5L6SA

Crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a positive allosteric regulator beta-fructose-1,6-diphosphate (fbp) - agpase*fbp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
421
structure length
409
Chain Sequence
LMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPATADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 130
structure length 409
sequence length 421
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5l6sA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5l6sA01
3CJ8A 1G2VA 1MC3A 4KC4A 3OH4A 4Y63A 3NGWA 1QRMA 3GUEA 3MQGA 2I7BA 4EA8A 5CQNX 4CJCA 3OTMA 1GX4A 1Z90A 2WLDA 2VFZA 1VZTA 2Y4KA 3GVDA 4EA7A 3CKQA 4ASJA 2RIJA 1ZJPA 1JVDA 1VH3A 1ZI1A 4M9CA 5C4DA 4Y7GA 5L6SA 3V0PA 4P00A 2RITA 3CU0A 1ZCTA 2QIVX 4IRQA 3MC4A 1VZXA 4XWIA 3SX5A 2VXLA 1INIA 3POLA 5IDTA 1KHRA 5U2KA 2VS3A 2JCKA 4AC3A 2AECA 1XZ6A 1VH1A 3OC9A 1KRVA 1H4EA 1JVGA 2BO8A 4FRAA 1SSQA 1ZDGA 1QGSA 1S80A 1ZCYA 1K4VA 4ISXA 2GGOA 3VBIA 2O1FA 3TQDA 2WLEA 1XATA 1R81A 4E6TA 4EQYA 2W0WA 5DDTA 3IXCA 2P73A 1R7TA 1MR9A 5DDVA 2O1HA 1S4NA 1H7QA 4KNRA 1HM8A 3KWDA 4EEGA 3Q1XA 5C1HA 4AYLA 4FRMA 1LL0A 2OI6A 4IHFA 2AQ9A 3ST8A 4KPZA 4EE4A 2P72A 4R7PA 1ZI5A 1GQ9A 2E3DA 3QVBA 3V91A 2WEEA 4N69A 4Y6UA 4CVHA 2ZU8A 2AM5A 1VICA 1WT3A 2RJ9A 5FTSA 1G9RA 5FUHA 1TW5A 2RJ8A 3K8DA 5C3DA 4EE3A 1SS9A 5I1FA 4N6BA 2Y4MA 4DECA 2XWNA 1G8OA 3OW5A 2CU2A 3OGZA 2V0JA 1OQMB 1S4PA 3TV0A 1H5RB 4D0TA 5IFYA 3HJJA 1JYLA 1G0RA 1YP4A 3U2XA 1JYKA 2Y7AA 2YCMA 1H5SB 2FY7A 3R2WA 3VBNA 2V0HA 5C47A 2JCOA 2JCJA 1G95A 3P47A 1GQCA 1S4OA 2PX7A 2PGYA 1QRLA 4YS8A 2XATA 4B3UA 2BO4A 3T7OA 4E1KA 2IC7A 1V3WA 4FRBA 2XWMA 1J2ZA 1MRLA 1FZWA 3SXEA 4IHGA 3EE5A 4EEMA 2Z86A 1O7QA 5CMGX 4Y7FA 2RJ0A 1SSMA 1QRGA 2WLCA 1G3LA 1QG8A 2D7IA 5CQMX 4FCEA 4EA9A 1TW1A 3U0YA 3R5AA 3Q80A 1H5RA 3R5DA 2WAWA 4P02A 2JCLA 1KK4A 4J18A 4E75A 1ON6A 2WE9A 4B5BA 1NWGB 5J49A 1JV1A 3FOQA 3ZF8A 3DK5A 4ECMA 5CMJA 1NF5B 2QGIA 3I0JA 4ASYA 4Y9XA 2WLFA 3OUPA 1H5TB 1QRFA 2UX8A 1HJJA 1ZHJA 3OH1A 4HO6A 4L41C 4FRPA 4KC2A 1OCXA 4G3SA 4D11C 4LW3A 5ADXU 3KWEA 1KK6A 4J09A 1FOAA 1O23B 2VS5A 2RIZA 1ZI3A 5DEMA 4E79A 3DUVA 2QKXA 3OU9A 4KPXA 4AA7A 2Y4LA 4NANA 3I0IX 1MP4A 3V0LA 1KK5A 1H7HA 3F1XA 4DDZA 1VGZA 1H7EA 1LZ0A 1W77A 1FG5N 2I5KA 2JF2A 4Y7VA 2P2OA 3RMWA 4LW6A 3JUKA 3I0DA 3BFPA 4GBPA 2RJ1A 3R3IA 1HV9A 3KWCA 1KRRA 3MQHA 2X5ZA 4IRPA 4R37A 3R3RA 4DCLA 1VGWA 1ZJ0A 3BCVA 3V0OA 3U2WA 4DE7A 3DHOA 1G1LA 5AFUV 1W57A 2D7RA 1H5TA 1LL3A 4Y7TA 4HURA 1ZDFA 3EG4A 2IUAA 3CKOA 2FYDB 3T7MA 1WT1A 2W0VA 4JISA 2VSHA 3SXAA 1EZIA 1GWWA 1ZJ2A 1GWVA 3VBMA 4HZDA 3TZTA 4G3PA 3VBPA 5IDSA 4FRLA 1VM8A 3I0GA 3IOHA 5AJOA 1FO8A 3FSXA 2Y4JA 2YQSA 1YP3A 1V67A 1INJA 2V0KA 3E26A 4CJBA 4EGGA 4K6RA 4D0ZA 4HO5A 4G87A 2BO7A 3VNPA 5CMIA 2YESA 2Z87A 4HO4A 3F1YA 1H5SC 5C3BA 2FFUA 2RIXA 4B2WA 4HOCA 3V4EA 3VBLA 1FRWA 2QH5A 4KRVA 4HO9A 1ON8A 1ZCVA 4BMAA 2YQJA 4FQWA 4NALA 4EVWA 1G93A 1WT0A 5CQOA 3BSWA 3PKQA 2DPWA 3SXDA 3OH0A 3TISA 5E3RA 3GOSA 1H4CA 3V0NA 3BRKX 3BSYA 3U2TA 2OI7A 1GX0A 1WT2A 2MZBA 3V90A 1YP2A 5AJNA 2Q4JA 2V0LA 1T3DA 3D98A 2A8UA 2FKOA 1H3MA 2RJ5A 1R80A 1VGTA 2IU9A 3Q7UA 2YC5A 1JV3A 4Y64A 3CKVA 4MYBA 1ZCUA 2AH9A 5C48A 4NAIA 3RMVA 1ZI4A 1LZIA 3IOIA 2ZU9A 3I0EA 4FRQA 1LVWA 1NMMB 1HJLA 3OKRA 1IIMA 1TVYA 1TDTA 2WVMA 2XMEA 4MNDA 2AM3A 5FU0A 2WLGA 2FYBA 1LL2A 2D0JA 4ZDQA 3V0QA 2ICXA 3SX7A 3CGXA 5CMHA 3HSQA 3T7NA 5C4FA 1H4DA 5E3PA 3TK8A 3RSBA 5FYEA 2OI5A 3I0KA 4N27A 4B42A 3NZ2A 4MZUA 4E6UA 1R7VA 3USQA 1R7XA 3JUJA 5FV9A 4MYOA 5EJ1A 1V83A 2OEGA 3TDTA 1IINA 1H7TA 3P1BA 5CQPA 1KWSA 2X60A 5FTVA 5C36A 3K8EA 3R5CA 3I0CA 4HO3A 2BO6A 1MP5A 3KIAA 2RJ6A 3EEVA 1H7GA 1QGQA 2AE7A 5BXCA 2APCA 3FSCA 1NHEB 1FGXA 2VSIA 2FYAA 3ZGGA 4M99A 3D8VA 4AAWA 2O1GA 2YQCA 3U2UA 3FS8A 1XHDA 4NAKA 3VBKA 2PA4A 4HG6A 1GA8A 4HO8A 4HZCA 5DEPA 4R36A 4G3QA 2VD4A 1THJA 2X65A 5C4BA 1NQIB 4M28A 5L6VA 5C38A 3ECTA 3FSBA 4FROA 2XWLA 3SXGA 1KGTA 4Y6NA 5C1GA 1WVCA 4EE5A 3SPTA 1OMXA 3PNNA 3SRTA 4HUSA 3PKPA 2ICYA 2TDTA 4HO0A 1E5KA 1SSTA 4CJ8A 3IGJA 3BXYA 3I3XA 4KNXA 1V84A 4Y62A 3SXBA 2V0IA 5F42A 1FGGA 3Q4SA 1TZFA 1W55A 1KRUA 3DJ4A 3O3PA 4KXOA 2YC3A 2WVLA 4EAAA 2Y6PA 1V82A 1I52A 3CKNA 1MP3A 1OMZA 2NXVA 1HM9A 2ZU7A 1FWYA 1G23A 5AFUU 1NKHB 2RIYA 2RJ4A 1R7UA 2E8BA 2IU8A 2VHEA 4FRHA 4IHHA 4B4GA 3V8YA 2AESA 4AYJA 4KT7A 1PZYB 1FR8A 3V8ZA 5HS2A 3BSSA 2QIAA 4B2XA 5CMFX 2OEFA 4M2AA 2X5SA 4ARWA 4HO2A 2YQHA 5C8RA 1H7LA 1VGUA 3U0XA 5EJZA 1R7YA 3OTZA 3FSYA 5C4EA 3VBJA 3IOJA 3ZLLA 1HM0A 2JF3A 3R0SA 4B4MA 2NPOA 3EH0A 3R5BA 5DG3A 2I5EA 3JTJA 3V0MA 3R1WA 3SXCA 1QREA 3E25A 4KC1A 1XHBA 4HCQA 5FU8A 1H5SD 4D11A 1QWJA 2FYCB 3OH2A 4BQHA 3U2VA 1R82A 1ZJ1A 4H7OA 4FRDA 4M2BA 4EABA 2WVKA 4M4KA 3C8VA 1O7OA 1FO9A 2FFVA 1FXJA 1LZ7A 1YROB 2WGZA 3R8YA 1ZJ3A 2GGQA 1QQ0A 1KGQA 2A8WA 1H7FA 3PMOA 3T57A 4N6AA 1ZIZA 4B4BA 4FREA 1G97A 1WSZA 2AM4A 5C4CA 4EEAA 2AGDA 3OAMA 3I3AA 1PZTA 3CKJA 3SX3A 3USRA 4M98A 3OH3A 3FWWA 3TWDA 2PGVA 1KQAA 5AJPA 4D48A 2RJ7A 5C1LA 3I0FA 1LZJA 5C49A 5EIYA 4KQLA 4FCUA 1LXAA 2P6WA 2VS4A 4UEGA 3I0LA 1FR9A 3HL3A 5E3QA 1O0RA 3JQYA 1FXOA 4C2SA 3FTTA 5ADXV 1ZJOA 3LW6A 5C3AA 1VPAA 3D5NA 3SX8A 1MR7A 1EYRA 4JD0A 3F1CA 4Y7UA 3ZGFA 2VXMA 1VZUA 4EEOA 2XMHA 1H5SA 3N9WA 5CQLX 3ZLKA 3TIOA 5JQQA 4MFGA 3I0HA
chains in the Genus database with same CATH superfamily
3CJ8A 1G2VA 1MC3A 4KC4A 3OH4A 4Y63A 3NGWA 1QRMA 3GUEA 3MQGA 2I7BA 4EA8A 5CQNX 4CJCA 3OTMA 1GX4A 1Z90A 2WLDA 2VFZA 1VZTA 2Y4KA 3GVDA 4EA7A 3CKQA 4ASJA 2RIJA 1ZJPA 1JVDA 1VH3A 1ZI1A 4M9CA 5C4DA 4Y7GA 5L6SA 3V0PA 4P00A 2RITA 3CU0A 3GQAA 1ZCTA 2QIVX 4IRQA 3MC4A 1VZXA 4XWIA 3SX5A 1Z2FA 2VXLA 1INIA 3POLA 5IDTA 1KHRA 2J0AA 5U2KA 2VS3A 2JCKA 4AC3A 2AECA 1XZ6A 1VH1A 3OC9A 1KRVA 1H4EA 1JVGA 2BO8A 4FRAA 1SSQA 1ZDGA 1QGSA 1S80A 1ZCYA 1K4VA 4ISXA 2GGOA 3VBIA 2O1FA 4MIXA 3TQDA 2WLEA 1XATA 2C0NA 1R81A 4E6TA 4EQYA 2W0WA 5DDTA 3IXCA 2P73A 1R7TA 1MR9A 5DDVA 2O1HA 1S4NA 1H7QA 4KNRA 1HM8A 3KWDA 4EEGA 3Q1XA 5C1HA 4AYLA 4FRMA 1LL0A 2OI6A 4IHFA 2AQ9A 3ST8A 4KPZA 4EE4A 2P72A 4R7PA 1ZI5A 1GQ9A 2E3DA 3QVBA 3V91A 2WEEA 4N69A 4Y6UA 4CVHA 2ZU8A 1L0SA 2AM5A 1VICA 1WT3A 2RJ9A 5FTSA 1G9RA 5FUHA 1TW5A 2RJ8A 3K8DA 5C3DA 4EE3A 1SS9A 5I1FA 4N6BA 2Y4MA 4DECA 2XWNA 1G8OA 3OW5A 2CU2A 3OGZA 2V0JA 1OQMB 1S4PA 3TV0A 1H5RB 4D0TA 5IFYA 3HJJA 1JYLA 1G0RA 1YP4A 3U2XA 1JYKA 2Y7AA 2YCMA 1H5SB 2FY7A 3R2WA 3VBNA 2V0HA 5C47A 2JCOA 2JCJA 1G95A 3P47A 1GQCA 1S4OA 2PX7A 2PGYA 1QRLA 4YS8A 2XATA 4B3UA 2BO4A 3T7OA 4E1KA 2IC7A 1V3WA 4FRBA 2XWMA 1J2ZA 1MRLA 1FZWA 3SXEA 4IHGA 3EE5A 4EEMA 2Z86A 1O7QA 5CMGX 4Y7FA 2RJ0A 1SSMA 1QRGA 2WLCA 1G3LA 1QG8A 2D7IA 5CQMX 4FCEA 4EA9A 1TW1A 3U0YA 3R5AA 3Q80A 1H5RA 3R5DA 2WAWA 4P02A 2JCLA 1KK4A 4J18A 4E75A 1ON6A 2WE9A 4B5BA 1NWGB 5J49A 1JV1A 3FOQA 3ZF8A 3DK5A 4ECMA 5CMJA 1NF5B 2QGIA 3I0JA 4ASYA 4Y9XA 2WLFA 3OUPA 1H5TB 1QRFA 2UX8A 1HJJA 1ZHJA 3OH1A 4HO6A 4L41C 4FRPA 4KC2A 1OCXA 4G3SA 4D11C 4LW3A 5ADXU 3KWEA 1KK6A 4J09A 1FOAA 1O23B 2VS5A 2RIZA 1ZI3A 5DEMA 4E79A 3DUVA 2QKXA 3OU9A 4KPXA 4AA7A 2Y4LA 4NANA 3I0IX 1MP4A 3V0LA 1KK5A 1H7HA 3F1XA 4DDZA 1VGZA 1H7EA 1LZ0A 1W77A 1FG5N 2I5KA 2JF2A 4Y7VA 2P2OA 3RMWA 4LW6A 3JUKA 3I0DA 3BFPA 4GBPA 2RJ1A 3R3IA 1HV9A 3KWCA 1KRRA 3MQHA 2X5ZA 4IRPA 4R37A 3R3RA 4DCLA 1VGWA 1ZJ0A 3BCVA 3V0OA 3U2WA 4DE7A 3DHOA 1G1LA 5AFUV 1W57A 2D7RA 1H5TA 1LL3A 4Y7TA 4HURA 1ZDFA 3EG4A 2IUAA 3CKOA 2FYDB 3T7MA 1WT1A 2W0VA 4JISA 2VSHA 5D91A 3SXAA 1EZIA 1GWWA 1ZJ2A 1GWVA 3VBMA 1N4IA 4HZDA 3TZTA 4G3PA 3VBPA 5IDSA 4FRLA 1VM8A 3I0GA 3IOHA 5AJOA 1FO8A 3FSXA 2Y4JA 2YQSA 1YP3A 1V67A 1INJA 2V0KA 3E26A 4CJBA 4EGGA 4K6RA 4D0ZA 4FIXA 4HO5A 4G87A 2BO7A 3VNPA 5CMIA 2YESA 2Z87A 4HO4A 3F1YA 1H5SC 5C3BA 2FFUA 2RIXA 4B2WA 4HOCA 3V4EA 3VBLA 1FRWA 2QH5A 4KRVA 4HO9A 1ON8A 1ZCVA 4BMAA 2YQJA 4FQWA 4NALA 4EVWA 1G93A 1WT0A 5CQOA 3BSWA 3PKQA 2DPWA 3SXDA 3OH0A 3TISA 5E3RA 3GOSA 1H4CA 3V0NA 3BRKX 3BSYA 3U2TA 2OI7A 1GX0A 1WT2A 2MZBA 3V90A 1YP2A 5AJNA 2Q4JA 2V0LA 1T3DA 3D98A 2A8UA 2FKOA 1H3MA 2RJ5A 1R80A 1VGTA 2IU9A 3Q7UA 2YC5A 1JV3A 1M8NA 4Y64A 3CKVA 4MYBA 1ZCUA 2AH9A 5C48A 4NAIA 3RMVA 1ZI4A 1LZIA 3IOIA 2ZU9A 3I0EA 4FRQA 1LVWA 1NMMB 1HJLA 3OKRA 1IIMA 1TVYA 1TDTA 2WVMA 2XMEA 4MNDA 2AM3A 5FU0A 2WLGA 2FYBA 1LL2A 2D0JA 4ZDQA 3V0QA 2ICXA 3SX7A 3CGXA 5CMHA 3HSQA 3T7NA 5C4FA 1H4DA 5E3PA 3TK8A 3RSBA 5FYEA 2OI5A 3I0KA 4N27A 4B42A 3NZ2A 4MZUA 4E6UA 1R7VA 3USQA 1R7XA 3JUJA 5FV9A 4MYOA 5EJ1A 1V83A 2OEGA 3TDTA 1IINA 1H7TA 3P1BA 5CQPA 1KWSA 2X60A 5FTVA 5C36A 3K8EA 3R5CA 3I0CA 4HO3A 2BO6A 1MP5A 3KIAA 2RJ6A 3EEVA 1H7GA 1QGQA 2AE7A 5BXCA 2APCA 3FSCA 1NHEB 1FGXA 2VSIA 2FYAA 3ZGGA 4M99A 3D8VA 4AAWA 2O1GA 2YQCA 3U2UA 3FS8A 1XHDA 4NAKA 3VBKA 2PA4A 4HG6A 1GA8A 4HO8A 4HZCA 5DEPA 4R36A 4G3QA 2VD4A 1THJA 2X65A 5C4BA 1NQIB 4M28A 5L6VA 5C38A 3ECTA 3FSBA 4FROA 2XWLA 3SXGA 1KGTA 4Y6NA 5C1GA 1WVCA 4EE5A 3SPTA 1OMXA 3PNNA 3SRTA 4HUSA 3PKPA 2ICYA 2TDTA 4HO0A 1E5KA 1SSTA 4CJ8A 3IGJA 3BXYA 3I3XA 4KNXA 1V84A 4FIYA 4Y62A 3SXBA 2V0IA 5F42A 1FGGA 3Q4SA 1TZFA 1W55A 1KRUA 3DJ4A 2VK9A 3O3PA 4KXOA 2YC3A 2WVLA 2J0BA 4EAAA 2Y6PA 1V82A 1I52A 3CKNA 1MP3A 3GQ9A 1EWWA 1OMZA 2NXVA 1HM9A 2ZU7A 1FWYA 1G23A 5AFUU 1NKHB 2RIYA 2RJ4A 1R7UA 2E8BA 2IU8A 2VHEA 4FRHA 4IHHA 4B4GA 3V8YA 2AESA 4AYJA 4KT7A 1PZYB 1FR8A 3V8ZA 5HS2A 3BSSA 2QIAA 4B2XA 5CMFX 2OEFA 4M2AA 2X5SA 4ARWA 4HO2A 2YQHA 5C8RA 1H7LA 1VGUA 3U0XA 5EJZA 1R7YA 3OTZA 3FSYA 4O6NA 5C4EA 3VBJA 3IOJA 3ZLLA 1HM0A 2JF3A 3R0SA 4B4MA 2NPOA 3EH0A 3R5BA 5DG3A 2I5EA 3JTJA 3V0MA 3R1WA 3SXCA 1QREA 3E25A 4KC1A 1XHBA 4O6MA 4HCQA 5FU8A 5D92A 1H5SD 4D11A 1QWJA 3SUCA 2FYCB 3OH2A 4BQHA 3U2VA 1R82A 1ZJ1A 4H7OA 4FRDA 4M2BA 4EABA 2WVKA 4M4KA 3C8VA 1O7OA 1FO9A 2FFVA 1FXJA 1LZ7A 1YROB 2WGZA 3R8YA 1ZJ3A 2GGQA 1QQ0A 1KGQA 2A8WA 1H7FA 3PMOA 3T57A 4N6AA 1ZIZA 4B4BA 4FREA 1G97A 1WSZA 2AM4A 5C4CA 4EEAA 2AGDA 3OAMA 3I3AA 1PZTA 3CKJA 3SX3A 3USRA 4M98A 4Q7CA 3OH3A 3FWWA 3TWDA 2PGVA 1KQAA 5AJPA 4D48A 2RJ7A 3GQ7A 5C1LA 3I0FA 1LZJA 5C49A 5EIYA 4KQLA 4FCUA 3GQ8A 1LXAA 2P6WA 2VS4A 4UEGA 3I0LA 1FR9A 3HL3A 5E3QA 1O0RA 3JQYA 1FXOA 4C2SA 3FTTA 5ADXV 1ZJOA 3LW6A 5C3AA 1VPAA 3D5NA 3SX8A 1MR7A 1EYRA 4JD0A 3F1CA 4Y7UA 3ZGFA 2VXMA 1VZUA 4EEOA 2XMHA 1H5SA 3N9WA 5CQLX 3ZLKA 3TIOA 5JQQA 4MFGA 3I0HA
chains in the Genus database with same CATH topology
3CJ8A 1G2VA 1MC3A 4KC4A 3OH4A 4Y63A 3NGWA 1QRMA 3GUEA 3MQGA 2I7BA 4EA8A 5CQNX 4CJCA 3OTMA 1GX4A 1Z90A 2WLDA 2VFZA 1VZTA 2Y4KA 3GVDA 4EA7A 3CKQA 4ASJA 2RIJA 1ZJPA 1JVDA 1VH3A 1ZI1A 4M9CA 5C4DA 4Y7GA 5L6SA 3V0PA 4P00A 2RITA 3CU0A 1ZCTA 2QIVX 4IRQA 3MC4A 1VZXA 4XWIA 3SX5A 2VXLA 1INIA 3POLA 5IDTA 1KHRA 2J0AA 5U2KA 2VS3A 2JCKA 4AC3A 2AECA 1XZ6A 1VH1A 3OC9A 1KRVA 1H4EA 1JVGA 2BO8A 4FRAA 1SSQA 1ZDGA 1QGSA 1S80A 1ZCYA 1K4VA 4ISXA 2GGOA 3VBIA 2O1FA 4MIXA 3TQDA 2WLEA 1XATA 2C0NA 1R81A 4E6TA 4EQYA 2W0WA 5DDTA 3IXCA 2P73A 1R7TA 1MR9A 5DDVA 2O1HA 1S4NA 1H7QA 4KNRA 1HM8A 3KWDA 4EEGA 3Q1XA 5C1HA 4AYLA 4FRMA 1LL0A 2OI6A 4IHFA 2AQ9A 3ST8A 4KPZA 4EE4A 2P72A 4R7PA 1ZI5A 1GQ9A 2E3DA 3QVBA 3V91A 2WEEA 4N69A 4Y6UA 4CVHA 2ZU8A 2AM5A 1VICA 1WT3A 2RJ9A 5FTSA 1G9RA 5FUHA 1TW5A 2RJ8A 3K8DA 5C3DA 4EE3A 1SS9A 5I1FA 4N6BA 2Y4MA 4DECA 2XWNA 1G8OA 3OW5A 2CU2A 3OGZA 2V0JA 1OQMB 1S4PA 3TV0A 1H5RB 4D0TA 5IFYA 3HJJA 1JYLA 1G0RA 1YP4A 3U2XA 1JYKA 2Y7AA 2YCMA 1H5SB 2FY7A 3R2WA 3VBNA 2V0HA 5C47A 2JCOA 2JCJA 1G95A 3P47A 1GQCA 1S4OA 2PX7A 2PGYA 1QRLA 4YS8A 2XATA 4B3UA 2BO4A 3T7OA 4E1KA 2IC7A 1V3WA 4FRBA 2XWMA 1J2ZA 1MRLA 1FZWA 3SXEA 4IHGA 3EE5A 4EEMA 2Z86A 1O7QA 5CMGX 4Y7FA 2RJ0A 1SSMA 1QRGA 2WLCA 1G3LA 1QG8A 2D7IA 5CQMX 4FCEA 4EA9A 1TW1A 3U0YA 3R5AA 3Q80A 1H5RA 3R5DA 2WAWA 4P02A 2JCLA 1KK4A 4J18A 4E75A 1ON6A 2WE9A 4B5BA 1NWGB 5J49A 1JV1A 3FOQA 3ZF8A 3DK5A 4ECMA 5CMJA 1NF5B 2QGIA 3I0JA 4ASYA 4Y9XA 2WLFA 3OUPA 1H5TB 1QRFA 2UX8A 1HJJA 1ZHJA 3OH1A 4HO6A 4L41C 4FRPA 4KC2A 1OCXA 4G3SA 4D11C 4LW3A 5ADXU 3KWEA 1KK6A 4J09A 1FOAA 1O23B 2VS5A 2RIZA 1ZI3A 5DEMA 4E79A 3DUVA 2QKXA 3OU9A 4KPXA 4AA7A 2Y4LA 4NANA 3I0IX 1MP4A 3V0LA 1KK5A 1H7HA 3F1XA 4DDZA 1VGZA 1H7EA 1LZ0A 1W77A 1FG5N 2I5KA 2JF2A 4Y7VA 2P2OA 3RMWA 4LW6A 3JUKA 3I0DA 3BFPA 4GBPA 2RJ1A 3R3IA 1HV9A 3KWCA 1KRRA 3MQHA 2X5ZA 4IRPA 4R37A 3R3RA 4DCLA 1VGWA 1ZJ0A 3BCVA 3V0OA 3U2WA 4DE7A 3DHOA 1G1LA 5AFUV 1W57A 2D7RA 1H5TA 1LL3A 4Y7TA 4HURA 1ZDFA 3EG4A 2IUAA 3CKOA 2FYDB 3T7MA 1WT1A 2W0VA 4JISA 2VSHA 5D91A 3SXAA 1EZIA 1GWWA 1ZJ2A 1GWVA 3VBMA 4HZDA 3TZTA 4G3PA 3VBPA 5IDSA 4FRLA 1VM8A 3I0GA 3IOHA 5AJOA 1FO8A 3FSXA 2Y4JA 2YQSA 1YP3A 1V67A 1INJA 2V0KA 3E26A 4CJBA 4EGGA 4K6RA 4D0ZA 4FIXA 4HO5A 4G87A 2BO7A 3VNPA 5CMIA 2YESA 2Z87A 4HO4A 3F1YA 1H5SC 5C3BA 2FFUA 2RIXA 4B2WA 4HOCA 3V4EA 3VBLA 1FRWA 2QH5A 4KRVA 4HO9A 1ON8A 1ZCVA 4BMAA 2YQJA 4FQWA 4NALA 4EVWA 1G93A 1WT0A 5CQOA 3BSWA 3PKQA 2DPWA 3SXDA 3OH0A 3TISA 5E3RA 3GOSA 1H4CA 3V0NA 3BRKX 3BSYA 3U2TA 2OI7A 1GX0A 1WT2A 2MZBA 3V90A 1YP2A 5AJNA 2Q4JA 2V0LA 1T3DA 3D98A 2A8UA 2FKOA 1H3MA 2RJ5A 1R80A 1VGTA 2IU9A 3Q7UA 2YC5A 1JV3A 4Y64A 3CKVA 4MYBA 1ZCUA 2AH9A 5C48A 4NAIA 3RMVA 1ZI4A 1LZIA 3IOIA 2ZU9A 3I0EA 4FRQA 1LVWA 1NMMB 1HJLA 3OKRA 1IIMA 1TVYA 1TDTA 2WVMA 2XMEA 4MNDA 2AM3A 5FU0A 2WLGA 2FYBA 1LL2A 2D0JA 4ZDQA 3V0QA 2ICXA 3SX7A 3CGXA 5CMHA 3HSQA 3T7NA 5C4FA 1H4DA 5E3PA 3TK8A 3RSBA 5FYEA 2OI5A 3I0KA 4N27A 4B42A 3NZ2A 4MZUA 4E6UA 1R7VA 3USQA 1R7XA 3JUJA 5FV9A 4MYOA 5EJ1A 1V83A 2OEGA 3TDTA 1IINA 1H7TA 3P1BA 5CQPA 1KWSA 2X60A 5FTVA 5C36A 3K8EA 3R5CA 3I0CA 4HO3A 2BO6A 1MP5A 3KIAA 2RJ6A 3EEVA 1H7GA 1QGQA 2AE7A 5BXCA 2APCA 3FSCA 1NHEB 1FGXA 2VSIA 2FYAA 3ZGGA 4M99A 3D8VA 4AAWA 2O1GA 2YQCA 3U2UA 3FS8A 1XHDA 4NAKA 3VBKA 2PA4A 4HG6A 1GA8A 4HO8A 4HZCA 5DEPA 4R36A 4G3QA 2VD4A 1THJA 2X65A 5C4BA 1NQIB 4M28A 5L6VA 5C38A 3ECTA 3FSBA 4FROA 2XWLA 3SXGA 1KGTA 4Y6NA 5C1GA 1WVCA 4EE5A 3SPTA 1OMXA 3PNNA 3SRTA 4HUSA 3PKPA 2ICYA 2TDTA 4HO0A 1E5KA 1SSTA 4CJ8A 3IGJA 3BXYA 3I3XA 4KNXA 1V84A 4FIYA 4Y62A 3SXBA 2V0IA 5F42A 1FGGA 3Q4SA 1TZFA 1W55A 1KRUA 3DJ4A 2VK9A 3O3PA 4KXOA 2YC3A 2WVLA 2J0BA 4EAAA 2Y6PA 1V82A 1I52A 3CKNA 1MP3A 1OMZA 2NXVA 1HM9A 2ZU7A 1FWYA 1G23A 5AFUU 1NKHB 2RIYA 2RJ4A 1R7UA 2E8BA 2IU8A 2VHEA 4FRHA 4IHHA 4B4GA 3V8YA 2AESA 4AYJA 4KT7A 1PZYB 1FR8A 3V8ZA 5HS2A 3BSSA 2QIAA 4B2XA 5CMFX 2OEFA 4M2AA 2X5SA 4ARWA 4HO2A 2YQHA 5C8RA 1H7LA 1VGUA 3U0XA 5EJZA 1R7YA 3OTZA 3FSYA 4O6NA 5C4EA 3VBJA 3IOJA 3ZLLA 1HM0A 2JF3A 3R0SA 4B4MA 2NPOA 3EH0A 3R5BA 5DG3A 2I5EA 3JTJA 3V0MA 3R1WA 3SXCA 1QREA 3E25A 4KC1A 1XHBA 4O6MA 4HCQA 5FU8A 5D92A 1H5SD 4D11A 1QWJA 2FYCB 3OH2A 4BQHA 3U2VA 1R82A 1ZJ1A 4H7OA 4FRDA 4M2BA 4EABA 2WVKA 4M4KA 3C8VA 1O7OA 1FO9A 2FFVA 1FXJA 1LZ7A 1YROB 2WGZA 3R8YA 1ZJ3A 2GGQA 1QQ0A 1KGQA 2A8WA 1H7FA 3PMOA 3T57A 4N6AA 1ZIZA 4B4BA 4FREA 1G97A 1WSZA 2AM4A 5C4CA 4EEAA 2AGDA 3OAMA 3I3AA 1PZTA 3CKJA 3SX3A 3USRA 4M98A 4Q7CA 3OH3A 3FWWA 3TWDA 2PGVA 1KQAA 5AJPA 4D48A 2RJ7A 5C1LA 3I0FA 1LZJA 5C49A 5EIYA 4KQLA 4FCUA 1LXAA 2P6WA 2VS4A 4UEGA 3I0LA 1FR9A 3HL3A 5E3QA 1O0RA 3JQYA 1FXOA 4C2SA 3FTTA 5ADXV 1ZJOA 3LW6A 5C3AA 1VPAA 3D5NA 3SX8A 1MR7A 1EYRA 4JD0A 3F1CA 4Y7UA 3ZGFA 2VXMA 1VZUA 4EEOA 2XMHA 1H5SA 3N9WA 5CQLX 3ZLKA 3TIOA 5JQQA 4MFGA 3I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJ8 A;  1G2V A;  1MC3 A;  4KC4 A;  3OH4 A;  4Y63 A;  3NGW A;  1QRM A;  3GUE A;  3MQG A;  2I7B A;  4EA8 A;  5CQN X;  4CJC A;  3OTM A;  1GX4 A;  1Z90 A;  2WLD A;  2VFZ A;  1VZT A;  2Y4K A;  3GVD A;  4EA7 A;  3CKQ A;  4ASJ A;  2RIJ A;  1ZJP A;  1JVD A;  1VH3 A;  1ZI1 A;  4M9C A;  5C4D A;  4Y7G A;  5L6S A;  3V0P A;  4P00 A;  2RIT A;  3CU0 A;  1ZCT A;  2QIV X;  4IRQ A;  3MC4 A;  1VZX A;  4XWI A;  3SX5 A;  2VXL A;  1INI A;  3POL A;  5IDT A;  1KHR A;  5U2K A;  2VS3 A;  2JCK A;  4AC3 A;  2AEC A;  1XZ6 A;  1VH1 A;  3OC9 A;  1KRV A;  1H4E A;  1JVG A;  2BO8 A;  4FRA A;  1SSQ A;  1ZDG A;  1QGS A;  1S80 A;  1ZCY A;  1K4V A;  4ISX A;  2GGO A;  3VBI A;  2O1F A;  3TQD A;  2WLE A;  1XAT A;  1R81 A;  4E6T A;  4EQY A;  2W0W A;  5DDT A;  3IXC A;  2P73 A;  1R7T A;  1MR9 A;  5DDV A;  2O1H A;  1S4N A;  1H7Q A;  4KNR A;  1HM8 A;  3KWD A;  4EEG A;  3Q1X A;  5C1H A;  4AYL A;  4FRM A;  1LL0 A;  2OI6 A;  4IHF A;  2AQ9 A;  3ST8 A;  4KPZ A;  4EE4 A;  2P72 A;  4R7P A;  1ZI5 A;  1GQ9 A;  2E3D A;  3QVB A;  3V91 A;  2WEE A;  4N69 A;  4Y6U A;  4CVH A;  2ZU8 A;  2AM5 A;  1VIC A;  1WT3 A;  2RJ9 A;  5FTS A;  1G9R A;  5FUH A;  1TW5 A;  2RJ8 A;  3K8D A;  5C3D A;  4EE3 A;  1SS9 A;  5I1F A;  4N6B A;  2Y4M A;  4DEC A;  2XWN A;  1G8O A;  3OW5 A;  2CU2 A;  3OGZ A;  2V0J A;  1OQM B;  1S4P A;  3TV0 A;  1H5R B;  4D0T A;  5IFY A;  3HJJ A;  1JYL A;  1G0R A;  1YP4 A;  3U2X A;  1JYK A;  2Y7A A;  2YCM A;  1H5S B;  2FY7 A;  3R2W A;  3VBN A;  2V0H A;  5C47 A;  2JCO A;  2JCJ A;  1G95 A;  3P47 A;  1GQC A;  1S4O A;  2PX7 A;  2PGY A;  1QRL A;  4YS8 A;  2XAT A;  4B3U A;  2BO4 A;  3T7O A;  4E1K A;  2IC7 A;  1V3W A;  4FRB A;  2XWM A;  1J2Z A;  1MRL A;  1FZW A;  3SXE A;  4IHG A;  3EE5 A;  4EEM A;  2Z86 A;  1O7Q A;  5CMG X;  4Y7F A;  2RJ0 A;  1SSM A;  1QRG A;  2WLC A;  1G3L A;  1QG8 A;  2D7I A;  5CQM X;  4FCE A;  4EA9 A;  1TW1 A;  3U0Y A;  3R5A A;  3Q80 A;  1H5R A;  3R5D A;  2WAW A;  4P02 A;  2JCL A;  1KK4 A;  4J18 A;  4E75 A;  1ON6 A;  2WE9 A;  4B5B A;  1NWG B;  5J49 A;  1JV1 A;  3FOQ A;  3ZF8 A;  3DK5 A;  4ECM A;  5CMJ A;  1NF5 B;  2QGI A;  3I0J A;  4ASY A;  4Y9X A;  2WLF A;  3OUP A;  1H5T B;  1QRF A;  2UX8 A;  1HJJ A;  1ZHJ A;  3OH1 A;  4HO6 A;  4L41 C;  4FRP A;  4KC2 A;  1OCX A;  4G3S A;  4D11 C;  4LW3 A;  5ADX U;  3KWE A;  1KK6 A;  4J09 A;  1FOA A;  1O23 B;  2VS5 A;  2RIZ A;  1ZI3 A;  5DEM A;  4E79 A;  3DUV A;  2QKX A;  3OU9 A;  4KPX A;  4AA7 A;  2Y4L A;  4NAN A;  3I0I X;  1MP4 A;  3V0L A;  1KK5 A;  1H7H A;  3F1X A;  4DDZ A;  1VGZ A;  1H7E A;  1LZ0 A;  1W77 A;  1FG5 N;  2I5K A;  2JF2 A;  4Y7V A;  2P2O A;  3RMW A;  4LW6 A;  3JUK A;  3I0D A;  3BFP A;  4GBP A;  2RJ1 A;  3R3I A;  1HV9 A;  3KWC A;  1KRR A;  3MQH A;  2X5Z A;  4IRP A;  4R37 A;  3R3R A;  4DCL A;  1VGW A;  1ZJ0 A;  3BCV A;  3V0O A;  3U2W A;  4DE7 A;  3DHO A;  1G1L A;  5AFU V;  1W57 A;  2D7R A;  1H5T A;  1LL3 A;  4Y7T A;  4HUR A;  1ZDF A;  3EG4 A;  2IUA A;  3CKO A;  2FYD B;  3T7M A;  1WT1 A;  2W0V A;  4JIS A;  2VSH A;  3SXA A;  1EZI A;  1GWW A;  1ZJ2 A;  1GWV A;  3VBM A;  4HZD A;  3TZT A;  4G3P A;  3VBP A;  5IDS A;  4FRL A;  1VM8 A;  3I0G A;  3IOH A;  5AJO A;  1FO8 A;  3FSX A;  2Y4J A;  2YQS A;  1YP3 A;  1V67 A;  1INJ A;  2V0K A;  3E26 A;  4CJB A;  4EGG A;  4K6R A;  4D0Z A;  4HO5 A;  4G87 A;  2BO7 A;  3VNP A;  5CMI A;  2YES A;  2Z87 A;  4HO4 A;  3F1Y A;  1H5S C;  5C3B A;  2FFU A;  2RIX A;  4B2W A;  4HOC A;  3V4E A;  3VBL A;  1FRW A;  2QH5 A;  4KRV A;  4HO9 A;  1ON8 A;  1ZCV A;  4BMA A;  2YQJ A;  4FQW A;  4NAL A;  4EVW A;  1G93 A;  1WT0 A;  5CQO A;  3BSW A;  3PKQ A;  2DPW A;  3SXD A;  3OH0 A;  3TIS A;  5E3R A;  3GOS A;  1H4C A;  3V0N A;  3BRK X;  3BSY A;  3U2T A;  2OI7 A;  1GX0 A;  1WT2 A;  2MZB A;  3V90 A;  1YP2 A;  5AJN A;  2Q4J A;  2V0L A;  1T3D A;  3D98 A;  2A8U A;  2FKO A;  1H3M A;  2RJ5 A;  1R80 A;  1VGT A;  2IU9 A;  3Q7U A;  2YC5 A;  1JV3 A;  4Y64 A;  3CKV A;  4MYB A;  1ZCU A;  2AH9 A;  5C48 A;  4NAI A;  3RMV A;  1ZI4 A;  1LZI A;  3IOI A;  2ZU9 A;  3I0E A;  4FRQ A;  1LVW A;  1NMM B;  1HJL A;  3OKR A;  1IIM A;  1TVY A;  1TDT A;  2WVM A;  2XME A;  4MND A;  2AM3 A;  5FU0 A;  2WLG A;  2FYB A;  1LL2 A;  2D0J A;  4ZDQ A;  3V0Q A;  2ICX A;  3SX7 A;  3CGX A;  5CMH A;  3HSQ A;  3T7N A;  5C4F A;  1H4D A;  5E3P A;  3TK8 A;  3RSB A;  5FYE A;  2OI5 A;  3I0K A;  4N27 A;  4B42 A;  3NZ2 A;  4MZU A;  4E6U A;  1R7V A;  3USQ A;  1R7X A;  3JUJ A;  5FV9 A;  4MYO A;  5EJ1 A;  1V83 A;  2OEG A;  3TDT A;  1IIN A;  1H7T A;  3P1B A;  5CQP A;  1KWS A;  2X60 A;  5FTV A;  5C36 A;  3K8E A;  3R5C A;  3I0C A;  4HO3 A;  2BO6 A;  1MP5 A;  3KIA A;  2RJ6 A;  3EEV A;  1H7G A;  1QGQ A;  2AE7 A;  5BXC A;  2APC A;  3FSC A;  1NHE B;  1FGX A;  2VSI A;  2FYA A;  3ZGG A;  4M99 A;  3D8V A;  4AAW A;  2O1G A;  2YQC A;  3U2U A;  3FS8 A;  1XHD A;  4NAK A;  3VBK A;  2PA4 A;  4HG6 A;  1GA8 A;  4HO8 A;  4HZC A;  5DEP A;  4R36 A;  4G3Q A;  2VD4 A;  1THJ A;  2X65 A;  5C4B A;  1NQI B;  4M28 A;  5L6V A;  5C38 A;  3ECT A;  3FSB A;  4FRO A;  2XWL A;  3SXG A;  1KGT A;  4Y6N A;  5C1G A;  1WVC A;  4EE5 A;  3SPT A;  1OMX A;  3PNN A;  3SRT A;  4HUS A;  3PKP A;  2ICY A;  2TDT A;  4HO0 A;  1E5K A;  1SST A;  4CJ8 A;  3IGJ A;  3BXY A;  3I3X A;  4KNX A;  1V84 A;  4Y62 A;  3SXB A;  2V0I A;  5F42 A;  1FGG A;  3Q4S A;  1TZF A;  1W55 A;  1KRU A;  3DJ4 A;  3O3P A;  4KXO A;  2YC3 A;  2WVL A;  4EAA A;  2Y6P A;  1V82 A;  1I52 A;  3CKN A;  1MP3 A;  1OMZ A;  2NXV A;  1HM9 A;  2ZU7 A;  1FWY A;  1G23 A;  5AFU U;  1NKH B;  2RIY A;  2RJ4 A;  1R7U A;  2E8B A;  2IU8 A;  2VHE A;  4FRH A;  4IHH A;  4B4G A;  3V8Y A;  2AES A;  4AYJ A;  4KT7 A;  1PZY B;  1FR8 A;  3V8Z A;  5HS2 A;  3BSS A;  2QIA A;  4B2X A;  5CMF X;  2OEF A;  4M2A A;  2X5S A;  4ARW A;  4HO2 A;  2YQH A;  5C8R A;  1H7L A;  1VGU A;  3U0X A;  5EJZ A;  1R7Y A;  3OTZ A;  3FSY A;  5C4E A;  3VBJ A;  3IOJ A;  3ZLL A;  1HM0 A;  2JF3 A;  3R0S A;  4B4M A;  2NPO A;  3EH0 A;  3R5B A;  5DG3 A;  2I5E A;  3JTJ A;  3V0M A;  3R1W A;  3SXC A;  1QRE A;  3E25 A;  4KC1 A;  1XHB A;  4HCQ A;  5FU8 A;  1H5S D;  4D11 A;  1QWJ A;  2FYC B;  3OH2 A;  4BQH A;  3U2V A;  1R82 A;  1ZJ1 A;  4H7O A;  4FRD A;  4M2B A;  4EAB A;  2WVK A;  4M4K A;  3C8V A;  1O7O A;  1FO9 A;  2FFV A;  1FXJ A;  1LZ7 A;  1YRO B;  2WGZ A;  3R8Y A;  1ZJ3 A;  2GGQ A;  1QQ0 A;  1KGQ A;  2A8W A;  1H7F A;  3PMO A;  3T57 A;  4N6A A;  1ZIZ A;  4B4B A;  4FRE A;  1G97 A;  1WSZ A;  2AM4 A;  5C4C A;  4EEA A;  2AGD A;  3OAM A;  3I3A A;  1PZT A;  3CKJ A;  3SX3 A;  3USR A;  4M98 A;  3OH3 A;  3FWW A;  3TWD A;  2PGV A;  1KQA A;  5AJP A;  4D48 A;  2RJ7 A;  5C1L A;  3I0F A;  1LZJ A;  5C49 A;  5EIY A;  4KQL A;  4FCU A;  1LXA A;  2P6W A;  2VS4 A;  4UEG A;  3I0L A;  1FR9 A;  3HL3 A;  5E3Q A;  1O0R A;  3JQY A;  1FXO A;  4C2S A;  3FTT A;  5ADX V;  1ZJO A;  3LW6 A;  5C3A A;  1VPA A;  3D5N A;  3SX8 A;  1MR7 A;  1EYR A;  4JD0 A;  3F1C A;  4Y7U A;  3ZGF A;  2VXM A;  1VZU A;  4EEO A;  2XMH A;  1H5S A;  3N9W A;  5CQL X;  3ZLK A;  3TIO A;  5JQQ A;  4MFG A;  3I0H A; 
#chains in the Genus database with same CATH topology
 3CJ8 A;  1G2V A;  1MC3 A;  4KC4 A;  3OH4 A;  4Y63 A;  3NGW A;  1QRM A;  3GUE A;  3MQG A;  2I7B A;  4EA8 A;  5CQN X;  4CJC A;  3OTM A;  1GX4 A;  1Z90 A;  2WLD A;  2VFZ A;  1VZT A;  2Y4K A;  3GVD A;  4EA7 A;  3CKQ A;  4ASJ A;  2RIJ A;  1ZJP A;  1JVD A;  1VH3 A;  1ZI1 A;  4M9C A;  5C4D A;  4Y7G A;  5L6S A;  3V0P A;  4P00 A;  2RIT A;  3CU0 A;  3GQA A;  1ZCT A;  2QIV X;  4IRQ A;  3MC4 A;  1VZX A;  4XWI A;  3SX5 A;  1Z2F A;  2VXL A;  1INI A;  3POL A;  5IDT A;  1KHR A;  2J0A A;  5U2K A;  2VS3 A;  2JCK A;  4AC3 A;  2AEC A;  1XZ6 A;  1VH1 A;  3OC9 A;  1KRV A;  1H4E A;  1JVG A;  2BO8 A;  4FRA A;  1SSQ A;  1ZDG A;  1QGS A;  1S80 A;  1ZCY A;  1K4V A;  4ISX A;  2GGO A;  3VBI A;  2O1F A;  4MIX A;  3TQD A;  2WLE A;  1XAT A;  2C0N A;  1R81 A;  4E6T A;  4EQY A;  2W0W A;  5DDT A;  3IXC A;  2P73 A;  1R7T A;  1MR9 A;  5DDV A;  2O1H A;  1S4N A;  1H7Q A;  4KNR A;  1HM8 A;  3KWD A;  4EEG A;  3Q1X A;  5C1H A;  4AYL A;  4FRM A;  1LL0 A;  2OI6 A;  4IHF A;  2AQ9 A;  3ST8 A;  4KPZ A;  4EE4 A;  2P72 A;  4R7P A;  1ZI5 A;  1GQ9 A;  2E3D A;  3QVB A;  3V91 A;  2WEE A;  4N69 A;  4Y6U A;  4CVH A;  2ZU8 A;  1L0S A;  2AM5 A;  1VIC A;  1WT3 A;  2RJ9 A;  5FTS A;  1G9R A;  5FUH A;  1TW5 A;  2RJ8 A;  3K8D A;  5C3D A;  4EE3 A;  1SS9 A;  5I1F A;  4N6B A;  2Y4M A;  4DEC A;  2XWN A;  1G8O A;  3OW5 A;  2CU2 A;  3OGZ A;  2V0J A;  1OQM B;  1S4P A;  3TV0 A;  1H5R B;  4D0T A;  5IFY A;  3HJJ A;  1JYL A;  1G0R A;  1YP4 A;  3U2X A;  1JYK A;  2Y7A A;  2YCM A;  1H5S B;  2FY7 A;  3R2W A;  3VBN A;  2V0H A;  5C47 A;  2JCO A;  2JCJ A;  1G95 A;  3P47 A;  1GQC A;  1S4O A;  2PX7 A;  2PGY A;  1QRL A;  4YS8 A;  2XAT A;  4B3U A;  2BO4 A;  3T7O A;  4E1K A;  2IC7 A;  1V3W A;  4FRB A;  2XWM A;  1J2Z A;  1MRL A;  1FZW A;  3SXE A;  4IHG A;  3EE5 A;  4EEM A;  2Z86 A;  1O7Q A;  5CMG X;  4Y7F A;  2RJ0 A;  1SSM A;  1QRG A;  2WLC A;  1G3L A;  1QG8 A;  2D7I A;  5CQM X;  4FCE A;  4EA9 A;  1TW1 A;  3U0Y A;  3R5A A;  3Q80 A;  1H5R A;  3R5D A;  2WAW A;  4P02 A;  2JCL A;  1KK4 A;  4J18 A;  4E75 A;  1ON6 A;  2WE9 A;  4B5B A;  1NWG B;  5J49 A;  1JV1 A;  3FOQ A;  3ZF8 A;  3DK5 A;  4ECM A;  5CMJ A;  1NF5 B;  2QGI A;  3I0J A;  4ASY A;  4Y9X A;  2WLF A;  3OUP A;  1H5T B;  1QRF A;  2UX8 A;  1HJJ A;  1ZHJ A;  3OH1 A;  4HO6 A;  4L41 C;  4FRP A;  4KC2 A;  1OCX A;  4G3S A;  4D11 C;  4LW3 A;  5ADX U;  3KWE A;  1KK6 A;  4J09 A;  1FOA A;  1O23 B;  2VS5 A;  2RIZ A;  1ZI3 A;  5DEM A;  4E79 A;  3DUV A;  2QKX A;  3OU9 A;  4KPX A;  4AA7 A;  2Y4L A;  4NAN A;  3I0I X;  1MP4 A;  3V0L A;  1KK5 A;  1H7H A;  3F1X A;  4DDZ A;  1VGZ A;  1H7E A;  1LZ0 A;  1W77 A;  1FG5 N;  2I5K A;  2JF2 A;  4Y7V A;  2P2O A;  3RMW A;  4LW6 A;  3JUK A;  3I0D A;  3BFP A;  4GBP A;  2RJ1 A;  3R3I A;  1HV9 A;  3KWC A;  1KRR A;  3MQH A;  2X5Z A;  4IRP A;  4R37 A;  3R3R A;  4DCL A;  1VGW A;  1ZJ0 A;  3BCV A;  3V0O A;  3U2W A;  4DE7 A;  3DHO A;  1G1L A;  5AFU V;  1W57 A;  2D7R A;  1H5T A;  1LL3 A;  4Y7T A;  4HUR A;  1ZDF A;  3EG4 A;  2IUA A;  3CKO A;  2FYD B;  3T7M A;  1WT1 A;  2W0V A;  4JIS A;  2VSH A;  5D91 A;  3SXA A;  1EZI A;  1GWW A;  1ZJ2 A;  1GWV A;  3VBM A;  1N4I A;  4HZD A;  3TZT A;  4G3P A;  3VBP A;  5IDS A;  4FRL A;  1VM8 A;  3I0G A;  3IOH A;  5AJO A;  1FO8 A;  3FSX A;  2Y4J A;  2YQS A;  1YP3 A;  1V67 A;  1INJ A;  2V0K A;  3E26 A;  4CJB A;  4EGG A;  4K6R A;  4D0Z A;  4FIX A;  4HO5 A;  4G87 A;  2BO7 A;  3VNP A;  5CMI A;  2YES A;  2Z87 A;  4HO4 A;  3F1Y A;  1H5S C;  5C3B A;  2FFU A;  2RIX A;  4B2W A;  4HOC A;  3V4E A;  3VBL A;  1FRW A;  2QH5 A;  4KRV A;  4HO9 A;  1ON8 A;  1ZCV A;  4BMA A;  2YQJ A;  4FQW A;  4NAL A;  4EVW A;  1G93 A;  1WT0 A;  5CQO A;  3BSW A;  3PKQ A;  2DPW A;  3SXD A;  3OH0 A;  3TIS A;  5E3R A;  3GOS A;  1H4C A;  3V0N A;  3BRK X;  3BSY A;  3U2T A;  2OI7 A;  1GX0 A;  1WT2 A;  2MZB A;  3V90 A;  1YP2 A;  5AJN A;  2Q4J A;  2V0L A;  1T3D A;  3D98 A;  2A8U A;  2FKO A;  1H3M A;  2RJ5 A;  1R80 A;  1VGT A;  2IU9 A;  3Q7U A;  2YC5 A;  1JV3 A;  1M8N A;  4Y64 A;  3CKV A;  4MYB A;  1ZCU A;  2AH9 A;  5C48 A;  4NAI A;  3RMV A;  1ZI4 A;  1LZI A;  3IOI A;  2ZU9 A;  3I0E A;  4FRQ A;  1LVW A;  1NMM B;  1HJL A;  3OKR A;  1IIM A;  1TVY A;  1TDT A;  2WVM A;  2XME A;  4MND A;  2AM3 A;  5FU0 A;  2WLG A;  2FYB A;  1LL2 A;  2D0J A;  4ZDQ A;  3V0Q A;  2ICX A;  3SX7 A;  3CGX A;  5CMH A;  3HSQ A;  3T7N A;  5C4F A;  1H4D A;  5E3P A;  3TK8 A;  3RSB A;  5FYE A;  2OI5 A;  3I0K A;  4N27 A;  4B42 A;  3NZ2 A;  4MZU A;  4E6U A;  1R7V A;  3USQ A;  1R7X A;  3JUJ A;  5FV9 A;  4MYO A;  5EJ1 A;  1V83 A;  2OEG A;  3TDT A;  1IIN A;  1H7T A;  3P1B A;  5CQP A;  1KWS A;  2X60 A;  5FTV A;  5C36 A;  3K8E A;  3R5C A;  3I0C A;  4HO3 A;  2BO6 A;  1MP5 A;  3KIA A;  2RJ6 A;  3EEV A;  1H7G A;  1QGQ A;  2AE7 A;  5BXC A;  2APC A;  3FSC A;  1NHE B;  1FGX A;  2VSI A;  2FYA A;  3ZGG A;  4M99 A;  3D8V A;  4AAW A;  2O1G A;  2YQC A;  3U2U A;  3FS8 A;  1XHD A;  4NAK A;  3VBK A;  2PA4 A;  4HG6 A;  1GA8 A;  4HO8 A;  4HZC A;  5DEP A;  4R36 A;  4G3Q A;  2VD4 A;  1THJ A;  2X65 A;  5C4B A;  1NQI B;  4M28 A;  5L6V A;  5C38 A;  3ECT A;  3FSB A;  4FRO A;  2XWL A;  3SXG A;  1KGT A;  4Y6N A;  5C1G A;  1WVC A;  4EE5 A;  3SPT A;  1OMX A;  3PNN A;  3SRT A;  4HUS A;  3PKP A;  2ICY A;  2TDT A;  4HO0 A;  1E5K A;  1SST A;  4CJ8 A;  3IGJ A;  3BXY A;  3I3X A;  4KNX A;  1V84 A;  4FIY A;  4Y62 A;  3SXB A;  2V0I A;  5F42 A;  1FGG A;  3Q4S A;  1TZF A;  1W55 A;  1KRU A;  3DJ4 A;  2VK9 A;  3O3P A;  4KXO A;  2YC3 A;  2WVL A;  2J0B A;  4EAA A;  2Y6P A;  1V82 A;  1I52 A;  3CKN A;  1MP3 A;  3GQ9 A;  1EWW A;  1OMZ A;  2NXV A;  1HM9 A;  2ZU7 A;  1FWY A;  1G23 A;  5AFU U;  1NKH B;  2RIY A;  2RJ4 A;  1R7U A;  2E8B A;  2IU8 A;  2VHE A;  4FRH A;  4IHH A;  4B4G A;  3V8Y A;  2AES A;  4AYJ A;  4KT7 A;  1PZY B;  1FR8 A;  3V8Z A;  5HS2 A;  3BSS A;  2QIA A;  4B2X A;  5CMF X;  2OEF A;  4M2A A;  2X5S A;  4ARW A;  4HO2 A;  2YQH A;  5C8R A;  1H7L A;  1VGU A;  3U0X A;  5EJZ A;  1R7Y A;  3OTZ A;  3FSY A;  4O6N A;  5C4E A;  3VBJ A;  3IOJ A;  3ZLL A;  1HM0 A;  2JF3 A;  3R0S A;  4B4M A;  2NPO A;  3EH0 A;  3R5B A;  5DG3 A;  2I5E A;  3JTJ A;  3V0M A;  3R1W A;  3SXC A;  1QRE A;  3E25 A;  4KC1 A;  1XHB A;  4O6M A;  4HCQ A;  5FU8 A;  5D92 A;  1H5S D;  4D11 A;  1QWJ A;  3SUC A;  2FYC B;  3OH2 A;  4BQH A;  3U2V A;  1R82 A;  1ZJ1 A;  4H7O A;  4FRD A;  4M2B A;  4EAB A;  2WVK A;  4M4K A;  3C8V A;  1O7O A;  1FO9 A;  2FFV A;  1FXJ A;  1LZ7 A;  1YRO B;  2WGZ A;  3R8Y A;  1ZJ3 A;  2GGQ A;  1QQ0 A;  1KGQ A;  2A8W A;  1H7F A;  3PMO A;  3T57 A;  4N6A A;  1ZIZ A;  4B4B A;  4FRE A;  1G97 A;  1WSZ A;  2AM4 A;  5C4C A;  4EEA A;  2AGD A;  3OAM A;  3I3A A;  1PZT A;  3CKJ A;  3SX3 A;  3USR A;  4M98 A;  4Q7C A;  3OH3 A;  3FWW A;  3TWD A;  2PGV A;  1KQA A;  5AJP A;  4D48 A;  2RJ7 A;  3GQ7 A;  5C1L A;  3I0F A;  1LZJ A;  5C49 A;  5EIY A;  4KQL A;  4FCU A;  3GQ8 A;  1LXA A;  2P6W A;  2VS4 A;  4UEG A;  3I0L A;  1FR9 A;  3HL3 A;  5E3Q A;  1O0R A;  3JQY A;  1FXO A;  4C2S A;  3FTT A;  5ADX V;  1ZJO A;  3LW6 A;  5C3A A;  1VPA A;  3D5N A;  3SX8 A;  1MR7 A;  1EYR A;  4JD0 A;  3F1C A;  4Y7U A;  3ZGF A;  2VXM A;  1VZU A;  4EEO A;  2XMH A;  1H5S A;  3N9W A;  5CQL X;  3ZLK A;  3TIO A;  5JQQ A;  4MFG A;  3I0H A; 
#chains in the Genus database with same CATH homology
 3CJ8 A;  1G2V A;  1MC3 A;  4KC4 A;  3OH4 A;  4Y63 A;  3NGW A;  1QRM A;  3GUE A;  3MQG A;  2I7B A;  4EA8 A;  5CQN X;  4CJC A;  3OTM A;  1GX4 A;  1Z90 A;  2WLD A;  2VFZ A;  1VZT A;  2Y4K A;  3GVD A;  4EA7 A;  3CKQ A;  4ASJ A;  2RIJ A;  1ZJP A;  1JVD A;  1VH3 A;  1ZI1 A;  4M9C A;  5C4D A;  4Y7G A;  5L6S A;  3V0P A;  4P00 A;  2RIT A;  3CU0 A;  1ZCT A;  2QIV X;  4IRQ A;  3MC4 A;  1VZX A;  4XWI A;  3SX5 A;  2VXL A;  1INI A;  3POL A;  5IDT A;  1KHR A;  2J0A A;  5U2K A;  2VS3 A;  2JCK A;  4AC3 A;  2AEC A;  1XZ6 A;  1VH1 A;  3OC9 A;  1KRV A;  1H4E A;  1JVG A;  2BO8 A;  4FRA A;  1SSQ A;  1ZDG A;  1QGS A;  1S80 A;  1ZCY A;  1K4V A;  4ISX A;  2GGO A;  3VBI A;  2O1F A;  4MIX A;  3TQD A;  2WLE A;  1XAT A;  2C0N A;  1R81 A;  4E6T A;  4EQY A;  2W0W A;  5DDT A;  3IXC A;  2P73 A;  1R7T A;  1MR9 A;  5DDV A;  2O1H A;  1S4N A;  1H7Q A;  4KNR A;  1HM8 A;  3KWD A;  4EEG A;  3Q1X A;  5C1H A;  4AYL A;  4FRM A;  1LL0 A;  2OI6 A;  4IHF A;  2AQ9 A;  3ST8 A;  4KPZ A;  4EE4 A;  2P72 A;  4R7P A;  1ZI5 A;  1GQ9 A;  2E3D A;  3QVB A;  3V91 A;  2WEE A;  4N69 A;  4Y6U A;  4CVH A;  2ZU8 A;  2AM5 A;  1VIC A;  1WT3 A;  2RJ9 A;  5FTS A;  1G9R A;  5FUH A;  1TW5 A;  2RJ8 A;  3K8D A;  5C3D A;  4EE3 A;  1SS9 A;  5I1F A;  4N6B A;  2Y4M A;  4DEC A;  2XWN A;  1G8O A;  3OW5 A;  2CU2 A;  3OGZ A;  2V0J A;  1OQM B;  1S4P A;  3TV0 A;  1H5R B;  4D0T A;  5IFY A;  3HJJ A;  1JYL A;  1G0R A;  1YP4 A;  3U2X A;  1JYK A;  2Y7A A;  2YCM A;  1H5S B;  2FY7 A;  3R2W A;  3VBN A;  2V0H A;  5C47 A;  2JCO A;  2JCJ A;  1G95 A;  3P47 A;  1GQC A;  1S4O A;  2PX7 A;  2PGY A;  1QRL A;  4YS8 A;  2XAT A;  4B3U A;  2BO4 A;  3T7O A;  4E1K A;  2IC7 A;  1V3W A;  4FRB A;  2XWM A;  1J2Z A;  1MRL A;  1FZW A;  3SXE A;  4IHG A;  3EE5 A;  4EEM A;  2Z86 A;  1O7Q A;  5CMG X;  4Y7F A;  2RJ0 A;  1SSM A;  1QRG A;  2WLC A;  1G3L A;  1QG8 A;  2D7I A;  5CQM X;  4FCE A;  4EA9 A;  1TW1 A;  3U0Y A;  3R5A A;  3Q80 A;  1H5R A;  3R5D A;  2WAW A;  4P02 A;  2JCL A;  1KK4 A;  4J18 A;  4E75 A;  1ON6 A;  2WE9 A;  4B5B A;  1NWG B;  5J49 A;  1JV1 A;  3FOQ A;  3ZF8 A;  3DK5 A;  4ECM A;  5CMJ A;  1NF5 B;  2QGI A;  3I0J A;  4ASY A;  4Y9X A;  2WLF A;  3OUP A;  1H5T B;  1QRF A;  2UX8 A;  1HJJ A;  1ZHJ A;  3OH1 A;  4HO6 A;  4L41 C;  4FRP A;  4KC2 A;  1OCX A;  4G3S A;  4D11 C;  4LW3 A;  5ADX U;  3KWE A;  1KK6 A;  4J09 A;  1FOA A;  1O23 B;  2VS5 A;  2RIZ A;  1ZI3 A;  5DEM A;  4E79 A;  3DUV A;  2QKX A;  3OU9 A;  4KPX A;  4AA7 A;  2Y4L A;  4NAN A;  3I0I X;  1MP4 A;  3V0L A;  1KK5 A;  1H7H A;  3F1X A;  4DDZ A;  1VGZ A;  1H7E A;  1LZ0 A;  1W77 A;  1FG5 N;  2I5K A;  2JF2 A;  4Y7V A;  2P2O A;  3RMW A;  4LW6 A;  3JUK A;  3I0D A;  3BFP A;  4GBP A;  2RJ1 A;  3R3I A;  1HV9 A;  3KWC A;  1KRR A;  3MQH A;  2X5Z A;  4IRP A;  4R37 A;  3R3R A;  4DCL A;  1VGW A;  1ZJ0 A;  3BCV A;  3V0O A;  3U2W A;  4DE7 A;  3DHO A;  1G1L A;  5AFU V;  1W57 A;  2D7R A;  1H5T A;  1LL3 A;  4Y7T A;  4HUR A;  1ZDF A;  3EG4 A;  2IUA A;  3CKO A;  2FYD B;  3T7M A;  1WT1 A;  2W0V A;  4JIS A;  2VSH A;  5D91 A;  3SXA A;  1EZI A;  1GWW A;  1ZJ2 A;  1GWV A;  3VBM A;  4HZD A;  3TZT A;  4G3P A;  3VBP A;  5IDS A;  4FRL A;  1VM8 A;  3I0G A;  3IOH A;  5AJO A;  1FO8 A;  3FSX A;  2Y4J A;  2YQS A;  1YP3 A;  1V67 A;  1INJ A;  2V0K A;  3E26 A;  4CJB A;  4EGG A;  4K6R A;  4D0Z A;  4FIX A;  4HO5 A;  4G87 A;  2BO7 A;  3VNP A;  5CMI A;  2YES A;  2Z87 A;  4HO4 A;  3F1Y A;  1H5S C;  5C3B A;  2FFU A;  2RIX A;  4B2W A;  4HOC A;  3V4E A;  3VBL A;  1FRW A;  2QH5 A;  4KRV A;  4HO9 A;  1ON8 A;  1ZCV A;  4BMA A;  2YQJ A;  4FQW A;  4NAL A;  4EVW A;  1G93 A;  1WT0 A;  5CQO A;  3BSW A;  3PKQ A;  2DPW A;  3SXD A;  3OH0 A;  3TIS A;  5E3R A;  3GOS A;  1H4C A;  3V0N A;  3BRK X;  3BSY A;  3U2T A;  2OI7 A;  1GX0 A;  1WT2 A;  2MZB A;  3V90 A;  1YP2 A;  5AJN A;  2Q4J A;  2V0L A;  1T3D A;  3D98 A;  2A8U A;  2FKO A;  1H3M A;  2RJ5 A;  1R80 A;  1VGT A;  2IU9 A;  3Q7U A;  2YC5 A;  1JV3 A;  4Y64 A;  3CKV A;  4MYB A;  1ZCU A;  2AH9 A;  5C48 A;  4NAI A;  3RMV A;  1ZI4 A;  1LZI A;  3IOI A;  2ZU9 A;  3I0E A;  4FRQ A;  1LVW A;  1NMM B;  1HJL A;  3OKR A;  1IIM A;  1TVY A;  1TDT A;  2WVM A;  2XME A;  4MND A;  2AM3 A;  5FU0 A;  2WLG A;  2FYB A;  1LL2 A;  2D0J A;  4ZDQ A;  3V0Q A;  2ICX A;  3SX7 A;  3CGX A;  5CMH A;  3HSQ A;  3T7N A;  5C4F A;  1H4D A;  5E3P A;  3TK8 A;  3RSB A;  5FYE A;  2OI5 A;  3I0K A;  4N27 A;  4B42 A;  3NZ2 A;  4MZU A;  4E6U A;  1R7V A;  3USQ A;  1R7X A;  3JUJ A;  5FV9 A;  4MYO A;  5EJ1 A;  1V83 A;  2OEG A;  3TDT A;  1IIN A;  1H7T A;  3P1B A;  5CQP A;  1KWS A;  2X60 A;  5FTV A;  5C36 A;  3K8E A;  3R5C A;  3I0C A;  4HO3 A;  2BO6 A;  1MP5 A;  3KIA A;  2RJ6 A;  3EEV A;  1H7G A;  1QGQ A;  2AE7 A;  5BXC A;  2APC A;  3FSC A;  1NHE B;  1FGX A;  2VSI A;  2FYA A;  3ZGG A;  4M99 A;  3D8V A;  4AAW A;  2O1G A;  2YQC A;  3U2U A;  3FS8 A;  1XHD A;  4NAK A;  3VBK A;  2PA4 A;  4HG6 A;  1GA8 A;  4HO8 A;  4HZC A;  5DEP A;  4R36 A;  4G3Q A;  2VD4 A;  1THJ A;  2X65 A;  5C4B A;  1NQI B;  4M28 A;  5L6V A;  5C38 A;  3ECT A;  3FSB A;  4FRO A;  2XWL A;  3SXG A;  1KGT A;  4Y6N A;  5C1G A;  1WVC A;  4EE5 A;  3SPT A;  1OMX A;  3PNN A;  3SRT A;  4HUS A;  3PKP A;  2ICY A;  2TDT A;  4HO0 A;  1E5K A;  1SST A;  4CJ8 A;  3IGJ A;  3BXY A;  3I3X A;  4KNX A;  1V84 A;  4FIY A;  4Y62 A;  3SXB A;  2V0I A;  5F42 A;  1FGG A;  3Q4S A;  1TZF A;  1W55 A;  1KRU A;  3DJ4 A;  2VK9 A;  3O3P A;  4KXO A;  2YC3 A;  2WVL A;  2J0B A;  4EAA A;  2Y6P A;  1V82 A;  1I52 A;  3CKN A;  1MP3 A;  1OMZ A;  2NXV A;  1HM9 A;  2ZU7 A;  1FWY A;  1G23 A;  5AFU U;  1NKH B;  2RIY A;  2RJ4 A;  1R7U A;  2E8B A;  2IU8 A;  2VHE A;  4FRH A;  4IHH A;  4B4G A;  3V8Y A;  2AES A;  4AYJ A;  4KT7 A;  1PZY B;  1FR8 A;  3V8Z A;  5HS2 A;  3BSS A;  2QIA A;  4B2X A;  5CMF X;  2OEF A;  4M2A A;  2X5S A;  4ARW A;  4HO2 A;  2YQH A;  5C8R A;  1H7L A;  1VGU A;  3U0X A;  5EJZ A;  1R7Y A;  3OTZ A;  3FSY A;  4O6N A;  5C4E A;  3VBJ A;  3IOJ A;  3ZLL A;  1HM0 A;  2JF3 A;  3R0S A;  4B4M A;  2NPO A;  3EH0 A;  3R5B A;  5DG3 A;  2I5E A;  3JTJ A;  3V0M A;  3R1W A;  3SXC A;  1QRE A;  3E25 A;  4KC1 A;  1XHB A;  4O6M A;  4HCQ A;  5FU8 A;  5D92 A;  1H5S D;  4D11 A;  1QWJ A;  2FYC B;  3OH2 A;  4BQH A;  3U2V A;  1R82 A;  1ZJ1 A;  4H7O A;  4FRD A;  4M2B A;  4EAB A;  2WVK A;  4M4K A;  3C8V A;  1O7O A;  1FO9 A;  2FFV A;  1FXJ A;  1LZ7 A;  1YRO B;  2WGZ A;  3R8Y A;  1ZJ3 A;  2GGQ A;  1QQ0 A;  1KGQ A;  2A8W A;  1H7F A;  3PMO A;  3T57 A;  4N6A A;  1ZIZ A;  4B4B A;  4FRE A;  1G97 A;  1WSZ A;  2AM4 A;  5C4C A;  4EEA A;  2AGD A;  3OAM A;  3I3A A;  1PZT A;  3CKJ A;  3SX3 A;  3USR A;  4M98 A;  4Q7C A;  3OH3 A;  3FWW A;  3TWD A;  2PGV A;  1KQA A;  5AJP A;  4D48 A;  2RJ7 A;  5C1L A;  3I0F A;  1LZJ A;  5C49 A;  5EIY A;  4KQL A;  4FCU A;  1LXA A;  2P6W A;  2VS4 A;  4UEG A;  3I0L A;  1FR9 A;  3HL3 A;  5E3Q A;  1O0R A;  3JQY A;  1FXO A;  4C2S A;  3FTT A;  5ADX V;  1ZJO A;  3LW6 A;  5C3A A;  1VPA A;  3D5N A;  3SX8 A;  1MR7 A;  1EYR A;  4JD0 A;  3F1C A;  4Y7U A;  3ZGF A;  2VXM A;  1VZU A;  4EEO A;  2XMH A;  1H5S A;  3N9W A;  5CQL X;  3ZLK A;  3TIO A;  5JQQ A;  4MFG A;  3I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...