5L6VA

Crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a negative allosteric regulator adenosine monophosphate (amp) - agpase*amp
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
422
structure length
422
Chain Sequence
b'HLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 141
structure length 422
sequence length 422
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5l6vA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5l6vA01
4HO5A 1O23B 3JQYA 1QWJA 2RIYA 1EYRA 3Q7UA 4D11A 1HM8A 4HUSA 1WT0A 2Y6PA 4IRPA 2BO4A 5EJ1A 4M9CA 4Y6NA 3ZGFA 5EIYA 1XHBA 4IHHA 4FRDA 2WLGA 2WLEA 2Y4KA 1H5TA 1R7VA 5C3BA 3FTTA 1R80A 3D8VA 3V0MA 5L6VA 1S4OA 1G1LA 1G8OA 3CKQA 3IGJA 3I0JA 3ZLKA 2WEEA 3SXCA 1WT1A 3PNNA 2YQHA 3I0KA 3SXAA 1H7HA 2RJ4A 2OI6A 5AFUU 1KK6A 4M4KA 4B2WA 1JVDA 3V8ZA 2A8WA 4E1KA 1KK4A 3U0YA 2RJ6A 4NANA 1H7TA 5C3DA 2DPWA 4HG6A 3RSBA 4AYJA 3I0FA 2JCLA 2JCOA 1ON6A 4KC1A 3EH0A 3EE5A 4CJBA 3PKQA 1H5SA 3I0IX 2RJ5A 4D0TA 4HZDA 2VXLA 3U2TA 3LW6A 2JCJA 3CKNA 3MQHA 2GGOA 1VZTA 2CU2A 2XMHA 4IRQA 3TZTA 1JV1A 4ISXA 2Y7AA 1MP5A 4G3SA 1NQIB 2X5ZA 4HO0A 1GA8A 3F1XA 3OAMA 4Y9XA 3RMWA 3E25A 3I0EA 4HOCA 2UX8A 3BCVA 5AFUV 4K6RA 1H7QA 3Q1XA 3DK5A 2A8UA 1GWVA 3D5NA 4M28A 3E26A 4KNRA 4KC4A 3ST8A 1NHEB 2FYAA 3POLA 5FTSA 2XWNA 5ADXU 3FWWA 1ZJOA 3SX8A 3FOQA 3SXEA 3P1BA 4D0ZA 4FQWA 4FROA 1GX4A 2WVLA 2IU9A 3USRA 2RIJA 1VH3A 4GBPA 3ZLLA 1H5RA 1O7OA 1ZDGA 4AC3A 2WAWA 1ZJ2A 3VBPA 3K8DA 2BO8A 3R0SA 2XWMA 2QKXA 2V0LA 1KRUA 2IUAA 3V0OA 5CQMX 5C49A 3ZGGA 4J09A 2RJ7A 2YC5A 2AESA 3BFPA 1LL0A 3I3AA 3QVBA 1OMZA 4Y6UA 2V0KA 1SSTA 4E75A 2WE9A 1YP2A 1QRMA 5FUHA 2AGDA 3V91A 4R36A 5FTVA 1SSMA 2PA4A 4ECMA 4E6UA 4B5BA 4JISA 3N9WA 2RJ1A 5ADXV 3FSBA 2YESA 5FV9A 3R8YA 1INJA 4EEAA 4IHFA 3IOJA 2VSHA 1V83A 1ZI3A 3BSWA 4FRAA 2YCMA 4FREA 4ARWA 2AH9A 4MYBA 5C1HA 3BSYA 1KGTA 2RIZA 4D11C 1QGSA 4Y62A 1ZJ3A 2FY7A 2WVMA 4DCLA 2X5SA 2Z87A 3CKOA 3CKVA 1KRVA 4MFGA 4M99A 1Z90A 5CMJA 3GVDA 2WGZA 3R5CA 4M2AA 4J18A 5E3QA 1S80A 4EE5A 4N6BA 1KK5A 1W57A 5IFYA 3PKPA 2AM5A 1H5TB 4B2XA 4FRLA 3SXGA 4B4GA 1G2VA 3CGXA 1W55A 5U2KA 4NAKA 3V90A 1MR7A 4Y7GA 4KXOA 1QRFA 3T7OA 3IXCA 3U2WA 2OEFA 5E3RA 3MC4A 1H7GA 2YQJA 2ZU8A 2O1GA 1QG8A 1H7EA 1ZI1A 2WLCA 2P73A 4EEOA 4MYOA 5C4CA 5C48A 1QREA 1YP3A 2P2OA 4M98A 1VZXA 1LZ0A 3Q4SA 2PGYA 3USQA 4MNDA 1KWSA 3MQGA 1WT2A 1QGQA 4XWIA 3Q80A 4ASJA 2VD4A 4AYLA 1ZCYA 1H5SC 1ZCUA 3FS8A 2AE7A 4B4BA 4EE3A 1FR8A 4L41C 2V0HA 1GWWA 1VPAA 1KHRA 5DEPA 1FRWA 2ICXA 1H5SB 4HZCA 2O1FA 4EA9A 1WSZA 5C1LA 3D98A 3FSCA 1LVWA 2NXVA 2ICYA 5BXCA 4FCUA 5CMHA 4EVWA 1G95A 4FRHA 1H7LA 1HJJA 4Y7UA 2AM4A 3U2XA 4FRMA 4EGGA 1VGUA 2VS4A 1XHDA 3CKJA 2PX7A 1OMXA 4HO3A 1GQCA 3CU0A 5C4EA 1VGWA 4H7OA 2E8BA 4B4MA 4KQLA 2V0JA 1KQAA 4HO8A 1R81A 3JTJA 3TDTA 1YP4A 3I0HA 2Z86A 2I5KA 5C4DA 3P47A 4N27A 1WT3A 4N69A 5IDTA 5FYEA 5C38A 1H5RB 5DEMA 1S4PA 3R1WA 3I3XA 1KRRA 3IOHA 3FSYA 3OW5A 3SX3A 3GUEA 4CJ8A 1H7FA 3OTZA 3OTMA 3V8YA 4Y7TA 2NPOA 2OEGA 2Q4JA 3I0GA 1O7QA 2D7RA 2FYDB 2VS3A 3BSSA 1G23A 3OU9A 3VBJA 1FGXA 3HSQA 3OC9A 1TW1A 1I52A 4KPXA 1MC3A 5AJPA 5C4FA 1QRGA 1FGGA 2RIXA 1LZJA 3OH4A 4ZDQA 1H4DA 3OH0A 3FSXA 4R7PA 1W77A 1FR9A 2RJ0A 2O1HA 3SXBA 3OH3A 1FXOA 4HO2A 4M2BA 2WLFA 4AA7A 2TDTA 5EJZA 4E79A 1KGQA 1PZTA 1ZDFA 5C47A 3SRTA 4FRPA 4UEGA 3V0LA 3GOSA 4E6TA 5CMFX 4YS8A 3KWDA 3OKRA 3SX7A 1E5KA 3V4EA 5CMGX 2MZBA 1G3LA 5CMIA 4ASYA 4CVHA 3V0QA 1ZIZA 3IOIA 4G87A 2P72A 5L6SA 2AECA 2GGQA 1ZJ1A 1SS9A 3VBNA 3OH2A 5CQPA 3VBMA 2OI7A 1VZUA 1LXAA 3V0NA 4KT7A 1R7UA 1MR9A 1MRLA 5DDTA 1LL3A 2VS5A 3I0CA 3TWDA 1LZ7A 5FU8A 5IDSA 1JYLA 4DECA 1VICA 2FFVA 4FRQA 1G97A 2RJ9A 1ON8A 4AAWA 1ZCTA 2FYCB 3U2VA 3DUVA 1JYKA 1WVCA 1G9RA 4NALA 1QRLA 1G0RA 3R3RA 1FO8A 2YQSA 1FG5N 1VGTA 1R7XA 5AJNA 2Y4MA 1PZYB 4KPZA 1TW5A 2E3DA 3NZ2A 1J2ZA 1TDTA 2QGIA 2VFZA 1IIMA 3O3PA 2QIAA 2IC7A 5FU0A 4EEGA 4B3UA 1OQMB 1R7TA 3SX5A 5J49A 4Y7VA 1H4CA 2XWLA 1IINA 4EEMA 4HO9A 5C36A 1NF5B 3JUKA 3TQDA 2FKOA 2P6WA 2X60A 3DJ4A 3VBLA 3I0LA 1OCXA 2YQCA 1SSQA 1V82A 3VBIA 4EQYA 1VH1A 5E3PA 1JVGA 3DHOA 4DE7A 2PGVA 1GX0A 2JF3A 4Y63A 5F42A 1NWGB 3TK8A 2FFUA 2OI5A 3R2WA 3NGWA 1G93A 3CJ8A 2I5EA 4N6AA 1HM9A 4CJCA 4Y7FA 3KWEA 1H3MA 2Y4JA 5C3AA 3R5AA 2QIVX 2D7IA 2RITA 1ZJ0A 4KC2A 1YROB 4G3PA 1ZI5A 4MZUA 4EAAA 4DDZA 5CQNX 4EABA 3SXDA 4KRVA 3ECTA 3VBKA 3TISA 3T7MA 5C4BA 1FO9A 3JUJA 3U2UA 1H4EA 1R82A 1O0RA 2AM3A 3EG4A 3C8VA 2ZU7A 2IU8A 2D0JA 3T57A 1NKHB 1GQ9A 1XATA 5DDVA 5HS2A 5CQLX 3SPTA 4C2SA 5C8RA 4LW3A 3KIAA 5JQQA 3KWCA 3OGZA 4BMAA 4P02A 1INIA 1FXJA 2AQ9A 4HO4A 2V0IA 3OUPA 2X65A 4IHGA 1FOAA 1MP4A 4P00A 1S4NA 1VGZA 1ZHJA 5C1GA 5AJOA 1ZI4A 4B42A 1EZIA 2Y4LA 3HL3A 3R3IA 3ZF8A 2JCKA 3TV0A 1JV3A 1THJA 2APCA 4JD0A 2BO7A 3RMVA 2FYBA 1HJLA 1ZCVA 1HV9A 4D48A 4NAIA 3OH1A 2VXMA 2YC3A 1T3DA 2VHEA 4EE4A 3VNPA 2W0WA 4HO6A 1HM0A 1MP3A 1NMMB 1V67A 1V3WA 2I7BA 4BQHA 1XZ6A 5CQOA 3BRKX 4G3QA 1V84A 1R7YA 4HCQA 3HJJA 4HURA 3V0PA 3K8EA 1FWYA 5I1FA 4KNXA 3BXYA 1TVYA 2W0VA 3F1YA 2JF2A 2WVKA 2ZU9A 4Y64A 3U0XA 4FCEA 2XATA 4EA7A 3T7NA 4FRBA 3PMOA 3EEVA 3R5DA 1TZFA 1K4VA 2VSIA 2RJ8A 3F1CA 1QQ0A 1H5SD 5DG3A 1VM8A 3TIOA 2QH5A 1LL2A 2XMEA 2BO6A 4EA8A 3R5BA 3I0DA 4R37A 1FZWA 1LZIA 2WLDA 4LW6A 1ZJPA
chains in the Genus database with same CATH superfamily
4HO5A 1O23B 3JQYA 1QWJA 2RIYA 1EYRA 3Q7UA 4D11A 1HM8A 4HUSA 1WT0A 2Y6PA 4IRPA 2BO4A 5EJ1A 4M9CA 4Y6NA 3ZGFA 5EIYA 1XHBA 4IHHA 4FRDA 2WLGA 2WLEA 2Y4KA 1H5TA 4Q7CA 1R7VA 5C3BA 3FTTA 1R80A 3D8VA 3V0MA 5L6VA 1S4OA 1G1LA 1L0SA 1G8OA 3CKQA 4O6MA 3IGJA 3I0JA 3ZLKA 2WEEA 3SXCA 1WT1A 3PNNA 2YQHA 3I0KA 3SXAA 1H7HA 2RJ4A 2OI6A 5AFUU 1KK6A 4M4KA 4B2WA 1JVDA 3V8ZA 2A8WA 4E1KA 1KK4A 3U0YA 2RJ6A 4NANA 1H7TA 5C3DA 2DPWA 4HG6A 3RSBA 4AYJA 3I0FA 2JCLA 2JCOA 1ON6A 4KC1A 3EH0A 3EE5A 4CJBA 3PKQA 1H5SA 3I0IX 2RJ5A 4D0TA 4HZDA 2VXLA 3U2TA 3SUCA 3LW6A 2JCJA 3CKNA 3MQHA 2GGOA 1VZTA 2CU2A 2XMHA 4IRQA 3TZTA 1JV1A 4ISXA 2Y7AA 1MP5A 4G3SA 1NQIB 2X5ZA 4HO0A 1GA8A 3F1XA 3OAMA 4Y9XA 3RMWA 3E25A 3I0EA 4HOCA 2UX8A 3BCVA 5AFUV 4K6RA 1H7QA 3Q1XA 3DK5A 2A8UA 1GWVA 3D5NA 4M28A 3E26A 4KNRA 4KC4A 4FIXA 3ST8A 1NHEB 2FYAA 3POLA 5FTSA 2XWNA 5ADXU 3FWWA 1ZJOA 3SX8A 3FOQA 3SXEA 3P1BA 4D0ZA 4FQWA 4FROA 1GX4A 2WVLA 2IU9A 3USRA 2RIJA 1VH3A 4GBPA 3ZLLA 1H5RA 1O7OA 1ZDGA 4AC3A 2WAWA 1ZJ2A 3VBPA 3K8DA 2BO8A 3R0SA 2XWMA 2QKXA 2V0LA 1KRUA 2IUAA 3V0OA 1M8NA 5CQMX 5C49A 3ZGGA 4J09A 2RJ7A 2YC5A 2AESA 3BFPA 1LL0A 3I3AA 3QVBA 1OMZA 4Y6UA 2V0KA 1SSTA 4E75A 2WE9A 1YP2A 1QRMA 5FUHA 2AGDA 3V91A 4R36A 5FTVA 1SSMA 2PA4A 4ECMA 4E6UA 4B5BA 4JISA 3N9WA 2RJ1A 5ADXV 3FSBA 2YESA 5FV9A 3R8YA 1INJA 4EEAA 4IHFA 3IOJA 2VSHA 1V83A 1ZI3A 3BSWA 4FRAA 2YCMA 4FREA 4O6NA 4ARWA 2AH9A 4MYBA 5C1HA 3BSYA 1KGTA 2RIZA 4D11C 1QGSA 4Y62A 1ZJ3A 2FY7A 2WVMA 4DCLA 2X5SA 2Z87A 3CKOA 3CKVA 1KRVA 4MFGA 4M99A 1Z90A 5CMJA 3GVDA 2WGZA 3R5CA 4M2AA 4J18A 5E3QA 1S80A 4EE5A 4N6BA 1KK5A 1W57A 5IFYA 3PKPA 2AM5A 1H5TB 4B2XA 4FRLA 3SXGA 4B4GA 1G2VA 3CGXA 1W55A 5U2KA 4NAKA 3V90A 1MR7A 4MIXA 4KXOA 4Y7GA 1QRFA 3T7OA 3IXCA 3U2WA 2OEFA 5E3RA 3MC4A 1H7GA 2YQJA 2ZU8A 2O1GA 1QG8A 1H7EA 1ZI1A 2WLCA 2P73A 4EEOA 4MYOA 5C4CA 5C48A 1QREA 1YP3A 2P2OA 4M98A 1VZXA 1LZ0A 2J0AA 3Q4SA 1N4IA 2PGYA 3USQA 4MNDA 1KWSA 3MQGA 1WT2A 1QGQA 4XWIA 3Q80A 4ASJA 2VD4A 4AYLA 1ZCYA 1H5SC 1ZCUA 3FS8A 2AE7A 4B4BA 4EE3A 1FR8A 4L41C 2V0HA 3GQ8A 1GWWA 1VPAA 1KHRA 5DEPA 1FRWA 2ICXA 1H5SB 4HZCA 2O1FA 4EA9A 1WSZA 3GQ9A 3D98A 3FSCA 1LVWA 5C1LA 2NXVA 2ICYA 5BXCA 4FCUA 5CMHA 4EVWA 1G95A 4FRHA 1H7LA 1HJJA 4Y7UA 2AM4A 3U2XA 4FRMA 4EGGA 1VGUA 2VS4A 1XHDA 3CKJA 2PX7A 1OMXA 4HO3A 1GQCA 3CU0A 5C4EA 1VGWA 4H7OA 2E8BA 4B4MA 4KQLA 2V0JA 1KQAA 4HO8A 1R81A 3JTJA 3TDTA 1YP4A 3I0HA 2Z86A 2I5KA 5C4DA 3P47A 4N27A 1WT3A 4N69A 5IDTA 5FYEA 5C38A 1H5RB 5DEMA 1S4PA 3R1WA 3I3XA 1KRRA 3IOHA 3FSYA 3OW5A 3SX3A 3GUEA 4CJ8A 1H7FA 3OTZA 3OTMA 3V8YA 4Y7TA 2NPOA 2OEGA 2Q4JA 3I0GA 1O7QA 2D7RA 2FYDB 2VS3A 3BSSA 1G23A 3OU9A 3VBJA 1FGXA 3HSQA 3OC9A 1TW1A 1I52A 4KPXA 3GQ7A 1MC3A 5AJPA 5C4FA 1QRGA 1FGGA 2RIXA 1LZJA 3OH4A 4ZDQA 1H4DA 3OH0A 3FSXA 4R7PA 1W77A 1FR9A 2RJ0A 2O1HA 3SXBA 3OH3A 1FXOA 4HO2A 4M2BA 2WLFA 4AA7A 2TDTA 5EJZA 4E79A 5D91A 1KGQA 1PZTA 1ZDFA 5C47A 3SRTA 4FRPA 4UEGA 3V0LA 3GOSA 4E6TA 5CMFX 4YS8A 3KWDA 3OKRA 3SX7A 1E5KA 3V4EA 5CMGX 2MZBA 1G3LA 5CMIA 4ASYA 4CVHA 3V0QA 1ZIZA 3IOIA 4G87A 2P72A 5L6SA 2AECA 2GGQA 1ZJ1A 1SS9A 3OH2A 3VBNA 5CQPA 3VBMA 2OI7A 1VZUA 1LXAA 3V0NA 4KT7A 1R7UA 1MR9A 1MRLA 5DDTA 1LL3A 2VS5A 3I0CA 3TWDA 1LZ7A 5FU8A 5IDSA 1JYLA 4DECA 1VICA 2FFVA 4FRQA 1G97A 2RJ9A 1ON8A 4AAWA 1ZCTA 2FYCB 3U2VA 3DUVA 1JYKA 1WVCA 1G9RA 4NALA 1QRLA 1G0RA 3R3RA 1FO8A 2YQSA 1FG5N 1VGTA 1R7XA 5AJNA 2Y4MA 1PZYB 4KPZA 1TW5A 2E3DA 3NZ2A 1J2ZA 1TDTA 3GQAA 2QGIA 2VFZA 1IIMA 3O3PA 2QIAA 2IC7A 5FU0A 4EEGA 4B3UA 1OQMB 1R7TA 3SX5A 5J49A 4Y7VA 1H4CA 2XWLA 1IINA 4EEMA 4HO9A 2C0NA 5C36A 1NF5B 3JUKA 3TQDA 2FKOA 2P6WA 2X60A 3DJ4A 3VBLA 3I0LA 1OCXA 2YQCA 1SSQA 1V82A 3VBIA 4EQYA 1VH1A 5E3PA 1JVGA 3DHOA 4DE7A 2PGVA 1GX0A 2JF3A 4Y63A 5F42A 1EWWA 1NWGB 3TK8A 2FFUA 2OI5A 3R2WA 3NGWA 1G93A 3CJ8A 2I5EA 4N6AA 1HM9A 4CJCA 4Y7FA 3KWEA 1Z2FA 1H3MA 2VK9A 2Y4JA 5C3AA 3R5AA 2QIVX 2D7IA 2RITA 1ZJ0A 4KC2A 1YROB 4G3PA 1ZI5A 4MZUA 4EAAA 4DDZA 5CQNX 4EABA 3SXDA 4KRVA 3ECTA 3VBKA 3TISA 3T7MA 5C4BA 1FO9A 3JUJA 3U2UA 1H4EA 1R82A 1O0RA 2AM3A 3EG4A 3C8VA 2ZU7A 2IU8A 2D0JA 3T57A 1NKHB 1GQ9A 1XATA 5DDVA 5HS2A 5CQLX 3SPTA 4C2SA 5C8RA 4LW3A 3KIAA 5JQQA 3KWCA 3OGZA 4FIYA 4BMAA 4P02A 1INIA 1FXJA 2AQ9A 4HO4A 2V0IA 3OUPA 2X65A 4IHGA 1FOAA 1MP4A 4P00A 1S4NA 1VGZA 1ZHJA 5C1GA 5AJOA 1ZI4A 4B42A 1EZIA 2Y4LA 3HL3A 2J0BA 5D92A 3R3IA 3ZF8A 2JCKA 3TV0A 1JV3A 1THJA 2APCA 4JD0A 2BO7A 3RMVA 2FYBA 1HJLA 1ZCVA 1HV9A 4D48A 4NAIA 3OH1A 2VXMA 2YC3A 1T3DA 2VHEA 4EE4A 3VNPA 2W0WA 4HO6A 1HM0A 1MP3A 1NMMB 1V67A 1V3WA 2I7BA 4BQHA 1XZ6A 5CQOA 3BRKX 4G3QA 1V84A 1R7YA 4HCQA 3HJJA 4HURA 3V0PA 3K8EA 1FWYA 5I1FA 4KNXA 3BXYA 1TVYA 2W0VA 3F1YA 2JF2A 2WVKA 2ZU9A 4Y64A 3U0XA 4FCEA 2XATA 4EA7A 3T7NA 4FRBA 3PMOA 3EEVA 3R5DA 1TZFA 1K4VA 2VSIA 2RJ8A 3F1CA 1QQ0A 1H5SD 5DG3A 1VM8A 3TIOA 2QH5A 1LL2A 2XMEA 2BO6A 4EA8A 3R5BA 3I0DA 4R37A 1FZWA 1LZIA 2WLDA 4LW6A 1ZJPA
chains in the Genus database with same CATH topology
4HO5A 1O23B 3JQYA 1QWJA 2RIYA 1EYRA 3Q7UA 4D11A 1HM8A 4HUSA 1WT0A 2Y6PA 4IRPA 2BO4A 5EJ1A 4M9CA 4Y6NA 3ZGFA 5EIYA 1XHBA 4IHHA 4FRDA 2WLGA 2WLEA 2Y4KA 1H5TA 4Q7CA 1R7VA 5C3BA 3FTTA 1R80A 3D8VA 3V0MA 5L6VA 1S4OA 1G1LA 1G8OA 3CKQA 4O6MA 3IGJA 3I0JA 3ZLKA 2WEEA 3SXCA 1WT1A 3PNNA 2YQHA 3I0KA 3SXAA 1H7HA 2RJ4A 2OI6A 5AFUU 1KK6A 4M4KA 4B2WA 1JVDA 3V8ZA 2A8WA 4E1KA 1KK4A 3U0YA 2RJ6A 4NANA 1H7TA 5C3DA 2DPWA 4HG6A 3RSBA 4AYJA 3I0FA 2JCLA 2JCOA 1ON6A 4KC1A 3EH0A 3EE5A 4CJBA 3PKQA 1H5SA 3I0IX 2RJ5A 4D0TA 4HZDA 2VXLA 3U2TA 3LW6A 2JCJA 3CKNA 3MQHA 2GGOA 1VZTA 2CU2A 2XMHA 4IRQA 3TZTA 1JV1A 4ISXA 2Y7AA 1MP5A 4G3SA 1NQIB 2X5ZA 4HO0A 1GA8A 3F1XA 3OAMA 4Y9XA 3RMWA 3E25A 3I0EA 4HOCA 2UX8A 3BCVA 5AFUV 4K6RA 1H7QA 3Q1XA 3DK5A 2A8UA 1GWVA 3D5NA 4M28A 3E26A 4KNRA 4KC4A 4FIXA 3ST8A 1NHEB 2FYAA 3POLA 5FTSA 2XWNA 5ADXU 3FWWA 1ZJOA 3SX8A 3FOQA 3SXEA 3P1BA 4D0ZA 4FQWA 4FROA 1GX4A 2WVLA 2IU9A 3USRA 2RIJA 1VH3A 4GBPA 3ZLLA 1H5RA 1O7OA 1ZDGA 4AC3A 2WAWA 1ZJ2A 3VBPA 3K8DA 2BO8A 3R0SA 2XWMA 2QKXA 2V0LA 1KRUA 2IUAA 3V0OA 5CQMX 5C49A 3ZGGA 4J09A 2RJ7A 2YC5A 2AESA 3BFPA 1LL0A 3I3AA 3QVBA 1OMZA 4Y6UA 2V0KA 1SSTA 4E75A 2WE9A 1YP2A 1QRMA 5FUHA 2AGDA 3V91A 4R36A 5FTVA 1SSMA 2PA4A 4ECMA 4E6UA 4B5BA 4JISA 3N9WA 2RJ1A 5ADXV 3FSBA 2YESA 5FV9A 3R8YA 1INJA 4EEAA 4IHFA 3IOJA 2VSHA 1V83A 1ZI3A 3BSWA 4FRAA 2YCMA 4FREA 4O6NA 4ARWA 2AH9A 4MYBA 5C1HA 3BSYA 1KGTA 2RIZA 4D11C 1QGSA 4Y62A 1ZJ3A 2FY7A 2WVMA 4DCLA 2X5SA 2Z87A 3CKOA 3CKVA 1KRVA 4MFGA 4M99A 1Z90A 5CMJA 3GVDA 2WGZA 3R5CA 4M2AA 4J18A 5E3QA 1S80A 4EE5A 4N6BA 1KK5A 1W57A 5IFYA 3PKPA 2AM5A 1H5TB 4B2XA 4FRLA 3SXGA 4B4GA 1G2VA 3CGXA 1W55A 5U2KA 4NAKA 3V90A 1MR7A 4MIXA 4KXOA 4Y7GA 1QRFA 3T7OA 3IXCA 3U2WA 2OEFA 5E3RA 3MC4A 1H7GA 2YQJA 2ZU8A 2O1GA 1QG8A 1H7EA 1ZI1A 2WLCA 2P73A 4EEOA 4MYOA 5C4CA 5C48A 1QREA 1YP3A 2P2OA 4M98A 1VZXA 1LZ0A 2J0AA 3Q4SA 2PGYA 3USQA 4MNDA 1KWSA 3MQGA 1WT2A 1QGQA 4XWIA 3Q80A 4ASJA 2VD4A 4AYLA 1ZCYA 1H5SC 1ZCUA 3FS8A 2AE7A 4B4BA 4EE3A 1FR8A 4L41C 2V0HA 1GWWA 1VPAA 1KHRA 5DEPA 1FRWA 2ICXA 1H5SB 4HZCA 2O1FA 4EA9A 1WSZA 5C1LA 3D98A 3FSCA 1LVWA 2NXVA 2ICYA 5BXCA 4FCUA 5CMHA 4EVWA 1G95A 4FRHA 1H7LA 1HJJA 4Y7UA 2AM4A 3U2XA 4FRMA 4EGGA 1VGUA 2VS4A 1XHDA 3CKJA 2PX7A 1OMXA 4HO3A 1GQCA 3CU0A 5C4EA 1VGWA 4H7OA 2E8BA 4B4MA 4KQLA 2V0JA 1KQAA 4HO8A 1R81A 3JTJA 3TDTA 1YP4A 3I0HA 2Z86A 2I5KA 5C4DA 3P47A 4N27A 1WT3A 4N69A 5IDTA 5FYEA 5C38A 1H5RB 5DEMA 1S4PA 3R1WA 3I3XA 1KRRA 3IOHA 3FSYA 3OW5A 3SX3A 3GUEA 4CJ8A 1H7FA 3OTZA 3OTMA 3V8YA 4Y7TA 2NPOA 2OEGA 2Q4JA 3I0GA 1O7QA 2D7RA 2FYDB 2VS3A 3BSSA 1G23A 3OU9A 3VBJA 1FGXA 3HSQA 3OC9A 1TW1A 1I52A 4KPXA 1MC3A 5AJPA 5C4FA 1QRGA 1FGGA 2RIXA 1LZJA 3OH4A 4ZDQA 1H4DA 3OH0A 3FSXA 4R7PA 1W77A 1FR9A 2RJ0A 2O1HA 3SXBA 3OH3A 1FXOA 4HO2A 4M2BA 2WLFA 4AA7A 2TDTA 5EJZA 4E79A 5D91A 1KGQA 1PZTA 1ZDFA 5C47A 3SRTA 4FRPA 4UEGA 3V0LA 3GOSA 4E6TA 5CMFX 4YS8A 3KWDA 3OKRA 3SX7A 1E5KA 3V4EA 5CMGX 2MZBA 1G3LA 5CMIA 4ASYA 4CVHA 3V0QA 1ZIZA 3IOIA 4G87A 2P72A 5L6SA 2AECA 2GGQA 1ZJ1A 1SS9A 3VBNA 3OH2A 5CQPA 3VBMA 2OI7A 1VZUA 1LXAA 3V0NA 4KT7A 1R7UA 1MR9A 1MRLA 5DDTA 1LL3A 2VS5A 3I0CA 3TWDA 1LZ7A 5FU8A 5IDSA 1JYLA 4DECA 1VICA 2FFVA 4FRQA 1G97A 2RJ9A 1ON8A 4AAWA 1ZCTA 2FYCB 3U2VA 3DUVA 1JYKA 1WVCA 1G9RA 4NALA 1QRLA 1G0RA 3R3RA 1FO8A 2YQSA 1FG5N 1VGTA 1R7XA 5AJNA 2Y4MA 1PZYB 4KPZA 1TW5A 2E3DA 3NZ2A 1J2ZA 1TDTA 2QGIA 2VFZA 1IIMA 3O3PA 2QIAA 2IC7A 5FU0A 4EEGA 4B3UA 1OQMB 1R7TA 3SX5A 5J49A 4Y7VA 1H4CA 2XWLA 1IINA 4EEMA 4HO9A 2C0NA 5C36A 1NF5B 3JUKA 3TQDA 2FKOA 2P6WA 2X60A 3DJ4A 3VBLA 3I0LA 1OCXA 2YQCA 1SSQA 1V82A 3VBIA 4EQYA 1VH1A 5E3PA 1JVGA 3DHOA 4DE7A 2PGVA 1GX0A 2JF3A 4Y63A 5F42A 1NWGB 3TK8A 2FFUA 2OI5A 3R2WA 3NGWA 1G93A 3CJ8A 2I5EA 4N6AA 1HM9A 4CJCA 4Y7FA 3KWEA 1H3MA 2VK9A 2Y4JA 5C3AA 3R5AA 2QIVX 2D7IA 2RITA 1ZJ0A 4KC2A 1YROB 4G3PA 1ZI5A 4MZUA 4EAAA 4DDZA 5CQNX 4EABA 3SXDA 4KRVA 3ECTA 3VBKA 3TISA 3T7MA 5C4BA 1FO9A 3JUJA 3U2UA 1H4EA 1R82A 1O0RA 2AM3A 3EG4A 3C8VA 2ZU7A 2IU8A 2D0JA 3T57A 1NKHB 1GQ9A 1XATA 5DDVA 5HS2A 5CQLX 3SPTA 4C2SA 5C8RA 4LW3A 3KIAA 5JQQA 3KWCA 3OGZA 4FIYA 4BMAA 4P02A 1INIA 1FXJA 2AQ9A 4HO4A 2V0IA 3OUPA 2X65A 4IHGA 1FOAA 1MP4A 4P00A 1S4NA 1VGZA 1ZHJA 5C1GA 5AJOA 1ZI4A 4B42A 1EZIA 2Y4LA 3HL3A 2J0BA 5D92A 3R3IA 3ZF8A 2JCKA 3TV0A 1JV3A 1THJA 2APCA 4JD0A 2BO7A 3RMVA 2FYBA 1HJLA 1ZCVA 1HV9A 4D48A 4NAIA 3OH1A 2VXMA 2YC3A 1T3DA 2VHEA 4EE4A 3VNPA 2W0WA 4HO6A 1HM0A 1MP3A 1NMMB 1V67A 1V3WA 2I7BA 4BQHA 1XZ6A 5CQOA 3BRKX 4G3QA 1V84A 1R7YA 4HCQA 3HJJA 4HURA 3V0PA 3K8EA 1FWYA 5I1FA 4KNXA 3BXYA 1TVYA 2W0VA 3F1YA 2JF2A 2WVKA 2ZU9A 4Y64A 3U0XA 4FCEA 2XATA 4EA7A 3T7NA 4FRBA 3PMOA 3EEVA 3R5DA 1TZFA 1K4VA 2VSIA 2RJ8A 3F1CA 1QQ0A 1H5SD 5DG3A 1VM8A 3TIOA 2QH5A 1LL2A 2XMEA 2BO6A 4EA8A 3R5BA 3I0DA 4R37A 1FZWA 1LZIA 2WLDA 4LW6A 1ZJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HO5 A;  1O23 B;  3JQY A;  1QWJ A;  2RIY A;  1EYR A;  3Q7U A;  4D11 A;  1HM8 A;  4HUS A;  1WT0 A;  2Y6P A;  4IRP A;  2BO4 A;  5EJ1 A;  4M9C A;  4Y6N A;  3ZGF A;  5EIY A;  1XHB A;  4IHH A;  4FRD A;  2WLG A;  2WLE A;  2Y4K A;  1H5T A;  1R7V A;  5C3B A;  3FTT A;  1R80 A;  3D8V A;  3V0M A;  5L6V A;  1S4O A;  1G1L A;  1G8O A;  3CKQ A;  3IGJ A;  3I0J A;  3ZLK A;  2WEE A;  3SXC A;  1WT1 A;  3PNN A;  2YQH A;  3I0K A;  3SXA A;  1H7H A;  2RJ4 A;  2OI6 A;  5AFU U;  1KK6 A;  4M4K A;  4B2W A;  1JVD A;  3V8Z A;  2A8W A;  4E1K A;  1KK4 A;  3U0Y A;  2RJ6 A;  4NAN A;  1H7T A;  5C3D A;  2DPW A;  4HG6 A;  3RSB A;  4AYJ A;  3I0F A;  2JCL A;  2JCO A;  1ON6 A;  4KC1 A;  3EH0 A;  3EE5 A;  4CJB A;  3PKQ A;  1H5S A;  3I0I X;  2RJ5 A;  4D0T A;  4HZD A;  2VXL A;  3U2T A;  3LW6 A;  2JCJ A;  3CKN A;  3MQH A;  2GGO A;  1VZT A;  2CU2 A;  2XMH A;  4IRQ A;  3TZT A;  1JV1 A;  4ISX A;  2Y7A A;  1MP5 A;  4G3S A;  1NQI B;  2X5Z A;  4HO0 A;  1GA8 A;  3F1X A;  3OAM A;  4Y9X A;  3RMW A;  3E25 A;  3I0E A;  4HOC A;  2UX8 A;  3BCV A;  5AFU V;  4K6R A;  1H7Q A;  3Q1X A;  3DK5 A;  2A8U A;  1GWV A;  3D5N A;  4M28 A;  3E26 A;  4KNR A;  4KC4 A;  3ST8 A;  1NHE B;  2FYA A;  3POL A;  5FTS A;  2XWN A;  5ADX U;  3FWW A;  1ZJO A;  3SX8 A;  3FOQ A;  3SXE A;  3P1B A;  4D0Z A;  4FQW A;  4FRO A;  1GX4 A;  2WVL A;  2IU9 A;  3USR A;  2RIJ A;  1VH3 A;  4GBP A;  3ZLL A;  1H5R A;  1O7O A;  1ZDG A;  4AC3 A;  2WAW A;  1ZJ2 A;  3VBP A;  3K8D A;  2BO8 A;  3R0S A;  2XWM A;  2QKX A;  2V0L A;  1KRU A;  2IUA A;  3V0O A;  5CQM X;  5C49 A;  3ZGG A;  4J09 A;  2RJ7 A;  2YC5 A;  2AES A;  3BFP A;  1LL0 A;  3I3A A;  3QVB A;  1OMZ A;  4Y6U A;  2V0K A;  1SST A;  4E75 A;  2WE9 A;  1YP2 A;  1QRM A;  5FUH A;  2AGD A;  3V91 A;  4R36 A;  5FTV A;  1SSM A;  2PA4 A;  4ECM A;  4E6U A;  4B5B A;  4JIS A;  3N9W A;  2RJ1 A;  5ADX V;  3FSB A;  2YES A;  5FV9 A;  3R8Y A;  1INJ A;  4EEA A;  4IHF A;  3IOJ A;  2VSH A;  1V83 A;  1ZI3 A;  3BSW A;  4FRA A;  2YCM A;  4FRE A;  4ARW A;  2AH9 A;  4MYB A;  5C1H A;  3BSY A;  1KGT A;  2RIZ A;  4D11 C;  1QGS A;  4Y62 A;  1ZJ3 A;  2FY7 A;  2WVM A;  4DCL A;  2X5S A;  2Z87 A;  3CKO A;  3CKV A;  1KRV A;  4MFG A;  4M99 A;  1Z90 A;  5CMJ A;  3GVD A;  2WGZ A;  3R5C A;  4M2A A;  4J18 A;  5E3Q A;  1S80 A;  4EE5 A;  4N6B A;  1KK5 A;  1W57 A;  5IFY A;  3PKP A;  2AM5 A;  1H5T B;  4B2X A;  4FRL A;  3SXG A;  4B4G A;  1G2V A;  3CGX A;  1W55 A;  5U2K A;  4NAK A;  3V90 A;  1MR7 A;  4Y7G A;  4KXO A;  1QRF A;  3T7O A;  3IXC A;  3U2W A;  2OEF A;  5E3R A;  3MC4 A;  1H7G A;  2YQJ A;  2ZU8 A;  2O1G A;  1QG8 A;  1H7E A;  1ZI1 A;  2WLC A;  2P73 A;  4EEO A;  4MYO A;  5C4C A;  5C48 A;  1QRE A;  1YP3 A;  2P2O A;  4M98 A;  1VZX A;  1LZ0 A;  3Q4S A;  2PGY A;  3USQ A;  4MND A;  1KWS A;  3MQG A;  1WT2 A;  1QGQ A;  4XWI A;  3Q80 A;  4ASJ A;  2VD4 A;  4AYL A;  1ZCY A;  1H5S C;  1ZCU A;  3FS8 A;  2AE7 A;  4B4B A;  4EE3 A;  1FR8 A;  4L41 C;  2V0H A;  1GWW A;  1VPA A;  1KHR A;  5DEP A;  1FRW A;  2ICX A;  1H5S B;  4HZC A;  2O1F A;  4EA9 A;  1WSZ A;  5C1L A;  3D98 A;  3FSC A;  1LVW A;  2NXV A;  2ICY A;  5BXC A;  4FCU A;  5CMH A;  4EVW A;  1G95 A;  4FRH A;  1H7L A;  1HJJ A;  4Y7U A;  2AM4 A;  3U2X A;  4FRM A;  4EGG A;  1VGU A;  2VS4 A;  1XHD A;  3CKJ A;  2PX7 A;  1OMX A;  4HO3 A;  1GQC A;  3CU0 A;  5C4E A;  1VGW A;  4H7O A;  2E8B A;  4B4M A;  4KQL A;  2V0J A;  1KQA A;  4HO8 A;  1R81 A;  3JTJ A;  3TDT A;  1YP4 A;  3I0H A;  2Z86 A;  2I5K A;  5C4D A;  3P47 A;  4N27 A;  1WT3 A;  4N69 A;  5IDT A;  5FYE A;  5C38 A;  1H5R B;  5DEM A;  1S4P A;  3R1W A;  3I3X A;  1KRR A;  3IOH A;  3FSY A;  3OW5 A;  3SX3 A;  3GUE A;  4CJ8 A;  1H7F A;  3OTZ A;  3OTM A;  3V8Y A;  4Y7T A;  2NPO A;  2OEG A;  2Q4J A;  3I0G A;  1O7Q A;  2D7R A;  2FYD B;  2VS3 A;  3BSS A;  1G23 A;  3OU9 A;  3VBJ A;  1FGX A;  3HSQ A;  3OC9 A;  1TW1 A;  1I52 A;  4KPX A;  1MC3 A;  5AJP A;  5C4F A;  1QRG A;  1FGG A;  2RIX A;  1LZJ A;  3OH4 A;  4ZDQ A;  1H4D A;  3OH0 A;  3FSX A;  4R7P A;  1W77 A;  1FR9 A;  2RJ0 A;  2O1H A;  3SXB A;  3OH3 A;  1FXO A;  4HO2 A;  4M2B A;  2WLF A;  4AA7 A;  2TDT A;  5EJZ A;  4E79 A;  1KGQ A;  1PZT A;  1ZDF A;  5C47 A;  3SRT A;  4FRP A;  4UEG A;  3V0L A;  3GOS A;  4E6T A;  5CMF X;  4YS8 A;  3KWD A;  3OKR A;  3SX7 A;  1E5K A;  3V4E A;  5CMG X;  2MZB A;  1G3L A;  5CMI A;  4ASY A;  4CVH A;  3V0Q A;  1ZIZ A;  3IOI A;  4G87 A;  2P72 A;  5L6S A;  2AEC A;  2GGQ A;  1ZJ1 A;  1SS9 A;  3VBN A;  3OH2 A;  5CQP A;  3VBM A;  2OI7 A;  1VZU A;  1LXA A;  3V0N A;  4KT7 A;  1R7U A;  1MR9 A;  1MRL A;  5DDT A;  1LL3 A;  2VS5 A;  3I0C A;  3TWD A;  1LZ7 A;  5FU8 A;  5IDS A;  1JYL A;  4DEC A;  1VIC A;  2FFV A;  4FRQ A;  1G97 A;  2RJ9 A;  1ON8 A;  4AAW A;  1ZCT A;  2FYC B;  3U2V A;  3DUV A;  1JYK A;  1WVC A;  1G9R A;  4NAL A;  1QRL A;  1G0R A;  3R3R A;  1FO8 A;  2YQS A;  1FG5 N;  1VGT A;  1R7X A;  5AJN A;  2Y4M A;  1PZY B;  4KPZ A;  1TW5 A;  2E3D A;  3NZ2 A;  1J2Z A;  1TDT A;  2QGI A;  2VFZ A;  1IIM A;  3O3P A;  2QIA A;  2IC7 A;  5FU0 A;  4EEG A;  4B3U A;  1OQM B;  1R7T A;  3SX5 A;  5J49 A;  4Y7V A;  1H4C A;  2XWL A;  1IIN A;  4EEM A;  4HO9 A;  5C36 A;  1NF5 B;  3JUK A;  3TQD A;  2FKO A;  2P6W A;  2X60 A;  3DJ4 A;  3VBL A;  3I0L A;  1OCX A;  2YQC A;  1SSQ A;  1V82 A;  3VBI A;  4EQY A;  1VH1 A;  5E3P A;  1JVG A;  3DHO A;  4DE7 A;  2PGV A;  1GX0 A;  2JF3 A;  4Y63 A;  5F42 A;  1NWG B;  3TK8 A;  2FFU A;  2OI5 A;  3R2W A;  3NGW A;  1G93 A;  3CJ8 A;  2I5E A;  4N6A A;  1HM9 A;  4CJC A;  4Y7F A;  3KWE A;  1H3M A;  2Y4J A;  5C3A A;  3R5A A;  2QIV X;  2D7I A;  2RIT A;  1ZJ0 A;  4KC2 A;  1YRO B;  4G3P A;  1ZI5 A;  4MZU A;  4EAA A;  4DDZ A;  5CQN X;  4EAB A;  3SXD A;  4KRV A;  3ECT A;  3VBK A;  3TIS A;  3T7M A;  5C4B A;  1FO9 A;  3JUJ A;  3U2U A;  1H4E A;  1R82 A;  1O0R A;  2AM3 A;  3EG4 A;  3C8V A;  2ZU7 A;  2IU8 A;  2D0J A;  3T57 A;  1NKH B;  1GQ9 A;  1XAT A;  5DDV A;  5HS2 A;  5CQL X;  3SPT A;  4C2S A;  5C8R A;  4LW3 A;  3KIA A;  5JQQ A;  3KWC A;  3OGZ A;  4BMA A;  4P02 A;  1INI A;  1FXJ A;  2AQ9 A;  4HO4 A;  2V0I A;  3OUP A;  2X65 A;  4IHG A;  1FOA A;  1MP4 A;  4P00 A;  1S4N A;  1VGZ A;  1ZHJ A;  5C1G A;  5AJO A;  1ZI4 A;  4B42 A;  1EZI A;  2Y4L A;  3HL3 A;  3R3I A;  3ZF8 A;  2JCK A;  3TV0 A;  1JV3 A;  1THJ A;  2APC A;  4JD0 A;  2BO7 A;  3RMV A;  2FYB A;  1HJL A;  1ZCV A;  1HV9 A;  4D48 A;  4NAI A;  3OH1 A;  2VXM A;  2YC3 A;  1T3D A;  2VHE A;  4EE4 A;  3VNP A;  2W0W A;  4HO6 A;  1HM0 A;  1MP3 A;  1NMM B;  1V67 A;  1V3W A;  2I7B A;  4BQH A;  1XZ6 A;  5CQO A;  3BRK X;  4G3Q A;  1V84 A;  1R7Y A;  4HCQ A;  3HJJ A;  4HUR A;  3V0P A;  3K8E A;  1FWY A;  5I1F A;  4KNX A;  3BXY A;  1TVY A;  2W0V A;  3F1Y A;  2JF2 A;  2WVK A;  2ZU9 A;  4Y64 A;  3U0X A;  4FCE A;  2XAT A;  4EA7 A;  3T7N A;  4FRB A;  3PMO A;  3EEV A;  3R5D A;  1TZF A;  1K4V A;  2VSI A;  2RJ8 A;  3F1C A;  1QQ0 A;  1H5S D;  5DG3 A;  1VM8 A;  3TIO A;  2QH5 A;  1LL2 A;  2XME A;  2BO6 A;  4EA8 A;  3R5B A;  3I0D A;  4R37 A;  1FZW A;  1LZI A;  2WLD A;  4LW6 A;  1ZJP A; 
#chains in the Genus database with same CATH topology
 4HO5 A;  1O23 B;  3JQY A;  1QWJ A;  2RIY A;  1EYR A;  3Q7U A;  4D11 A;  1HM8 A;  4HUS A;  1WT0 A;  2Y6P A;  4IRP A;  2BO4 A;  5EJ1 A;  4M9C A;  4Y6N A;  3ZGF A;  5EIY A;  1XHB A;  4IHH A;  4FRD A;  2WLG A;  2WLE A;  2Y4K A;  1H5T A;  4Q7C A;  1R7V A;  5C3B A;  3FTT A;  1R80 A;  3D8V A;  3V0M A;  5L6V A;  1S4O A;  1G1L A;  1L0S A;  1G8O A;  3CKQ A;  4O6M A;  3IGJ A;  3I0J A;  3ZLK A;  2WEE A;  3SXC A;  1WT1 A;  3PNN A;  2YQH A;  3I0K A;  3SXA A;  1H7H A;  2RJ4 A;  2OI6 A;  5AFU U;  1KK6 A;  4M4K A;  4B2W A;  1JVD A;  3V8Z A;  2A8W A;  4E1K A;  1KK4 A;  3U0Y A;  2RJ6 A;  4NAN A;  1H7T A;  5C3D A;  2DPW A;  4HG6 A;  3RSB A;  4AYJ A;  3I0F A;  2JCL A;  2JCO A;  1ON6 A;  4KC1 A;  3EH0 A;  3EE5 A;  4CJB A;  3PKQ A;  1H5S A;  3I0I X;  2RJ5 A;  4D0T A;  4HZD A;  2VXL A;  3U2T A;  3SUC A;  3LW6 A;  2JCJ A;  3CKN A;  3MQH A;  2GGO A;  1VZT A;  2CU2 A;  2XMH A;  4IRQ A;  3TZT A;  1JV1 A;  4ISX A;  2Y7A A;  1MP5 A;  4G3S A;  1NQI B;  2X5Z A;  4HO0 A;  1GA8 A;  3F1X A;  3OAM A;  4Y9X A;  3RMW A;  3E25 A;  3I0E A;  4HOC A;  2UX8 A;  3BCV A;  5AFU V;  4K6R A;  1H7Q A;  3Q1X A;  3DK5 A;  2A8U A;  1GWV A;  3D5N A;  4M28 A;  3E26 A;  4KNR A;  4KC4 A;  4FIX A;  3ST8 A;  1NHE B;  2FYA A;  3POL A;  5FTS A;  2XWN A;  5ADX U;  3FWW A;  1ZJO A;  3SX8 A;  3FOQ A;  3SXE A;  3P1B A;  4D0Z A;  4FQW A;  4FRO A;  1GX4 A;  2WVL A;  2IU9 A;  3USR A;  2RIJ A;  1VH3 A;  4GBP A;  3ZLL A;  1H5R A;  1O7O A;  1ZDG A;  4AC3 A;  2WAW A;  1ZJ2 A;  3VBP A;  3K8D A;  2BO8 A;  3R0S A;  2XWM A;  2QKX A;  2V0L A;  1KRU A;  2IUA A;  3V0O A;  1M8N A;  5CQM X;  5C49 A;  3ZGG A;  4J09 A;  2RJ7 A;  2YC5 A;  2AES A;  3BFP A;  1LL0 A;  3I3A A;  3QVB A;  1OMZ A;  4Y6U A;  2V0K A;  1SST A;  4E75 A;  2WE9 A;  1YP2 A;  1QRM A;  5FUH A;  2AGD A;  3V91 A;  4R36 A;  5FTV A;  1SSM A;  2PA4 A;  4ECM A;  4E6U A;  4B5B A;  4JIS A;  3N9W A;  2RJ1 A;  5ADX V;  3FSB A;  2YES A;  5FV9 A;  3R8Y A;  1INJ A;  4EEA A;  4IHF A;  3IOJ A;  2VSH A;  1V83 A;  1ZI3 A;  3BSW A;  4FRA A;  2YCM A;  4FRE A;  4O6N A;  4ARW A;  2AH9 A;  4MYB A;  5C1H A;  3BSY A;  1KGT A;  2RIZ A;  4D11 C;  1QGS A;  4Y62 A;  1ZJ3 A;  2FY7 A;  2WVM A;  4DCL A;  2X5S A;  2Z87 A;  3CKO A;  3CKV A;  1KRV A;  4MFG A;  4M99 A;  1Z90 A;  5CMJ A;  3GVD A;  2WGZ A;  3R5C A;  4M2A A;  4J18 A;  5E3Q A;  1S80 A;  4EE5 A;  4N6B A;  1KK5 A;  1W57 A;  5IFY A;  3PKP A;  2AM5 A;  1H5T B;  4B2X A;  4FRL A;  3SXG A;  4B4G A;  1G2V A;  3CGX A;  1W55 A;  5U2K A;  4NAK A;  3V90 A;  1MR7 A;  4MIX A;  4KXO A;  4Y7G A;  1QRF A;  3T7O A;  3IXC A;  3U2W A;  2OEF A;  5E3R A;  3MC4 A;  1H7G A;  2YQJ A;  2ZU8 A;  2O1G A;  1QG8 A;  1H7E A;  1ZI1 A;  2WLC A;  2P73 A;  4EEO A;  4MYO A;  5C4C A;  5C48 A;  1QRE A;  1YP3 A;  2P2O A;  4M98 A;  1VZX A;  1LZ0 A;  2J0A A;  3Q4S A;  1N4I A;  2PGY A;  3USQ A;  4MND A;  1KWS A;  3MQG A;  1WT2 A;  1QGQ A;  4XWI A;  3Q80 A;  4ASJ A;  2VD4 A;  4AYL A;  1ZCY A;  1H5S C;  1ZCU A;  3FS8 A;  2AE7 A;  4B4B A;  4EE3 A;  1FR8 A;  4L41 C;  2V0H A;  3GQ8 A;  1GWW A;  1VPA A;  1KHR A;  5DEP A;  1FRW A;  2ICX A;  1H5S B;  4HZC A;  2O1F A;  4EA9 A;  1WSZ A;  3GQ9 A;  3D98 A;  3FSC A;  1LVW A;  5C1L A;  2NXV A;  2ICY A;  5BXC A;  4FCU A;  5CMH A;  4EVW A;  1G95 A;  4FRH A;  1H7L A;  1HJJ A;  4Y7U A;  2AM4 A;  3U2X A;  4FRM A;  4EGG A;  1VGU A;  2VS4 A;  1XHD A;  3CKJ A;  2PX7 A;  1OMX A;  4HO3 A;  1GQC A;  3CU0 A;  5C4E A;  1VGW A;  4H7O A;  2E8B A;  4B4M A;  4KQL A;  2V0J A;  1KQA A;  4HO8 A;  1R81 A;  3JTJ A;  3TDT A;  1YP4 A;  3I0H A;  2Z86 A;  2I5K A;  5C4D A;  3P47 A;  4N27 A;  1WT3 A;  4N69 A;  5IDT A;  5FYE A;  5C38 A;  1H5R B;  5DEM A;  1S4P A;  3R1W A;  3I3X A;  1KRR A;  3IOH A;  3FSY A;  3OW5 A;  3SX3 A;  3GUE A;  4CJ8 A;  1H7F A;  3OTZ A;  3OTM A;  3V8Y A;  4Y7T A;  2NPO A;  2OEG A;  2Q4J A;  3I0G A;  1O7Q A;  2D7R A;  2FYD B;  2VS3 A;  3BSS A;  1G23 A;  3OU9 A;  3VBJ A;  1FGX A;  3HSQ A;  3OC9 A;  1TW1 A;  1I52 A;  4KPX A;  3GQ7 A;  1MC3 A;  5AJP A;  5C4F A;  1QRG A;  1FGG A;  2RIX A;  1LZJ A;  3OH4 A;  4ZDQ A;  1H4D A;  3OH0 A;  3FSX A;  4R7P A;  1W77 A;  1FR9 A;  2RJ0 A;  2O1H A;  3SXB A;  3OH3 A;  1FXO A;  4HO2 A;  4M2B A;  2WLF A;  4AA7 A;  2TDT A;  5EJZ A;  4E79 A;  5D91 A;  1KGQ A;  1PZT A;  1ZDF A;  5C47 A;  3SRT A;  4FRP A;  4UEG A;  3V0L A;  3GOS A;  4E6T A;  5CMF X;  4YS8 A;  3KWD A;  3OKR A;  3SX7 A;  1E5K A;  3V4E A;  5CMG X;  2MZB A;  1G3L A;  5CMI A;  4ASY A;  4CVH A;  3V0Q A;  1ZIZ A;  3IOI A;  4G87 A;  2P72 A;  5L6S A;  2AEC A;  2GGQ A;  1ZJ1 A;  1SS9 A;  3OH2 A;  3VBN A;  5CQP A;  3VBM A;  2OI7 A;  1VZU A;  1LXA A;  3V0N A;  4KT7 A;  1R7U A;  1MR9 A;  1MRL A;  5DDT A;  1LL3 A;  2VS5 A;  3I0C A;  3TWD A;  1LZ7 A;  5FU8 A;  5IDS A;  1JYL A;  4DEC A;  1VIC A;  2FFV A;  4FRQ A;  1G97 A;  2RJ9 A;  1ON8 A;  4AAW A;  1ZCT A;  2FYC B;  3U2V A;  3DUV A;  1JYK A;  1WVC A;  1G9R A;  4NAL A;  1QRL A;  1G0R A;  3R3R A;  1FO8 A;  2YQS A;  1FG5 N;  1VGT A;  1R7X A;  5AJN A;  2Y4M A;  1PZY B;  4KPZ A;  1TW5 A;  2E3D A;  3NZ2 A;  1J2Z A;  1TDT A;  3GQA A;  2QGI A;  2VFZ A;  1IIM A;  3O3P A;  2QIA A;  2IC7 A;  5FU0 A;  4EEG A;  4B3U A;  1OQM B;  1R7T A;  3SX5 A;  5J49 A;  4Y7V A;  1H4C A;  2XWL A;  1IIN A;  4EEM A;  4HO9 A;  2C0N A;  5C36 A;  1NF5 B;  3JUK A;  3TQD A;  2FKO A;  2P6W A;  2X60 A;  3DJ4 A;  3VBL A;  3I0L A;  1OCX A;  2YQC A;  1SSQ A;  1V82 A;  3VBI A;  4EQY A;  1VH1 A;  5E3P A;  1JVG A;  3DHO A;  4DE7 A;  2PGV A;  1GX0 A;  2JF3 A;  4Y63 A;  5F42 A;  1EWW A;  1NWG B;  3TK8 A;  2FFU A;  2OI5 A;  3R2W A;  3NGW A;  1G93 A;  3CJ8 A;  2I5E A;  4N6A A;  1HM9 A;  4CJC A;  4Y7F A;  3KWE A;  1Z2F A;  1H3M A;  2VK9 A;  2Y4J A;  5C3A A;  3R5A A;  2QIV X;  2D7I A;  2RIT A;  1ZJ0 A;  4KC2 A;  1YRO B;  4G3P A;  1ZI5 A;  4MZU A;  4EAA A;  4DDZ A;  5CQN X;  4EAB A;  3SXD A;  4KRV A;  3ECT A;  3VBK A;  3TIS A;  3T7M A;  5C4B A;  1FO9 A;  3JUJ A;  3U2U A;  1H4E A;  1R82 A;  1O0R A;  2AM3 A;  3EG4 A;  3C8V A;  2ZU7 A;  2IU8 A;  2D0J A;  3T57 A;  1NKH B;  1GQ9 A;  1XAT A;  5DDV A;  5HS2 A;  5CQL X;  3SPT A;  4C2S A;  5C8R A;  4LW3 A;  3KIA A;  5JQQ A;  3KWC A;  3OGZ A;  4FIY A;  4BMA A;  4P02 A;  1INI A;  1FXJ A;  2AQ9 A;  4HO4 A;  2V0I A;  3OUP A;  2X65 A;  4IHG A;  1FOA A;  1MP4 A;  4P00 A;  1S4N A;  1VGZ A;  1ZHJ A;  5C1G A;  5AJO A;  1ZI4 A;  4B42 A;  1EZI A;  2Y4L A;  3HL3 A;  2J0B A;  5D92 A;  3R3I A;  3ZF8 A;  2JCK A;  3TV0 A;  1JV3 A;  1THJ A;  2APC A;  4JD0 A;  2BO7 A;  3RMV A;  2FYB A;  1HJL A;  1ZCV A;  1HV9 A;  4D48 A;  4NAI A;  3OH1 A;  2VXM A;  2YC3 A;  1T3D A;  2VHE A;  4EE4 A;  3VNP A;  2W0W A;  4HO6 A;  1HM0 A;  1MP3 A;  1NMM B;  1V67 A;  1V3W A;  2I7B A;  4BQH A;  1XZ6 A;  5CQO A;  3BRK X;  4G3Q A;  1V84 A;  1R7Y A;  4HCQ A;  3HJJ A;  4HUR A;  3V0P A;  3K8E A;  1FWY A;  5I1F A;  4KNX A;  3BXY A;  1TVY A;  2W0V A;  3F1Y A;  2JF2 A;  2WVK A;  2ZU9 A;  4Y64 A;  3U0X A;  4FCE A;  2XAT A;  4EA7 A;  3T7N A;  4FRB A;  3PMO A;  3EEV A;  3R5D A;  1TZF A;  1K4V A;  2VSI A;  2RJ8 A;  3F1C A;  1QQ0 A;  1H5S D;  5DG3 A;  1VM8 A;  3TIO A;  2QH5 A;  1LL2 A;  2XME A;  2BO6 A;  4EA8 A;  3R5B A;  3I0D A;  4R37 A;  1FZW A;  1LZI A;  2WLD A;  4LW6 A;  1ZJP A; 
#chains in the Genus database with same CATH homology
 4HO5 A;  1O23 B;  3JQY A;  1QWJ A;  2RIY A;  1EYR A;  3Q7U A;  4D11 A;  1HM8 A;  4HUS A;  1WT0 A;  2Y6P A;  4IRP A;  2BO4 A;  5EJ1 A;  4M9C A;  4Y6N A;  3ZGF A;  5EIY A;  1XHB A;  4IHH A;  4FRD A;  2WLG A;  2WLE A;  2Y4K A;  1H5T A;  4Q7C A;  1R7V A;  5C3B A;  3FTT A;  1R80 A;  3D8V A;  3V0M A;  5L6V A;  1S4O A;  1G1L A;  1G8O A;  3CKQ A;  4O6M A;  3IGJ A;  3I0J A;  3ZLK A;  2WEE A;  3SXC A;  1WT1 A;  3PNN A;  2YQH A;  3I0K A;  3SXA A;  1H7H A;  2RJ4 A;  2OI6 A;  5AFU U;  1KK6 A;  4M4K A;  4B2W A;  1JVD A;  3V8Z A;  2A8W A;  4E1K A;  1KK4 A;  3U0Y A;  2RJ6 A;  4NAN A;  1H7T A;  5C3D A;  2DPW A;  4HG6 A;  3RSB A;  4AYJ A;  3I0F A;  2JCL A;  2JCO A;  1ON6 A;  4KC1 A;  3EH0 A;  3EE5 A;  4CJB A;  3PKQ A;  1H5S A;  3I0I X;  2RJ5 A;  4D0T A;  4HZD A;  2VXL A;  3U2T A;  3LW6 A;  2JCJ A;  3CKN A;  3MQH A;  2GGO A;  1VZT A;  2CU2 A;  2XMH A;  4IRQ A;  3TZT A;  1JV1 A;  4ISX A;  2Y7A A;  1MP5 A;  4G3S A;  1NQI B;  2X5Z A;  4HO0 A;  1GA8 A;  3F1X A;  3OAM A;  4Y9X A;  3RMW A;  3E25 A;  3I0E A;  4HOC A;  2UX8 A;  3BCV A;  5AFU V;  4K6R A;  1H7Q A;  3Q1X A;  3DK5 A;  2A8U A;  1GWV A;  3D5N A;  4M28 A;  3E26 A;  4KNR A;  4KC4 A;  4FIX A;  3ST8 A;  1NHE B;  2FYA A;  3POL A;  5FTS A;  2XWN A;  5ADX U;  3FWW A;  1ZJO A;  3SX8 A;  3FOQ A;  3SXE A;  3P1B A;  4D0Z A;  4FQW A;  4FRO A;  1GX4 A;  2WVL A;  2IU9 A;  3USR A;  2RIJ A;  1VH3 A;  4GBP A;  3ZLL A;  1H5R A;  1O7O A;  1ZDG A;  4AC3 A;  2WAW A;  1ZJ2 A;  3VBP A;  3K8D A;  2BO8 A;  3R0S A;  2XWM A;  2QKX A;  2V0L A;  1KRU A;  2IUA A;  3V0O A;  5CQM X;  5C49 A;  3ZGG A;  4J09 A;  2RJ7 A;  2YC5 A;  2AES A;  3BFP A;  1LL0 A;  3I3A A;  3QVB A;  1OMZ A;  4Y6U A;  2V0K A;  1SST A;  4E75 A;  2WE9 A;  1YP2 A;  1QRM A;  5FUH A;  2AGD A;  3V91 A;  4R36 A;  5FTV A;  1SSM A;  2PA4 A;  4ECM A;  4E6U A;  4B5B A;  4JIS A;  3N9W A;  2RJ1 A;  5ADX V;  3FSB A;  2YES A;  5FV9 A;  3R8Y A;  1INJ A;  4EEA A;  4IHF A;  3IOJ A;  2VSH A;  1V83 A;  1ZI3 A;  3BSW A;  4FRA A;  2YCM A;  4FRE A;  4O6N A;  4ARW A;  2AH9 A;  4MYB A;  5C1H A;  3BSY A;  1KGT A;  2RIZ A;  4D11 C;  1QGS A;  4Y62 A;  1ZJ3 A;  2FY7 A;  2WVM A;  4DCL A;  2X5S A;  2Z87 A;  3CKO A;  3CKV A;  1KRV A;  4MFG A;  4M99 A;  1Z90 A;  5CMJ A;  3GVD A;  2WGZ A;  3R5C A;  4M2A A;  4J18 A;  5E3Q A;  1S80 A;  4EE5 A;  4N6B A;  1KK5 A;  1W57 A;  5IFY A;  3PKP A;  2AM5 A;  1H5T B;  4B2X A;  4FRL A;  3SXG A;  4B4G A;  1G2V A;  3CGX A;  1W55 A;  5U2K A;  4NAK A;  3V90 A;  1MR7 A;  4MIX A;  4KXO A;  4Y7G A;  1QRF A;  3T7O A;  3IXC A;  3U2W A;  2OEF A;  5E3R A;  3MC4 A;  1H7G A;  2YQJ A;  2ZU8 A;  2O1G A;  1QG8 A;  1H7E A;  1ZI1 A;  2WLC A;  2P73 A;  4EEO A;  4MYO A;  5C4C A;  5C48 A;  1QRE A;  1YP3 A;  2P2O A;  4M98 A;  1VZX A;  1LZ0 A;  2J0A A;  3Q4S A;  2PGY A;  3USQ A;  4MND A;  1KWS A;  3MQG A;  1WT2 A;  1QGQ A;  4XWI A;  3Q80 A;  4ASJ A;  2VD4 A;  4AYL A;  1ZCY A;  1H5S C;  1ZCU A;  3FS8 A;  2AE7 A;  4B4B A;  4EE3 A;  1FR8 A;  4L41 C;  2V0H A;  1GWW A;  1VPA A;  1KHR A;  5DEP A;  1FRW A;  2ICX A;  1H5S B;  4HZC A;  2O1F A;  4EA9 A;  1WSZ A;  5C1L A;  3D98 A;  3FSC A;  1LVW A;  2NXV A;  2ICY A;  5BXC A;  4FCU A;  5CMH A;  4EVW A;  1G95 A;  4FRH A;  1H7L A;  1HJJ A;  4Y7U A;  2AM4 A;  3U2X A;  4FRM A;  4EGG A;  1VGU A;  2VS4 A;  1XHD A;  3CKJ A;  2PX7 A;  1OMX A;  4HO3 A;  1GQC A;  3CU0 A;  5C4E A;  1VGW A;  4H7O A;  2E8B A;  4B4M A;  4KQL A;  2V0J A;  1KQA A;  4HO8 A;  1R81 A;  3JTJ A;  3TDT A;  1YP4 A;  3I0H A;  2Z86 A;  2I5K A;  5C4D A;  3P47 A;  4N27 A;  1WT3 A;  4N69 A;  5IDT A;  5FYE A;  5C38 A;  1H5R B;  5DEM A;  1S4P A;  3R1W A;  3I3X A;  1KRR A;  3IOH A;  3FSY A;  3OW5 A;  3SX3 A;  3GUE A;  4CJ8 A;  1H7F A;  3OTZ A;  3OTM A;  3V8Y A;  4Y7T A;  2NPO A;  2OEG A;  2Q4J A;  3I0G A;  1O7Q A;  2D7R A;  2FYD B;  2VS3 A;  3BSS A;  1G23 A;  3OU9 A;  3VBJ A;  1FGX A;  3HSQ A;  3OC9 A;  1TW1 A;  1I52 A;  4KPX A;  1MC3 A;  5AJP A;  5C4F A;  1QRG A;  1FGG A;  2RIX A;  1LZJ A;  3OH4 A;  4ZDQ A;  1H4D A;  3OH0 A;  3FSX A;  4R7P A;  1W77 A;  1FR9 A;  2RJ0 A;  2O1H A;  3SXB A;  3OH3 A;  1FXO A;  4HO2 A;  4M2B A;  2WLF A;  4AA7 A;  2TDT A;  5EJZ A;  4E79 A;  5D91 A;  1KGQ A;  1PZT A;  1ZDF A;  5C47 A;  3SRT A;  4FRP A;  4UEG A;  3V0L A;  3GOS A;  4E6T A;  5CMF X;  4YS8 A;  3KWD A;  3OKR A;  3SX7 A;  1E5K A;  3V4E A;  5CMG X;  2MZB A;  1G3L A;  5CMI A;  4ASY A;  4CVH A;  3V0Q A;  1ZIZ A;  3IOI A;  4G87 A;  2P72 A;  5L6S A;  2AEC A;  2GGQ A;  1ZJ1 A;  1SS9 A;  3VBN A;  3OH2 A;  5CQP A;  3VBM A;  2OI7 A;  1VZU A;  1LXA A;  3V0N A;  4KT7 A;  1R7U A;  1MR9 A;  1MRL A;  5DDT A;  1LL3 A;  2VS5 A;  3I0C A;  3TWD A;  1LZ7 A;  5FU8 A;  5IDS A;  1JYL A;  4DEC A;  1VIC A;  2FFV A;  4FRQ A;  1G97 A;  2RJ9 A;  1ON8 A;  4AAW A;  1ZCT A;  2FYC B;  3U2V A;  3DUV A;  1JYK A;  1WVC A;  1G9R A;  4NAL A;  1QRL A;  1G0R A;  3R3R A;  1FO8 A;  2YQS A;  1FG5 N;  1VGT A;  1R7X A;  5AJN A;  2Y4M A;  1PZY B;  4KPZ A;  1TW5 A;  2E3D A;  3NZ2 A;  1J2Z A;  1TDT A;  2QGI A;  2VFZ A;  1IIM A;  3O3P A;  2QIA A;  2IC7 A;  5FU0 A;  4EEG A;  4B3U A;  1OQM B;  1R7T A;  3SX5 A;  5J49 A;  4Y7V A;  1H4C A;  2XWL A;  1IIN A;  4EEM A;  4HO9 A;  2C0N A;  5C36 A;  1NF5 B;  3JUK A;  3TQD A;  2FKO A;  2P6W A;  2X60 A;  3DJ4 A;  3VBL A;  3I0L A;  1OCX A;  2YQC A;  1SSQ A;  1V82 A;  3VBI A;  4EQY A;  1VH1 A;  5E3P A;  1JVG A;  3DHO A;  4DE7 A;  2PGV A;  1GX0 A;  2JF3 A;  4Y63 A;  5F42 A;  1NWG B;  3TK8 A;  2FFU A;  2OI5 A;  3R2W A;  3NGW A;  1G93 A;  3CJ8 A;  2I5E A;  4N6A A;  1HM9 A;  4CJC A;  4Y7F A;  3KWE A;  1H3M A;  2VK9 A;  2Y4J A;  5C3A A;  3R5A A;  2QIV X;  2D7I A;  2RIT A;  1ZJ0 A;  4KC2 A;  1YRO B;  4G3P A;  1ZI5 A;  4MZU A;  4EAA A;  4DDZ A;  5CQN X;  4EAB A;  3SXD A;  4KRV A;  3ECT A;  3VBK A;  3TIS A;  3T7M A;  5C4B A;  1FO9 A;  3JUJ A;  3U2U A;  1H4E A;  1R82 A;  1O0R A;  2AM3 A;  3EG4 A;  3C8V A;  2ZU7 A;  2IU8 A;  2D0J A;  3T57 A;  1NKH B;  1GQ9 A;  1XAT A;  5DDV A;  5HS2 A;  5CQL X;  3SPT A;  4C2S A;  5C8R A;  4LW3 A;  3KIA A;  5JQQ A;  3KWC A;  3OGZ A;  4FIY A;  4BMA A;  4P02 A;  1INI A;  1FXJ A;  2AQ9 A;  4HO4 A;  2V0I A;  3OUP A;  2X65 A;  4IHG A;  1FOA A;  1MP4 A;  4P00 A;  1S4N A;  1VGZ A;  1ZHJ A;  5C1G A;  5AJO A;  1ZI4 A;  4B42 A;  1EZI A;  2Y4L A;  3HL3 A;  2J0B A;  5D92 A;  3R3I A;  3ZF8 A;  2JCK A;  3TV0 A;  1JV3 A;  1THJ A;  2APC A;  4JD0 A;  2BO7 A;  3RMV A;  2FYB A;  1HJL A;  1ZCV A;  1HV9 A;  4D48 A;  4NAI A;  3OH1 A;  2VXM A;  2YC3 A;  1T3D A;  2VHE A;  4EE4 A;  3VNP A;  2W0W A;  4HO6 A;  1HM0 A;  1MP3 A;  1NMM B;  1V67 A;  1V3W A;  2I7B A;  4BQH A;  1XZ6 A;  5CQO A;  3BRK X;  4G3Q A;  1V84 A;  1R7Y A;  4HCQ A;  3HJJ A;  4HUR A;  3V0P A;  3K8E A;  1FWY A;  5I1F A;  4KNX A;  3BXY A;  1TVY A;  2W0V A;  3F1Y A;  2JF2 A;  2WVK A;  2ZU9 A;  4Y64 A;  3U0X A;  4FCE A;  2XAT A;  4EA7 A;  3T7N A;  4FRB A;  3PMO A;  3EEV A;  3R5D A;  1TZF A;  1K4V A;  2VSI A;  2RJ8 A;  3F1C A;  1QQ0 A;  1H5S D;  5DG3 A;  1VM8 A;  3TIO A;  2QH5 A;  1LL2 A;  2XME A;  2BO6 A;  4EA8 A;  3R5B A;  3I0D A;  4R37 A;  1FZW A;  1LZI A;  2WLD A;  4LW6 A;  1ZJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...