5L6SA

Crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a positive allosteric regulator beta-fructose-1,6-diphosphate (fbp) - agpase*fbp
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
421
structure length
409
Chain Sequence
LMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPATADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
molecule keywords Glucose-1-phosphate adenylyltransferase
total genus 130
structure length 409
sequence length 421
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5l6sA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5l6sA01
3DUVA 4XWIA 4NAKA 1O0RA 3T7MA 3VBKA 5C3DA 1ZIZA 5FTVA 3EG4A 1S4OA 5DEPA 1ZJ2A 1H4CA 4KPXA 4N27A 4EA8A 2RIYA 2VFZA 2P2OA 1G23A 1VGTA 5C4EA 5U2KA 1WT1A 1OCXA 1KRUA 1V67A 4HO6A 1G95A 4R37A 3OH4A 2RJ0A 3R8YA 4FROA 3CKQA 1NF5B 4HO8A 3USQA 1NMMB 2E3DA 1WT2A 4P00A 1ZCUA 2AECA 1KGQA 3FSBA 1G3LA 1R7TA 1OMZA 5AJPA 1HM9A 4M98A 3KWEA 3CKVA 3I0CA 4EEMA 1ZJPA 3NGWA 4Y7UA 1G1LA 1R7UA 3Q7UA 4FCEA 3I0DA 2QKXA 3SXBA 1KK4A 1W55A 3IOJA 1YP3A 4FRQA 1R80A 2ZU8A 3OH2A 3MC4A 4M4KA 4N6BA 3RMVA 4CJCA 3SX7A 1KQAA 3FS8A 3T57A 4ECMA 2VS5A 4HO2A 1ZI1A 3C8VA 1TW5A 1MP3A 4Y6UA 3BSWA 2AGDA 1H7EA 3E26A 5DEMA 3JUKA 2AE7A 3K8DA 3I0EA 4EQYA 2E8BA 1QGSA 1G2VA 1PZTA 2GGOA 2BO6A 2WLFA 3OH0A 3NZ2A 2W0WA 2RJ1A 1MP4A 4EEOA 4Y9XA 1MC3A 2RJ4A 2RJ8A 1ZI3A 2JF2A 4KXOA 3I0KA 1VICA 2V0LA 5HS2A 4G3PA 3SXCA 4Y7FA 4DECA 3I0JA 4IRQA 4G87A 4HZDA 3V8ZA 3F1XA 5FUHA 4N69A 1ZCTA 2YCMA 3SX8A 1XHDA 3OU9A 1ZI4A 4EEGA 5CMJA 2X60A 2A8UA 2IC7A 4M28A 4D0ZA 4D11A 1H7HA 2ICXA 1INJA 1VM8A 3I0GA 1R7YA 5FU8A 3PNNA 1O23B 1NKHB 2NPOA 1R7XA 3U2TA 2OI7A 5IDTA 2NXVA 1FZWA 1TDTA 4HO0A 3R5AA 2XMHA 1QRGA 3OGZA 5CMIA 3OTZA 2QH5A 3O3PA 2JCLA 2P6WA 2YQHA 3I0IX 5EIYA 2FYDB 1IIMA 1FO8A 3HJJA 4DCLA 3SPTA 2AM4A 1ZJOA 5AJOA 4KQLA 2O1GA 3PKQA 3Q4SA 4Y63A 1KK5A 5E3PA 1GX0A 2FYAA 5C3BA 4G3SA 2BO8A 4HO9A 3OH1A 2FFVA 2MZBA 2WLEA 4C2SA 2XWMA 2VHEA 3EE5A 1HM0A 3EH0A 2APCA 1VH1A 2VS4A 3ZF8A 1XHBA 4FRMA 2QIAA 5EJZA 4HUSA 4EAAA 3F1YA 2ZU7A 2P72A 3E25A 5ADXV 2O1FA 4J09A 3OC9A 1OQMB 2D7RA 1S4NA 3OW5A 4GBPA 2VS3A 3IOHA 4KT7A 4ZDQA 5C8RA 3ZLLA 4EE4A 2VXMA 4E1KA 1JYLA 4IHGA 3U2VA 2P73A 3IGJA 1GX4A 4G3QA 2QIVX 1NQIB 4R36A 4N6AA 4EA7A 1VZUA 2X5SA 1PZYB 2RITA 4J18A 3VBNA 3OKRA 2X5ZA 3V8YA 2A8WA 3GVDA 2V0KA 3R5BA 3HSQA 1R7VA 3BSYA 5C49A 2TDTA 1JV1A 2AH9A 3V0LA 1MR9A 3VBMA 1VGWA 2PA4A 1O7QA 4HCQA 4Y7GA 2RJ5A 3CKOA 1XZ6A 3CJ8A 5BXCA 5CQLX 1H5SA 3BXYA 1HM8A 5DDVA 3OUPA 4Y7TA 1FG5N 1VGUA 4FREA 3R2WA 4B4MA 3OTMA 1ZJ0A 4CJ8A 5C47A 4Y62A 5C1GA 5I1FA 5C4FA 2JCKA 1ON8A 3FSXA 4KPZA 3U2UA 5CQNX 4MZUA 3GUEA 2VXLA 1S80A 1FR9A 5C1HA 1JYKA 2IUAA 2JF3A 3HL3A 4FRBA 3TZTA 1MRLA 4D48A 3I3AA 3V0PA 3SXDA 2O1HA 5C4BA 3R3RA 3BSSA 4EABA 2AM5A 1J2ZA 4E75A 1GWVA 3KIAA 3V0QA 1MR7A 2PGVA 1Z90A 3V0OA 3R5CA 1FR8A 3IXCA 2RIXA 4FRDA 3FOQA 3TV0A 1I52A 1TW1A 4FCUA 2D0JA 5DDTA 3I0HA 3V0NA 4M2BA 4NALA 3FSYA 1FXOA 3U2XA 3ECTA 3R1WA 4KC2A 1KRVA 3KWDA 1MP5A 1HV9A 1FWYA 1G9RA 4Y6NA 3FTTA 2V0JA 1W77A 2PX7A 4FRAA 2BO7A 1T3DA 1H5SB 1FRWA 3FWWA 1ZCYA 3SX5A 4M99A 3RSBA 3BCVA 1IINA 5C4DA 3LW6A 1FGXA 1EYRA 3MQGA 1H7FA 4KRVA 3SX3A 2Q4JA 4B4BA 4Y64A 3CKNA 2XATA 1G8OA 2VSHA 3CKJA 2UX8A 1HJLA 1KHRA 3TDTA 2IU9A 1H5RA 2YQJA 2RIJA 4AYJA 1H3MA 1JV3A 3I3XA 5FTSA 5IFYA 4FRPA 1QGQA 3P1BA 2GGQA 1S4PA 2WGZA 1WSZA 4JISA 5FV9A 1ZDGA 1V83A 4HO5A 2ZU9A 4EE5A 3MQHA 3K8EA 2Y4JA 1H7QA 4E6TA 5EJ1A 4EGGA 3EEVA 4BMAA 4YS8A 2WVLA 1LZ0A 2RJ7A 3Q80A 3ZGFA 3DJ4A 1QRFA 4ISXA 1G93A 1H4EA 1ZHJA 2OI6A 4IRPA 4HZCA 2RIZA 2X65A 5ADXU 2Z86A 3V0MA 1R81A 3D5NA 1O7OA 1GWWA 2WVMA 5AFUV 5F42A 2WLCA 4MFGA 1SSMA 1TVYA 1VPAA 3TK8A 3SRTA 1H5TA 4NANA 1SSTA 2VD4A 4EA9A 2RJ6A 4M9CA 2FFUA 3U2WA 1H7TA 5L6SA 1XATA 4UEGA 1W57A 5CMHA 1V84A 4HURA 2OI5A 3PKPA 2WLGA 3KWCA 3Q1XA 5C36A 1LL2A 3RMWA 2Y7AA 2OEGA 4IHFA 4AC3A 5CMGX 5C38A 1H5TB 4ASJA 4CJBA 1K4VA 1LXAA 1YROB 2FYCB 5AJNA 4E6UA 1LZIA 1ON6A 5CQPA 5IDSA 4KC4A 1NHEB 3TIOA 1VZXA 2QGIA 3I0LA 4CVHA 1KGTA 2FYBA 1KRRA 1SS9A 1ZJ3A 4MNDA 2BO4A 2AESA 1H7GA 5C1LA 3VBPA 2D7IA 1LL0A 2AQ9A 1ZCVA 1VH3A 3VBJA 2ICYA 1KK6A 1WVCA 4AA7A 1FXJA 3QVBA 5FYEA 2JCOA 1KWSA 1GQ9A 3JTJA 2Y4MA 4EVWA 1QRMA 1V82A 2YC5A 1SSQA 1V3WA 3R3IA 5DG3A 1WT0A 2WVKA 1R82A 3IOIA 4B42A 2W0VA 2JCJA 4M2AA 4HO4A 4JD0A 4DDZA 3VBIA 3TWDA 2WE9A 2CU2A 4L41C 3DHOA 1H5SC 2RJ9A 2V0IA 3R5DA 5L6VA 4E79A 2Y4LA 4KC1A 3ZGGA 4BQHA 2WEEA 3SXEA 4LW6A 4AAWA 1INIA 4NAIA 5CMFX 4EE3A 1QWJA 1QREA 5C48A 4EEAA 3PMOA 3N9WA 3V4EA 3V90A 4P02A 2FKOA 5C3AA 1GQCA 4B2WA 1FO9A 1HJJA 4R7PA 4ARWA 3JUJA 1GA8A 4FRLA 3R0SA 4MYBA 2YQSA 5CQMX 4H7OA 4DE7A 3USRA 3DK5A 3U0YA 2WLDA 4B2XA 4Y7VA 4HG6A 3POLA 1YP4A 5J49A 3CGXA 1VZTA 2I5KA 1ZDFA 2VSIA 3GOSA 2YQCA 3T7OA 3U0XA 4D0TA 1THJA 4IHHA 1H5RB 1ZI5A 2I7BA 1JVGA 1H4DA 1H5SD 1LZ7A 4B3UA 5JQQA 2FY7A 4FQWA 3T7NA 1LZJA 5E3RA 4K6RA 2WAWA 2Y6PA 3TISA 4FRHA 1QQ0A 2IU8A 1G97A 1QRLA 2XWLA 3BRKX 1H7LA 1OMXA 2XWNA 3SXAA 3SXGA 1LL3A 2I5EA 1FOAA 2YC3A 4HO3A 3D98A 4ASYA 2AM3A 3FSCA 1VGZA 4D11C 4MYOA 3ST8A 1FGGA 4B4GA 1LVWA 4B5BA 3BFPA 4LW3A 3VNPA 1YP2A 5E3QA 3TQDA 2V0HA 2PGYA 2DPWA 1G0RA 3ZLKA 1E5KA 3VBLA 2Z87A 1NWGB 5CQOA 2YESA 4AYLA 3I0FA 1QG8A 2OEFA 3F1CA 5AFUU 3CU0A 3JQYA 3P47A 4KNRA 1EZIA 3OH3A 3OAMA 4HOCA 2XMEA 5C4CA 4KNXA 5FU0A 3V91A 3D8VA 2Y4KA 1WT3A 1ZJ1A 1TZFA 1JVDA
chains in the Genus database with same CATH superfamily
3DUVA 4XWIA 4NAKA 1O0RA 3T7MA 3VBKA 5C3DA 1ZIZA 5FTVA 3EG4A 1S4OA 5DEPA 1ZJ2A 1H4CA 4KPXA 4N27A 4EA8A 2RIYA 2VFZA 2P2OA 1G23A 1VGTA 5C4EA 5U2KA 1WT1A 1OCXA 1KRUA 1V67A 4HO6A 1G95A 4R37A 3OH4A 2RJ0A 3R8YA 4FROA 3CKQA 1NF5B 4HO8A 3USQA 1NMMB 2E3DA 1WT2A 4P00A 1ZCUA 2AECA 1KGQA 3FSBA 1G3LA 1R7TA 1OMZA 5AJPA 1HM9A 4M98A 3KWEA 3CKVA 3I0CA 4EEMA 1ZJPA 3NGWA 4Y7UA 1G1LA 1R7UA 3Q7UA 4FCEA 3I0DA 2QKXA 3SXBA 1KK4A 1W55A 3IOJA 1YP3A 4FRQA 1R80A 2ZU8A 3OH2A 3MC4A 4M4KA 4N6BA 3RMVA 4CJCA 3SX7A 1KQAA 3FS8A 3T57A 4ECMA 2VS5A 4HO2A 1ZI1A 3C8VA 1TW5A 1MP3A 4Y6UA 3BSWA 2AGDA 1H7EA 3E26A 5DEMA 3JUKA 2AE7A 3K8DA 3I0EA 4Q7CA 4EQYA 2E8BA 1QGSA 1G2VA 1PZTA 2GGOA 5D92A 3OH0A 2WLFA 2BO6A 3NZ2A 2W0WA 2VK9A 2RJ1A 1MP4A 4EEOA 1Z2FA 4Y9XA 1MC3A 2RJ4A 2RJ8A 1ZI3A 2JF2A 4KXOA 3I0KA 1VICA 2V0LA 5HS2A 4G3PA 3SXCA 4Y7FA 4DECA 3I0JA 4IRQA 4G87A 4HZDA 3V8ZA 3F1XA 5FUHA 4N69A 1ZCTA 2YCMA 3SX8A 1XHDA 3OU9A 1ZI4A 4EEGA 5CMJA 2X60A 2A8UA 2IC7A 4M28A 4D0ZA 4D11A 1H7HA 2ICXA 1INJA 1VM8A 3I0GA 1R7YA 5FU8A 3PNNA 1O23B 1NKHB 2NPOA 1R7XA 3U2TA 2OI7A 5IDTA 2NXVA 4O6MA 1FZWA 1TDTA 4HO0A 3R5AA 2XMHA 1QRGA 3OGZA 5CMIA 3OTZA 2QH5A 3O3PA 2JCLA 2P6WA 2YQHA 3I0IX 5EIYA 2FYDB 1IIMA 1FO8A 3HJJA 4DCLA 3SPTA 2AM4A 1ZJOA 5AJOA 4KQLA 2O1GA 3PKQA 3Q4SA 4Y63A 1KK5A 5E3PA 1GX0A 2FYAA 5C3BA 4G3SA 2BO8A 4HO9A 3OH1A 2FFVA 2MZBA 2WLEA 4C2SA 2XWMA 2VHEA 3EE5A 1HM0A 3EH0A 2APCA 1VH1A 2VS4A 3ZF8A 1XHBA 4FRMA 2QIAA 5EJZA 4HUSA 4EAAA 3F1YA 2ZU7A 1EWWA 2P72A 3E25A 5ADXV 2O1FA 4J09A 3OC9A 1OQMB 2D7RA 1S4NA 3OW5A 4GBPA 2VS3A 3IOHA 4KT7A 4ZDQA 5C8RA 3ZLLA 4EE4A 2VXMA 4E1KA 1L0SA 4IHGA 1JYLA 3U2VA 2P73A 3IGJA 1GX4A 4G3QA 2QIVX 1NQIB 4R36A 4N6AA 4EA7A 1VZUA 2X5SA 1PZYB 2RITA 4J18A 3VBNA 3OKRA 2X5ZA 3V8YA 2A8WA 3GVDA 2V0KA 3R5BA 3HSQA 1R7VA 3BSYA 5C49A 2TDTA 1JV1A 2AH9A 3V0LA 1MR9A 3VBMA 1VGWA 2PA4A 1O7QA 4HCQA 4Y7GA 2RJ5A 3CKOA 1XZ6A 3CJ8A 5BXCA 5CQLX 1H5SA 3BXYA 1HM8A 4MIXA 5DDVA 3OUPA 4Y7TA 1FG5N 1VGUA 4FREA 3R2WA 4B4MA 4FIYA 3OTMA 1ZJ0A 4CJ8A 5C47A 4Y62A 5C1GA 5I1FA 5C4FA 2JCKA 1ON8A 3FSXA 4KPZA 3U2UA 5CQNX 5D91A 4MZUA 3GUEA 2VXLA 1S80A 1M8NA 1FR9A 5C1HA 1JYKA 2IUAA 2JF3A 3HL3A 4FRBA 3TZTA 1MRLA 4D48A 3I3AA 3V0PA 3SXDA 2O1HA 5C4BA 3R3RA 3BSSA 4EABA 2AM5A 1J2ZA 4E75A 1GWVA 3KIAA 3V0QA 1MR7A 2PGVA 1Z90A 3V0OA 3R5CA 1FR8A 3IXCA 2RIXA 1N4IA 4FRDA 3FOQA 3TV0A 1I52A 1TW1A 4FCUA 2D0JA 5DDTA 3I0HA 3V0NA 4M2BA 4NALA 3FSYA 1FXOA 3U2XA 3ECTA 3R1WA 4KC2A 1KRVA 3KWDA 1MP5A 2C0NA 1HV9A 1FWYA 1G9RA 4Y6NA 3FTTA 2V0JA 1W77A 2PX7A 4FRAA 2BO7A 1T3DA 1H5SB 1FRWA 3FWWA 1ZCYA 3SX5A 4M99A 3RSBA 3BCVA 1IINA 5C4DA 3LW6A 1FGXA 1EYRA 3MQGA 1H7FA 4KRVA 3SX3A 2Q4JA 4B4BA 4Y64A 3CKNA 2XATA 1G8OA 2VSHA 3CKJA 2UX8A 4FIXA 1HJLA 1KHRA 3TDTA 2IU9A 1H5RA 2YQJA 2RIJA 4AYJA 1H3MA 1JV3A 3I3XA 5FTSA 5IFYA 4FRPA 1QGQA 3P1BA 2GGQA 1S4PA 2WGZA 1WSZA 4JISA 5FV9A 1ZDGA 1V83A 4HO5A 2ZU9A 4EE5A 3MQHA 3K8EA 2Y4JA 1H7QA 4E6TA 5EJ1A 4EGGA 3EEVA 4BMAA 4YS8A 2WVLA 1LZ0A 2RJ7A 3Q80A 3ZGFA 3DJ4A 1QRFA 4ISXA 1G93A 1H4EA 1ZHJA 2OI6A 4IRPA 4HZCA 2RIZA 2X65A 5ADXU 2Z86A 3V0MA 1R81A 3D5NA 1O7OA 1GWWA 2WVMA 5AFUV 5F42A 2WLCA 4MFGA 1SSMA 1TVYA 1VPAA 3TK8A 3SRTA 1H5TA 4NANA 1SSTA 2VD4A 4EA9A 2RJ6A 4M9CA 2FFUA 3U2WA 1H7TA 5L6SA 1XATA 4UEGA 1W57A 5CMHA 1V84A 4HURA 2OI5A 3PKPA 3SUCA 2WLGA 3KWCA 3Q1XA 5C36A 1LL2A 3RMWA 2Y7AA 2OEGA 4IHFA 4AC3A 5CMGX 5C38A 3GQ9A 1H5TB 4ASJA 4CJBA 1K4VA 1LXAA 1YROB 2FYCB 5AJNA 4E6UA 1LZIA 1ON6A 5CQPA 5IDSA 4KC4A 1NHEB 3TIOA 1VZXA 2QGIA 3I0LA 4CVHA 1KGTA 2FYBA 1KRRA 1SS9A 1ZJ3A 4MNDA 2BO4A 2AESA 1H7GA 5C1LA 3VBPA 2D7IA 1LL0A 2AQ9A 1ZCVA 1VH3A 3VBJA 2ICYA 1KK6A 2J0BA 1WVCA 4AA7A 3GQAA 1FXJA 3QVBA 5FYEA 3GQ7A 1KWSA 2JCOA 1GQ9A 3JTJA 2Y4MA 4EVWA 1QRMA 1V82A 2YC5A 1SSQA 1V3WA 3R3IA 5DG3A 1WT0A 2WVKA 1R82A 3IOIA 4B42A 2W0VA 2JCJA 4M2AA 4HO4A 3GQ8A 4JD0A 4DDZA 3VBIA 3TWDA 2WE9A 2CU2A 4L41C 3DHOA 1H5SC 2RJ9A 2V0IA 3R5DA 5L6VA 4E79A 2Y4LA 4KC1A 3ZGGA 4BQHA 2WEEA 3SXEA 4LW6A 4AAWA 1INIA 4NAIA 5CMFX 4EE3A 1QWJA 1QREA 5C48A 4EEAA 3PMOA 3N9WA 3V4EA 3V90A 4P02A 2FKOA 5C3AA 1GQCA 4B2WA 1FO9A 1HJJA 4R7PA 4ARWA 3JUJA 1GA8A 4FRLA 3R0SA 4MYBA 2YQSA 5CQMX 4H7OA 4O6NA 4DE7A 3USRA 3DK5A 3U0YA 2WLDA 4B2XA 4Y7VA 4HG6A 3POLA 1YP4A 5J49A 3CGXA 1VZTA 2I5KA 1ZDFA 2VSIA 3GOSA 2YQCA 3T7OA 3U0XA 4D0TA 1THJA 4IHHA 1H5RB 1ZI5A 2I7BA 1JVGA 1H4DA 1H5SD 1LZ7A 4B3UA 5JQQA 2FY7A 4FQWA 3T7NA 1LZJA 5E3RA 4K6RA 2WAWA 2Y6PA 3TISA 4FRHA 1QQ0A 2IU8A 1G97A 1QRLA 2J0AA 2XWLA 3BRKX 1H7LA 1OMXA 2XWNA 3SXAA 3SXGA 1LL3A 2I5EA 1FOAA 2YC3A 4HO3A 3D98A 4ASYA 2AM3A 3FSCA 1VGZA 4D11C 4MYOA 3ST8A 1FGGA 4B4GA 1LVWA 4B5BA 3BFPA 4LW3A 3VNPA 1YP2A 5E3QA 3TQDA 2V0HA 2PGYA 2DPWA 1G0RA 3ZLKA 1E5KA 3VBLA 2Z87A 1NWGB 5CQOA 2YESA 4AYLA 3I0FA 1QG8A 2OEFA 3F1CA 5AFUU 3CU0A 3JQYA 3OH3A 3P47A 4KNRA 1EZIA 3OAMA 4HOCA 2XMEA 5C4CA 4KNXA 5FU0A 3V91A 3D8VA 2Y4KA 1WT3A 1ZJ1A 1TZFA 1JVDA
chains in the Genus database with same CATH topology
3DUVA 4XWIA 4NAKA 1O0RA 3T7MA 3VBKA 5C3DA 1ZIZA 5FTVA 3EG4A 1S4OA 5DEPA 1ZJ2A 1H4CA 4KPXA 4N27A 4EA8A 2RIYA 2VFZA 2P2OA 1G23A 1VGTA 5C4EA 5U2KA 1WT1A 1OCXA 1KRUA 1V67A 4HO6A 1G95A 4R37A 3OH4A 2RJ0A 3R8YA 4FROA 3CKQA 1NF5B 4HO8A 3USQA 1NMMB 2E3DA 1WT2A 4P00A 1ZCUA 2AECA 1KGQA 3FSBA 1G3LA 1R7TA 1OMZA 5AJPA 1HM9A 4M98A 3KWEA 3CKVA 3I0CA 4EEMA 1ZJPA 3NGWA 4Y7UA 1G1LA 1R7UA 3Q7UA 4FCEA 3I0DA 2QKXA 3SXBA 1KK4A 1W55A 3IOJA 1YP3A 4FRQA 1R80A 2ZU8A 3OH2A 3MC4A 4M4KA 4N6BA 3RMVA 4CJCA 3SX7A 1KQAA 3FS8A 3T57A 4ECMA 2VS5A 4HO2A 1ZI1A 3C8VA 1TW5A 1MP3A 4Y6UA 3BSWA 2AGDA 1H7EA 3E26A 5DEMA 3JUKA 2AE7A 3K8DA 3I0EA 4Q7CA 4EQYA 2E8BA 1QGSA 1G2VA 1PZTA 2GGOA 5D92A 2BO6A 2WLFA 3OH0A 3NZ2A 2W0WA 2VK9A 2RJ1A 1MP4A 4EEOA 4Y9XA 1MC3A 2RJ4A 2RJ8A 1ZI3A 2JF2A 4KXOA 3I0KA 1VICA 2V0LA 5HS2A 4G3PA 3SXCA 4Y7FA 4DECA 3I0JA 4IRQA 4G87A 4HZDA 3V8ZA 3F1XA 5FUHA 4N69A 1ZCTA 2YCMA 3SX8A 1XHDA 3OU9A 1ZI4A 4EEGA 5CMJA 2X60A 2A8UA 2IC7A 4M28A 4D0ZA 4D11A 1H7HA 2ICXA 1INJA 1VM8A 3I0GA 1R7YA 5FU8A 3PNNA 1O23B 1NKHB 2NPOA 1R7XA 3U2TA 2OI7A 5IDTA 2NXVA 4O6MA 1FZWA 1TDTA 4HO0A 3R5AA 2XMHA 1QRGA 3OGZA 5CMIA 3OTZA 2QH5A 3O3PA 2JCLA 2P6WA 2YQHA 3I0IX 5EIYA 2FYDB 1IIMA 1FO8A 3HJJA 4DCLA 3SPTA 2AM4A 1ZJOA 5AJOA 4KQLA 2O1GA 3PKQA 3Q4SA 4Y63A 1KK5A 5E3PA 1GX0A 2FYAA 5C3BA 4G3SA 2BO8A 4HO9A 3OH1A 2FFVA 2MZBA 2WLEA 4C2SA 2XWMA 2VHEA 3EE5A 1HM0A 3EH0A 2APCA 1VH1A 2VS4A 3ZF8A 1XHBA 4FRMA 2QIAA 5EJZA 4HUSA 4EAAA 3F1YA 2ZU7A 2P72A 3E25A 5ADXV 2O1FA 4J09A 3OC9A 1OQMB 2D7RA 1S4NA 3OW5A 4GBPA 2VS3A 3IOHA 4KT7A 4ZDQA 5C8RA 3ZLLA 4EE4A 2VXMA 4E1KA 1JYLA 4IHGA 3U2VA 2P73A 3IGJA 1GX4A 4G3QA 2QIVX 1NQIB 4R36A 4N6AA 4EA7A 1VZUA 2X5SA 1PZYB 2RITA 4J18A 3VBNA 3OKRA 2X5ZA 3V8YA 2A8WA 3GVDA 2V0KA 3R5BA 3HSQA 1R7VA 3BSYA 5C49A 2TDTA 1JV1A 2AH9A 3V0LA 1MR9A 3VBMA 1VGWA 2PA4A 1O7QA 4HCQA 4Y7GA 2RJ5A 3CKOA 1XZ6A 3CJ8A 5BXCA 5CQLX 1H5SA 3BXYA 1HM8A 4MIXA 5DDVA 3OUPA 4Y7TA 1FG5N 1VGUA 4FREA 3R2WA 4B4MA 4FIYA 3OTMA 1ZJ0A 4CJ8A 5C47A 4Y62A 5C1GA 5I1FA 5C4FA 2JCKA 1ON8A 3FSXA 4KPZA 3U2UA 5CQNX 5D91A 4MZUA 3GUEA 2VXLA 1S80A 1FR9A 5C1HA 1JYKA 2IUAA 2JF3A 3HL3A 4FRBA 3TZTA 1MRLA 4D48A 3I3AA 3V0PA 3SXDA 2O1HA 5C4BA 3R3RA 3BSSA 4EABA 2AM5A 1J2ZA 4E75A 1GWVA 3KIAA 3V0QA 1MR7A 2PGVA 1Z90A 3V0OA 3R5CA 1FR8A 3IXCA 2RIXA 4FRDA 3FOQA 3TV0A 1I52A 1TW1A 4FCUA 2D0JA 5DDTA 3I0HA 3V0NA 4M2BA 4NALA 3FSYA 1FXOA 3U2XA 3ECTA 3R1WA 4KC2A 1KRVA 3KWDA 1MP5A 2C0NA 1HV9A 1FWYA 1G9RA 4Y6NA 3FTTA 2V0JA 1W77A 2PX7A 4FRAA 2BO7A 1T3DA 1H5SB 1FRWA 3FWWA 1ZCYA 3SX5A 4M99A 3RSBA 3BCVA 1IINA 5C4DA 3LW6A 1FGXA 1EYRA 3MQGA 1H7FA 4KRVA 3SX3A 2Q4JA 4B4BA 4Y64A 3CKNA 2XATA 1G8OA 2VSHA 3CKJA 2UX8A 4FIXA 1HJLA 1KHRA 3TDTA 2IU9A 1H5RA 2YQJA 2RIJA 4AYJA 1H3MA 1JV3A 3I3XA 5FTSA 5IFYA 4FRPA 1QGQA 3P1BA 2GGQA 1S4PA 2WGZA 1WSZA 4JISA 5FV9A 1ZDGA 1V83A 4HO5A 2ZU9A 4EE5A 3MQHA 3K8EA 2Y4JA 1H7QA 4E6TA 5EJ1A 4EGGA 3EEVA 4BMAA 4YS8A 2WVLA 1LZ0A 2RJ7A 3Q80A 3ZGFA 3DJ4A 1QRFA 4ISXA 1G93A 1H4EA 1ZHJA 2OI6A 4IRPA 4HZCA 2RIZA 2X65A 5ADXU 2Z86A 3V0MA 1R81A 3D5NA 1O7OA 1GWWA 2WVMA 5AFUV 5F42A 2WLCA 4MFGA 1SSMA 1TVYA 1VPAA 3TK8A 3SRTA 1H5TA 4NANA 1SSTA 2VD4A 4EA9A 2RJ6A 4M9CA 2FFUA 3U2WA 1H7TA 5L6SA 1XATA 4UEGA 1W57A 5CMHA 1V84A 4HURA 2OI5A 3PKPA 2WLGA 3KWCA 3Q1XA 5C36A 1LL2A 3RMWA 2Y7AA 2OEGA 4IHFA 4AC3A 5CMGX 5C38A 1H5TB 4ASJA 4CJBA 1K4VA 1LXAA 1YROB 2FYCB 5AJNA 4E6UA 1LZIA 1ON6A 5CQPA 5IDSA 4KC4A 1NHEB 3TIOA 1VZXA 2QGIA 3I0LA 4CVHA 1KGTA 2FYBA 1KRRA 1SS9A 1ZJ3A 4MNDA 2BO4A 2AESA 1H7GA 5C1LA 3VBPA 2D7IA 1LL0A 2AQ9A 1ZCVA 1VH3A 3VBJA 2ICYA 1KK6A 2J0BA 1WVCA 4AA7A 1FXJA 3QVBA 5FYEA 2JCOA 1KWSA 1GQ9A 3JTJA 2Y4MA 4EVWA 1QRMA 1V82A 2YC5A 1SSQA 1V3WA 3R3IA 5DG3A 1WT0A 2WVKA 1R82A 3IOIA 4B42A 2W0VA 2JCJA 4M2AA 4HO4A 4JD0A 4DDZA 3VBIA 3TWDA 2WE9A 2CU2A 4L41C 3DHOA 1H5SC 2RJ9A 2V0IA 3R5DA 5L6VA 4E79A 2Y4LA 4KC1A 3ZGGA 4BQHA 2WEEA 3SXEA 4LW6A 4AAWA 1INIA 4NAIA 5CMFX 4EE3A 1QWJA 1QREA 5C48A 4EEAA 3PMOA 3N9WA 3V4EA 3V90A 4P02A 2FKOA 5C3AA 1GQCA 4B2WA 1FO9A 1HJJA 4R7PA 4ARWA 3JUJA 1GA8A 4FRLA 3R0SA 4MYBA 2YQSA 5CQMX 4H7OA 4O6NA 4DE7A 3USRA 3DK5A 3U0YA 2WLDA 4B2XA 4Y7VA 4HG6A 3POLA 1YP4A 5J49A 3CGXA 1VZTA 2I5KA 1ZDFA 2VSIA 3GOSA 2YQCA 3T7OA 3U0XA 4D0TA 1THJA 4IHHA 1H5RB 1ZI5A 2I7BA 1JVGA 1H4DA 1H5SD 1LZ7A 4B3UA 5JQQA 2FY7A 4FQWA 3T7NA 1LZJA 5E3RA 4K6RA 2WAWA 2Y6PA 3TISA 4FRHA 1QQ0A 2IU8A 1G97A 1QRLA 2J0AA 2XWLA 3BRKX 1H7LA 1OMXA 2XWNA 3SXAA 3SXGA 1LL3A 2I5EA 1FOAA 2YC3A 4HO3A 3D98A 4ASYA 2AM3A 3FSCA 1VGZA 4D11C 4MYOA 3ST8A 1FGGA 4B4GA 1LVWA 4B5BA 3BFPA 4LW3A 3VNPA 1YP2A 5E3QA 3TQDA 2V0HA 2PGYA 2DPWA 1G0RA 3ZLKA 1E5KA 3VBLA 2Z87A 1NWGB 5CQOA 2YESA 4AYLA 3I0FA 1QG8A 2OEFA 3F1CA 5AFUU 3CU0A 3JQYA 3P47A 4KNRA 1EZIA 3OH3A 3OAMA 4HOCA 2XMEA 5C4CA 4KNXA 5FU0A 3V91A 3D8VA 2Y4KA 1WT3A 1ZJ1A 1TZFA 1JVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DUV A;  4XWI A;  4NAK A;  1O0R A;  3T7M A;  3VBK A;  5C3D A;  1ZIZ A;  5FTV A;  3EG4 A;  1S4O A;  5DEP A;  1ZJ2 A;  1H4C A;  4KPX A;  4N27 A;  4EA8 A;  2RIY A;  2VFZ A;  2P2O A;  1G23 A;  1VGT A;  5C4E A;  5U2K A;  1WT1 A;  1OCX A;  1KRU A;  1V67 A;  4HO6 A;  1G95 A;  4R37 A;  3OH4 A;  2RJ0 A;  3R8Y A;  4FRO A;  3CKQ A;  1NF5 B;  4HO8 A;  3USQ A;  1NMM B;  2E3D A;  1WT2 A;  4P00 A;  1ZCU A;  2AEC A;  1KGQ A;  3FSB A;  1G3L A;  1R7T A;  1OMZ A;  5AJP A;  1HM9 A;  4M98 A;  3KWE A;  3CKV A;  3I0C A;  4EEM A;  1ZJP A;  3NGW A;  4Y7U A;  1G1L A;  1R7U A;  3Q7U A;  4FCE A;  3I0D A;  2QKX A;  3SXB A;  1KK4 A;  1W55 A;  3IOJ A;  1YP3 A;  4FRQ A;  1R80 A;  2ZU8 A;  3OH2 A;  3MC4 A;  4M4K A;  4N6B A;  3RMV A;  4CJC A;  3SX7 A;  1KQA A;  3FS8 A;  3T57 A;  4ECM A;  2VS5 A;  4HO2 A;  1ZI1 A;  3C8V A;  1TW5 A;  1MP3 A;  4Y6U A;  3BSW A;  2AGD A;  1H7E A;  3E26 A;  5DEM A;  3JUK A;  2AE7 A;  3K8D A;  3I0E A;  4EQY A;  2E8B A;  1QGS A;  1G2V A;  1PZT A;  2GGO A;  2BO6 A;  2WLF A;  3OH0 A;  3NZ2 A;  2W0W A;  2RJ1 A;  1MP4 A;  4EEO A;  4Y9X A;  1MC3 A;  2RJ4 A;  2RJ8 A;  1ZI3 A;  2JF2 A;  4KXO A;  3I0K A;  1VIC A;  2V0L A;  5HS2 A;  4G3P A;  3SXC A;  4Y7F A;  4DEC A;  3I0J A;  4IRQ A;  4G87 A;  4HZD A;  3V8Z A;  3F1X A;  5FUH A;  4N69 A;  1ZCT A;  2YCM A;  3SX8 A;  1XHD A;  3OU9 A;  1ZI4 A;  4EEG A;  5CMJ A;  2X60 A;  2A8U A;  2IC7 A;  4M28 A;  4D0Z A;  4D11 A;  1H7H A;  2ICX A;  1INJ A;  1VM8 A;  3I0G A;  1R7Y A;  5FU8 A;  3PNN A;  1O23 B;  1NKH B;  2NPO A;  1R7X A;  3U2T A;  2OI7 A;  5IDT A;  2NXV A;  1FZW A;  1TDT A;  4HO0 A;  3R5A A;  2XMH A;  1QRG A;  3OGZ A;  5CMI A;  3OTZ A;  2QH5 A;  3O3P A;  2JCL A;  2P6W A;  2YQH A;  3I0I X;  5EIY A;  2FYD B;  1IIM A;  1FO8 A;  3HJJ A;  4DCL A;  3SPT A;  2AM4 A;  1ZJO A;  5AJO A;  4KQL A;  2O1G A;  3PKQ A;  3Q4S A;  4Y63 A;  1KK5 A;  5E3P A;  1GX0 A;  2FYA A;  5C3B A;  4G3S A;  2BO8 A;  4HO9 A;  3OH1 A;  2FFV A;  2MZB A;  2WLE A;  4C2S A;  2XWM A;  2VHE A;  3EE5 A;  1HM0 A;  3EH0 A;  2APC A;  1VH1 A;  2VS4 A;  3ZF8 A;  1XHB A;  4FRM A;  2QIA A;  5EJZ A;  4HUS A;  4EAA A;  3F1Y A;  2ZU7 A;  2P72 A;  3E25 A;  5ADX V;  2O1F A;  4J09 A;  3OC9 A;  1OQM B;  2D7R A;  1S4N A;  3OW5 A;  4GBP A;  2VS3 A;  3IOH A;  4KT7 A;  4ZDQ A;  5C8R A;  3ZLL A;  4EE4 A;  2VXM A;  4E1K A;  1JYL A;  4IHG A;  3U2V A;  2P73 A;  3IGJ A;  1GX4 A;  4G3Q A;  2QIV X;  1NQI B;  4R36 A;  4N6A A;  4EA7 A;  1VZU A;  2X5S A;  1PZY B;  2RIT A;  4J18 A;  3VBN A;  3OKR A;  2X5Z A;  3V8Y A;  2A8W A;  3GVD A;  2V0K A;  3R5B A;  3HSQ A;  1R7V A;  3BSY A;  5C49 A;  2TDT A;  1JV1 A;  2AH9 A;  3V0L A;  1MR9 A;  3VBM A;  1VGW A;  2PA4 A;  1O7Q A;  4HCQ A;  4Y7G A;  2RJ5 A;  3CKO A;  1XZ6 A;  3CJ8 A;  5BXC A;  5CQL X;  1H5S A;  3BXY A;  1HM8 A;  5DDV A;  3OUP A;  4Y7T A;  1FG5 N;  1VGU A;  4FRE A;  3R2W A;  4B4M A;  3OTM A;  1ZJ0 A;  4CJ8 A;  5C47 A;  4Y62 A;  5C1G A;  5I1F A;  5C4F A;  2JCK A;  1ON8 A;  3FSX A;  4KPZ A;  3U2U A;  5CQN X;  4MZU A;  3GUE A;  2VXL A;  1S80 A;  1FR9 A;  5C1H A;  1JYK A;  2IUA A;  2JF3 A;  3HL3 A;  4FRB A;  3TZT A;  1MRL A;  4D48 A;  3I3A A;  3V0P A;  3SXD A;  2O1H A;  5C4B A;  3R3R A;  3BSS A;  4EAB A;  2AM5 A;  1J2Z A;  4E75 A;  1GWV A;  3KIA A;  3V0Q A;  1MR7 A;  2PGV A;  1Z90 A;  3V0O A;  3R5C A;  1FR8 A;  3IXC A;  2RIX A;  4FRD A;  3FOQ A;  3TV0 A;  1I52 A;  1TW1 A;  4FCU A;  2D0J A;  5DDT A;  3I0H A;  3V0N A;  4M2B A;  4NAL A;  3FSY A;  1FXO A;  3U2X A;  3ECT A;  3R1W A;  4KC2 A;  1KRV A;  3KWD A;  1MP5 A;  1HV9 A;  1FWY A;  1G9R A;  4Y6N A;  3FTT A;  2V0J A;  1W77 A;  2PX7 A;  4FRA A;  2BO7 A;  1T3D A;  1H5S B;  1FRW A;  3FWW A;  1ZCY A;  3SX5 A;  4M99 A;  3RSB A;  3BCV A;  1IIN A;  5C4D A;  3LW6 A;  1FGX A;  1EYR A;  3MQG A;  1H7F A;  4KRV A;  3SX3 A;  2Q4J A;  4B4B A;  4Y64 A;  3CKN A;  2XAT A;  1G8O A;  2VSH A;  3CKJ A;  2UX8 A;  1HJL A;  1KHR A;  3TDT A;  2IU9 A;  1H5R A;  2YQJ A;  2RIJ A;  4AYJ A;  1H3M A;  1JV3 A;  3I3X A;  5FTS A;  5IFY A;  4FRP A;  1QGQ A;  3P1B A;  2GGQ A;  1S4P A;  2WGZ A;  1WSZ A;  4JIS A;  5FV9 A;  1ZDG A;  1V83 A;  4HO5 A;  2ZU9 A;  4EE5 A;  3MQH A;  3K8E A;  2Y4J A;  1H7Q A;  4E6T A;  5EJ1 A;  4EGG A;  3EEV A;  4BMA A;  4YS8 A;  2WVL A;  1LZ0 A;  2RJ7 A;  3Q80 A;  3ZGF A;  3DJ4 A;  1QRF A;  4ISX A;  1G93 A;  1H4E A;  1ZHJ A;  2OI6 A;  4IRP A;  4HZC A;  2RIZ A;  2X65 A;  5ADX U;  2Z86 A;  3V0M A;  1R81 A;  3D5N A;  1O7O A;  1GWW A;  2WVM A;  5AFU V;  5F42 A;  2WLC A;  4MFG A;  1SSM A;  1TVY A;  1VPA A;  3TK8 A;  3SRT A;  1H5T A;  4NAN A;  1SST A;  2VD4 A;  4EA9 A;  2RJ6 A;  4M9C A;  2FFU A;  3U2W A;  1H7T A;  5L6S A;  1XAT A;  4UEG A;  1W57 A;  5CMH A;  1V84 A;  4HUR A;  2OI5 A;  3PKP A;  2WLG A;  3KWC A;  3Q1X A;  5C36 A;  1LL2 A;  3RMW A;  2Y7A A;  2OEG A;  4IHF A;  4AC3 A;  5CMG X;  5C38 A;  1H5T B;  4ASJ A;  4CJB A;  1K4V A;  1LXA A;  1YRO B;  2FYC B;  5AJN A;  4E6U A;  1LZI A;  1ON6 A;  5CQP A;  5IDS A;  4KC4 A;  1NHE B;  3TIO A;  1VZX A;  2QGI A;  3I0L A;  4CVH A;  1KGT A;  2FYB A;  1KRR A;  1SS9 A;  1ZJ3 A;  4MND A;  2BO4 A;  2AES A;  1H7G A;  5C1L A;  3VBP A;  2D7I A;  1LL0 A;  2AQ9 A;  1ZCV A;  1VH3 A;  3VBJ A;  2ICY A;  1KK6 A;  1WVC A;  4AA7 A;  1FXJ A;  3QVB A;  5FYE A;  2JCO A;  1KWS A;  1GQ9 A;  3JTJ A;  2Y4M A;  4EVW A;  1QRM A;  1V82 A;  2YC5 A;  1SSQ A;  1V3W A;  3R3I A;  5DG3 A;  1WT0 A;  2WVK A;  1R82 A;  3IOI A;  4B42 A;  2W0V A;  2JCJ A;  4M2A A;  4HO4 A;  4JD0 A;  4DDZ A;  3VBI A;  3TWD A;  2WE9 A;  2CU2 A;  4L41 C;  3DHO A;  1H5S C;  2RJ9 A;  2V0I A;  3R5D A;  5L6V A;  4E79 A;  2Y4L A;  4KC1 A;  3ZGG A;  4BQH A;  2WEE A;  3SXE A;  4LW6 A;  4AAW A;  1INI A;  4NAI A;  5CMF X;  4EE3 A;  1QWJ A;  1QRE A;  5C48 A;  4EEA A;  3PMO A;  3N9W A;  3V4E A;  3V90 A;  4P02 A;  2FKO A;  5C3A A;  1GQC A;  4B2W A;  1FO9 A;  1HJJ A;  4R7P A;  4ARW A;  3JUJ A;  1GA8 A;  4FRL A;  3R0S A;  4MYB A;  2YQS A;  5CQM X;  4H7O A;  4DE7 A;  3USR A;  3DK5 A;  3U0Y A;  2WLD A;  4B2X A;  4Y7V A;  4HG6 A;  3POL A;  1YP4 A;  5J49 A;  3CGX A;  1VZT A;  2I5K A;  1ZDF A;  2VSI A;  3GOS A;  2YQC A;  3T7O A;  3U0X A;  4D0T A;  1THJ A;  4IHH A;  1H5R B;  1ZI5 A;  2I7B A;  1JVG A;  1H4D A;  1H5S D;  1LZ7 A;  4B3U A;  5JQQ A;  2FY7 A;  4FQW A;  3T7N A;  1LZJ A;  5E3R A;  4K6R A;  2WAW A;  2Y6P A;  3TIS A;  4FRH A;  1QQ0 A;  2IU8 A;  1G97 A;  1QRL A;  2XWL A;  3BRK X;  1H7L A;  1OMX A;  2XWN A;  3SXA A;  3SXG A;  1LL3 A;  2I5E A;  1FOA A;  2YC3 A;  4HO3 A;  3D98 A;  4ASY A;  2AM3 A;  3FSC A;  1VGZ A;  4D11 C;  4MYO A;  3ST8 A;  1FGG A;  4B4G A;  1LVW A;  4B5B A;  3BFP A;  4LW3 A;  3VNP A;  1YP2 A;  5E3Q A;  3TQD A;  2V0H A;  2PGY A;  2DPW A;  1G0R A;  3ZLK A;  1E5K A;  3VBL A;  2Z87 A;  1NWG B;  5CQO A;  2YES A;  4AYL A;  3I0F A;  1QG8 A;  2OEF A;  3F1C A;  5AFU U;  3CU0 A;  3JQY A;  3P47 A;  4KNR A;  1EZI A;  3OH3 A;  3OAM A;  4HOC A;  2XME A;  5C4C A;  4KNX A;  5FU0 A;  3V91 A;  3D8V A;  2Y4K A;  1WT3 A;  1ZJ1 A;  1TZF A;  1JVD A; 
#chains in the Genus database with same CATH topology
 3DUV A;  4XWI A;  4NAK A;  1O0R A;  3T7M A;  3VBK A;  5C3D A;  1ZIZ A;  5FTV A;  3EG4 A;  1S4O A;  5DEP A;  1ZJ2 A;  1H4C A;  4KPX A;  4N27 A;  4EA8 A;  2RIY A;  2VFZ A;  2P2O A;  1G23 A;  1VGT A;  5C4E A;  5U2K A;  1WT1 A;  1OCX A;  1KRU A;  1V67 A;  4HO6 A;  1G95 A;  4R37 A;  3OH4 A;  2RJ0 A;  3R8Y A;  4FRO A;  3CKQ A;  1NF5 B;  4HO8 A;  3USQ A;  1NMM B;  2E3D A;  1WT2 A;  4P00 A;  1ZCU A;  2AEC A;  1KGQ A;  3FSB A;  1G3L A;  1R7T A;  1OMZ A;  5AJP A;  1HM9 A;  4M98 A;  3KWE A;  3CKV A;  3I0C A;  4EEM A;  1ZJP A;  3NGW A;  4Y7U A;  1G1L A;  1R7U A;  3Q7U A;  4FCE A;  3I0D A;  2QKX A;  3SXB A;  1KK4 A;  1W55 A;  3IOJ A;  1YP3 A;  4FRQ A;  1R80 A;  2ZU8 A;  3OH2 A;  3MC4 A;  4M4K A;  4N6B A;  3RMV A;  4CJC A;  3SX7 A;  1KQA A;  3FS8 A;  3T57 A;  4ECM A;  2VS5 A;  4HO2 A;  1ZI1 A;  3C8V A;  1TW5 A;  1MP3 A;  4Y6U A;  3BSW A;  2AGD A;  1H7E A;  3E26 A;  5DEM A;  3JUK A;  2AE7 A;  3K8D A;  3I0E A;  4Q7C A;  4EQY A;  2E8B A;  1QGS A;  1G2V A;  1PZT A;  2GGO A;  5D92 A;  3OH0 A;  2WLF A;  2BO6 A;  3NZ2 A;  2W0W A;  2VK9 A;  2RJ1 A;  1MP4 A;  4EEO A;  1Z2F A;  4Y9X A;  1MC3 A;  2RJ4 A;  2RJ8 A;  1ZI3 A;  2JF2 A;  4KXO A;  3I0K A;  1VIC A;  2V0L A;  5HS2 A;  4G3P A;  3SXC A;  4Y7F A;  4DEC A;  3I0J A;  4IRQ A;  4G87 A;  4HZD A;  3V8Z A;  3F1X A;  5FUH A;  4N69 A;  1ZCT A;  2YCM A;  3SX8 A;  1XHD A;  3OU9 A;  1ZI4 A;  4EEG A;  5CMJ A;  2X60 A;  2A8U A;  2IC7 A;  4M28 A;  4D0Z A;  4D11 A;  1H7H A;  2ICX A;  1INJ A;  1VM8 A;  3I0G A;  1R7Y A;  5FU8 A;  3PNN A;  1O23 B;  1NKH B;  2NPO A;  1R7X A;  3U2T A;  2OI7 A;  5IDT A;  2NXV A;  4O6M A;  1FZW A;  1TDT A;  4HO0 A;  3R5A A;  2XMH A;  1QRG A;  3OGZ A;  5CMI A;  3OTZ A;  2QH5 A;  3O3P A;  2JCL A;  2P6W A;  2YQH A;  3I0I X;  5EIY A;  2FYD B;  1IIM A;  1FO8 A;  3HJJ A;  4DCL A;  3SPT A;  2AM4 A;  1ZJO A;  5AJO A;  4KQL A;  2O1G A;  3PKQ A;  3Q4S A;  4Y63 A;  1KK5 A;  5E3P A;  1GX0 A;  2FYA A;  5C3B A;  4G3S A;  2BO8 A;  4HO9 A;  3OH1 A;  2FFV A;  2MZB A;  2WLE A;  4C2S A;  2XWM A;  2VHE A;  3EE5 A;  1HM0 A;  3EH0 A;  2APC A;  1VH1 A;  2VS4 A;  3ZF8 A;  1XHB A;  4FRM A;  2QIA A;  5EJZ A;  4HUS A;  4EAA A;  3F1Y A;  2ZU7 A;  1EWW A;  2P72 A;  3E25 A;  5ADX V;  2O1F A;  4J09 A;  3OC9 A;  1OQM B;  2D7R A;  1S4N A;  3OW5 A;  4GBP A;  2VS3 A;  3IOH A;  4KT7 A;  4ZDQ A;  5C8R A;  3ZLL A;  4EE4 A;  2VXM A;  4E1K A;  1L0S A;  4IHG A;  1JYL A;  3U2V A;  2P73 A;  3IGJ A;  1GX4 A;  4G3Q A;  2QIV X;  1NQI B;  4R36 A;  4N6A A;  4EA7 A;  1VZU A;  2X5S A;  1PZY B;  2RIT A;  4J18 A;  3VBN A;  3OKR A;  2X5Z A;  3V8Y A;  2A8W A;  3GVD A;  2V0K A;  3R5B A;  3HSQ A;  1R7V A;  3BSY A;  5C49 A;  2TDT A;  1JV1 A;  2AH9 A;  3V0L A;  1MR9 A;  3VBM A;  1VGW A;  2PA4 A;  1O7Q A;  4HCQ A;  4Y7G A;  2RJ5 A;  3CKO A;  1XZ6 A;  3CJ8 A;  5BXC A;  5CQL X;  1H5S A;  3BXY A;  1HM8 A;  4MIX A;  5DDV A;  3OUP A;  4Y7T A;  1FG5 N;  1VGU A;  4FRE A;  3R2W A;  4B4M A;  4FIY A;  3OTM A;  1ZJ0 A;  4CJ8 A;  5C47 A;  4Y62 A;  5C1G A;  5I1F A;  5C4F A;  2JCK A;  1ON8 A;  3FSX A;  4KPZ A;  3U2U A;  5CQN X;  5D91 A;  4MZU A;  3GUE A;  2VXL A;  1S80 A;  1M8N A;  1FR9 A;  5C1H A;  1JYK A;  2IUA A;  2JF3 A;  3HL3 A;  4FRB A;  3TZT A;  1MRL A;  4D48 A;  3I3A A;  3V0P A;  3SXD A;  2O1H A;  5C4B A;  3R3R A;  3BSS A;  4EAB A;  2AM5 A;  1J2Z A;  4E75 A;  1GWV A;  3KIA A;  3V0Q A;  1MR7 A;  2PGV A;  1Z90 A;  3V0O A;  3R5C A;  1FR8 A;  3IXC A;  2RIX A;  1N4I A;  4FRD A;  3FOQ A;  3TV0 A;  1I52 A;  1TW1 A;  4FCU A;  2D0J A;  5DDT A;  3I0H A;  3V0N A;  4M2B A;  4NAL A;  3FSY A;  1FXO A;  3U2X A;  3ECT A;  3R1W A;  4KC2 A;  1KRV A;  3KWD A;  1MP5 A;  2C0N A;  1HV9 A;  1FWY A;  1G9R A;  4Y6N A;  3FTT A;  2V0J A;  1W77 A;  2PX7 A;  4FRA A;  2BO7 A;  1T3D A;  1H5S B;  1FRW A;  3FWW A;  1ZCY A;  3SX5 A;  4M99 A;  3RSB A;  3BCV A;  1IIN A;  5C4D A;  3LW6 A;  1FGX A;  1EYR A;  3MQG A;  1H7F A;  4KRV A;  3SX3 A;  2Q4J A;  4B4B A;  4Y64 A;  3CKN A;  2XAT A;  1G8O A;  2VSH A;  3CKJ A;  2UX8 A;  4FIX A;  1HJL A;  1KHR A;  3TDT A;  2IU9 A;  1H5R A;  2YQJ A;  2RIJ A;  4AYJ A;  1H3M A;  1JV3 A;  3I3X A;  5FTS A;  5IFY A;  4FRP A;  1QGQ A;  3P1B A;  2GGQ A;  1S4P A;  2WGZ A;  1WSZ A;  4JIS A;  5FV9 A;  1ZDG A;  1V83 A;  4HO5 A;  2ZU9 A;  4EE5 A;  3MQH A;  3K8E A;  2Y4J A;  1H7Q A;  4E6T A;  5EJ1 A;  4EGG A;  3EEV A;  4BMA A;  4YS8 A;  2WVL A;  1LZ0 A;  2RJ7 A;  3Q80 A;  3ZGF A;  3DJ4 A;  1QRF A;  4ISX A;  1G93 A;  1H4E A;  1ZHJ A;  2OI6 A;  4IRP A;  4HZC A;  2RIZ A;  2X65 A;  5ADX U;  2Z86 A;  3V0M A;  1R81 A;  3D5N A;  1O7O A;  1GWW A;  2WVM A;  5AFU V;  5F42 A;  2WLC A;  4MFG A;  1SSM A;  1TVY A;  1VPA A;  3TK8 A;  3SRT A;  1H5T A;  4NAN A;  1SST A;  2VD4 A;  4EA9 A;  2RJ6 A;  4M9C A;  2FFU A;  3U2W A;  1H7T A;  5L6S A;  1XAT A;  4UEG A;  1W57 A;  5CMH A;  1V84 A;  4HUR A;  2OI5 A;  3PKP A;  3SUC A;  2WLG A;  3KWC A;  3Q1X A;  5C36 A;  1LL2 A;  3RMW A;  2Y7A A;  2OEG A;  4IHF A;  4AC3 A;  5CMG X;  5C38 A;  3GQ9 A;  1H5T B;  4ASJ A;  4CJB A;  1K4V A;  1LXA A;  1YRO B;  2FYC B;  5AJN A;  4E6U A;  1LZI A;  1ON6 A;  5CQP A;  5IDS A;  4KC4 A;  1NHE B;  3TIO A;  1VZX A;  2QGI A;  3I0L A;  4CVH A;  1KGT A;  2FYB A;  1KRR A;  1SS9 A;  1ZJ3 A;  4MND A;  2BO4 A;  2AES A;  1H7G A;  5C1L A;  3VBP A;  2D7I A;  1LL0 A;  2AQ9 A;  1ZCV A;  1VH3 A;  3VBJ A;  2ICY A;  1KK6 A;  2J0B A;  1WVC A;  4AA7 A;  3GQA A;  1FXJ A;  3QVB A;  5FYE A;  3GQ7 A;  1KWS A;  2JCO A;  1GQ9 A;  3JTJ A;  2Y4M A;  4EVW A;  1QRM A;  1V82 A;  2YC5 A;  1SSQ A;  1V3W A;  3R3I A;  5DG3 A;  1WT0 A;  2WVK A;  1R82 A;  3IOI A;  4B42 A;  2W0V A;  2JCJ A;  4M2A A;  4HO4 A;  3GQ8 A;  4JD0 A;  4DDZ A;  3VBI A;  3TWD A;  2WE9 A;  2CU2 A;  4L41 C;  3DHO A;  1H5S C;  2RJ9 A;  2V0I A;  3R5D A;  5L6V A;  4E79 A;  2Y4L A;  4KC1 A;  3ZGG A;  4BQH A;  2WEE A;  3SXE A;  4LW6 A;  4AAW A;  1INI A;  4NAI A;  5CMF X;  4EE3 A;  1QWJ A;  1QRE A;  5C48 A;  4EEA A;  3PMO A;  3N9W A;  3V4E A;  3V90 A;  4P02 A;  2FKO A;  5C3A A;  1GQC A;  4B2W A;  1FO9 A;  1HJJ A;  4R7P A;  4ARW A;  3JUJ A;  1GA8 A;  4FRL A;  3R0S A;  4MYB A;  2YQS A;  5CQM X;  4H7O A;  4O6N A;  4DE7 A;  3USR A;  3DK5 A;  3U0Y A;  2WLD A;  4B2X A;  4Y7V A;  4HG6 A;  3POL A;  1YP4 A;  5J49 A;  3CGX A;  1VZT A;  2I5K A;  1ZDF A;  2VSI A;  3GOS A;  2YQC A;  3T7O A;  3U0X A;  4D0T A;  1THJ A;  4IHH A;  1H5R B;  1ZI5 A;  2I7B A;  1JVG A;  1H4D A;  1H5S D;  1LZ7 A;  4B3U A;  5JQQ A;  2FY7 A;  4FQW A;  3T7N A;  1LZJ A;  5E3R A;  4K6R A;  2WAW A;  2Y6P A;  3TIS A;  4FRH A;  1QQ0 A;  2IU8 A;  1G97 A;  1QRL A;  2J0A A;  2XWL A;  3BRK X;  1H7L A;  1OMX A;  2XWN A;  3SXA A;  3SXG A;  1LL3 A;  2I5E A;  1FOA A;  2YC3 A;  4HO3 A;  3D98 A;  4ASY A;  2AM3 A;  3FSC A;  1VGZ A;  4D11 C;  4MYO A;  3ST8 A;  1FGG A;  4B4G A;  1LVW A;  4B5B A;  3BFP A;  4LW3 A;  3VNP A;  1YP2 A;  5E3Q A;  3TQD A;  2V0H A;  2PGY A;  2DPW A;  1G0R A;  3ZLK A;  1E5K A;  3VBL A;  2Z87 A;  1NWG B;  5CQO A;  2YES A;  4AYL A;  3I0F A;  1QG8 A;  2OEF A;  3F1C A;  5AFU U;  3CU0 A;  3JQY A;  3OH3 A;  3P47 A;  4KNR A;  1EZI A;  3OAM A;  4HOC A;  2XME A;  5C4C A;  4KNX A;  5FU0 A;  3V91 A;  3D8V A;  2Y4K A;  1WT3 A;  1ZJ1 A;  1TZF A;  1JVD A; 
#chains in the Genus database with same CATH homology
 3DUV A;  4XWI A;  4NAK A;  1O0R A;  3T7M A;  3VBK A;  5C3D A;  1ZIZ A;  5FTV A;  3EG4 A;  1S4O A;  5DEP A;  1ZJ2 A;  1H4C A;  4KPX A;  4N27 A;  4EA8 A;  2RIY A;  2VFZ A;  2P2O A;  1G23 A;  1VGT A;  5C4E A;  5U2K A;  1WT1 A;  1OCX A;  1KRU A;  1V67 A;  4HO6 A;  1G95 A;  4R37 A;  3OH4 A;  2RJ0 A;  3R8Y A;  4FRO A;  3CKQ A;  1NF5 B;  4HO8 A;  3USQ A;  1NMM B;  2E3D A;  1WT2 A;  4P00 A;  1ZCU A;  2AEC A;  1KGQ A;  3FSB A;  1G3L A;  1R7T A;  1OMZ A;  5AJP A;  1HM9 A;  4M98 A;  3KWE A;  3CKV A;  3I0C A;  4EEM A;  1ZJP A;  3NGW A;  4Y7U A;  1G1L A;  1R7U A;  3Q7U A;  4FCE A;  3I0D A;  2QKX A;  3SXB A;  1KK4 A;  1W55 A;  3IOJ A;  1YP3 A;  4FRQ A;  1R80 A;  2ZU8 A;  3OH2 A;  3MC4 A;  4M4K A;  4N6B A;  3RMV A;  4CJC A;  3SX7 A;  1KQA A;  3FS8 A;  3T57 A;  4ECM A;  2VS5 A;  4HO2 A;  1ZI1 A;  3C8V A;  1TW5 A;  1MP3 A;  4Y6U A;  3BSW A;  2AGD A;  1H7E A;  3E26 A;  5DEM A;  3JUK A;  2AE7 A;  3K8D A;  3I0E A;  4Q7C A;  4EQY A;  2E8B A;  1QGS A;  1G2V A;  1PZT A;  2GGO A;  5D92 A;  2BO6 A;  2WLF A;  3OH0 A;  3NZ2 A;  2W0W A;  2VK9 A;  2RJ1 A;  1MP4 A;  4EEO A;  4Y9X A;  1MC3 A;  2RJ4 A;  2RJ8 A;  1ZI3 A;  2JF2 A;  4KXO A;  3I0K A;  1VIC A;  2V0L A;  5HS2 A;  4G3P A;  3SXC A;  4Y7F A;  4DEC A;  3I0J A;  4IRQ A;  4G87 A;  4HZD A;  3V8Z A;  3F1X A;  5FUH A;  4N69 A;  1ZCT A;  2YCM A;  3SX8 A;  1XHD A;  3OU9 A;  1ZI4 A;  4EEG A;  5CMJ A;  2X60 A;  2A8U A;  2IC7 A;  4M28 A;  4D0Z A;  4D11 A;  1H7H A;  2ICX A;  1INJ A;  1VM8 A;  3I0G A;  1R7Y A;  5FU8 A;  3PNN A;  1O23 B;  1NKH B;  2NPO A;  1R7X A;  3U2T A;  2OI7 A;  5IDT A;  2NXV A;  4O6M A;  1FZW A;  1TDT A;  4HO0 A;  3R5A A;  2XMH A;  1QRG A;  3OGZ A;  5CMI A;  3OTZ A;  2QH5 A;  3O3P A;  2JCL A;  2P6W A;  2YQH A;  3I0I X;  5EIY A;  2FYD B;  1IIM A;  1FO8 A;  3HJJ A;  4DCL A;  3SPT A;  2AM4 A;  1ZJO A;  5AJO A;  4KQL A;  2O1G A;  3PKQ A;  3Q4S A;  4Y63 A;  1KK5 A;  5E3P A;  1GX0 A;  2FYA A;  5C3B A;  4G3S A;  2BO8 A;  4HO9 A;  3OH1 A;  2FFV A;  2MZB A;  2WLE A;  4C2S A;  2XWM A;  2VHE A;  3EE5 A;  1HM0 A;  3EH0 A;  2APC A;  1VH1 A;  2VS4 A;  3ZF8 A;  1XHB A;  4FRM A;  2QIA A;  5EJZ A;  4HUS A;  4EAA A;  3F1Y A;  2ZU7 A;  2P72 A;  3E25 A;  5ADX V;  2O1F A;  4J09 A;  3OC9 A;  1OQM B;  2D7R A;  1S4N A;  3OW5 A;  4GBP A;  2VS3 A;  3IOH A;  4KT7 A;  4ZDQ A;  5C8R A;  3ZLL A;  4EE4 A;  2VXM A;  4E1K A;  1JYL A;  4IHG A;  3U2V A;  2P73 A;  3IGJ A;  1GX4 A;  4G3Q A;  2QIV X;  1NQI B;  4R36 A;  4N6A A;  4EA7 A;  1VZU A;  2X5S A;  1PZY B;  2RIT A;  4J18 A;  3VBN A;  3OKR A;  2X5Z A;  3V8Y A;  2A8W A;  3GVD A;  2V0K A;  3R5B A;  3HSQ A;  1R7V A;  3BSY A;  5C49 A;  2TDT A;  1JV1 A;  2AH9 A;  3V0L A;  1MR9 A;  3VBM A;  1VGW A;  2PA4 A;  1O7Q A;  4HCQ A;  4Y7G A;  2RJ5 A;  3CKO A;  1XZ6 A;  3CJ8 A;  5BXC A;  5CQL X;  1H5S A;  3BXY A;  1HM8 A;  4MIX A;  5DDV A;  3OUP A;  4Y7T A;  1FG5 N;  1VGU A;  4FRE A;  3R2W A;  4B4M A;  4FIY A;  3OTM A;  1ZJ0 A;  4CJ8 A;  5C47 A;  4Y62 A;  5C1G A;  5I1F A;  5C4F A;  2JCK A;  1ON8 A;  3FSX A;  4KPZ A;  3U2U A;  5CQN X;  5D91 A;  4MZU A;  3GUE A;  2VXL A;  1S80 A;  1FR9 A;  5C1H A;  1JYK A;  2IUA A;  2JF3 A;  3HL3 A;  4FRB A;  3TZT A;  1MRL A;  4D48 A;  3I3A A;  3V0P A;  3SXD A;  2O1H A;  5C4B A;  3R3R A;  3BSS A;  4EAB A;  2AM5 A;  1J2Z A;  4E75 A;  1GWV A;  3KIA A;  3V0Q A;  1MR7 A;  2PGV A;  1Z90 A;  3V0O A;  3R5C A;  1FR8 A;  3IXC A;  2RIX A;  4FRD A;  3FOQ A;  3TV0 A;  1I52 A;  1TW1 A;  4FCU A;  2D0J A;  5DDT A;  3I0H A;  3V0N A;  4M2B A;  4NAL A;  3FSY A;  1FXO A;  3U2X A;  3ECT A;  3R1W A;  4KC2 A;  1KRV A;  3KWD A;  1MP5 A;  2C0N A;  1HV9 A;  1FWY A;  1G9R A;  4Y6N A;  3FTT A;  2V0J A;  1W77 A;  2PX7 A;  4FRA A;  2BO7 A;  1T3D A;  1H5S B;  1FRW A;  3FWW A;  1ZCY A;  3SX5 A;  4M99 A;  3RSB A;  3BCV A;  1IIN A;  5C4D A;  3LW6 A;  1FGX A;  1EYR A;  3MQG A;  1H7F A;  4KRV A;  3SX3 A;  2Q4J A;  4B4B A;  4Y64 A;  3CKN A;  2XAT A;  1G8O A;  2VSH A;  3CKJ A;  2UX8 A;  4FIX A;  1HJL A;  1KHR A;  3TDT A;  2IU9 A;  1H5R A;  2YQJ A;  2RIJ A;  4AYJ A;  1H3M A;  1JV3 A;  3I3X A;  5FTS A;  5IFY A;  4FRP A;  1QGQ A;  3P1B A;  2GGQ A;  1S4P A;  2WGZ A;  1WSZ A;  4JIS A;  5FV9 A;  1ZDG A;  1V83 A;  4HO5 A;  2ZU9 A;  4EE5 A;  3MQH A;  3K8E A;  2Y4J A;  1H7Q A;  4E6T A;  5EJ1 A;  4EGG A;  3EEV A;  4BMA A;  4YS8 A;  2WVL A;  1LZ0 A;  2RJ7 A;  3Q80 A;  3ZGF A;  3DJ4 A;  1QRF A;  4ISX A;  1G93 A;  1H4E A;  1ZHJ A;  2OI6 A;  4IRP A;  4HZC A;  2RIZ A;  2X65 A;  5ADX U;  2Z86 A;  3V0M A;  1R81 A;  3D5N A;  1O7O A;  1GWW A;  2WVM A;  5AFU V;  5F42 A;  2WLC A;  4MFG A;  1SSM A;  1TVY A;  1VPA A;  3TK8 A;  3SRT A;  1H5T A;  4NAN A;  1SST A;  2VD4 A;  4EA9 A;  2RJ6 A;  4M9C A;  2FFU A;  3U2W A;  1H7T A;  5L6S A;  1XAT A;  4UEG A;  1W57 A;  5CMH A;  1V84 A;  4HUR A;  2OI5 A;  3PKP A;  2WLG A;  3KWC A;  3Q1X A;  5C36 A;  1LL2 A;  3RMW A;  2Y7A A;  2OEG A;  4IHF A;  4AC3 A;  5CMG X;  5C38 A;  1H5T B;  4ASJ A;  4CJB A;  1K4V A;  1LXA A;  1YRO B;  2FYC B;  5AJN A;  4E6U A;  1LZI A;  1ON6 A;  5CQP A;  5IDS A;  4KC4 A;  1NHE B;  3TIO A;  1VZX A;  2QGI A;  3I0L A;  4CVH A;  1KGT A;  2FYB A;  1KRR A;  1SS9 A;  1ZJ3 A;  4MND A;  2BO4 A;  2AES A;  1H7G A;  5C1L A;  3VBP A;  2D7I A;  1LL0 A;  2AQ9 A;  1ZCV A;  1VH3 A;  3VBJ A;  2ICY A;  1KK6 A;  2J0B A;  1WVC A;  4AA7 A;  1FXJ A;  3QVB A;  5FYE A;  2JCO A;  1KWS A;  1GQ9 A;  3JTJ A;  2Y4M A;  4EVW A;  1QRM A;  1V82 A;  2YC5 A;  1SSQ A;  1V3W A;  3R3I A;  5DG3 A;  1WT0 A;  2WVK A;  1R82 A;  3IOI A;  4B42 A;  2W0V A;  2JCJ A;  4M2A A;  4HO4 A;  4JD0 A;  4DDZ A;  3VBI A;  3TWD A;  2WE9 A;  2CU2 A;  4L41 C;  3DHO A;  1H5S C;  2RJ9 A;  2V0I A;  3R5D A;  5L6V A;  4E79 A;  2Y4L A;  4KC1 A;  3ZGG A;  4BQH A;  2WEE A;  3SXE A;  4LW6 A;  4AAW A;  1INI A;  4NAI A;  5CMF X;  4EE3 A;  1QWJ A;  1QRE A;  5C48 A;  4EEA A;  3PMO A;  3N9W A;  3V4E A;  3V90 A;  4P02 A;  2FKO A;  5C3A A;  1GQC A;  4B2W A;  1FO9 A;  1HJJ A;  4R7P A;  4ARW A;  3JUJ A;  1GA8 A;  4FRL A;  3R0S A;  4MYB A;  2YQS A;  5CQM X;  4H7O A;  4O6N A;  4DE7 A;  3USR A;  3DK5 A;  3U0Y A;  2WLD A;  4B2X A;  4Y7V A;  4HG6 A;  3POL A;  1YP4 A;  5J49 A;  3CGX A;  1VZT A;  2I5K A;  1ZDF A;  2VSI A;  3GOS A;  2YQC A;  3T7O A;  3U0X A;  4D0T A;  1THJ A;  4IHH A;  1H5R B;  1ZI5 A;  2I7B A;  1JVG A;  1H4D A;  1H5S D;  1LZ7 A;  4B3U A;  5JQQ A;  2FY7 A;  4FQW A;  3T7N A;  1LZJ A;  5E3R A;  4K6R A;  2WAW A;  2Y6P A;  3TIS A;  4FRH A;  1QQ0 A;  2IU8 A;  1G97 A;  1QRL A;  2J0A A;  2XWL A;  3BRK X;  1H7L A;  1OMX A;  2XWN A;  3SXA A;  3SXG A;  1LL3 A;  2I5E A;  1FOA A;  2YC3 A;  4HO3 A;  3D98 A;  4ASY A;  2AM3 A;  3FSC A;  1VGZ A;  4D11 C;  4MYO A;  3ST8 A;  1FGG A;  4B4G A;  1LVW A;  4B5B A;  3BFP A;  4LW3 A;  3VNP A;  1YP2 A;  5E3Q A;  3TQD A;  2V0H A;  2PGY A;  2DPW A;  1G0R A;  3ZLK A;  1E5K A;  3VBL A;  2Z87 A;  1NWG B;  5CQO A;  2YES A;  4AYL A;  3I0F A;  1QG8 A;  2OEF A;  3F1C A;  5AFU U;  3CU0 A;  3JQY A;  3P47 A;  4KNR A;  1EZI A;  3OH3 A;  3OAM A;  4HOC A;  2XME A;  5C4C A;  4KNX A;  5FU0 A;  3V91 A;  3D8V A;  2Y4K A;  1WT3 A;  1ZJ1 A;  1TZF A;  1JVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...