5L6SA

Crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a positive allosteric regulator beta-fructose-1,6-diphosphate (fbp) - agpase*fbp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
421
structure length
409
Chain Sequence
b'LMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPATADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 130
structure length 409
sequence length 421
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5l6sA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5l6sA01
2FYBA 5C1HA 2WGZA 4B4MA 2WLFA 2VXMA 1KQAA 1Z90A 4HOCA 1VICA 1LXAA 3F1CA 3C8VA 3R2WA 1EZIA 3BSYA 1H5SA 2PGVA 4HUSA 4IHHA 4HO2A 1KWSA 1ON8A 1I52A 1QRLA 2CU2A 2FYAA 4AA7A 1H7TA 1QGQA 3V8ZA 3DK5A 3CGXA 3ST8A 1R7VA 2DPWA 4XWIA 2APCA 2E3DA 3V90A 1LZJA 4JD0A 2GGQA 2RIYA 3V4EA 2YQHA 5CQOA 4Y62A 3NZ2A 2AH9A 2VS3A 3BXYA 4KC2A 3SX3A 3MQHA 4EA7A 3NGWA 1ZIZA 4ARWA 2MZBA 1G8OA 2YQJA 1OMZA 3I3AA 1H3MA 1VGZA 3V8YA 1H5RB 1IINA 3U2VA 4Y64A 1ZCTA 1GX0A 1HJJA 1YP4A 5J49A 1ZHJA 4FCUA 3TK8A 4MYBA 4P02A 1ZJ1A 2RITA 1H7LA 3OH1A 2ZU9A 1NQIB 1H5TB 2XMHA 1W57A 4C2SA 3BCVA 5CQLX 3T7NA 2WLGA 2WLDA 4N6AA 2XMEA 5EJZA 4B2WA 1KGTA 3SXDA 4P00A 1FXJA 1HM9A 3PKPA 1QRGA 5CQPA 3I0IX 2PGYA 2JCLA 2AE7A 1HV9A 2AECA 4D48A 1KK4A 1ZJOA 5AJOA 4BQHA 3V91A 1JVGA 4GBPA 2RJ5A 2WVMA 1NMMB 2A8UA 3R5BA 1GQ9A 1NKHB 1O7OA 5C48A 1QRMA 3T57A 3RSBA 1ZJ2A 2VSIA 1VM8A 3CKQA 4J18A 4M2BA 4FCEA 1JVDA 1OCXA 3P1BA 4FRMA 1H5RA 3SX8A 5I1FA 1TW1A 4FRAA 3TDTA 1QGSA 2RJ0A 1ZCYA 2VS4A 3Q1XA 2O1FA 2Y4MA 5CMFX 4HCQA 4HO3A 1INIA 2VSHA 2YQCA 1ZJ0A 3PNNA 1H5SC 2VXLA 2RJ7A 2PA4A 2X65A 3SX7A 3I0EA 4R7PA 1V67A 3EH0A 3CU0A 4NAIA 4AYJA 3OKRA 4EEGA 4IRPA 3Q7UA 1FXOA 3IGJA 1JV1A 2OI6A 4NANA 1V84A 1TDTA 1FO9A 3U2XA 2BO6A 1JYKA 3V0OA 5FYEA 3ZLKA 3R1WA 3IOIA 1ZI3A 4IRQA 5BXCA 5C4FA 4ASYA 1R7TA 2FKOA 2JF2A 2AM4A 3CKNA 3I0LA 1H7EA 1SSMA 2Q4JA 3FOQA 5FU8A 2QGIA 1S80A 4B5BA 4KNXA 1INJA 2QIAA 3JUJA 1ZCUA 3FSXA 3ZLLA 1R81A 2UX8A 2JF3A 1G95A 5ADXV 1ZDGA 1MC3A 1TW5A 1H7QA 3MC4A 4EEAA 2D7IA 3JQYA 1NF5B 3TQDA 1PZTA 1SSQA 3ZGFA 4D11A 2V0KA 1V3WA 3GOSA 1WT0A 1R7UA 3SX5A 1XHDA 4R37A 1G2VA 4EE5A 2RJ4A 5C8RA 2WLCA 1V82A 4B3UA 4M28A 3ZGGA 3VBPA 1FR8A 4ISXA 4E6UA 4G3SA 3FTTA 2O1GA 3KIAA 3U2WA 3OH3A 1KRVA 5C3DA 3K8EA 3QVBA 1VH1A 4E75A 4EAAA 1WVCA 2X5ZA 4HO8A 1VPAA 4KT7A 2BO7A 2AM3A 2Y6PA 3E25A 1JYLA 4N69A 1FOAA 1OMXA 2VD4A 2YCMA 5IFYA 2OI5A 4FROA 3VBLA 3D98A 3OTZA 2D0JA 2RJ6A 4B4BA 4IHGA 3PMOA 4EE3A 4K6RA 1FG5N 3OTMA 4MZUA 4AC3A 2Y4LA 4KC4A 4M4KA 5C4DA 5HS2A 4KC1A 2WLEA 2IC7A 3TZTA 3VBIA 4DE7A 5DG3A 2AESA 2YQSA 2W0WA 2YC3A 1GWWA 1TZFA 1G97A 4G3PA 3OH4A 1LL2A 4B4GA 3I3XA 2IUAA 5C3BA 1G3LA 3DJ4A 2NPOA 4KQLA 3R5AA 1MP3A 3ECTA 2O1HA 1O23B 4J09A 3I0JA 1WT2A 2RIJA 4EEOA 5C47A 2RJ1A 2YC5A 4D0TA 3OGZA 4E6TA 3OH0A 4DCLA 5ADXU 4FRDA 3POLA 3VBKA 3EEVA 2NXVA 1G93A 4FRPA 1VGUA 5CMIA 3FWWA 2WE9A 4HO6A 1O7QA 4ECMA 1LVWA 1KRRA 3OH2A 1QWJA 4N27A 1K4VA 1FO8A 3KWDA 1LZ0A 2V0IA 4D11C 3EE5A 3SXAA 4M2AA 1ON6A 1HJLA 2ICXA 3BSWA 1H5TA 3VBMA 3V0LA 1WT3A 3SXGA 5EJ1A 3CJ8A 1MP4A 3USQA 3N9WA 1ZDFA 4EGGA 5L6SA 5DEMA 5F42A 1FZWA 4D0ZA 2XWNA 2YESA 4UEGA 3SXBA 1KK5A 2X5SA 5IDSA 4Y7UA 1WT1A 3BFPA 3TV0A 5JQQA 5AJPA 3MQGA 1OQMB 4EQYA 5CQMX 2FYDB 1S4OA 1VZUA 3R5CA 3Q4SA 4EABA 4KNRA 2RIZA 3SPTA 1H5SB 4E79A 4HZDA 3FS8A 3T7MA 5L6VA 3U2UA 4M98A 1PZYB 3IXCA 4FRLA 3KWEA 2P6WA 5C38A 1KGQA 4HO5A 4B2XA 2P2OA 1ZJPA 1SSTA 2JCKA 1IIMA 1GA8A 1JV3A 4FRHA 1FR9A 2RJ8A 4KRVA 3D5NA 3PKQA 1O0RA 1THJA 3FSCA 4EE4A 5AJNA 4M9CA 3TWDA 5C4CA 2I5EA 1J2ZA 2V0JA 3K8DA 4M99A 1XZ6A 2P73A 3R5DA 2Z86A 3CKJA 4FREA 4Y7TA 4IHFA 2BO4A 4MFGA 1QG8A 5AFUV 5FTSA 2V0HA 4HURA 4G87A 2Y4JA 2IU8A 3JTJA 4G3QA 3LW6A 4Y6NA 5DDVA 2ZU7A 2PX7A 2XATA 1KRUA 1ZI4A 5CMHA 3V0MA 5C1GA 5E3QA 2I5KA 1R7XA 3I0HA 2AGDA 2FY7A 2E8BA 3FSBA 3R3IA 1T3DA 4EA9A 1LZ7A 2I7BA 1GWVA 3OAMA 4FQWA 2BO8A 3TISA 1VGWA 4HO4A 1R82A 1S4NA 4AAWA 2OEFA 3USRA 1YP2A 4KPXA 4Y7GA 5EIYA 3V0NA 3SXEA 1VZTA 3GVDA 1MP5A 2WVLA 3V0PA 3Q80A 4NALA 4L41C 3DUVA 1W55A 1G0RA 1NHEB 3OC9A 4CJCA 3IOHA 2XWMA 3O3PA 5CMGX 1XHBA 3I0DA 3RMWA 2X60A 3BRKX 1NWGB 1ZCVA 4Y63A 3P47A 1FGGA 2W0VA 4R36A 5E3PA 1FGXA 3I0CA 2QIVX 1EYRA 1SS9A 3U2TA 1H5SD 5CMJA 1FRWA 4YS8A 1H7FA 1MR9A 1VGTA 1H4CA 5CQNX 1MR7A 5FU0A 2VFZA 1R7YA 2WEEA 1H4DA 4LW6A 1E5KA 4HO0A 4Y9XA 4B42A 2FFVA 3R3RA 3SXCA 4N6BA 5FV9A 3R8YA 1KHRA 1H7GA 1LZIA 1WSZA 5E3RA 5IDTA 4KXOA 4EEMA 1ZI5A 2D7RA 3SRTA 4CJBA 4CVHA 2A8WA 1W77A 5C36A 2Y7AA 3V0QA 2QH5A 1S4PA 3ZF8A 1YROB 4Y7VA 4EA8A 1GQCA 1LL3A 4AYLA 1LL0A 2Z87A 5AFUU 4MYOA 4E1KA 1TVYA 2Y4KA 3U0XA 2OI7A 3D8VA 2RJ9A 1HM0A 4JISA 1VZXA 4BMAA 1QREA 1G9RA 2AQ9A 3EG4A 4CJ8A 4H7OA 1GX4A 1MRLA 4HG6A 3I0KA 3F1YA 3GUEA 3KWCA 2VS5A 3HJJA 2JCJA 5C49A 2P72A 1ZI1A 4ZDQA 2ICYA 2IU9A 5FTVA 5DEPA 3VNPA 1V83A 3I0GA 5U2KA 3CKVA 3RMVA 3BSSA 2VHEA 1VH3A 2FFUA 2AM5A 1G1LA 3DHOA 3OU9A 2V0LA 3CKOA 3OUPA 1H7HA 3IOJA 2QKXA 3OW5A 4FRQA 4KPZA 2FYCB 3VBNA 5C3AA 2GGOA 2XWLA 4EVWA 2JCOA 2WVKA 3TIOA 1QQ0A 1R80A 4Y6UA 5FUHA 4DECA 1KK6A 1FWYA 4HZCA 1QRFA 4DDZA 4FRBA 5DDTA 4ASJA 1G23A 2ZU8A 3FSYA 3T7OA 3U0YA 5C4BA 2WAWA 3HL3A 4LW3A 4Y7FA 3R0SA 1H4EA 1HM8A 1ZJ3A 3JUKA 1YP3A 4HO9A 3VBJA 3F1XA 5C4EA 3HSQA 2OEGA 2TDTA 1XATA 3I0FA 4NAKA 5C1LA 4MNDA 2RIXA 3E26A
chains in the Genus database with same CATH superfamily
2FYBA 5C1HA 2WGZA 4B4MA 2WLFA 2VXMA 1KQAA 1Z90A 4HOCA 1VICA 1LXAA 3F1CA 3C8VA 3R2WA 1EZIA 3BSYA 1H5SA 2PGVA 4HUSA 4IHHA 4HO2A 1KWSA 1ON8A 3GQ9A 1I52A 1QRLA 2CU2A 2FYAA 4AA7A 1H7TA 1QGQA 3V8ZA 3DK5A 3CGXA 3ST8A 1R7VA 2DPWA 4XWIA 2APCA 2E3DA 3V90A 1LZJA 4JD0A 2GGQA 2RIYA 3V4EA 2YQHA 5CQOA 4Y62A 3NZ2A 2AH9A 2VS3A 3BXYA 4KC2A 3SX3A 3MQHA 4EA7A 3NGWA 1ZIZA 4ARWA 2MZBA 1G8OA 2YQJA 1OMZA 3I3AA 1H3MA 1VGZA 3V8YA 1H5RB 1IINA 3U2VA 4Y64A 1ZCTA 1GX0A 1HJJA 1YP4A 5J49A 1ZHJA 4FCUA 3TK8A 4MYBA 4P02A 1ZJ1A 2RITA 1H7LA 3OH1A 2ZU9A 1NQIB 1H5TB 2XMHA 1W57A 4C2SA 3BCVA 5CQLX 3T7NA 2WLGA 2WLDA 4N6AA 2XMEA 5EJZA 4B2WA 1KGTA 3SXDA 4P00A 1FXJA 1HM9A 3PKPA 1QRGA 5CQPA 3I0IX 2PGYA 2JCLA 2AE7A 1HV9A 2AECA 4D48A 4MIXA 1KK4A 1ZJOA 1Z2FA 5AJOA 4BQHA 3V91A 1JVGA 4GBPA 2RJ5A 2WVMA 1NMMB 2A8UA 3R5BA 1GQ9A 1NKHB 1O7OA 5C48A 1QRMA 3T57A 3RSBA 1ZJ2A 2VSIA 1VM8A 3CKQA 4J18A 4M2BA 4FCEA 1JVDA 1OCXA 3P1BA 4FRMA 1H5RA 3SX8A 5I1FA 1TW1A 4FRAA 3TDTA 1QGSA 2RJ0A 1ZCYA 2C0NA 2VS4A 3Q1XA 2O1FA 2Y4MA 3GQ7A 5CMFX 4HCQA 4HO3A 1INIA 2VSHA 2YQCA 1ZJ0A 3PNNA 1H5SC 2VXLA 2RJ7A 2PA4A 2X65A 3SX7A 3I0EA 4R7PA 1V67A 3EH0A 3CU0A 4NAIA 4AYJA 3OKRA 4EEGA 4IRPA 3Q7UA 1FXOA 3IGJA 1JV1A 2OI6A 4NANA 1V84A 1TDTA 1FO9A 3U2XA 2BO6A 1JYKA 3V0OA 5FYEA 3ZLKA 3R1WA 3IOIA 1ZI3A 4IRQA 5BXCA 5C4FA 4ASYA 1R7TA 2FKOA 2JF2A 2AM4A 3CKNA 3I0LA 1H7EA 3SUCA 1SSMA 2Q4JA 3FOQA 5FU8A 2QGIA 1S80A 4B5BA 4KNXA 1INJA 2QIAA 3JUJA 1ZCUA 3FSXA 3ZLLA 1R81A 2UX8A 2JF3A 1G95A 5ADXV 1ZDGA 1MC3A 1TW5A 1H7QA 3MC4A 4EEAA 2D7IA 3JQYA 1NF5B 3TQDA 1PZTA 1SSQA 3ZGFA 4D11A 2V0KA 1V3WA 3GOSA 1WT0A 1R7UA 3SX5A 1XHDA 4R37A 1G2VA 1L0SA 4EE5A 5D91A 2RJ4A 5C8RA 2WLCA 1V82A 4B3UA 4M28A 3ZGGA 3VBPA 1FR8A 4ISXA 4E6UA 4G3SA 3FTTA 2O1GA 3KIAA 3U2WA 3OH3A 1KRVA 5C3DA 3K8EA 3QVBA 1VH1A 4E75A 4EAAA 1WVCA 2X5ZA 4HO8A 1VPAA 4KT7A 2BO7A 2AM3A 2Y6PA 3E25A 1JYLA 4N69A 1FOAA 1OMXA 2VD4A 2YCMA 5IFYA 2OI5A 4FROA 3VBLA 3D98A 3OTZA 2D0JA 2RJ6A 4B4BA 4IHGA 3PMOA 4EE3A 4K6RA 1FG5N 3OTMA 4MZUA 4AC3A 2Y4LA 4KC4A 4M4KA 5C4DA 5HS2A 4KC1A 2WLEA 2IC7A 3TZTA 3VBIA 4DE7A 5DG3A 2AESA 2YQSA 2W0WA 2YC3A 1GWWA 1TZFA 1G97A 4G3PA 4FIYA 3OH4A 1LL2A 4B4GA 3I3XA 2IUAA 5C3BA 1G3LA 3DJ4A 2NPOA 4KQLA 3R5AA 1MP3A 3ECTA 2O1HA 1O23B 4J09A 3I0JA 1WT2A 2RIJA 4EEOA 5C47A 2RJ1A 2YC5A 4D0TA 3OGZA 4E6TA 3OH0A 4DCLA 5ADXU 4FRDA 3POLA 3VBKA 3EEVA 2NXVA 1G93A 4FRPA 1VGUA 5CMIA 3FWWA 2WE9A 4HO6A 1O7QA 4ECMA 3OH2A 1KRRA 1LVWA 1QWJA 4N27A 1K4VA 1FO8A 3KWDA 1LZ0A 2V0IA 4D11C 3EE5A 3SXAA 4M2AA 1ON6A 1HJLA 2ICXA 3BSWA 1H5TA 3VBMA 3V0LA 1WT3A 3SXGA 5EJ1A 3CJ8A 1MP4A 3USQA 3N9WA 1ZDFA 4EGGA 5L6SA 5DEMA 5F42A 1FZWA 4D0ZA 2XWNA 2YESA 1M8NA 4UEGA 3SXBA 1KK5A 2X5SA 5IDSA 4Y7UA 1WT1A 3BFPA 3TV0A 5JQQA 5AJPA 3MQGA 1OQMB 4EQYA 5CQMX 2FYDB 1S4OA 1VZUA 3R5CA 3Q4SA 4EABA 4KNRA 2RIZA 3SPTA 1H5SB 4E79A 4HZDA 3FS8A 3T7MA 5L6VA 3U2UA 4M98A 1PZYB 3IXCA 4FRLA 3KWEA 2P6WA 5C38A 1KGQA 4HO5A 4B2XA 2P2OA 1ZJPA 1SSTA 2JCKA 1IIMA 2J0AA 1GA8A 1JV3A 4FRHA 1FR9A 2RJ8A 4KRVA 3D5NA 3PKQA 1O0RA 1THJA 3FSCA 4EE4A 5AJNA 4M9CA 3TWDA 5C4CA 2I5EA 1J2ZA 2V0JA 3K8DA 4M99A 1XZ6A 2P73A 3R5DA 2Z86A 3CKJA 4FREA 4Y7TA 4IHFA 2BO4A 4MFGA 1QG8A 5AFUV 5FTSA 2V0HA 2VK9A 4HURA 4G87A 2Y4JA 2IU8A 3JTJA 4G3QA 3LW6A 4Y6NA 5DDVA 2ZU7A 2PX7A 2XATA 1KRUA 1ZI4A 5CMHA 3V0MA 5C1GA 5E3QA 2I5KA 1R7XA 3I0HA 2AGDA 2FY7A 2E8BA 3FSBA 3R3IA 1T3DA 4EA9A 1LZ7A 2I7BA 1GWVA 3OAMA 4FQWA 2BO8A 3TISA 4FIXA 1VGWA 4HO4A 1R82A 1S4NA 4AAWA 2OEFA 3USRA 1YP2A 4KPXA 4Y7GA 5EIYA 3V0NA 3SXEA 1VZTA 3GVDA 1MP5A 2WVLA 3V0PA 3Q80A 4NALA 4L41C 3DUVA 1W55A 1G0RA 1NHEB 3OC9A 4CJCA 3IOHA 2XWMA 3O3PA 5CMGX 1XHBA 3I0DA 3RMWA 2X60A 3BRKX 1NWGB 1ZCVA 4Y63A 3P47A 1FGGA 2W0VA 4R36A 5E3PA 1FGXA 3I0CA 2QIVX 1EYRA 1SS9A 3U2TA 1H5SD 5CMJA 1FRWA 4YS8A 1H7FA 1MR9A 1VGTA 1H4CA 5CQNX 3GQAA 1MR7A 5FU0A 2VFZA 1R7YA 2WEEA 1H4DA 4O6NA 4LW6A 1E5KA 4HO0A 4Y9XA 4B42A 2FFVA 3R3RA 3SXCA 4N6BA 5FV9A 3R8YA 1KHRA 1H7GA 1LZIA 1WSZA 5E3RA 5IDTA 4KXOA 4EEMA 1ZI5A 2D7RA 3SRTA 4CJBA 4CVHA 2A8WA 1W77A 5C36A 2Y7AA 3V0QA 4O6MA 2QH5A 1S4PA 3ZF8A 1YROB 4Q7CA 4Y7VA 4EA8A 1GQCA 1LL3A 4AYLA 1LL0A 2Z87A 5AFUU 4MYOA 4E1KA 1TVYA 2Y4KA 3U0XA 2OI7A 3D8VA 2RJ9A 1HM0A 4JISA 1VZXA 4BMAA 1QREA 1G9RA 2AQ9A 3EG4A 4CJ8A 4H7OA 1GX4A 1MRLA 4HG6A 5D92A 3I0KA 3F1YA 3GUEA 3KWCA 2VS5A 3HJJA 2JCJA 5C49A 2P72A 1ZI1A 4ZDQA 2ICYA 2IU9A 5FTVA 5DEPA 3VNPA 1V83A 3I0GA 5U2KA 3CKVA 3RMVA 3BSSA 2VHEA 1VH3A 2FFUA 2AM5A 1G1LA 3DHOA 3OU9A 2V0LA 3CKOA 3OUPA 1H7HA 3IOJA 2QKXA 3OW5A 4FRQA 4KPZA 2FYCB 3VBNA 5C3AA 2GGOA 2XWLA 4EVWA 2JCOA 1EWWA 2WVKA 3TIOA 1QQ0A 1R80A 4Y6UA 5FUHA 4DECA 1KK6A 1FWYA 4HZCA 1QRFA 4DDZA 4FRBA 5DDTA 4ASJA 1G23A 2ZU8A 3FSYA 3T7OA 2J0BA 3U0YA 5C4BA 2WAWA 3HL3A 4LW3A 4Y7FA 3R0SA 1H4EA 1HM8A 1ZJ3A 3JUKA 1N4IA 1YP3A 4HO9A 3VBJA 3F1XA 5C4EA 3HSQA 2OEGA 2TDTA 1XATA 3I0FA 4NAKA 3GQ8A 5C1LA 4MNDA 2RIXA 3E26A
chains in the Genus database with same CATH topology
2FYBA 5C1HA 2WGZA 4B4MA 2WLFA 2VXMA 1KQAA 1Z90A 4HOCA 1VICA 1LXAA 3F1CA 3C8VA 3R2WA 1EZIA 3BSYA 1H5SA 2PGVA 4HUSA 4IHHA 4HO2A 1KWSA 1ON8A 1I52A 1QRLA 2CU2A 2FYAA 4AA7A 1H7TA 1QGQA 3V8ZA 3DK5A 3CGXA 3ST8A 1R7VA 2DPWA 4XWIA 2APCA 2E3DA 3V90A 1LZJA 4JD0A 2GGQA 2RIYA 3V4EA 2YQHA 5CQOA 4Y62A 3NZ2A 2AH9A 2VS3A 3BXYA 4KC2A 3SX3A 3MQHA 4EA7A 3NGWA 1ZIZA 4ARWA 2MZBA 1G8OA 2YQJA 1OMZA 3I3AA 1H3MA 1VGZA 3V8YA 1H5RB 1IINA 3U2VA 4Y64A 1ZCTA 1GX0A 1HJJA 1YP4A 5J49A 1ZHJA 4FCUA 3TK8A 4MYBA 4P02A 1ZJ1A 2RITA 1H7LA 3OH1A 2ZU9A 1NQIB 1H5TB 2XMHA 1W57A 4C2SA 3BCVA 5CQLX 3T7NA 2WLGA 2WLDA 4N6AA 2XMEA 5EJZA 4B2WA 1KGTA 3SXDA 4P00A 1FXJA 1HM9A 3PKPA 1QRGA 5CQPA 3I0IX 2PGYA 2JCLA 2AE7A 1HV9A 2AECA 4D48A 4MIXA 1KK4A 1ZJOA 5AJOA 4BQHA 3V91A 1JVGA 4GBPA 2RJ5A 2WVMA 1NMMB 2A8UA 3R5BA 1GQ9A 1NKHB 1O7OA 5C48A 1QRMA 3T57A 3RSBA 1ZJ2A 2VSIA 1VM8A 3CKQA 4J18A 4M2BA 4FCEA 1JVDA 1OCXA 3P1BA 4FRMA 1H5RA 3SX8A 5I1FA 1TW1A 4FRAA 3TDTA 1QGSA 2RJ0A 1ZCYA 2C0NA 2VS4A 3Q1XA 2O1FA 2Y4MA 5CMFX 4HCQA 4HO3A 1INIA 2VSHA 2YQCA 1ZJ0A 3PNNA 1H5SC 2VXLA 2RJ7A 2PA4A 2X65A 3SX7A 3I0EA 4R7PA 1V67A 3EH0A 3CU0A 4NAIA 4AYJA 3OKRA 4EEGA 4IRPA 3Q7UA 1FXOA 3IGJA 1JV1A 2OI6A 4NANA 1V84A 1TDTA 1FO9A 3U2XA 2BO6A 1JYKA 3V0OA 5FYEA 3ZLKA 3R1WA 3IOIA 1ZI3A 4IRQA 5BXCA 5C4FA 4ASYA 1R7TA 2FKOA 2JF2A 2AM4A 3CKNA 3I0LA 1H7EA 1SSMA 2Q4JA 3FOQA 5FU8A 2QGIA 1S80A 4B5BA 4KNXA 1INJA 2QIAA 3JUJA 1ZCUA 3FSXA 3ZLLA 1R81A 2UX8A 2JF3A 1G95A 5ADXV 1ZDGA 1MC3A 1TW5A 1H7QA 3MC4A 4EEAA 2D7IA 3JQYA 1NF5B 3TQDA 1PZTA 1SSQA 3ZGFA 4D11A 2V0KA 1V3WA 3GOSA 1WT0A 1R7UA 3SX5A 1XHDA 4R37A 1G2VA 4EE5A 5D91A 2RJ4A 5C8RA 2WLCA 1V82A 4B3UA 4M28A 3ZGGA 3VBPA 1FR8A 4ISXA 4E6UA 4G3SA 3FTTA 2O1GA 3KIAA 3U2WA 3OH3A 1KRVA 5C3DA 3K8EA 3QVBA 1VH1A 4E75A 4EAAA 1WVCA 2X5ZA 4HO8A 1VPAA 4KT7A 2BO7A 2AM3A 2Y6PA 3E25A 1JYLA 4N69A 1FOAA 1OMXA 2VD4A 2YCMA 5IFYA 2OI5A 4FROA 3VBLA 3D98A 3OTZA 2D0JA 2RJ6A 4B4BA 4IHGA 3PMOA 4EE3A 4K6RA 1FG5N 3OTMA 4MZUA 4AC3A 2Y4LA 4KC4A 4M4KA 5C4DA 5HS2A 4KC1A 2WLEA 2IC7A 3TZTA 3VBIA 4DE7A 5DG3A 2AESA 2YQSA 2W0WA 2YC3A 1GWWA 1TZFA 1G97A 4G3PA 4FIYA 3OH4A 1LL2A 4B4GA 3I3XA 2IUAA 5C3BA 1G3LA 3DJ4A 2NPOA 4KQLA 3R5AA 1MP3A 3ECTA 2O1HA 1O23B 4J09A 3I0JA 1WT2A 2RIJA 4EEOA 5C47A 2RJ1A 2YC5A 4D0TA 3OGZA 4E6TA 3OH0A 4DCLA 5ADXU 4FRDA 3POLA 3VBKA 3EEVA 2NXVA 1G93A 4FRPA 1VGUA 5CMIA 3FWWA 2WE9A 4HO6A 1O7QA 4ECMA 1LVWA 1KRRA 3OH2A 1QWJA 4N27A 1K4VA 1FO8A 3KWDA 1LZ0A 2V0IA 4D11C 3EE5A 3SXAA 4M2AA 1ON6A 1HJLA 2ICXA 3BSWA 1H5TA 3VBMA 3V0LA 1WT3A 3SXGA 5EJ1A 3CJ8A 1MP4A 3USQA 3N9WA 1ZDFA 4EGGA 5L6SA 5DEMA 5F42A 1FZWA 4D0ZA 2XWNA 2YESA 4UEGA 3SXBA 1KK5A 2X5SA 5IDSA 4Y7UA 1WT1A 3BFPA 3TV0A 5JQQA 5AJPA 3MQGA 1OQMB 4EQYA 5CQMX 2FYDB 1S4OA 1VZUA 3R5CA 3Q4SA 4EABA 4KNRA 2RIZA 3SPTA 1H5SB 4E79A 4HZDA 3FS8A 3T7MA 5L6VA 3U2UA 4M98A 1PZYB 3IXCA 4FRLA 3KWEA 2P6WA 5C38A 1KGQA 4HO5A 4B2XA 2P2OA 1ZJPA 1SSTA 2JCKA 1IIMA 2J0AA 1GA8A 1JV3A 4FRHA 1FR9A 2RJ8A 4KRVA 3D5NA 3PKQA 1O0RA 1THJA 3FSCA 4EE4A 5AJNA 4M9CA 3TWDA 5C4CA 2I5EA 1J2ZA 2V0JA 3K8DA 4M99A 1XZ6A 2P73A 3R5DA 2Z86A 3CKJA 4FREA 4Y7TA 4IHFA 2BO4A 4MFGA 1QG8A 5AFUV 5FTSA 2V0HA 2VK9A 4HURA 4G87A 2Y4JA 2IU8A 3JTJA 4G3QA 3LW6A 4Y6NA 5DDVA 2ZU7A 2PX7A 2XATA 1KRUA 1ZI4A 5CMHA 3V0MA 5C1GA 5E3QA 2I5KA 1R7XA 3I0HA 2AGDA 2FY7A 2E8BA 3FSBA 3R3IA 1T3DA 4EA9A 1LZ7A 2I7BA 1GWVA 3OAMA 4FQWA 2BO8A 3TISA 4FIXA 1VGWA 4HO4A 1R82A 1S4NA 4AAWA 2OEFA 3USRA 1YP2A 4KPXA 4Y7GA 5EIYA 3V0NA 3SXEA 1VZTA 3GVDA 1MP5A 2WVLA 3V0PA 3Q80A 4NALA 4L41C 3DUVA 1W55A 1G0RA 1NHEB 3OC9A 4CJCA 3IOHA 2XWMA 3O3PA 5CMGX 1XHBA 3I0DA 3RMWA 2X60A 3BRKX 1NWGB 1ZCVA 4Y63A 3P47A 1FGGA 2W0VA 4R36A 5E3PA 1FGXA 3I0CA 2QIVX 1EYRA 1SS9A 3U2TA 1H5SD 5CMJA 1FRWA 4YS8A 1H7FA 1MR9A 1VGTA 1H4CA 5CQNX 1MR7A 5FU0A 2VFZA 1R7YA 2WEEA 1H4DA 4O6NA 4LW6A 1E5KA 4HO0A 4Y9XA 4B42A 2FFVA 3R3RA 3SXCA 4N6BA 5FV9A 3R8YA 1KHRA 1H7GA 1LZIA 1WSZA 5E3RA 5IDTA 4KXOA 4EEMA 1ZI5A 2D7RA 3SRTA 4CJBA 4CVHA 2A8WA 1W77A 5C36A 2Y7AA 3V0QA 4O6MA 2QH5A 1S4PA 3ZF8A 1YROB 4Q7CA 4Y7VA 4EA8A 1GQCA 1LL3A 4AYLA 1LL0A 2Z87A 5AFUU 4MYOA 4E1KA 1TVYA 2Y4KA 3U0XA 2OI7A 3D8VA 2RJ9A 1HM0A 4JISA 1VZXA 4BMAA 1QREA 1G9RA 2AQ9A 3EG4A 4CJ8A 4H7OA 1GX4A 1MRLA 4HG6A 5D92A 3I0KA 3F1YA 3GUEA 3KWCA 2VS5A 3HJJA 2JCJA 5C49A 2P72A 1ZI1A 4ZDQA 2ICYA 2IU9A 5FTVA 5DEPA 3VNPA 1V83A 3I0GA 5U2KA 3CKVA 3RMVA 3BSSA 2VHEA 1VH3A 2FFUA 2AM5A 1G1LA 3DHOA 3OU9A 2V0LA 3CKOA 3OUPA 1H7HA 3IOJA 2QKXA 3OW5A 4FRQA 4KPZA 2FYCB 3VBNA 5C3AA 2GGOA 2XWLA 4EVWA 2JCOA 2WVKA 3TIOA 1QQ0A 1R80A 4Y6UA 5FUHA 4DECA 1KK6A 1FWYA 4HZCA 1QRFA 4DDZA 4FRBA 5DDTA 4ASJA 1G23A 2ZU8A 3FSYA 3T7OA 2J0BA 3U0YA 5C4BA 2WAWA 3HL3A 4LW3A 4Y7FA 3R0SA 1H4EA 1HM8A 1ZJ3A 3JUKA 1YP3A 4HO9A 3VBJA 3F1XA 5C4EA 3HSQA 2OEGA 2TDTA 1XATA 3I0FA 4NAKA 5C1LA 4MNDA 2RIXA 3E26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYB A;  5C1H A;  2WGZ A;  4B4M A;  2WLF A;  2VXM A;  1KQA A;  1Z90 A;  4HOC A;  1VIC A;  1LXA A;  3F1C A;  3C8V A;  3R2W A;  1EZI A;  3BSY A;  1H5S A;  2PGV A;  4HUS A;  4IHH A;  4HO2 A;  1KWS A;  1ON8 A;  1I52 A;  1QRL A;  2CU2 A;  2FYA A;  4AA7 A;  1H7T A;  1QGQ A;  3V8Z A;  3DK5 A;  3CGX A;  3ST8 A;  1R7V A;  2DPW A;  4XWI A;  2APC A;  2E3D A;  3V90 A;  1LZJ A;  4JD0 A;  2GGQ A;  2RIY A;  3V4E A;  2YQH A;  5CQO A;  4Y62 A;  3NZ2 A;  2AH9 A;  2VS3 A;  3BXY A;  4KC2 A;  3SX3 A;  3MQH A;  4EA7 A;  3NGW A;  1ZIZ A;  4ARW A;  2MZB A;  1G8O A;  2YQJ A;  1OMZ A;  3I3A A;  1H3M A;  1VGZ A;  3V8Y A;  1H5R B;  1IIN A;  3U2V A;  4Y64 A;  1ZCT A;  1GX0 A;  1HJJ A;  1YP4 A;  5J49 A;  1ZHJ A;  4FCU A;  3TK8 A;  4MYB A;  4P02 A;  1ZJ1 A;  2RIT A;  1H7L A;  3OH1 A;  2ZU9 A;  1NQI B;  1H5T B;  2XMH A;  1W57 A;  4C2S A;  3BCV A;  5CQL X;  3T7N A;  2WLG A;  2WLD A;  4N6A A;  2XME A;  5EJZ A;  4B2W A;  1KGT A;  3SXD A;  4P00 A;  1FXJ A;  1HM9 A;  3PKP A;  1QRG A;  5CQP A;  3I0I X;  2PGY A;  2JCL A;  2AE7 A;  1HV9 A;  2AEC A;  4D48 A;  1KK4 A;  1ZJO A;  5AJO A;  4BQH A;  3V91 A;  1JVG A;  4GBP A;  2RJ5 A;  2WVM A;  1NMM B;  2A8U A;  3R5B A;  1GQ9 A;  1NKH B;  1O7O A;  5C48 A;  1QRM A;  3T57 A;  3RSB A;  1ZJ2 A;  2VSI A;  1VM8 A;  3CKQ A;  4J18 A;  4M2B A;  4FCE A;  1JVD A;  1OCX A;  3P1B A;  4FRM A;  1H5R A;  3SX8 A;  5I1F A;  1TW1 A;  4FRA A;  3TDT A;  1QGS A;  2RJ0 A;  1ZCY A;  2VS4 A;  3Q1X A;  2O1F A;  2Y4M A;  5CMF X;  4HCQ A;  4HO3 A;  1INI A;  2VSH A;  2YQC A;  1ZJ0 A;  3PNN A;  1H5S C;  2VXL A;  2RJ7 A;  2PA4 A;  2X65 A;  3SX7 A;  3I0E A;  4R7P A;  1V67 A;  3EH0 A;  3CU0 A;  4NAI A;  4AYJ A;  3OKR A;  4EEG A;  4IRP A;  3Q7U A;  1FXO A;  3IGJ A;  1JV1 A;  2OI6 A;  4NAN A;  1V84 A;  1TDT A;  1FO9 A;  3U2X A;  2BO6 A;  1JYK A;  3V0O A;  5FYE A;  3ZLK A;  3R1W A;  3IOI A;  1ZI3 A;  4IRQ A;  5BXC A;  5C4F A;  4ASY A;  1R7T A;  2FKO A;  2JF2 A;  2AM4 A;  3CKN A;  3I0L A;  1H7E A;  1SSM A;  2Q4J A;  3FOQ A;  5FU8 A;  2QGI A;  1S80 A;  4B5B A;  4KNX A;  1INJ A;  2QIA A;  3JUJ A;  1ZCU A;  3FSX A;  3ZLL A;  1R81 A;  2UX8 A;  2JF3 A;  1G95 A;  5ADX V;  1ZDG A;  1MC3 A;  1TW5 A;  1H7Q A;  3MC4 A;  4EEA A;  2D7I A;  3JQY A;  1NF5 B;  3TQD A;  1PZT A;  1SSQ A;  3ZGF A;  4D11 A;  2V0K A;  1V3W A;  3GOS A;  1WT0 A;  1R7U A;  3SX5 A;  1XHD A;  4R37 A;  1G2V A;  4EE5 A;  2RJ4 A;  5C8R A;  2WLC A;  1V82 A;  4B3U A;  4M28 A;  3ZGG A;  3VBP A;  1FR8 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  2O1G A;  3KIA A;  3U2W A;  3OH3 A;  1KRV A;  5C3D A;  3K8E A;  3QVB A;  1VH1 A;  4E75 A;  4EAA A;  1WVC A;  2X5Z A;  4HO8 A;  1VPA A;  4KT7 A;  2BO7 A;  2AM3 A;  2Y6P A;  3E25 A;  1JYL A;  4N69 A;  1FOA A;  1OMX A;  2VD4 A;  2YCM A;  5IFY A;  2OI5 A;  4FRO A;  3VBL A;  3D98 A;  3OTZ A;  2D0J A;  2RJ6 A;  4B4B A;  4IHG A;  3PMO A;  4EE3 A;  4K6R A;  1FG5 N;  3OTM A;  4MZU A;  4AC3 A;  2Y4L A;  4KC4 A;  4M4K A;  5C4D A;  5HS2 A;  4KC1 A;  2WLE A;  2IC7 A;  3TZT A;  3VBI A;  4DE7 A;  5DG3 A;  2AES A;  2YQS A;  2W0W A;  2YC3 A;  1GWW A;  1TZF A;  1G97 A;  4G3P A;  3OH4 A;  1LL2 A;  4B4G A;  3I3X A;  2IUA A;  5C3B A;  1G3L A;  3DJ4 A;  2NPO A;  4KQL A;  3R5A A;  1MP3 A;  3ECT A;  2O1H A;  1O23 B;  4J09 A;  3I0J A;  1WT2 A;  2RIJ A;  4EEO A;  5C47 A;  2RJ1 A;  2YC5 A;  4D0T A;  3OGZ A;  4E6T A;  3OH0 A;  4DCL A;  5ADX U;  4FRD A;  3POL A;  3VBK A;  3EEV A;  2NXV A;  1G93 A;  4FRP A;  1VGU A;  5CMI A;  3FWW A;  2WE9 A;  4HO6 A;  1O7Q A;  4ECM A;  1LVW A;  1KRR A;  3OH2 A;  1QWJ A;  4N27 A;  1K4V A;  1FO8 A;  3KWD A;  1LZ0 A;  2V0I A;  4D11 C;  3EE5 A;  3SXA A;  4M2A A;  1ON6 A;  1HJL A;  2ICX A;  3BSW A;  1H5T A;  3VBM A;  3V0L A;  1WT3 A;  3SXG A;  5EJ1 A;  3CJ8 A;  1MP4 A;  3USQ A;  3N9W A;  1ZDF A;  4EGG A;  5L6S A;  5DEM A;  5F42 A;  1FZW A;  4D0Z A;  2XWN A;  2YES A;  4UEG A;  3SXB A;  1KK5 A;  2X5S A;  5IDS A;  4Y7U A;  1WT1 A;  3BFP A;  3TV0 A;  5JQQ A;  5AJP A;  3MQG A;  1OQM B;  4EQY A;  5CQM X;  2FYD B;  1S4O A;  1VZU A;  3R5C A;  3Q4S A;  4EAB A;  4KNR A;  2RIZ A;  3SPT A;  1H5S B;  4E79 A;  4HZD A;  3FS8 A;  3T7M A;  5L6V A;  3U2U A;  4M98 A;  1PZY B;  3IXC A;  4FRL A;  3KWE A;  2P6W A;  5C38 A;  1KGQ A;  4HO5 A;  4B2X A;  2P2O A;  1ZJP A;  1SST A;  2JCK A;  1IIM A;  1GA8 A;  1JV3 A;  4FRH A;  1FR9 A;  2RJ8 A;  4KRV A;  3D5N A;  3PKQ A;  1O0R A;  1THJ A;  3FSC A;  4EE4 A;  5AJN A;  4M9C A;  3TWD A;  5C4C A;  2I5E A;  1J2Z A;  2V0J A;  3K8D A;  4M99 A;  1XZ6 A;  2P73 A;  3R5D A;  2Z86 A;  3CKJ A;  4FRE A;  4Y7T A;  4IHF A;  2BO4 A;  4MFG A;  1QG8 A;  5AFU V;  5FTS A;  2V0H A;  4HUR A;  4G87 A;  2Y4J A;  2IU8 A;  3JTJ A;  4G3Q A;  3LW6 A;  4Y6N A;  5DDV A;  2ZU7 A;  2PX7 A;  2XAT A;  1KRU A;  1ZI4 A;  5CMH A;  3V0M A;  5C1G A;  5E3Q A;  2I5K A;  1R7X A;  3I0H A;  2AGD A;  2FY7 A;  2E8B A;  3FSB A;  3R3I A;  1T3D A;  4EA9 A;  1LZ7 A;  2I7B A;  1GWV A;  3OAM A;  4FQW A;  2BO8 A;  3TIS A;  1VGW A;  4HO4 A;  1R82 A;  1S4N A;  4AAW A;  2OEF A;  3USR A;  1YP2 A;  4KPX A;  4Y7G A;  5EIY A;  3V0N A;  3SXE A;  1VZT A;  3GVD A;  1MP5 A;  2WVL A;  3V0P A;  3Q80 A;  4NAL A;  4L41 C;  3DUV A;  1W55 A;  1G0R A;  1NHE B;  3OC9 A;  4CJC A;  3IOH A;  2XWM A;  3O3P A;  5CMG X;  1XHB A;  3I0D A;  3RMW A;  2X60 A;  3BRK X;  1NWG B;  1ZCV A;  4Y63 A;  3P47 A;  1FGG A;  2W0V A;  4R36 A;  5E3P A;  1FGX A;  3I0C A;  2QIV X;  1EYR A;  1SS9 A;  3U2T A;  1H5S D;  5CMJ A;  1FRW A;  4YS8 A;  1H7F A;  1MR9 A;  1VGT A;  1H4C A;  5CQN X;  1MR7 A;  5FU0 A;  2VFZ A;  1R7Y A;  2WEE A;  1H4D A;  4LW6 A;  1E5K A;  4HO0 A;  4Y9X A;  4B42 A;  2FFV A;  3R3R A;  3SXC A;  4N6B A;  5FV9 A;  3R8Y A;  1KHR A;  1H7G A;  1LZI A;  1WSZ A;  5E3R A;  5IDT A;  4KXO A;  4EEM A;  1ZI5 A;  2D7R A;  3SRT A;  4CJB A;  4CVH A;  2A8W A;  1W77 A;  5C36 A;  2Y7A A;  3V0Q A;  2QH5 A;  1S4P A;  3ZF8 A;  1YRO B;  4Y7V A;  4EA8 A;  1GQC A;  1LL3 A;  4AYL A;  1LL0 A;  2Z87 A;  5AFU U;  4MYO A;  4E1K A;  1TVY A;  2Y4K A;  3U0X A;  2OI7 A;  3D8V A;  2RJ9 A;  1HM0 A;  4JIS A;  1VZX A;  4BMA A;  1QRE A;  1G9R A;  2AQ9 A;  3EG4 A;  4CJ8 A;  4H7O A;  1GX4 A;  1MRL A;  4HG6 A;  3I0K A;  3F1Y A;  3GUE A;  3KWC A;  2VS5 A;  3HJJ A;  2JCJ A;  5C49 A;  2P72 A;  1ZI1 A;  4ZDQ A;  2ICY A;  2IU9 A;  5FTV A;  5DEP A;  3VNP A;  1V83 A;  3I0G A;  5U2K A;  3CKV A;  3RMV A;  3BSS A;  2VHE A;  1VH3 A;  2FFU A;  2AM5 A;  1G1L A;  3DHO A;  3OU9 A;  2V0L A;  3CKO A;  3OUP A;  1H7H A;  3IOJ A;  2QKX A;  3OW5 A;  4FRQ A;  4KPZ A;  2FYC B;  3VBN A;  5C3A A;  2GGO A;  2XWL A;  4EVW A;  2JCO A;  2WVK A;  3TIO A;  1QQ0 A;  1R80 A;  4Y6U A;  5FUH A;  4DEC A;  1KK6 A;  1FWY A;  4HZC A;  1QRF A;  4DDZ A;  4FRB A;  5DDT A;  4ASJ A;  1G23 A;  2ZU8 A;  3FSY A;  3T7O A;  3U0Y A;  5C4B A;  2WAW A;  3HL3 A;  4LW3 A;  4Y7F A;  3R0S A;  1H4E A;  1HM8 A;  1ZJ3 A;  3JUK A;  1YP3 A;  4HO9 A;  3VBJ A;  3F1X A;  5C4E A;  3HSQ A;  2OEG A;  2TDT A;  1XAT A;  3I0F A;  4NAK A;  5C1L A;  4MND A;  2RIX A;  3E26 A; 
#chains in the Genus database with same CATH topology
 2FYB A;  5C1H A;  2WGZ A;  4B4M A;  2WLF A;  2VXM A;  1KQA A;  1Z90 A;  4HOC A;  1VIC A;  1LXA A;  3F1C A;  3C8V A;  3R2W A;  1EZI A;  3BSY A;  1H5S A;  2PGV A;  4HUS A;  4IHH A;  4HO2 A;  1KWS A;  1ON8 A;  3GQ9 A;  1I52 A;  1QRL A;  2CU2 A;  2FYA A;  4AA7 A;  1H7T A;  1QGQ A;  3V8Z A;  3DK5 A;  3CGX A;  3ST8 A;  1R7V A;  2DPW A;  4XWI A;  2APC A;  2E3D A;  3V90 A;  1LZJ A;  4JD0 A;  2GGQ A;  2RIY A;  3V4E A;  2YQH A;  5CQO A;  4Y62 A;  3NZ2 A;  2AH9 A;  2VS3 A;  3BXY A;  4KC2 A;  3SX3 A;  3MQH A;  4EA7 A;  3NGW A;  1ZIZ A;  4ARW A;  2MZB A;  1G8O A;  2YQJ A;  1OMZ A;  3I3A A;  1H3M A;  1VGZ A;  3V8Y A;  1H5R B;  1IIN A;  3U2V A;  4Y64 A;  1ZCT A;  1GX0 A;  1HJJ A;  1YP4 A;  5J49 A;  1ZHJ A;  4FCU A;  3TK8 A;  4MYB A;  4P02 A;  1ZJ1 A;  2RIT A;  1H7L A;  3OH1 A;  2ZU9 A;  1NQI B;  1H5T B;  2XMH A;  1W57 A;  4C2S A;  3BCV A;  5CQL X;  3T7N A;  2WLG A;  2WLD A;  4N6A A;  2XME A;  5EJZ A;  4B2W A;  1KGT A;  3SXD A;  4P00 A;  1FXJ A;  1HM9 A;  3PKP A;  1QRG A;  5CQP A;  3I0I X;  2PGY A;  2JCL A;  2AE7 A;  1HV9 A;  2AEC A;  4D48 A;  4MIX A;  1KK4 A;  1ZJO A;  1Z2F A;  5AJO A;  4BQH A;  3V91 A;  1JVG A;  4GBP A;  2RJ5 A;  2WVM A;  1NMM B;  2A8U A;  3R5B A;  1GQ9 A;  1NKH B;  1O7O A;  5C48 A;  1QRM A;  3T57 A;  3RSB A;  1ZJ2 A;  2VSI A;  1VM8 A;  3CKQ A;  4J18 A;  4M2B A;  4FCE A;  1JVD A;  1OCX A;  3P1B A;  4FRM A;  1H5R A;  3SX8 A;  5I1F A;  1TW1 A;  4FRA A;  3TDT A;  1QGS A;  2RJ0 A;  1ZCY A;  2C0N A;  2VS4 A;  3Q1X A;  2O1F A;  2Y4M A;  3GQ7 A;  5CMF X;  4HCQ A;  4HO3 A;  1INI A;  2VSH A;  2YQC A;  1ZJ0 A;  3PNN A;  1H5S C;  2VXL A;  2RJ7 A;  2PA4 A;  2X65 A;  3SX7 A;  3I0E A;  4R7P A;  1V67 A;  3EH0 A;  3CU0 A;  4NAI A;  4AYJ A;  3OKR A;  4EEG A;  4IRP A;  3Q7U A;  1FXO A;  3IGJ A;  1JV1 A;  2OI6 A;  4NAN A;  1V84 A;  1TDT A;  1FO9 A;  3U2X A;  2BO6 A;  1JYK A;  3V0O A;  5FYE A;  3ZLK A;  3R1W A;  3IOI A;  1ZI3 A;  4IRQ A;  5BXC A;  5C4F A;  4ASY A;  1R7T A;  2FKO A;  2JF2 A;  2AM4 A;  3CKN A;  3I0L A;  1H7E A;  3SUC A;  1SSM A;  2Q4J A;  3FOQ A;  5FU8 A;  2QGI A;  1S80 A;  4B5B A;  4KNX A;  1INJ A;  2QIA A;  3JUJ A;  1ZCU A;  3FSX A;  3ZLL A;  1R81 A;  2UX8 A;  2JF3 A;  1G95 A;  5ADX V;  1ZDG A;  1MC3 A;  1TW5 A;  1H7Q A;  3MC4 A;  4EEA A;  2D7I A;  3JQY A;  1NF5 B;  3TQD A;  1PZT A;  1SSQ A;  3ZGF A;  4D11 A;  2V0K A;  1V3W A;  3GOS A;  1WT0 A;  1R7U A;  3SX5 A;  1XHD A;  4R37 A;  1G2V A;  1L0S A;  4EE5 A;  5D91 A;  2RJ4 A;  5C8R A;  2WLC A;  1V82 A;  4B3U A;  4M28 A;  3ZGG A;  3VBP A;  1FR8 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  2O1G A;  3KIA A;  3U2W A;  3OH3 A;  1KRV A;  5C3D A;  3K8E A;  3QVB A;  1VH1 A;  4E75 A;  4EAA A;  1WVC A;  2X5Z A;  4HO8 A;  1VPA A;  4KT7 A;  2BO7 A;  2AM3 A;  2Y6P A;  3E25 A;  1JYL A;  4N69 A;  1FOA A;  1OMX A;  2VD4 A;  2YCM A;  5IFY A;  2OI5 A;  4FRO A;  3VBL A;  3D98 A;  3OTZ A;  2D0J A;  2RJ6 A;  4B4B A;  4IHG A;  3PMO A;  4EE3 A;  4K6R A;  1FG5 N;  3OTM A;  4MZU A;  4AC3 A;  2Y4L A;  4KC4 A;  4M4K A;  5C4D A;  5HS2 A;  4KC1 A;  2WLE A;  2IC7 A;  3TZT A;  3VBI A;  4DE7 A;  5DG3 A;  2AES A;  2YQS A;  2W0W A;  2YC3 A;  1GWW A;  1TZF A;  1G97 A;  4G3P A;  4FIY A;  3OH4 A;  1LL2 A;  4B4G A;  3I3X A;  2IUA A;  5C3B A;  1G3L A;  3DJ4 A;  2NPO A;  4KQL A;  3R5A A;  1MP3 A;  3ECT A;  2O1H A;  1O23 B;  4J09 A;  3I0J A;  1WT2 A;  2RIJ A;  4EEO A;  5C47 A;  2RJ1 A;  2YC5 A;  4D0T A;  3OGZ A;  4E6T A;  3OH0 A;  4DCL A;  5ADX U;  4FRD A;  3POL A;  3VBK A;  3EEV A;  2NXV A;  1G93 A;  4FRP A;  1VGU A;  5CMI A;  3FWW A;  2WE9 A;  4HO6 A;  1O7Q A;  4ECM A;  3OH2 A;  1KRR A;  1LVW A;  1QWJ A;  4N27 A;  1K4V A;  1FO8 A;  3KWD A;  1LZ0 A;  2V0I A;  4D11 C;  3EE5 A;  3SXA A;  4M2A A;  1ON6 A;  1HJL A;  2ICX A;  3BSW A;  1H5T A;  3VBM A;  3V0L A;  1WT3 A;  3SXG A;  5EJ1 A;  3CJ8 A;  1MP4 A;  3USQ A;  3N9W A;  1ZDF A;  4EGG A;  5L6S A;  5DEM A;  5F42 A;  1FZW A;  4D0Z A;  2XWN A;  2YES A;  1M8N A;  4UEG A;  3SXB A;  1KK5 A;  2X5S A;  5IDS A;  4Y7U A;  1WT1 A;  3BFP A;  3TV0 A;  5JQQ A;  5AJP A;  3MQG A;  1OQM B;  4EQY A;  5CQM X;  2FYD B;  1S4O A;  1VZU A;  3R5C A;  3Q4S A;  4EAB A;  4KNR A;  2RIZ A;  3SPT A;  1H5S B;  4E79 A;  4HZD A;  3FS8 A;  3T7M A;  5L6V A;  3U2U A;  4M98 A;  1PZY B;  3IXC A;  4FRL A;  3KWE A;  2P6W A;  5C38 A;  1KGQ A;  4HO5 A;  4B2X A;  2P2O A;  1ZJP A;  1SST A;  2JCK A;  1IIM A;  2J0A A;  1GA8 A;  1JV3 A;  4FRH A;  1FR9 A;  2RJ8 A;  4KRV A;  3D5N A;  3PKQ A;  1O0R A;  1THJ A;  3FSC A;  4EE4 A;  5AJN A;  4M9C A;  3TWD A;  5C4C A;  2I5E A;  1J2Z A;  2V0J A;  3K8D A;  4M99 A;  1XZ6 A;  2P73 A;  3R5D A;  2Z86 A;  3CKJ A;  4FRE A;  4Y7T A;  4IHF A;  2BO4 A;  4MFG A;  1QG8 A;  5AFU V;  5FTS A;  2V0H A;  2VK9 A;  4HUR A;  4G87 A;  2Y4J A;  2IU8 A;  3JTJ A;  4G3Q A;  3LW6 A;  4Y6N A;  5DDV A;  2ZU7 A;  2PX7 A;  2XAT A;  1KRU A;  1ZI4 A;  5CMH A;  3V0M A;  5C1G A;  5E3Q A;  2I5K A;  1R7X A;  3I0H A;  2AGD A;  2FY7 A;  2E8B A;  3FSB A;  3R3I A;  1T3D A;  4EA9 A;  1LZ7 A;  2I7B A;  1GWV A;  3OAM A;  4FQW A;  2BO8 A;  3TIS A;  4FIX A;  1VGW A;  4HO4 A;  1R82 A;  1S4N A;  4AAW A;  2OEF A;  3USR A;  1YP2 A;  4KPX A;  4Y7G A;  5EIY A;  3V0N A;  3SXE A;  1VZT A;  3GVD A;  1MP5 A;  2WVL A;  3V0P A;  3Q80 A;  4NAL A;  4L41 C;  3DUV A;  1W55 A;  1G0R A;  1NHE B;  3OC9 A;  4CJC A;  3IOH A;  2XWM A;  3O3P A;  5CMG X;  1XHB A;  3I0D A;  3RMW A;  2X60 A;  3BRK X;  1NWG B;  1ZCV A;  4Y63 A;  3P47 A;  1FGG A;  2W0V A;  4R36 A;  5E3P A;  1FGX A;  3I0C A;  2QIV X;  1EYR A;  1SS9 A;  3U2T A;  1H5S D;  5CMJ A;  1FRW A;  4YS8 A;  1H7F A;  1MR9 A;  1VGT A;  1H4C A;  5CQN X;  3GQA A;  1MR7 A;  5FU0 A;  2VFZ A;  1R7Y A;  2WEE A;  1H4D A;  4O6N A;  4LW6 A;  1E5K A;  4HO0 A;  4Y9X A;  4B42 A;  2FFV A;  3R3R A;  3SXC A;  4N6B A;  5FV9 A;  3R8Y A;  1KHR A;  1H7G A;  1LZI A;  1WSZ A;  5E3R A;  5IDT A;  4KXO A;  4EEM A;  1ZI5 A;  2D7R A;  3SRT A;  4CJB A;  4CVH A;  2A8W A;  1W77 A;  5C36 A;  2Y7A A;  3V0Q A;  4O6M A;  2QH5 A;  1S4P A;  3ZF8 A;  1YRO B;  4Q7C A;  4Y7V A;  4EA8 A;  1GQC A;  1LL3 A;  4AYL A;  1LL0 A;  2Z87 A;  5AFU U;  4MYO A;  4E1K A;  1TVY A;  2Y4K A;  3U0X A;  2OI7 A;  3D8V A;  2RJ9 A;  1HM0 A;  4JIS A;  1VZX A;  4BMA A;  1QRE A;  1G9R A;  2AQ9 A;  3EG4 A;  4CJ8 A;  4H7O A;  1GX4 A;  1MRL A;  4HG6 A;  5D92 A;  3I0K A;  3F1Y A;  3GUE A;  3KWC A;  2VS5 A;  3HJJ A;  2JCJ A;  5C49 A;  2P72 A;  1ZI1 A;  4ZDQ A;  2ICY A;  2IU9 A;  5FTV A;  5DEP A;  3VNP A;  1V83 A;  3I0G A;  5U2K A;  3CKV A;  3RMV A;  3BSS A;  2VHE A;  1VH3 A;  2FFU A;  2AM5 A;  1G1L A;  3DHO A;  3OU9 A;  2V0L A;  3CKO A;  3OUP A;  1H7H A;  3IOJ A;  2QKX A;  3OW5 A;  4FRQ A;  4KPZ A;  2FYC B;  3VBN A;  5C3A A;  2GGO A;  2XWL A;  4EVW A;  2JCO A;  1EWW A;  2WVK A;  3TIO A;  1QQ0 A;  1R80 A;  4Y6U A;  5FUH A;  4DEC A;  1KK6 A;  1FWY A;  4HZC A;  1QRF A;  4DDZ A;  4FRB A;  5DDT A;  4ASJ A;  1G23 A;  2ZU8 A;  3FSY A;  3T7O A;  2J0B A;  3U0Y A;  5C4B A;  2WAW A;  3HL3 A;  4LW3 A;  4Y7F A;  3R0S A;  1H4E A;  1HM8 A;  1ZJ3 A;  3JUK A;  1N4I A;  1YP3 A;  4HO9 A;  3VBJ A;  3F1X A;  5C4E A;  3HSQ A;  2OEG A;  2TDT A;  1XAT A;  3I0F A;  4NAK A;  3GQ8 A;  5C1L A;  4MND A;  2RIX A;  3E26 A; 
#chains in the Genus database with same CATH homology
 2FYB A;  5C1H A;  2WGZ A;  4B4M A;  2WLF A;  2VXM A;  1KQA A;  1Z90 A;  4HOC A;  1VIC A;  1LXA A;  3F1C A;  3C8V A;  3R2W A;  1EZI A;  3BSY A;  1H5S A;  2PGV A;  4HUS A;  4IHH A;  4HO2 A;  1KWS A;  1ON8 A;  1I52 A;  1QRL A;  2CU2 A;  2FYA A;  4AA7 A;  1H7T A;  1QGQ A;  3V8Z A;  3DK5 A;  3CGX A;  3ST8 A;  1R7V A;  2DPW A;  4XWI A;  2APC A;  2E3D A;  3V90 A;  1LZJ A;  4JD0 A;  2GGQ A;  2RIY A;  3V4E A;  2YQH A;  5CQO A;  4Y62 A;  3NZ2 A;  2AH9 A;  2VS3 A;  3BXY A;  4KC2 A;  3SX3 A;  3MQH A;  4EA7 A;  3NGW A;  1ZIZ A;  4ARW A;  2MZB A;  1G8O A;  2YQJ A;  1OMZ A;  3I3A A;  1H3M A;  1VGZ A;  3V8Y A;  1H5R B;  1IIN A;  3U2V A;  4Y64 A;  1ZCT A;  1GX0 A;  1HJJ A;  1YP4 A;  5J49 A;  1ZHJ A;  4FCU A;  3TK8 A;  4MYB A;  4P02 A;  1ZJ1 A;  2RIT A;  1H7L A;  3OH1 A;  2ZU9 A;  1NQI B;  1H5T B;  2XMH A;  1W57 A;  4C2S A;  3BCV A;  5CQL X;  3T7N A;  2WLG A;  2WLD A;  4N6A A;  2XME A;  5EJZ A;  4B2W A;  1KGT A;  3SXD A;  4P00 A;  1FXJ A;  1HM9 A;  3PKP A;  1QRG A;  5CQP A;  3I0I X;  2PGY A;  2JCL A;  2AE7 A;  1HV9 A;  2AEC A;  4D48 A;  4MIX A;  1KK4 A;  1ZJO A;  5AJO A;  4BQH A;  3V91 A;  1JVG A;  4GBP A;  2RJ5 A;  2WVM A;  1NMM B;  2A8U A;  3R5B A;  1GQ9 A;  1NKH B;  1O7O A;  5C48 A;  1QRM A;  3T57 A;  3RSB A;  1ZJ2 A;  2VSI A;  1VM8 A;  3CKQ A;  4J18 A;  4M2B A;  4FCE A;  1JVD A;  1OCX A;  3P1B A;  4FRM A;  1H5R A;  3SX8 A;  5I1F A;  1TW1 A;  4FRA A;  3TDT A;  1QGS A;  2RJ0 A;  1ZCY A;  2C0N A;  2VS4 A;  3Q1X A;  2O1F A;  2Y4M A;  5CMF X;  4HCQ A;  4HO3 A;  1INI A;  2VSH A;  2YQC A;  1ZJ0 A;  3PNN A;  1H5S C;  2VXL A;  2RJ7 A;  2PA4 A;  2X65 A;  3SX7 A;  3I0E A;  4R7P A;  1V67 A;  3EH0 A;  3CU0 A;  4NAI A;  4AYJ A;  3OKR A;  4EEG A;  4IRP A;  3Q7U A;  1FXO A;  3IGJ A;  1JV1 A;  2OI6 A;  4NAN A;  1V84 A;  1TDT A;  1FO9 A;  3U2X A;  2BO6 A;  1JYK A;  3V0O A;  5FYE A;  3ZLK A;  3R1W A;  3IOI A;  1ZI3 A;  4IRQ A;  5BXC A;  5C4F A;  4ASY A;  1R7T A;  2FKO A;  2JF2 A;  2AM4 A;  3CKN A;  3I0L A;  1H7E A;  1SSM A;  2Q4J A;  3FOQ A;  5FU8 A;  2QGI A;  1S80 A;  4B5B A;  4KNX A;  1INJ A;  2QIA A;  3JUJ A;  1ZCU A;  3FSX A;  3ZLL A;  1R81 A;  2UX8 A;  2JF3 A;  1G95 A;  5ADX V;  1ZDG A;  1MC3 A;  1TW5 A;  1H7Q A;  3MC4 A;  4EEA A;  2D7I A;  3JQY A;  1NF5 B;  3TQD A;  1PZT A;  1SSQ A;  3ZGF A;  4D11 A;  2V0K A;  1V3W A;  3GOS A;  1WT0 A;  1R7U A;  3SX5 A;  1XHD A;  4R37 A;  1G2V A;  4EE5 A;  5D91 A;  2RJ4 A;  5C8R A;  2WLC A;  1V82 A;  4B3U A;  4M28 A;  3ZGG A;  3VBP A;  1FR8 A;  4ISX A;  4E6U A;  4G3S A;  3FTT A;  2O1G A;  3KIA A;  3U2W A;  3OH3 A;  1KRV A;  5C3D A;  3K8E A;  3QVB A;  1VH1 A;  4E75 A;  4EAA A;  1WVC A;  2X5Z A;  4HO8 A;  1VPA A;  4KT7 A;  2BO7 A;  2AM3 A;  2Y6P A;  3E25 A;  1JYL A;  4N69 A;  1FOA A;  1OMX A;  2VD4 A;  2YCM A;  5IFY A;  2OI5 A;  4FRO A;  3VBL A;  3D98 A;  3OTZ A;  2D0J A;  2RJ6 A;  4B4B A;  4IHG A;  3PMO A;  4EE3 A;  4K6R A;  1FG5 N;  3OTM A;  4MZU A;  4AC3 A;  2Y4L A;  4KC4 A;  4M4K A;  5C4D A;  5HS2 A;  4KC1 A;  2WLE A;  2IC7 A;  3TZT A;  3VBI A;  4DE7 A;  5DG3 A;  2AES A;  2YQS A;  2W0W A;  2YC3 A;  1GWW A;  1TZF A;  1G97 A;  4G3P A;  4FIY A;  3OH4 A;  1LL2 A;  4B4G A;  3I3X A;  2IUA A;  5C3B A;  1G3L A;  3DJ4 A;  2NPO A;  4KQL A;  3R5A A;  1MP3 A;  3ECT A;  2O1H A;  1O23 B;  4J09 A;  3I0J A;  1WT2 A;  2RIJ A;  4EEO A;  5C47 A;  2RJ1 A;  2YC5 A;  4D0T A;  3OGZ A;  4E6T A;  3OH0 A;  4DCL A;  5ADX U;  4FRD A;  3POL A;  3VBK A;  3EEV A;  2NXV A;  1G93 A;  4FRP A;  1VGU A;  5CMI A;  3FWW A;  2WE9 A;  4HO6 A;  1O7Q A;  4ECM A;  1LVW A;  1KRR A;  3OH2 A;  1QWJ A;  4N27 A;  1K4V A;  1FO8 A;  3KWD A;  1LZ0 A;  2V0I A;  4D11 C;  3EE5 A;  3SXA A;  4M2A A;  1ON6 A;  1HJL A;  2ICX A;  3BSW A;  1H5T A;  3VBM A;  3V0L A;  1WT3 A;  3SXG A;  5EJ1 A;  3CJ8 A;  1MP4 A;  3USQ A;  3N9W A;  1ZDF A;  4EGG A;  5L6S A;  5DEM A;  5F42 A;  1FZW A;  4D0Z A;  2XWN A;  2YES A;  4UEG A;  3SXB A;  1KK5 A;  2X5S A;  5IDS A;  4Y7U A;  1WT1 A;  3BFP A;  3TV0 A;  5JQQ A;  5AJP A;  3MQG A;  1OQM B;  4EQY A;  5CQM X;  2FYD B;  1S4O A;  1VZU A;  3R5C A;  3Q4S A;  4EAB A;  4KNR A;  2RIZ A;  3SPT A;  1H5S B;  4E79 A;  4HZD A;  3FS8 A;  3T7M A;  5L6V A;  3U2U A;  4M98 A;  1PZY B;  3IXC A;  4FRL A;  3KWE A;  2P6W A;  5C38 A;  1KGQ A;  4HO5 A;  4B2X A;  2P2O A;  1ZJP A;  1SST A;  2JCK A;  1IIM A;  2J0A A;  1GA8 A;  1JV3 A;  4FRH A;  1FR9 A;  2RJ8 A;  4KRV A;  3D5N A;  3PKQ A;  1O0R A;  1THJ A;  3FSC A;  4EE4 A;  5AJN A;  4M9C A;  3TWD A;  5C4C A;  2I5E A;  1J2Z A;  2V0J A;  3K8D A;  4M99 A;  1XZ6 A;  2P73 A;  3R5D A;  2Z86 A;  3CKJ A;  4FRE A;  4Y7T A;  4IHF A;  2BO4 A;  4MFG A;  1QG8 A;  5AFU V;  5FTS A;  2V0H A;  2VK9 A;  4HUR A;  4G87 A;  2Y4J A;  2IU8 A;  3JTJ A;  4G3Q A;  3LW6 A;  4Y6N A;  5DDV A;  2ZU7 A;  2PX7 A;  2XAT A;  1KRU A;  1ZI4 A;  5CMH A;  3V0M A;  5C1G A;  5E3Q A;  2I5K A;  1R7X A;  3I0H A;  2AGD A;  2FY7 A;  2E8B A;  3FSB A;  3R3I A;  1T3D A;  4EA9 A;  1LZ7 A;  2I7B A;  1GWV A;  3OAM A;  4FQW A;  2BO8 A;  3TIS A;  4FIX A;  1VGW A;  4HO4 A;  1R82 A;  1S4N A;  4AAW A;  2OEF A;  3USR A;  1YP2 A;  4KPX A;  4Y7G A;  5EIY A;  3V0N A;  3SXE A;  1VZT A;  3GVD A;  1MP5 A;  2WVL A;  3V0P A;  3Q80 A;  4NAL A;  4L41 C;  3DUV A;  1W55 A;  1G0R A;  1NHE B;  3OC9 A;  4CJC A;  3IOH A;  2XWM A;  3O3P A;  5CMG X;  1XHB A;  3I0D A;  3RMW A;  2X60 A;  3BRK X;  1NWG B;  1ZCV A;  4Y63 A;  3P47 A;  1FGG A;  2W0V A;  4R36 A;  5E3P A;  1FGX A;  3I0C A;  2QIV X;  1EYR A;  1SS9 A;  3U2T A;  1H5S D;  5CMJ A;  1FRW A;  4YS8 A;  1H7F A;  1MR9 A;  1VGT A;  1H4C A;  5CQN X;  1MR7 A;  5FU0 A;  2VFZ A;  1R7Y A;  2WEE A;  1H4D A;  4O6N A;  4LW6 A;  1E5K A;  4HO0 A;  4Y9X A;  4B42 A;  2FFV A;  3R3R A;  3SXC A;  4N6B A;  5FV9 A;  3R8Y A;  1KHR A;  1H7G A;  1LZI A;  1WSZ A;  5E3R A;  5IDT A;  4KXO A;  4EEM A;  1ZI5 A;  2D7R A;  3SRT A;  4CJB A;  4CVH A;  2A8W A;  1W77 A;  5C36 A;  2Y7A A;  3V0Q A;  4O6M A;  2QH5 A;  1S4P A;  3ZF8 A;  1YRO B;  4Q7C A;  4Y7V A;  4EA8 A;  1GQC A;  1LL3 A;  4AYL A;  1LL0 A;  2Z87 A;  5AFU U;  4MYO A;  4E1K A;  1TVY A;  2Y4K A;  3U0X A;  2OI7 A;  3D8V A;  2RJ9 A;  1HM0 A;  4JIS A;  1VZX A;  4BMA A;  1QRE A;  1G9R A;  2AQ9 A;  3EG4 A;  4CJ8 A;  4H7O A;  1GX4 A;  1MRL A;  4HG6 A;  5D92 A;  3I0K A;  3F1Y A;  3GUE A;  3KWC A;  2VS5 A;  3HJJ A;  2JCJ A;  5C49 A;  2P72 A;  1ZI1 A;  4ZDQ A;  2ICY A;  2IU9 A;  5FTV A;  5DEP A;  3VNP A;  1V83 A;  3I0G A;  5U2K A;  3CKV A;  3RMV A;  3BSS A;  2VHE A;  1VH3 A;  2FFU A;  2AM5 A;  1G1L A;  3DHO A;  3OU9 A;  2V0L A;  3CKO A;  3OUP A;  1H7H A;  3IOJ A;  2QKX A;  3OW5 A;  4FRQ A;  4KPZ A;  2FYC B;  3VBN A;  5C3A A;  2GGO A;  2XWL A;  4EVW A;  2JCO A;  2WVK A;  3TIO A;  1QQ0 A;  1R80 A;  4Y6U A;  5FUH A;  4DEC A;  1KK6 A;  1FWY A;  4HZC A;  1QRF A;  4DDZ A;  4FRB A;  5DDT A;  4ASJ A;  1G23 A;  2ZU8 A;  3FSY A;  3T7O A;  2J0B A;  3U0Y A;  5C4B A;  2WAW A;  3HL3 A;  4LW3 A;  4Y7F A;  3R0S A;  1H4E A;  1HM8 A;  1ZJ3 A;  3JUK A;  1YP3 A;  4HO9 A;  3VBJ A;  3F1X A;  5C4E A;  3HSQ A;  2OEG A;  2TDT A;  1XAT A;  3I0F A;  4NAK A;  5C1L A;  4MND A;  2RIX A;  3E26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...