNR A;  5FL1 A;  3K3O A;  3B57 A;  4HEA A;  3RIU C;  1UV6 A;  5HXR A;  2HN1 A;  3AE9 A;  4IE0 A;  1M7K A;  4TNV A;  5JDM A;  3NRY A;  3AEE A;  3C79 A;  3EDU A;  3TLW A;  4IDQ A;  4XHE A;  3AE6 A;  4X62 T;  1ZEE A;  2Y7Y A;  3QB5 A;  4AFT A;  3AE3 A;  4X1K E;  4GYR A;  3G06 A;  1D0Z A;  3AA7 B;  3QOF A;  2BYS A;  2CWO A;  4QAC A;  4ZI7 E;  3N2G E;  4A5X A;  2VWA A;  1SHZ C;  2JMH A;  1US7 B;  2ES0 A;  3AEA A;  5AQQ B;  3DJB A;  2QA7 A;  5AQM B;  2QRX A;  4U7Y A;  2M6I A;  2IW5 B;  1MIW A;  4NUU A;  2QC1 B;  2C0S A;  3ZN1 B;  5AQJ B;  3S4U A;  4JLE A;  1UW6 A;  3R84 B;  3AEC A;  1HS7 A;  3P50 A;  2BG9 E;  3CX8 B;  3ZDG A;  3RYH E;  3J9X 1;  5LMU T;  2NR4 A;  2LSG A;  3DP7 A;  3WTO A;  1N36 T;  5KE4 A;  1IBM T;  3KV6 A;  1HG5 A;  2SPC A;  4I0U A;  2DCF A;  5LHG B;  1UUS A;  5JH7 E;  2DL1 A;  3O1H A;  3CQC B;  4EXT A;  4AKL A;  5ABF A;  1JNZ A;  4KI0 F;  2C9T A;  3T1H T;  3JAD A;  2JQK A;  1XNQ T;  3ZYK A;  2BKN A;  4A56 A;  5FMN A;  5HEO A;  2PFV A;  4CI1 B;  1T8B A;  2AXD S;  4WYV A;  5C3J A;  2YU2 A;  3AAI A;  2I0M A;  3U8N A;  4N78 D;  2CPT A;  3MKD A;  2I6H A;  5CO5 A;  3I0O A;  4OX9 T;  4PNI A;  2Q9Q A;  3ZCJ A;  3OKQ A;  3HKC E;  4Z90 A;  3WI3 A;  4CN4 A;  2V7K A;  2DLR A;  5J1G A;  4DVD A;  3IEE A;  3N9P A;  5L3G B;  4UXN B;  3NVO A;  3MXZ A;  4L9I A;  3PEO A;  2BBJ A;  3FXD B;  3RIF A;  3F2E A;  5J0Z A;  5ABG A;  1E7P A;  1UK5 A;  2LHN A;  3ZMT B;  4LFA T;  3MJX A;  5AQL B;  4LF5 T;  2XM2 A;  4TWF A;  4XZC A;  5AFM A;  4BQT A;  5KMG P;  2PJQ A;  4A98 A;  4JUY A;  2X68 A;  4PAG A;  4IE4 A;  3R6N A;  1XNR T;  3LSV A;  3E22 E;  4O4L E;  4ZEY A;  3A5X A;  1N32 T;  2Y57 A;  4ZI2 D;  4DO0 A;  5HEU A;  2WDQ A;  2IAK A;  4U72 A;  5HWX A;  2UXB T;  2LKH A;  5AQR B;  4DR1 T;  2E9X D;  4Z91 A;  2KMF A;  2BS2 A;  5IUX A;  3HKE E;  4O2A E;  2K3W A;  3QK6 A;  5IYZ E;  2UXX B;  5JDN A;  4YJ3 E;  4DUY T;  4F8H A;  5M4Y A;  5KDM C;  1CUN A;  2VUR A;  4JI1 T;  5DAB A;  4BA9 A;  5ETW A;  5LCY A;  3PUY F;  2MTQ A;  5AQK B;  3OYX A;  2Q9Q C;  3QUJ A;  2JMK A;  2CCQ A;  3ZMU B;  4AQY T;  3B5M A;  3WTI A;  1KNP A;  4IDN A;  1IJ6 A;  4QH5 A;  4OHF A;  5JTG A;  5EZY E;  5AIN A;  5HEG A;  3LK3 B;  4LF4 T;  2IDO B;  5F5W A;  1BR4 A;  2PTF A;  4IL9 A;  4X20 E;  1ZP0 A;  2BR8 A;  4HWH A;  4GK0 E;  3GWH A;  4G63 A;  4CI3 B;  4EB6 E;  3P7I A;  5CGM A;  4UF0 A;  4ZRU A;  5L3B B;  4UEM A;  2D9D A;  4H63 H;  2J62 A;  4OFZ A;  2VK9 A;  1MMN A;  2W2U A;  2BJ0 A;  3CVR A;  2CE7 A;  3PUG A;  1LVF A;  1QLB A;  1OWA A;  4EZ4 A;  1SE7 A;  4HWD A;  4EYY R;  4KP3 C;  2EHO A;  4YXD A;  2XSA A; 
#chains in the Genus database with same CATH homology
 2XNT A;  2YN6 A;  4QH1 A;  2Y56 A;  2ZJV A;  4Z91 A;  2BYQ A;  4UY2 A;  4WV9 A;  4TNV A;  5HEO A;  5IUX A;  5SYO A;  3UU6 A;  5BRX A;  4COF A;  3C79 A;  4X5T A;  4IL4 A;  3TLW A;  4UM3 A;  2W8G A;  3UU8 A;  5HCM A;  5AFL A;  4HFH A;  2XQ8 A;  4XHE A;  4F8H A;  4AFG A;  3U8N A;  2Y7Y A;  4HFI A;  5HCJ A;  3SH1 A;  4AFT A;  5FJV A;  4UXU A;  2WNC A;  3RQU A;  1I9B A;  3C84 A;  3TLT A;  2LLY A;  4A97 A;  2LKG A;  5CO5 A;  5L4H A;  5AFN A;  3RQW A;  2BYS A;  5LG3 A;  3UU5 A;  2BG9 C;  5L47 A;  4ILC A;  4QAC A;  3U8J A;  3U8K A;  3WTK A;  4B5D A;  3TLU A;  2YOE A;  3WTM A;  4Z90 A;  4DBM A;  2BYN A;  3SIO A;  4UM3 S;  1OED E;  2YKS A;  2XZ5 A;  2XQ3 A;  2XZ6 A;  3ZDH A;  5BW2 A;  2WNL A;  2XQ4 A;  4IRE A;  5LXB A;  3U8M A;  3UU4 A;  4TNW A;  2KSR A;  4HFC A;  2XYT A;  2MAW A;  3JAF A;  3WTI A;  3EHZ A;  4AFH A;  4QAA A;  2XQ6 A;  4ZZC A;  4QH5 A;  5HEH A;  4LML A;  4TWD A;  2M6I A;  2UZ6 A;  3PEO A;  2XQA A;  1OED B;  3JAE A;  4UM3 P;  2QC1 B;  5AIN A;  5JME A;  5HEJ A;  5HEG A;  3RI5 A;  2XNV A;  3WTJ A;  3RIF A;  2YME A;  2BR7 A;  1UW6 A;  5J0Z A;  2WN9 A;  2XYS A;  2Y54 A;  2X00 A;  3PMZ A;  3RIA A;  4ZR6 A;  3P50 A;  3SQ9 A;  2BG9 E;  3EAM A;  2BYP A;  3ZDG A;  4QAB A;  4HFB A;  2XQ7 A;  3UQ4 A;  3T4M A;  4BFQ A;  5AFH A;  4IL9 A;  3U8L A;  5BP0 A;  4FRR A;  5J5G A;  2XQ9 A;  4ZJS A;  4NPP A;  4ZJT A;  3SQ6 A;  2BR8 A;  3WTO A;  2PH9 A;  2XQ5 A;  5AFK A;  2PGZ A;  5KE4 A;  4UM1 A;  5J5F A;  5TVC A;  4TWF A;  5KZU A;  3IGQ A;  5J5I A;  4ZRU A;  4ZK4 A;  3WTH A;  5J5H A;  4HFD A;  4ILA A;  5AFM B;  3WTL A;  3UUB A;  5L4E A;  5AFM A;  4BQT A;  4PIR A;  3EI0 A;  3WIP A;  4XK9 A;  4A98 A;  4TWH A;  1OED C;  3UU3 A;  3GUA A;  5AFJ A;  2X00 D;  4EZ1 A;  4QH4 A;  2BJ0 A;  2W8F A;  2M6B A;  1UX2 A;  4ZZB A;  2YMD A;  3LSV A;  2VL0 A;  2Y58 A;  3RHW A;  2C9T A;  2Y57 A;  2BYR A;  3JAD A;  2WNJ A;  4NZB A;  5HEU A;  4ZK1 A;  1OED A;  4HQP A;  4ALX A;  5CFB A;  4D01 A;  2ZJU A;  3WTN A;  4LMJ A;  3P4W A;  4ILB A;  2LM2 A;  1UV6 A;  2WZY A;  3TLV A;  3TLS A;  3UQ7 A;  2XNU A;  4HFE A;  2BG9 B;  3ZKR A;  2BG9 A;  4LMK A;  2LKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...