5L6VA

Crystal structure of e. coli adp-glucose pyrophosphorylase (agpase) in complex with a negative allosteric regulator adenosine monophosphate (amp) - agpase*amp
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
422
structure length
422
Chain Sequence
HLMLARQLPLKSVALILAGGRGTRLKDLTNKRAKPAVHFGGKFRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGWSFFNEEMNEFVDLLPAQQRMKGENWYRGTADAVTQNLDIIRRYKAEYVVILAGDHIYKQDYSRMLIDHVEKGARCTVACMPVPIEEASAFGVMAVDENDKIIEFVEKPANPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAGLAYAHPFPLSCVQSDPDAEPYWRDVGTLEAYWKANLDLASVVPELDMYDRNWPIRTYNESLPPAKFVQDRSGSHGMTLNSLVSGGCVISGSVVVQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARRFYRSEEGIVLVTREMLRKLGHKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glucose-1-phosphate adenylyltransferase
publication title Structural Basis of Glycogen Biosynthesis Regulation in Bacteria.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 141
structure length 422
sequence length 422
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 2.7.7.27: Glucose-1-phosphate adenylyltransferase.
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00483 NTP_transferase Nucleotidyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5l6vA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 5l6vA01
2RITA 2RIZA 2OI6A 5IFYA 1G9RA 3CJ8A 3R3IA 2WEEA 5C4EA 1ZCVA 4FRHA 5CQNX 2RJ8A 1O23B 1JVDA 1TVYA 2WLEA 4HOCA 5FUHA 1QRFA 4FROA 2ICXA 3OC9A 4DCLA 2NPOA 3OH2A 2FFUA 4B42A 2Q4JA 1S4PA 1V83A 2YC5A 1IINA 3I0DA 1YP2A 2Y7AA 3I0GA 5CMGX 4IHFA 2FKOA 2VFZA 2OEGA 1H7LA 5AJPA 1ZDGA 3T7MA 1NKHB 5E3RA 5DEMA 3I0KA 2NXVA 1FXOA 5CMFX 3TV0A 3V8YA 1T3DA 2WLDA 1NWGB 1ON6A 1MR7A 1FO8A 1G23A 1ON8A 2ICYA 3PKQA 2Y4JA 1XHBA 4Y7FA 1QREA 1ZJPA 2IC7A 4KNXA 4Y64A 3OTMA 3U2VA 5C3BA 3MQHA 1OMXA 2VSIA 1R7XA 5L6VA 4B3UA 5CMHA 1H5TA 1HM0A 1KGTA 2PGVA 2VXMA 4EA8A 1SS9A 2RIYA 3CKVA 4M28A 3BSYA 4M2BA 3V0MA 3JQYA 3CU0A 4LW6A 1ZI3A 3FOQA 2FYBA 1OCXA 2E8BA 1G95A 1GX0A 4AAWA 5C4DA 2V0HA 4IHHA 3U2XA 1H7QA 1R7UA 3DHOA 1HJLA 2JCJA 3OH3A 4HO8A 5HS2A 2IUAA 4JISA 4KQLA 3TQDA 5C8RA 3SX5A 3IGJA 5AFUU 4D11C 2FYDB 4KPXA 2AM5A 5C48A 2TDTA 1V84A 4B4GA 1H4DA 5CQOA 2PA4A 5C3DA 4M99A 3V90A 1G97A 2I5KA 2YQJA 3R5AA 3C8VA 2QKXA 3MQGA 3SX7A 4FRBA 5FYEA 3RSBA 1VM8A 1XATA 1FRWA 1G93A 3R0SA 1V67A 2XMEA 1QRGA 1MP4A 1R81A 4R7PA 1QQ0A 4H7OA 1H7TA 1KWSA 2XWMA 4B2XA 5IDSA 2RJ6A 4NAKA 5C1HA 1GWWA 1XZ6A 2XWLA 5FU8A 1WT2A 5JQQA 1YP3A 4KC4A 1V3WA 4N6AA 1LZIA 1WSZA 1R7VA 2FFVA 2O1HA 4Y9XA 4Y63A 4KRVA 1H7FA 1PZYB 1VICA 3ZGFA 4ECMA 3V0PA 1W77A 2YQHA 4MYOA 5EIYA 1TW5A 2X65A 1ZJ0A 3U0YA 3VBLA 2YC3A 4E6UA 2V0KA 5AFUV 2FYAA 2WVMA 1S4NA 3BXYA 1JV1A 4Y6UA 3USQA 2RJ0A 3T7NA 4HO6A 4AYLA 3FSBA 1ZJ1A 3Q7UA 3MC4A 3SRTA 2VSHA 3D5NA 1V82A 3BSWA 3D98A 1VPAA 1ZI1A 5DDTA 5C1LA 2JF3A 2XWNA 1NF5B 1O7QA 3D8VA 2RIXA 4MZUA 5EJ1A 3U0XA 1QRLA 2JCLA 4ARWA 2BO6A 2RJ1A 3DUVA 1H5RB 1S4OA 4EEGA 4R37A 4GBPA 3EH0A 1R80A 2V0JA 2X60A 1ZI5A 2YESA 3OTZA 4FRAA 3EEVA 4KC1A 4D11A 3CKNA 1KHRA 3P1BA 1ZJ3A 4FRLA 4EAAA 2AGDA 3RMVA 1QWJA 4EE3A 1NHEB 3JTJA 3F1XA 5C47A 2VHEA 3OKRA 3I0LA 4HG6A 3BRKX 3ST8A 3Q80A 3O3PA 5FU0A 5DG3A 1H4EA 1ZIZA 3V0NA 1R7YA 2OI7A 2BO7A 3OAMA 1INJA 1TDTA 4EQYA 1G8OA 3VBPA 4P02A 4YS8A 1FO9A 4FRDA 5C4CA 4N69A 1FG5N 3EE5A 2QH5A 2GGOA 1OMZA 1JV3A 3DK5A 1GWVA 2QIAA 1SSMA 4N27A 3IOIA 1LXAA 3BCVA 2IU9A 3FTTA 1MP5A 4B2WA 1QG8A 1VZUA 4IRPA 4HO4A 3I0FA 2D7IA 4B5BA 4Y7TA 4HCQA 1G3LA 1LL3A 3JUKA 5FTSA 1MRLA 4HO0A 4FRQA 2JF2A 2AQ9A 2ZU7A 3USRA 2WAWA 1G1LA 3JUJA 3VNPA 5ADXU 2CU2A 5AJOA 5DDVA 1KK5A 2Z86A 3I0JA 3SXEA 5CQLX 4BQHA 4KXOA 3RMWA 3CKOA 3FWWA 3Q4SA 3GUEA 1H5SB 1VGZA 4EE4A 1EZIA 2X5SA 3V8ZA 4C2SA 1ZJ2A 1FWYA 1ZHJA 1TW1A 4HZCA 2W0WA 4EA7A 2AECA 4AA7A 3GOSA 4CJBA 3R3RA 1ZDFA 4B4BA 1SSTA 5CMIA 5FV9A 3ZGGA 4HURA 1HJJA 1KK4A 1I52A 4Y6NA 2YQSA 3KWCA 1HM9A 3OUPA 3SXCA 1HM8A 1ZI4A 1OQMB 4AC3A 1KGQA 4DE7A 4EGGA 4MNDA 3V0OA 1LVWA 1SSQA 2OEFA 2ZU8A 1FXJA 4M98A 4EEOA 5J49A 1MR9A 5C3AA 3TISA 3F1YA 1QRMA 4NALA 1H7GA 3U2TA 2YCMA 2QIVX 1FZWA 3R2WA 4K6RA 1IIMA 4CVHA 5C49A 4Y7UA 1VH3A 1INIA 3PNNA 5F42A 1H5SC 1K4VA 4FRPA 2I5EA 3I0CA 2Y4KA 1O7OA 1H5RA 1LZ7A 2I7BA 4HO9A 4HO3A 4HZDA 4HUSA 4KC2A 2V0LA 3HJJA 4G3QA 3TK8A 2MZBA 2WE9A 1O0RA 1YP4A 1GQCA 1H7HA 2Y4LA 3VBNA 3SX3A 5C4FA 1KQAA 4L41C 3LW6A 1TZFA 3DJ4A 4G3PA 1ZCUA 4LW3A 1HV9A 2Y6PA 1VGWA 1VZXA 3IOJA 3R1WA 1GX4A 1Z90A 3VBJA 5CQPA 4UEGA 4E75A 3HSQA 3E26A 1VGUA 3BSSA 5L6SA 2AH9A 3OGZA 1ZJOA 2RJ9A 1WT3A 3SXDA 3TIOA 1G0RA 4KT7A 3OW5A 3QVBA 4EEMA 4B4MA 1THJA 1MC3A 4D0ZA 2VD4A 3HL3A 3R8YA 2APCA 1KRRA 3R5DA 3I0HA 1FGXA 3TDTA 1ZCTA 1G2VA 1VGTA 4ASYA 1LZ0A 1NQIB 3V91A 4Y7VA 5C38A 5CMJA 2P72A 4EABA 2VS5A 3ECTA 1FOAA 3K8DA 3CGXA 1PZTA 3KIAA 3IOHA 3GVDA 2XMHA 2Z87A 3OU9A 4G3SA 3U2WA 4FCUA 4J18A 2RJ5A 3CKJA 2RIJA 2P2OA 1KRVA 2E3DA 2XATA 1GQ9A 1VZTA 3T57A 2X5ZA 1VH1A 2WLFA 3POLA 5C1GA 1JYKA 2D7RA 2BO4A 1H5SA 2PX7A 3I3AA 1KK6A 4FQWA 4EEAA 3EG4A 2O1FA 5C4BA 2AESA 3Q1XA 3OH4A 4KNRA 2JCKA 3ZLKA 2P73A 4DECA 1GA8A 2P6WA 4KPZA 3PKPA 3SPTA 5U2KA 4BMAA 4JD0A 4CJ8A 5FTVA 4D0TA 4J09A 4AYJA 1H4CA 2JCOA 3OH0A 1S80A 4DDZA 4Y7GA 3KWDA 4CJCA 3VBMA 4EVWA 1FGGA 1NMMB 4R36A 1WT1A 1EYRA 2VS4A 2WVLA 2WLGA 2RJ7A 4ZDQA 2YQCA 1XHDA 2AE7A 1WVCA 4Y62A 5EJZA 1LL2A 1QGQA 5AJNA 3P47A 3VBKA 4EE5A 5BXCA 3TWDA 3R5BA 2OI5A 2O1GA 1R82A 4ISXA 1H5SD 3ZF8A 3K8EA 3BFPA 1H5TB 2FY7A 3U2UA 4M2AA 3V4EA 5ADXV 1E5KA 1LL0A 4E6TA 2W0VA 1MP3A 4E79A 4G87A 1WT0A 4XWIA 3V0QA 4HO5A 5IDTA 1H3MA 1LZJA 3FSXA 3CKQA 2QGIA 3SXBA 1FR8A 2A8WA 3ZLLA 1ZCYA 3E25A 1YROB 2FYCB 5E3QA 4FRMA 4EA9A 5E3PA 3I0EA 1J2ZA 3T7OA 4P00A 2WVKA 4M9CA 1R7TA 4MFGA 2Y4MA 5CQMX 3TZTA 2V0IA 3N9WA 3NGWA 1QGSA 5C36A 3R5CA 3V0LA 5I1FA 4NANA 1W57A 3I3XA 2VXLA 3SX8A 2ZU9A 2D0JA 3KWEA 4E1KA 2AM4A 1W55A 2BO8A 2UX8A 2DPWA 3F1CA 5DEPA 2WGZA 4ASJA 4D48A 1KRUA 3FSYA 3PMOA 4IHGA 3NZ2A 3I0IX 2PGYA 3IXCA 2IU8A 3VBIA 4M4KA 3FSCA 2A8UA 2VS3A 1H7EA 2AM3A 4FREA 1FR9A 2GGQA 4HO2A 4NAIA 1JVGA 2WLCA 4MYBA 4FCEA 4IRQA 3OH1A 1JYLA 2RJ4A 3SXGA 3FS8A 3SXAA 4N6BA
chains in the Genus database with same CATH superfamily
2RITA 2RIZA 2OI6A 5IFYA 1G9RA 3CJ8A 3R3IA 2WEEA 5C4EA 1ZCVA 4FRHA 5CQNX 2RJ8A 1O23B 1JVDA 1TVYA 2WLEA 4HOCA 4O6NA 1QRFA 5FUHA 4FROA 2ICXA 3OC9A 4DCLA 2NPOA 3OH2A 2FFUA 4B42A 2Q4JA 1S4PA 1V83A 2YC5A 1IINA 3I0DA 1YP2A 2Y7AA 3I0GA 5CMGX 4IHFA 2FKOA 2VFZA 2OEGA 1H7LA 5AJPA 1ZDGA 3T7MA 1NKHB 5E3RA 5DEMA 3I0KA 2NXVA 1FXOA 5CMFX 3TV0A 3V8YA 1T3DA 2WLDA 1NWGB 1ON6A 1MR7A 1FO8A 1G23A 1ON8A 2ICYA 3PKQA 2Y4JA 1XHBA 4Y7FA 1QREA 1ZJPA 2IC7A 4KNXA 4Y64A 3OTMA 3U2VA 5C3BA 3MQHA 1OMXA 2VSIA 1R7XA 5L6VA 4B3UA 5CMHA 1H5TA 1HM0A 1KGTA 2PGVA 2VXMA 4EA8A 1SS9A 2RIYA 3CKVA 4M28A 3BSYA 4M2BA 3V0MA 3JQYA 3CU0A 4LW6A 1ZI3A 3FOQA 2FYBA 1OCXA 2E8BA 1G95A 1GX0A 4AAWA 5C4DA 2V0HA 4IHHA 3U2XA 1H7QA 1R7UA 3DHOA 1HJLA 3OH3A 2JCJA 4HO8A 5HS2A 2IUAA 4JISA 4KQLA 3TQDA 5C8RA 3SX5A 3IGJA 5AFUU 4D11C 2FYDB 4KPXA 2AM5A 5C48A 2TDTA 1V84A 4B4GA 1H4DA 5CQOA 2PA4A 5C3DA 4M99A 3V90A 1G97A 2I5KA 2YQJA 3R5AA 3SUCA 3C8VA 2QKXA 3MQGA 3SX7A 4FRBA 5FYEA 3RSBA 1VM8A 1XATA 1FRWA 1G93A 3R0SA 1V67A 2XMEA 1QRGA 1MP4A 1R81A 4R7PA 1QQ0A 4H7OA 1H7TA 1KWSA 2XWMA 4B2XA 5IDSA 2RJ6A 4NAKA 5C1HA 1GWWA 1XZ6A 2XWLA 5FU8A 1WT2A 5JQQA 1YP3A 4KC4A 5D92A 1V3WA 4N6AA 1LZIA 1WSZA 1R7VA 2FFVA 2O1HA 4Y9XA 4Y63A 4KRVA 1H7FA 1PZYB 1VICA 3ZGFA 4ECMA 3V0PA 1W77A 2YQHA 4MYOA 5EIYA 1TW5A 2X65A 1ZJ0A 3U0YA 3VBLA 2YC3A 4E6UA 2V0KA 5AFUV 2FYAA 2WVMA 1S4NA 3BXYA 1JV1A 4Y6UA 3USQA 2RJ0A 3T7NA 4HO6A 4AYLA 3FSBA 1ZJ1A 3Q7UA 3MC4A 3SRTA 2VSHA 3D5NA 1V82A 3BSWA 3D98A 1VPAA 1ZI1A 5DDTA 5C1LA 2JF3A 2XWNA 1NF5B 1O7QA 3D8VA 2RIXA 4MZUA 5EJ1A 1EWWA 3U0XA 1QRLA 2JCLA 4ARWA 2BO6A 2RJ1A 3DUVA 1H5RB 1S4OA 4EEGA 4R37A 4GBPA 3EH0A 1R80A 2V0JA 2X60A 1ZI5A 2YESA 3OTZA 4FRAA 3EEVA 4KC1A 4D11A 3CKNA 1KHRA 3P1BA 1ZJ3A 4FRLA 4EAAA 2AGDA 3RMVA 1QWJA 4EE3A 2VK9A 1NHEB 3JTJA 3F1XA 5C47A 2VHEA 3OKRA 3I0LA 4HG6A 3BRKX 3ST8A 3Q80A 3O3PA 5FU0A 5DG3A 1H4EA 1ZIZA 3V0NA 1R7YA 2OI7A 2BO7A 3OAMA 1INJA 2C0NA 1TDTA 4EQYA 1G8OA 3VBPA 4P02A 4YS8A 1FO9A 4FRDA 5C4CA 1N4IA 4N69A 1FG5N 3EE5A 2QH5A 2GGOA 1OMZA 1JV3A 3DK5A 1GWVA 2QIAA 1SSMA 4N27A 3IOIA 1LXAA 3BCVA 2IU9A 3FTTA 1MP5A 4B2WA 1QG8A 1VZUA 4IRPA 4HO4A 3I0FA 2D7IA 4B5BA 4Y7TA 4HCQA 1G3LA 1LL3A 3JUKA 4MIXA 5FTSA 1MRLA 4HO0A 4FRQA 2JF2A 2AQ9A 2ZU7A 3USRA 2WAWA 1G1LA 3JUJA 3VNPA 5ADXU 2CU2A 5AJOA 5DDVA 1KK5A 2Z86A 3I0JA 3SXEA 5CQLX 4BQHA 4KXOA 3RMWA 3CKOA 3FWWA 3Q4SA 3GUEA 1H5SB 1VGZA 4EE4A 1EZIA 2X5SA 3V8ZA 4C2SA 1ZJ2A 1FWYA 1ZHJA 1TW1A 4HZCA 2W0WA 4EA7A 2AECA 4AA7A 3GOSA 4CJBA 3R3RA 1ZDFA 4B4BA 1SSTA 5CMIA 5FV9A 3ZGGA 4HURA 1HJJA 1KK4A 1I52A 4Y6NA 2YQSA 3KWCA 1HM9A 3OUPA 3SXCA 1HM8A 1ZI4A 1OQMB 4AC3A 1KGQA 4DE7A 4EGGA 4MNDA 3V0OA 1LVWA 1SSQA 2OEFA 2ZU8A 1FXJA 4M98A 4EEOA 5J49A 1MR9A 5C3AA 3TISA 3F1YA 1QRMA 4NALA 1H7GA 3U2TA 3GQ9A 2YCMA 2QIVX 1FZWA 3R2WA 4K6RA 1IIMA 4CVHA 5C49A 4Y7UA 1VH3A 1INIA 3PNNA 5F42A 1H5SC 1K4VA 4FRPA 2I5EA 3I0CA 2Y4KA 1O7OA 1H5RA 1LZ7A 2I7BA 4HO9A 4HO3A 4HZDA 4HUSA 4KC2A 2V0LA 3HJJA 4G3QA 3TK8A 2MZBA 2WE9A 1O0RA 1YP4A 1GQCA 1H7HA 2Y4LA 3VBNA 3SX3A 5C4FA 1KQAA 4L41C 3LW6A 1TZFA 3DJ4A 4G3PA 1ZCUA 4LW3A 1HV9A 2Y6PA 1VGWA 1VZXA 3IOJA 3R1WA 1GX4A 1Z90A 3VBJA 5CQPA 4UEGA 4E75A 3HSQA 3E26A 1VGUA 3BSSA 1M8NA 5L6SA 2AH9A 3OGZA 1ZJOA 2RJ9A 3GQAA 1WT3A 3SXDA 3TIOA 1G0RA 4KT7A 3OW5A 3QVBA 4EEMA 4B4MA 1THJA 1MC3A 4D0ZA 2VD4A 3HL3A 3R8YA 2APCA 1KRRA 3R5DA 3I0HA 1FGXA 3TDTA 1ZCTA 1G2VA 1VGTA 4FIYA 4ASYA 1LZ0A 1NQIB 3V91A 4Y7VA 5C38A 5CMJA 2P72A 4EABA 2VS5A 3ECTA 1FOAA 3K8DA 3CGXA 1PZTA 3KIAA 3IOHA 3GVDA 2XMHA 2Z87A 3OU9A 4G3SA 3U2WA 4FCUA 4J18A 2RJ5A 3CKJA 2RIJA 2P2OA 1KRVA 2E3DA 2XATA 1GQ9A 1VZTA 3T57A 2X5ZA 1VH1A 2WLFA 3POLA 5C1GA 1JYKA 2D7RA 2BO4A 1Z2FA 1H5SA 2PX7A 4O6MA 3I3AA 1KK6A 3GQ8A 4FQWA 4EEAA 3EG4A 2O1FA 5C4BA 2AESA 3Q1XA 3OH4A 4KNRA 2JCKA 3ZLKA 2P73A 4DECA 1GA8A 2P6WA 4KPZA 3PKPA 3SPTA 5U2KA 4BMAA 4JD0A 4CJ8A 5FTVA 4D0TA 4J09A 4AYJA 1H4CA 3OH0A 2JCOA 1S80A 1L0SA 4DDZA 4Y7GA 3KWDA 4CJCA 3VBMA 4EVWA 3GQ7A 1FGGA 1NMMB 4R36A 1WT1A 1EYRA 2VS4A 2WVLA 2WLGA 2RJ7A 4ZDQA 2YQCA 1XHDA 2AE7A 1WVCA 4Y62A 5D91A 5EJZA 1LL2A 1QGQA 5AJNA 3P47A 3VBKA 4EE5A 5BXCA 3TWDA 3R5BA 2OI5A 2O1GA 1R82A 4ISXA 1H5SD 3ZF8A 3K8EA 3BFPA 1H5TB 2FY7A 3U2UA 4M2AA 3V4EA 5ADXV 1E5KA 1LL0A 4E6TA 2W0VA 1MP3A 4E79A 4G87A 1WT0A 4XWIA 3V0QA 4HO5A 5IDTA 1H3MA 1LZJA 3FSXA 3CKQA 2QGIA 3SXBA 1FR8A 2A8WA 3ZLLA 1ZCYA 3E25A 1YROB 2FYCB 5E3QA 4FRMA 4EA9A 5E3PA 3I0EA 1J2ZA 3T7OA 4P00A 2WVKA 4M9CA 1R7TA 4MFGA 2Y4MA 5CQMX 3TZTA 2V0IA 3N9WA 3NGWA 1QGSA 5C36A 3R5CA 3V0LA 5I1FA 4NANA 1W57A 4Q7CA 3I3XA 2VXLA 3SX8A 2ZU9A 2D0JA 3KWEA 4E1KA 2AM4A 1W55A 2BO8A 2UX8A 2DPWA 3F1CA 5DEPA 2WGZA 4ASJA 4D48A 1KRUA 3FSYA 3PMOA 4IHGA 2J0BA 3NZ2A 3I0IX 2PGYA 3IXCA 2IU8A 3VBIA 4M4KA 3FSCA 2A8UA 2VS3A 1H7EA 2AM3A 4FREA 1FR9A 2GGQA 4FIXA 4HO2A 4NAIA 1JVGA 2WLCA 2J0AA 4MYBA 4FCEA 4IRQA 3OH1A 1JYLA 2RJ4A 3SXGA 3FS8A 3SXAA 4N6BA
chains in the Genus database with same CATH topology
2RITA 2RIZA 2OI6A 5IFYA 1G9RA 3CJ8A 3R3IA 2WEEA 5C4EA 1ZCVA 4FRHA 5CQNX 2RJ8A 1O23B 1JVDA 1TVYA 2WLEA 4HOCA 4O6NA 1QRFA 5FUHA 4FROA 2ICXA 3OC9A 4DCLA 2NPOA 3OH2A 2FFUA 4B42A 2Q4JA 1S4PA 1V83A 2YC5A 1IINA 3I0DA 1YP2A 2Y7AA 3I0GA 5CMGX 4IHFA 2FKOA 2VFZA 2OEGA 1H7LA 5AJPA 1ZDGA 3T7MA 1NKHB 5E3RA 5DEMA 3I0KA 2NXVA 1FXOA 5CMFX 3TV0A 3V8YA 1T3DA 2WLDA 1NWGB 1ON6A 1MR7A 1FO8A 1G23A 1ON8A 2ICYA 3PKQA 2Y4JA 1XHBA 4Y7FA 1QREA 1ZJPA 2IC7A 4KNXA 4Y64A 3OTMA 3U2VA 5C3BA 3MQHA 1OMXA 2VSIA 1R7XA 5L6VA 4B3UA 5CMHA 1H5TA 1HM0A 1KGTA 2PGVA 2VXMA 4EA8A 1SS9A 2RIYA 3CKVA 4M28A 3BSYA 4M2BA 3V0MA 3JQYA 3CU0A 4LW6A 1ZI3A 3FOQA 2FYBA 1OCXA 2E8BA 1G95A 1GX0A 4AAWA 5C4DA 2V0HA 4IHHA 3U2XA 1H7QA 1R7UA 3DHOA 1HJLA 2JCJA 3OH3A 4HO8A 5HS2A 2IUAA 4JISA 4KQLA 3TQDA 5C8RA 3SX5A 3IGJA 5AFUU 4D11C 2FYDB 4KPXA 2AM5A 5C48A 2TDTA 1V84A 4B4GA 1H4DA 5CQOA 2PA4A 5C3DA 4M99A 3V90A 1G97A 2I5KA 2YQJA 3R5AA 3C8VA 2QKXA 3MQGA 3SX7A 4FRBA 5FYEA 3RSBA 1VM8A 1XATA 1FRWA 1G93A 3R0SA 1V67A 2XMEA 1QRGA 1MP4A 1R81A 4R7PA 1QQ0A 4H7OA 1H7TA 1KWSA 2XWMA 4B2XA 5IDSA 2RJ6A 4NAKA 5C1HA 1GWWA 1XZ6A 2XWLA 5FU8A 1WT2A 5JQQA 1YP3A 4KC4A 5D92A 1V3WA 4N6AA 1LZIA 1WSZA 1R7VA 2FFVA 2O1HA 4Y9XA 4Y63A 4KRVA 1H7FA 1PZYB 1VICA 3ZGFA 4ECMA 3V0PA 1W77A 2YQHA 4MYOA 5EIYA 1TW5A 2X65A 1ZJ0A 3U0YA 3VBLA 2YC3A 4E6UA 2V0KA 5AFUV 2FYAA 2WVMA 1S4NA 3BXYA 1JV1A 4Y6UA 3USQA 2RJ0A 3T7NA 4HO6A 4AYLA 3FSBA 1ZJ1A 3Q7UA 3MC4A 3SRTA 2VSHA 3D5NA 1V82A 3BSWA 3D98A 1VPAA 1ZI1A 5DDTA 5C1LA 2JF3A 2XWNA 1NF5B 1O7QA 3D8VA 2RIXA 4MZUA 5EJ1A 3U0XA 1QRLA 2JCLA 4ARWA 2BO6A 2RJ1A 3DUVA 1H5RB 1S4OA 4EEGA 4R37A 4GBPA 3EH0A 1R80A 2V0JA 2X60A 1ZI5A 2YESA 3OTZA 4FRAA 3EEVA 4KC1A 4D11A 3CKNA 1KHRA 3P1BA 1ZJ3A 4FRLA 4EAAA 2AGDA 3RMVA 1QWJA 4EE3A 2VK9A 1NHEB 3JTJA 3F1XA 5C47A 2VHEA 3OKRA 3I0LA 4HG6A 3BRKX 3ST8A 3Q80A 3O3PA 5FU0A 5DG3A 1H4EA 1ZIZA 3V0NA 1R7YA 2OI7A 2BO7A 3OAMA 1INJA 2C0NA 1TDTA 4EQYA 1G8OA 3VBPA 4P02A 4YS8A 1FO9A 4FRDA 5C4CA 4N69A 1FG5N 3EE5A 2QH5A 2GGOA 1OMZA 1JV3A 3DK5A 1GWVA 2QIAA 1SSMA 4N27A 3IOIA 1LXAA 3BCVA 2IU9A 3FTTA 1MP5A 4B2WA 1QG8A 1VZUA 4IRPA 4HO4A 3I0FA 2D7IA 4B5BA 4Y7TA 4HCQA 1G3LA 1LL3A 3JUKA 4MIXA 5FTSA 1MRLA 4HO0A 4FRQA 2JF2A 2AQ9A 2ZU7A 3USRA 2WAWA 1G1LA 3JUJA 3VNPA 5ADXU 2CU2A 5AJOA 5DDVA 1KK5A 2Z86A 3I0JA 3SXEA 5CQLX 4BQHA 4KXOA 3RMWA 3CKOA 3FWWA 3Q4SA 3GUEA 1H5SB 1VGZA 4EE4A 1EZIA 2X5SA 3V8ZA 4C2SA 1ZJ2A 1FWYA 1ZHJA 1TW1A 4HZCA 2W0WA 4EA7A 2AECA 4AA7A 3GOSA 4CJBA 3R3RA 1ZDFA 4B4BA 1SSTA 5CMIA 5FV9A 3ZGGA 4HURA 1HJJA 1KK4A 1I52A 4Y6NA 2YQSA 3KWCA 1HM9A 3OUPA 3SXCA 1HM8A 1ZI4A 1OQMB 4AC3A 1KGQA 4DE7A 4EGGA 4MNDA 3V0OA 1LVWA 1SSQA 2OEFA 2ZU8A 1FXJA 4M98A 4EEOA 5J49A 1MR9A 5C3AA 3TISA 3F1YA 1QRMA 4NALA 1H7GA 3U2TA 2YCMA 2QIVX 1FZWA 3R2WA 4K6RA 1IIMA 4CVHA 5C49A 4Y7UA 1VH3A 1INIA 3PNNA 5F42A 1H5SC 1K4VA 4FRPA 2I5EA 3I0CA 2Y4KA 1O7OA 1H5RA 1LZ7A 2I7BA 4HO9A 4HO3A 4HZDA 4HUSA 4KC2A 2V0LA 3HJJA 4G3QA 3TK8A 2MZBA 2WE9A 1O0RA 1YP4A 1GQCA 1H7HA 2Y4LA 3VBNA 3SX3A 5C4FA 1KQAA 4L41C 3LW6A 1TZFA 3DJ4A 4G3PA 1ZCUA 4LW3A 1HV9A 2Y6PA 1VGWA 1VZXA 3IOJA 3R1WA 1GX4A 1Z90A 3VBJA 5CQPA 4UEGA 4E75A 3HSQA 3E26A 1VGUA 3BSSA 5L6SA 2AH9A 3OGZA 1ZJOA 2RJ9A 1WT3A 3SXDA 3TIOA 1G0RA 4KT7A 3OW5A 3QVBA 4EEMA 4B4MA 1THJA 1MC3A 4D0ZA 2VD4A 3HL3A 3R8YA 2APCA 1KRRA 3R5DA 3I0HA 1FGXA 3TDTA 1ZCTA 1G2VA 1VGTA 4FIYA 4ASYA 1LZ0A 1NQIB 3V91A 4Y7VA 5C38A 5CMJA 2P72A 4EABA 2VS5A 3ECTA 1FOAA 3K8DA 3CGXA 1PZTA 3KIAA 3IOHA 3GVDA 2XMHA 2Z87A 3OU9A 4G3SA 3U2WA 4FCUA 4J18A 2RJ5A 3CKJA 2RIJA 2P2OA 1KRVA 2E3DA 2XATA 1GQ9A 1VZTA 3T57A 2X5ZA 1VH1A 2WLFA 3POLA 5C1GA 1JYKA 2D7RA 2BO4A 1H5SA 2PX7A 4O6MA 3I3AA 1KK6A 4FQWA 4EEAA 3EG4A 2O1FA 5C4BA 2AESA 3Q1XA 3OH4A 4KNRA 2JCKA 3ZLKA 2P73A 4DECA 1GA8A 2P6WA 4KPZA 3PKPA 3SPTA 5U2KA 4BMAA 4JD0A 4CJ8A 5FTVA 4D0TA 4J09A 4AYJA 1H4CA 2JCOA 3OH0A 1S80A 4DDZA 4Y7GA 3KWDA 4CJCA 3VBMA 4EVWA 1FGGA 1NMMB 4R36A 1WT1A 1EYRA 2VS4A 2WVLA 2WLGA 2RJ7A 4ZDQA 2YQCA 1XHDA 2AE7A 1WVCA 4Y62A 5D91A 5EJZA 1LL2A 1QGQA 5AJNA 3P47A 3VBKA 4EE5A 5BXCA 3TWDA 3R5BA 2OI5A 2O1GA 1R82A 4ISXA 1H5SD 3ZF8A 3K8EA 3BFPA 1H5TB 2FY7A 3U2UA 4M2AA 3V4EA 5ADXV 1E5KA 1LL0A 4E6TA 2W0VA 1MP3A 4E79A 4G87A 1WT0A 4XWIA 3V0QA 4HO5A 5IDTA 1H3MA 1LZJA 3FSXA 3CKQA 2QGIA 3SXBA 1FR8A 2A8WA 3ZLLA 1ZCYA 3E25A 1YROB 2FYCB 5E3QA 4FRMA 4EA9A 5E3PA 3I0EA 1J2ZA 3T7OA 4P00A 2WVKA 4M9CA 1R7TA 4MFGA 2Y4MA 5CQMX 3TZTA 2V0IA 3N9WA 3NGWA 1QGSA 5C36A 3R5CA 3V0LA 5I1FA 4NANA 1W57A 4Q7CA 3I3XA 2VXLA 3SX8A 2ZU9A 2D0JA 3KWEA 4E1KA 2AM4A 1W55A 2BO8A 2UX8A 2DPWA 3F1CA 5DEPA 2WGZA 4ASJA 4D48A 1KRUA 3FSYA 3PMOA 4IHGA 2J0BA 3NZ2A 3I0IX 2PGYA 3IXCA 2IU8A 3VBIA 4M4KA 3FSCA 2A8UA 2VS3A 1H7EA 2AM3A 4FREA 1FR9A 2GGQA 4FIXA 4HO2A 4NAIA 1JVGA 2WLCA 2J0AA 4MYBA 4FCEA 4IRQA 3OH1A 1JYLA 2RJ4A 3SXGA 3FS8A 3SXAA 4N6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIT A;  2RIZ A;  2OI6 A;  5IFY A;  1G9R A;  3CJ8 A;  3R3I A;  2WEE A;  5C4E A;  1ZCV A;  4FRH A;  5CQN X;  2RJ8 A;  1O23 B;  1JVD A;  1TVY A;  2WLE A;  4HOC A;  5FUH A;  1QRF A;  4FRO A;  2ICX A;  3OC9 A;  4DCL A;  2NPO A;  3OH2 A;  2FFU A;  4B42 A;  2Q4J A;  1S4P A;  1V83 A;  2YC5 A;  1IIN A;  3I0D A;  1YP2 A;  2Y7A A;  3I0G A;  5CMG X;  4IHF A;  2FKO A;  2VFZ A;  2OEG A;  1H7L A;  5AJP A;  1ZDG A;  3T7M A;  1NKH B;  5E3R A;  5DEM A;  3I0K A;  2NXV A;  1FXO A;  5CMF X;  3TV0 A;  3V8Y A;  1T3D A;  2WLD A;  1NWG B;  1ON6 A;  1MR7 A;  1FO8 A;  1G23 A;  1ON8 A;  2ICY A;  3PKQ A;  2Y4J A;  1XHB A;  4Y7F A;  1QRE A;  1ZJP A;  2IC7 A;  4KNX A;  4Y64 A;  3OTM A;  3U2V A;  5C3B A;  3MQH A;  1OMX A;  2VSI A;  1R7X A;  5L6V A;  4B3U A;  5CMH A;  1H5T A;  1HM0 A;  1KGT A;  2PGV A;  2VXM A;  4EA8 A;  1SS9 A;  2RIY A;  3CKV A;  4M28 A;  3BSY A;  4M2B A;  3V0M A;  3JQY A;  3CU0 A;  4LW6 A;  1ZI3 A;  3FOQ A;  2FYB A;  1OCX A;  2E8B A;  1G95 A;  1GX0 A;  4AAW A;  5C4D A;  2V0H A;  4IHH A;  3U2X A;  1H7Q A;  1R7U A;  3DHO A;  1HJL A;  2JCJ A;  3OH3 A;  4HO8 A;  5HS2 A;  2IUA A;  4JIS A;  4KQL A;  3TQD A;  5C8R A;  3SX5 A;  3IGJ A;  5AFU U;  4D11 C;  2FYD B;  4KPX A;  2AM5 A;  5C48 A;  2TDT A;  1V84 A;  4B4G A;  1H4D A;  5CQO A;  2PA4 A;  5C3D A;  4M99 A;  3V90 A;  1G97 A;  2I5K A;  2YQJ A;  3R5A A;  3C8V A;  2QKX A;  3MQG A;  3SX7 A;  4FRB A;  5FYE A;  3RSB A;  1VM8 A;  1XAT A;  1FRW A;  1G93 A;  3R0S A;  1V67 A;  2XME A;  1QRG A;  1MP4 A;  1R81 A;  4R7P A;  1QQ0 A;  4H7O A;  1H7T A;  1KWS A;  2XWM A;  4B2X A;  5IDS A;  2RJ6 A;  4NAK A;  5C1H A;  1GWW A;  1XZ6 A;  2XWL A;  5FU8 A;  1WT2 A;  5JQQ A;  1YP3 A;  4KC4 A;  1V3W A;  4N6A A;  1LZI A;  1WSZ A;  1R7V A;  2FFV A;  2O1H A;  4Y9X A;  4Y63 A;  4KRV A;  1H7F A;  1PZY B;  1VIC A;  3ZGF A;  4ECM A;  3V0P A;  1W77 A;  2YQH A;  4MYO A;  5EIY A;  1TW5 A;  2X65 A;  1ZJ0 A;  3U0Y A;  3VBL A;  2YC3 A;  4E6U A;  2V0K A;  5AFU V;  2FYA A;  2WVM A;  1S4N A;  3BXY A;  1JV1 A;  4Y6U A;  3USQ A;  2RJ0 A;  3T7N A;  4HO6 A;  4AYL A;  3FSB A;  1ZJ1 A;  3Q7U A;  3MC4 A;  3SRT A;  2VSH A;  3D5N A;  1V82 A;  3BSW A;  3D98 A;  1VPA A;  1ZI1 A;  5DDT A;  5C1L A;  2JF3 A;  2XWN A;  1NF5 B;  1O7Q A;  3D8V A;  2RIX A;  4MZU A;  5EJ1 A;  3U0X A;  1QRL A;  2JCL A;  4ARW A;  2BO6 A;  2RJ1 A;  3DUV A;  1H5R B;  1S4O A;  4EEG A;  4R37 A;  4GBP A;  3EH0 A;  1R80 A;  2V0J A;  2X60 A;  1ZI5 A;  2YES A;  3OTZ A;  4FRA A;  3EEV A;  4KC1 A;  4D11 A;  3CKN A;  1KHR A;  3P1B A;  1ZJ3 A;  4FRL A;  4EAA A;  2AGD A;  3RMV A;  1QWJ A;  4EE3 A;  1NHE B;  3JTJ A;  3F1X A;  5C47 A;  2VHE A;  3OKR A;  3I0L A;  4HG6 A;  3BRK X;  3ST8 A;  3Q80 A;  3O3P A;  5FU0 A;  5DG3 A;  1H4E A;  1ZIZ A;  3V0N A;  1R7Y A;  2OI7 A;  2BO7 A;  3OAM A;  1INJ A;  1TDT A;  4EQY A;  1G8O A;  3VBP A;  4P02 A;  4YS8 A;  1FO9 A;  4FRD A;  5C4C A;  4N69 A;  1FG5 N;  3EE5 A;  2QH5 A;  2GGO A;  1OMZ A;  1JV3 A;  3DK5 A;  1GWV A;  2QIA A;  1SSM A;  4N27 A;  3IOI A;  1LXA A;  3BCV A;  2IU9 A;  3FTT A;  1MP5 A;  4B2W A;  1QG8 A;  1VZU A;  4IRP A;  4HO4 A;  3I0F A;  2D7I A;  4B5B A;  4Y7T A;  4HCQ A;  1G3L A;  1LL3 A;  3JUK A;  5FTS A;  1MRL A;  4HO0 A;  4FRQ A;  2JF2 A;  2AQ9 A;  2ZU7 A;  3USR A;  2WAW A;  1G1L A;  3JUJ A;  3VNP A;  5ADX U;  2CU2 A;  5AJO A;  5DDV A;  1KK5 A;  2Z86 A;  3I0J A;  3SXE A;  5CQL X;  4BQH A;  4KXO A;  3RMW A;  3CKO A;  3FWW A;  3Q4S A;  3GUE A;  1H5S B;  1VGZ A;  4EE4 A;  1EZI A;  2X5S A;  3V8Z A;  4C2S A;  1ZJ2 A;  1FWY A;  1ZHJ A;  1TW1 A;  4HZC A;  2W0W A;  4EA7 A;  2AEC A;  4AA7 A;  3GOS A;  4CJB A;  3R3R A;  1ZDF A;  4B4B A;  1SST A;  5CMI A;  5FV9 A;  3ZGG A;  4HUR A;  1HJJ A;  1KK4 A;  1I52 A;  4Y6N A;  2YQS A;  3KWC A;  1HM9 A;  3OUP A;  3SXC A;  1HM8 A;  1ZI4 A;  1OQM B;  4AC3 A;  1KGQ A;  4DE7 A;  4EGG A;  4MND A;  3V0O A;  1LVW A;  1SSQ A;  2OEF A;  2ZU8 A;  1FXJ A;  4M98 A;  4EEO A;  5J49 A;  1MR9 A;  5C3A A;  3TIS A;  3F1Y A;  1QRM A;  4NAL A;  1H7G A;  3U2T A;  2YCM A;  2QIV X;  1FZW A;  3R2W A;  4K6R A;  1IIM A;  4CVH A;  5C49 A;  4Y7U A;  1VH3 A;  1INI A;  3PNN A;  5F42 A;  1H5S C;  1K4V A;  4FRP A;  2I5E A;  3I0C A;  2Y4K A;  1O7O A;  1H5R A;  1LZ7 A;  2I7B A;  4HO9 A;  4HO3 A;  4HZD A;  4HUS A;  4KC2 A;  2V0L A;  3HJJ A;  4G3Q A;  3TK8 A;  2MZB A;  2WE9 A;  1O0R A;  1YP4 A;  1GQC A;  1H7H A;  2Y4L A;  3VBN A;  3SX3 A;  5C4F A;  1KQA A;  4L41 C;  3LW6 A;  1TZF A;  3DJ4 A;  4G3P A;  1ZCU A;  4LW3 A;  1HV9 A;  2Y6P A;  1VGW A;  1VZX A;  3IOJ A;  3R1W A;  1GX4 A;  1Z90 A;  3VBJ A;  5CQP A;  4UEG A;  4E75 A;  3HSQ A;  3E26 A;  1VGU A;  3BSS A;  5L6S A;  2AH9 A;  3OGZ A;  1ZJO A;  2RJ9 A;  1WT3 A;  3SXD A;  3TIO A;  1G0R A;  4KT7 A;  3OW5 A;  3QVB A;  4EEM A;  4B4M A;  1THJ A;  1MC3 A;  4D0Z A;  2VD4 A;  3HL3 A;  3R8Y A;  2APC A;  1KRR A;  3R5D A;  3I0H A;  1FGX A;  3TDT A;  1ZCT A;  1G2V A;  1VGT A;  4ASY A;  1LZ0 A;  1NQI B;  3V91 A;  4Y7V A;  5C38 A;  5CMJ A;  2P72 A;  4EAB A;  2VS5 A;  3ECT A;  1FOA A;  3K8D A;  3CGX A;  1PZT A;  3KIA A;  3IOH A;  3GVD A;  2XMH A;  2Z87 A;  3OU9 A;  4G3S A;  3U2W A;  4FCU A;  4J18 A;  2RJ5 A;  3CKJ A;  2RIJ A;  2P2O A;  1KRV A;  2E3D A;  2XAT A;  1GQ9 A;  1VZT A;  3T57 A;  2X5Z A;  1VH1 A;  2WLF A;  3POL A;  5C1G A;  1JYK A;  2D7R A;  2BO4 A;  1H5S A;  2PX7 A;  3I3A A;  1KK6 A;  4FQW A;  4EEA A;  3EG4 A;  2O1F A;  5C4B A;  2AES A;  3Q1X A;  3OH4 A;  4KNR A;  2JCK A;  3ZLK A;  2P73 A;  4DEC A;  1GA8 A;  2P6W A;  4KPZ A;  3PKP A;  3SPT A;  5U2K A;  4BMA A;  4JD0 A;  4CJ8 A;  5FTV A;  4D0T A;  4J09 A;  4AYJ A;  1H4C A;  2JCO A;  3OH0 A;  1S80 A;  4DDZ A;  4Y7G A;  3KWD A;  4CJC A;  3VBM A;  4EVW A;  1FGG A;  1NMM B;  4R36 A;  1WT1 A;  1EYR A;  2VS4 A;  2WVL A;  2WLG A;  2RJ7 A;  4ZDQ A;  2YQC A;  1XHD A;  2AE7 A;  1WVC A;  4Y62 A;  5EJZ A;  1LL2 A;  1QGQ A;  5AJN A;  3P47 A;  3VBK A;  4EE5 A;  5BXC A;  3TWD A;  3R5B A;  2OI5 A;  2O1G A;  1R82 A;  4ISX A;  1H5S D;  3ZF8 A;  3K8E A;  3BFP A;  1H5T B;  2FY7 A;  3U2U A;  4M2A A;  3V4E A;  5ADX V;  1E5K A;  1LL0 A;  4E6T A;  2W0V A;  1MP3 A;  4E79 A;  4G87 A;  1WT0 A;  4XWI A;  3V0Q A;  4HO5 A;  5IDT A;  1H3M A;  1LZJ A;  3FSX A;  3CKQ A;  2QGI A;  3SXB A;  1FR8 A;  2A8W A;  3ZLL A;  1ZCY A;  3E25 A;  1YRO B;  2FYC B;  5E3Q A;  4FRM A;  4EA9 A;  5E3P A;  3I0E A;  1J2Z A;  3T7O A;  4P00 A;  2WVK A;  4M9C A;  1R7T A;  4MFG A;  2Y4M A;  5CQM X;  3TZT A;  2V0I A;  3N9W A;  3NGW A;  1QGS A;  5C36 A;  3R5C A;  3V0L A;  5I1F A;  4NAN A;  1W57 A;  3I3X A;  2VXL A;  3SX8 A;  2ZU9 A;  2D0J A;  3KWE A;  4E1K A;  2AM4 A;  1W55 A;  2BO8 A;  2UX8 A;  2DPW A;  3F1C A;  5DEP A;  2WGZ A;  4ASJ A;  4D48 A;  1KRU A;  3FSY A;  3PMO A;  4IHG A;  3NZ2 A;  3I0I X;  2PGY A;  3IXC A;  2IU8 A;  3VBI A;  4M4K A;  3FSC A;  2A8U A;  2VS3 A;  1H7E A;  2AM3 A;  4FRE A;  1FR9 A;  2GGQ A;  4HO2 A;  4NAI A;  1JVG A;  2WLC A;  4MYB A;  4FCE A;  4IRQ A;  3OH1 A;  1JYL A;  2RJ4 A;  3SXG A;  3FS8 A;  3SXA A;  4N6B A; 
#chains in the Genus database with same CATH topology
 2RIT A;  2RIZ A;  2OI6 A;  5IFY A;  1G9R A;  3CJ8 A;  3R3I A;  2WEE A;  5C4E A;  1ZCV A;  4FRH A;  5CQN X;  2RJ8 A;  1O23 B;  1JVD A;  1TVY A;  2WLE A;  4HOC A;  4O6N A;  1QRF A;  5FUH A;  4FRO A;  2ICX A;  3OC9 A;  4DCL A;  2NPO A;  3OH2 A;  2FFU A;  4B42 A;  2Q4J A;  1S4P A;  1V83 A;  2YC5 A;  1IIN A;  3I0D A;  1YP2 A;  2Y7A A;  3I0G A;  5CMG X;  4IHF A;  2FKO A;  2VFZ A;  2OEG A;  1H7L A;  5AJP A;  1ZDG A;  3T7M A;  1NKH B;  5E3R A;  5DEM A;  3I0K A;  2NXV A;  1FXO A;  5CMF X;  3TV0 A;  3V8Y A;  1T3D A;  2WLD A;  1NWG B;  1ON6 A;  1MR7 A;  1FO8 A;  1G23 A;  1ON8 A;  2ICY A;  3PKQ A;  2Y4J A;  1XHB A;  4Y7F A;  1QRE A;  1ZJP A;  2IC7 A;  4KNX A;  4Y64 A;  3OTM A;  3U2V A;  5C3B A;  3MQH A;  1OMX A;  2VSI A;  1R7X A;  5L6V A;  4B3U A;  5CMH A;  1H5T A;  1HM0 A;  1KGT A;  2PGV A;  2VXM A;  4EA8 A;  1SS9 A;  2RIY A;  3CKV A;  4M28 A;  3BSY A;  4M2B A;  3V0M A;  3JQY A;  3CU0 A;  4LW6 A;  1ZI3 A;  3FOQ A;  2FYB A;  1OCX A;  2E8B A;  1G95 A;  1GX0 A;  4AAW A;  5C4D A;  2V0H A;  4IHH A;  3U2X A;  1H7Q A;  1R7U A;  3DHO A;  1HJL A;  3OH3 A;  2JCJ A;  4HO8 A;  5HS2 A;  2IUA A;  4JIS A;  4KQL A;  3TQD A;  5C8R A;  3SX5 A;  3IGJ A;  5AFU U;  4D11 C;  2FYD B;  4KPX A;  2AM5 A;  5C48 A;  2TDT A;  1V84 A;  4B4G A;  1H4D A;  5CQO A;  2PA4 A;  5C3D A;  4M99 A;  3V90 A;  1G97 A;  2I5K A;  2YQJ A;  3R5A A;  3SUC A;  3C8V A;  2QKX A;  3MQG A;  3SX7 A;  4FRB A;  5FYE A;  3RSB A;  1VM8 A;  1XAT A;  1FRW A;  1G93 A;  3R0S A;  1V67 A;  2XME A;  1QRG A;  1MP4 A;  1R81 A;  4R7P A;  1QQ0 A;  4H7O A;  1H7T A;  1KWS A;  2XWM A;  4B2X A;  5IDS A;  2RJ6 A;  4NAK A;  5C1H A;  1GWW A;  1XZ6 A;  2XWL A;  5FU8 A;  1WT2 A;  5JQQ A;  1YP3 A;  4KC4 A;  5D92 A;  1V3W A;  4N6A A;  1LZI A;  1WSZ A;  1R7V A;  2FFV A;  2O1H A;  4Y9X A;  4Y63 A;  4KRV A;  1H7F A;  1PZY B;  1VIC A;  3ZGF A;  4ECM A;  3V0P A;  1W77 A;  2YQH A;  4MYO A;  5EIY A;  1TW5 A;  2X65 A;  1ZJ0 A;  3U0Y A;  3VBL A;  2YC3 A;  4E6U A;  2V0K A;  5AFU V;  2FYA A;  2WVM A;  1S4N A;  3BXY A;  1JV1 A;  4Y6U A;  3USQ A;  2RJ0 A;  3T7N A;  4HO6 A;  4AYL A;  3FSB A;  1ZJ1 A;  3Q7U A;  3MC4 A;  3SRT A;  2VSH A;  3D5N A;  1V82 A;  3BSW A;  3D98 A;  1VPA A;  1ZI1 A;  5DDT A;  5C1L A;  2JF3 A;  2XWN A;  1NF5 B;  1O7Q A;  3D8V A;  2RIX A;  4MZU A;  5EJ1 A;  1EWW A;  3U0X A;  1QRL A;  2JCL A;  4ARW A;  2BO6 A;  2RJ1 A;  3DUV A;  1H5R B;  1S4O A;  4EEG A;  4R37 A;  4GBP A;  3EH0 A;  1R80 A;  2V0J A;  2X60 A;  1ZI5 A;  2YES A;  3OTZ A;  4FRA A;  3EEV A;  4KC1 A;  4D11 A;  3CKN A;  1KHR A;  3P1B A;  1ZJ3 A;  4FRL A;  4EAA A;  2AGD A;  3RMV A;  1QWJ A;  4EE3 A;  2VK9 A;  1NHE B;  3JTJ A;  3F1X A;  5C47 A;  2VHE A;  3OKR A;  3I0L A;  4HG6 A;  3BRK X;  3ST8 A;  3Q80 A;  3O3P A;  5FU0 A;  5DG3 A;  1H4E A;  1ZIZ A;  3V0N A;  1R7Y A;  2OI7 A;  2BO7 A;  3OAM A;  1INJ A;  2C0N A;  1TDT A;  4EQY A;  1G8O A;  3VBP A;  4P02 A;  4YS8 A;  1FO9 A;  4FRD A;  5C4C A;  1N4I A;  4N69 A;  1FG5 N;  3EE5 A;  2QH5 A;  2GGO A;  1OMZ A;  1JV3 A;  3DK5 A;  1GWV A;  2QIA A;  1SSM A;  4N27 A;  3IOI A;  1LXA A;  3BCV A;  2IU9 A;  3FTT A;  1MP5 A;  4B2W A;  1QG8 A;  1VZU A;  4IRP A;  4HO4 A;  3I0F A;  2D7I A;  4B5B A;  4Y7T A;  4HCQ A;  1G3L A;  1LL3 A;  3JUK A;  4MIX A;  5FTS A;  1MRL A;  4HO0 A;  4FRQ A;  2JF2 A;  2AQ9 A;  2ZU7 A;  3USR A;  2WAW A;  1G1L A;  3JUJ A;  3VNP A;  5ADX U;  2CU2 A;  5AJO A;  5DDV A;  1KK5 A;  2Z86 A;  3I0J A;  3SXE A;  5CQL X;  4BQH A;  4KXO A;  3RMW A;  3CKO A;  3FWW A;  3Q4S A;  3GUE A;  1H5S B;  1VGZ A;  4EE4 A;  1EZI A;  2X5S A;  3V8Z A;  4C2S A;  1ZJ2 A;  1FWY A;  1ZHJ A;  1TW1 A;  4HZC A;  2W0W A;  4EA7 A;  2AEC A;  4AA7 A;  3GOS A;  4CJB A;  3R3R A;  1ZDF A;  4B4B A;  1SST A;  5CMI A;  5FV9 A;  3ZGG A;  4HUR A;  1HJJ A;  1KK4 A;  1I52 A;  4Y6N A;  2YQS A;  3KWC A;  1HM9 A;  3OUP A;  3SXC A;  1HM8 A;  1ZI4 A;  1OQM B;  4AC3 A;  1KGQ A;  4DE7 A;  4EGG A;  4MND A;  3V0O A;  1LVW A;  1SSQ A;  2OEF A;  2ZU8 A;  1FXJ A;  4M98 A;  4EEO A;  5J49 A;  1MR9 A;  5C3A A;  3TIS A;  3F1Y A;  1QRM A;  4NAL A;  1H7G A;  3U2T A;  3GQ9 A;  2YCM A;  2QIV X;  1FZW A;  3R2W A;  4K6R A;  1IIM A;  4CVH A;  5C49 A;  4Y7U A;  1VH3 A;  1INI A;  3PNN A;  5F42 A;  1H5S C;  1K4V A;  4FRP A;  2I5E A;  3I0C A;  2Y4K A;  1O7O A;  1H5R A;  1LZ7 A;  2I7B A;  4HO9 A;  4HO3 A;  4HZD A;  4HUS A;  4KC2 A;  2V0L A;  3HJJ A;  4G3Q A;  3TK8 A;  2MZB A;  2WE9 A;  1O0R A;  1YP4 A;  1GQC A;  1H7H A;  2Y4L A;  3VBN A;  3SX3 A;  5C4F A;  1KQA A;  4L41 C;  3LW6 A;  1TZF A;  3DJ4 A;  4G3P A;  1ZCU A;  4LW3 A;  1HV9 A;  2Y6P A;  1VGW A;  1VZX A;  3IOJ A;  3R1W A;  1GX4 A;  1Z90 A;  3VBJ A;  5CQP A;  4UEG A;  4E75 A;  3HSQ A;  3E26 A;  1VGU A;  3BSS A;  1M8N A;  5L6S A;  2AH9 A;  3OGZ A;  1ZJO A;  2RJ9 A;  3GQA A;  1WT3 A;  3SXD A;  3TIO A;  1G0R A;  4KT7 A;  3OW5 A;  3QVB A;  4EEM A;  4B4M A;  1THJ A;  1MC3 A;  4D0Z A;  2VD4 A;  3HL3 A;  3R8Y A;  2APC A;  1KRR A;  3R5D A;  3I0H A;  1FGX A;  3TDT A;  1ZCT A;  1G2V A;  1VGT A;  4FIY A;  4ASY A;  1LZ0 A;  1NQI B;  3V91 A;  4Y7V A;  5C38 A;  5CMJ A;  2P72 A;  4EAB A;  2VS5 A;  3ECT A;  1FOA A;  3K8D A;  3CGX A;  1PZT A;  3KIA A;  3IOH A;  3GVD A;  2XMH A;  2Z87 A;  3OU9 A;  4G3S A;  3U2W A;  4FCU A;  4J18 A;  2RJ5 A;  3CKJ A;  2RIJ A;  2P2O A;  1KRV A;  2E3D A;  2XAT A;  1GQ9 A;  1VZT A;  3T57 A;  2X5Z A;  1VH1 A;  2WLF A;  3POL A;  5C1G A;  1JYK A;  2D7R A;  2BO4 A;  1Z2F A;  1H5S A;  2PX7 A;  4O6M A;  3I3A A;  1KK6 A;  3GQ8 A;  4FQW A;  4EEA A;  3EG4 A;  2O1F A;  5C4B A;  2AES A;  3Q1X A;  3OH4 A;  4KNR A;  2JCK A;  3ZLK A;  2P73 A;  4DEC A;  1GA8 A;  2P6W A;  4KPZ A;  3PKP A;  3SPT A;  5U2K A;  4BMA A;  4JD0 A;  4CJ8 A;  5FTV A;  4D0T A;  4J09 A;  4AYJ A;  1H4C A;  3OH0 A;  2JCO A;  1S80 A;  1L0S A;  4DDZ A;  4Y7G A;  3KWD A;  4CJC A;  3VBM A;  4EVW A;  3GQ7 A;  1FGG A;  1NMM B;  4R36 A;  1WT1 A;  1EYR A;  2VS4 A;  2WVL A;  2WLG A;  2RJ7 A;  4ZDQ A;  2YQC A;  1XHD A;  2AE7 A;  1WVC A;  4Y62 A;  5D91 A;  5EJZ A;  1LL2 A;  1QGQ A;  5AJN A;  3P47 A;  3VBK A;  4EE5 A;  5BXC A;  3TWD A;  3R5B A;  2OI5 A;  2O1G A;  1R82 A;  4ISX A;  1H5S D;  3ZF8 A;  3K8E A;  3BFP A;  1H5T B;  2FY7 A;  3U2U A;  4M2A A;  3V4E A;  5ADX V;  1E5K A;  1LL0 A;  4E6T A;  2W0V A;  1MP3 A;  4E79 A;  4G87 A;  1WT0 A;  4XWI A;  3V0Q A;  4HO5 A;  5IDT A;  1H3M A;  1LZJ A;  3FSX A;  3CKQ A;  2QGI A;  3SXB A;  1FR8 A;  2A8W A;  3ZLL A;  1ZCY A;  3E25 A;  1YRO B;  2FYC B;  5E3Q A;  4FRM A;  4EA9 A;  5E3P A;  3I0E A;  1J2Z A;  3T7O A;  4P00 A;  2WVK A;  4M9C A;  1R7T A;  4MFG A;  2Y4M A;  5CQM X;  3TZT A;  2V0I A;  3N9W A;  3NGW A;  1QGS A;  5C36 A;  3R5C A;  3V0L A;  5I1F A;  4NAN A;  1W57 A;  4Q7C A;  3I3X A;  2VXL A;  3SX8 A;  2ZU9 A;  2D0J A;  3KWE A;  4E1K A;  2AM4 A;  1W55 A;  2BO8 A;  2UX8 A;  2DPW A;  3F1C A;  5DEP A;  2WGZ A;  4ASJ A;  4D48 A;  1KRU A;  3FSY A;  3PMO A;  4IHG A;  2J0B A;  3NZ2 A;  3I0I X;  2PGY A;  3IXC A;  2IU8 A;  3VBI A;  4M4K A;  3FSC A;  2A8U A;  2VS3 A;  1H7E A;  2AM3 A;  4FRE A;  1FR9 A;  2GGQ A;  4FIX A;  4HO2 A;  4NAI A;  1JVG A;  2WLC A;  2J0A A;  4MYB A;  4FCE A;  4IRQ A;  3OH1 A;  1JYL A;  2RJ4 A;  3SXG A;  3FS8 A;  3SXA A;  4N6B A; 
#chains in the Genus database with same CATH homology
 2RIT A;  2RIZ A;  2OI6 A;  5IFY A;  1G9R A;  3CJ8 A;  3R3I A;  2WEE A;  5C4E A;  1ZCV A;  4FRH A;  5CQN X;  2RJ8 A;  1O23 B;  1JVD A;  1TVY A;  2WLE A;  4HOC A;  4O6N A;  1QRF A;  5FUH A;  4FRO A;  2ICX A;  3OC9 A;  4DCL A;  2NPO A;  3OH2 A;  2FFU A;  4B42 A;  2Q4J A;  1S4P A;  1V83 A;  2YC5 A;  1IIN A;  3I0D A;  1YP2 A;  2Y7A A;  3I0G A;  5CMG X;  4IHF A;  2FKO A;  2VFZ A;  2OEG A;  1H7L A;  5AJP A;  1ZDG A;  3T7M A;  1NKH B;  5E3R A;  5DEM A;  3I0K A;  2NXV A;  1FXO A;  5CMF X;  3TV0 A;  3V8Y A;  1T3D A;  2WLD A;  1NWG B;  1ON6 A;  1MR7 A;  1FO8 A;  1G23 A;  1ON8 A;  2ICY A;  3PKQ A;  2Y4J A;  1XHB A;  4Y7F A;  1QRE A;  1ZJP A;  2IC7 A;  4KNX A;  4Y64 A;  3OTM A;  3U2V A;  5C3B A;  3MQH A;  1OMX A;  2VSI A;  1R7X A;  5L6V A;  4B3U A;  5CMH A;  1H5T A;  1HM0 A;  1KGT A;  2PGV A;  2VXM A;  4EA8 A;  1SS9 A;  2RIY A;  3CKV A;  4M28 A;  3BSY A;  4M2B A;  3V0M A;  3JQY A;  3CU0 A;  4LW6 A;  1ZI3 A;  3FOQ A;  2FYB A;  1OCX A;  2E8B A;  1G95 A;  1GX0 A;  4AAW A;  5C4D A;  2V0H A;  4IHH A;  3U2X A;  1H7Q A;  1R7U A;  3DHO A;  1HJL A;  2JCJ A;  3OH3 A;  4HO8 A;  5HS2 A;  2IUA A;  4JIS A;  4KQL A;  3TQD A;  5C8R A;  3SX5 A;  3IGJ A;  5AFU U;  4D11 C;  2FYD B;  4KPX A;  2AM5 A;  5C48 A;  2TDT A;  1V84 A;  4B4G A;  1H4D A;  5CQO A;  2PA4 A;  5C3D A;  4M99 A;  3V90 A;  1G97 A;  2I5K A;  2YQJ A;  3R5A A;  3C8V A;  2QKX A;  3MQG A;  3SX7 A;  4FRB A;  5FYE A;  3RSB A;  1VM8 A;  1XAT A;  1FRW A;  1G93 A;  3R0S A;  1V67 A;  2XME A;  1QRG A;  1MP4 A;  1R81 A;  4R7P A;  1QQ0 A;  4H7O A;  1H7T A;  1KWS A;  2XWM A;  4B2X A;  5IDS A;  2RJ6 A;  4NAK A;  5C1H A;  1GWW A;  1XZ6 A;  2XWL A;  5FU8 A;  1WT2 A;  5JQQ A;  1YP3 A;  4KC4 A;  5D92 A;  1V3W A;  4N6A A;  1LZI A;  1WSZ A;  1R7V A;  2FFV A;  2O1H A;  4Y9X A;  4Y63 A;  4KRV A;  1H7F A;  1PZY B;  1VIC A;  3ZGF A;  4ECM A;  3V0P A;  1W77 A;  2YQH A;  4MYO A;  5EIY A;  1TW5 A;  2X65 A;  1ZJ0 A;  3U0Y A;  3VBL A;  2YC3 A;  4E6U A;  2V0K A;  5AFU V;  2FYA A;  2WVM A;  1S4N A;  3BXY A;  1JV1 A;  4Y6U A;  3USQ A;  2RJ0 A;  3T7N A;  4HO6 A;  4AYL A;  3FSB A;  1ZJ1 A;  3Q7U A;  3MC4 A;  3SRT A;  2VSH A;  3D5N A;  1V82 A;  3BSW A;  3D98 A;  1VPA A;  1ZI1 A;  5DDT A;  5C1L A;  2JF3 A;  2XWN A;  1NF5 B;  1O7Q A;  3D8V A;  2RIX A;  4MZU A;  5EJ1 A;  3U0X A;  1QRL A;  2JCL A;  4ARW A;  2BO6 A;  2RJ1 A;  3DUV A;  1H5R B;  1S4O A;  4EEG A;  4R37 A;  4GBP A;  3EH0 A;  1R80 A;  2V0J A;  2X60 A;  1ZI5 A;  2YES A;  3OTZ A;  4FRA A;  3EEV A;  4KC1 A;  4D11 A;  3CKN A;  1KHR A;  3P1B A;  1ZJ3 A;  4FRL A;  4EAA A;  2AGD A;  3RMV A;  1QWJ A;  4EE3 A;  2VK9 A;  1NHE B;  3JTJ A;  3F1X A;  5C47 A;  2VHE A;  3OKR A;  3I0L A;  4HG6 A;  3BRK X;  3ST8 A;  3Q80 A;  3O3P A;  5FU0 A;  5DG3 A;  1H4E A;  1ZIZ A;  3V0N A;  1R7Y A;  2OI7 A;  2BO7 A;  3OAM A;  1INJ A;  2C0N A;  1TDT A;  4EQY A;  1G8O A;  3VBP A;  4P02 A;  4YS8 A;  1FO9 A;  4FRD A;  5C4C A;  4N69 A;  1FG5 N;  3EE5 A;  2QH5 A;  2GGO A;  1OMZ A;  1JV3 A;  3DK5 A;  1GWV A;  2QIA A;  1SSM A;  4N27 A;  3IOI A;  1LXA A;  3BCV A;  2IU9 A;  3FTT A;  1MP5 A;  4B2W A;  1QG8 A;  1VZU A;  4IRP A;  4HO4 A;  3I0F A;  2D7I A;  4B5B A;  4Y7T A;  4HCQ A;  1G3L A;  1LL3 A;  3JUK A;  4MIX A;  5FTS A;  1MRL A;  4HO0 A;  4FRQ A;  2JF2 A;  2AQ9 A;  2ZU7 A;  3USR A;  2WAW A;  1G1L A;  3JUJ A;  3VNP A;  5ADX U;  2CU2 A;  5AJO A;  5DDV A;  1KK5 A;  2Z86 A;  3I0J A;  3SXE A;  5CQL X;  4BQH A;  4KXO A;  3RMW A;  3CKO A;  3FWW A;  3Q4S A;  3GUE A;  1H5S B;  1VGZ A;  4EE4 A;  1EZI A;  2X5S A;  3V8Z A;  4C2S A;  1ZJ2 A;  1FWY A;  1ZHJ A;  1TW1 A;  4HZC A;  2W0W A;  4EA7 A;  2AEC A;  4AA7 A;  3GOS A;  4CJB A;  3R3R A;  1ZDF A;  4B4B A;  1SST A;  5CMI A;  5FV9 A;  3ZGG A;  4HUR A;  1HJJ A;  1KK4 A;  1I52 A;  4Y6N A;  2YQS A;  3KWC A;  1HM9 A;  3OUP A;  3SXC A;  1HM8 A;  1ZI4 A;  1OQM B;  4AC3 A;  1KGQ A;  4DE7 A;  4EGG A;  4MND A;  3V0O A;  1LVW A;  1SSQ A;  2OEF A;  2ZU8 A;  1FXJ A;  4M98 A;  4EEO A;  5J49 A;  1MR9 A;  5C3A A;  3TIS A;  3F1Y A;  1QRM A;  4NAL A;  1H7G A;  3U2T A;  2YCM A;  2QIV X;  1FZW A;  3R2W A;  4K6R A;  1IIM A;  4CVH A;  5C49 A;  4Y7U A;  1VH3 A;  1INI A;  3PNN A;  5F42 A;  1H5S C;  1K4V A;  4FRP A;  2I5E A;  3I0C A;  2Y4K A;  1O7O A;  1H5R A;  1LZ7 A;  2I7B A;  4HO9 A;  4HO3 A;  4HZD A;  4HUS A;  4KC2 A;  2V0L A;  3HJJ A;  4G3Q A;  3TK8 A;  2MZB A;  2WE9 A;  1O0R A;  1YP4 A;  1GQC A;  1H7H A;  2Y4L A;  3VBN A;  3SX3 A;  5C4F A;  1KQA A;  4L41 C;  3LW6 A;  1TZF A;  3DJ4 A;  4G3P A;  1ZCU A;  4LW3 A;  1HV9 A;  2Y6P A;  1VGW A;  1VZX A;  3IOJ A;  3R1W A;  1GX4 A;  1Z90 A;  3VBJ A;  5CQP A;  4UEG A;  4E75 A;  3HSQ A;  3E26 A;  1VGU A;  3BSS A;  5L6S A;  2AH9 A;  3OGZ A;  1ZJO A;  2RJ9 A;  1WT3 A;  3SXD A;  3TIO A;  1G0R A;  4KT7 A;  3OW5 A;  3QVB A;  4EEM A;  4B4M A;  1THJ A;  1MC3 A;  4D0Z A;  2VD4 A;  3HL3 A;  3R8Y A;  2APC A;  1KRR A;  3R5D A;  3I0H A;  1FGX A;  3TDT A;  1ZCT A;  1G2V A;  1VGT A;  4FIY A;  4ASY A;  1LZ0 A;  1NQI B;  3V91 A;  4Y7V A;  5C38 A;  5CMJ A;  2P72 A;  4EAB A;  2VS5 A;  3ECT A;  1FOA A;  3K8D A;  3CGX A;  1PZT A;  3KIA A;  3IOH A;  3GVD A;  2XMH A;  2Z87 A;  3OU9 A;  4G3S A;  3U2W A;  4FCU A;  4J18 A;  2RJ5 A;  3CKJ A;  2RIJ A;  2P2O A;  1KRV A;  2E3D A;  2XAT A;  1GQ9 A;  1VZT A;  3T57 A;  2X5Z A;  1VH1 A;  2WLF A;  3POL A;  5C1G A;  1JYK A;  2D7R A;  2BO4 A;  1H5S A;  2PX7 A;  4O6M A;  3I3A A;  1KK6 A;  4FQW A;  4EEA A;  3EG4 A;  2O1F A;  5C4B A;  2AES A;  3Q1X A;  3OH4 A;  4KNR A;  2JCK A;  3ZLK A;  2P73 A;  4DEC A;  1GA8 A;  2P6W A;  4KPZ A;  3PKP A;  3SPT A;  5U2K A;  4BMA A;  4JD0 A;  4CJ8 A;  5FTV A;  4D0T A;  4J09 A;  4AYJ A;  1H4C A;  2JCO A;  3OH0 A;  1S80 A;  4DDZ A;  4Y7G A;  3KWD A;  4CJC A;  3VBM A;  4EVW A;  1FGG A;  1NMM B;  4R36 A;  1WT1 A;  1EYR A;  2VS4 A;  2WVL A;  2WLG A;  2RJ7 A;  4ZDQ A;  2YQC A;  1XHD A;  2AE7 A;  1WVC A;  4Y62 A;  5D91 A;  5EJZ A;  1LL2 A;  1QGQ A;  5AJN A;  3P47 A;  3VBK A;  4EE5 A;  5BXC A;  3TWD A;  3R5B A;  2OI5 A;  2O1G A;  1R82 A;  4ISX A;  1H5S D;  3ZF8 A;  3K8E A;  3BFP A;  1H5T B;  2FY7 A;  3U2U A;  4M2A A;  3V4E A;  5ADX V;  1E5K A;  1LL0 A;  4E6T A;  2W0V A;  1MP3 A;  4E79 A;  4G87 A;  1WT0 A;  4XWI A;  3V0Q A;  4HO5 A;  5IDT A;  1H3M A;  1LZJ A;  3FSX A;  3CKQ A;  2QGI A;  3SXB A;  1FR8 A;  2A8W A;  3ZLL A;  1ZCY A;  3E25 A;  1YRO B;  2FYC B;  5E3Q A;  4FRM A;  4EA9 A;  5E3P A;  3I0E A;  1J2Z A;  3T7O A;  4P00 A;  2WVK A;  4M9C A;  1R7T A;  4MFG A;  2Y4M A;  5CQM X;  3TZT A;  2V0I A;  3N9W A;  3NGW A;  1QGS A;  5C36 A;  3R5C A;  3V0L A;  5I1F A;  4NAN A;  1W57 A;  4Q7C A;  3I3X A;  2VXL A;  3SX8 A;  2ZU9 A;  2D0J A;  3KWE A;  4E1K A;  2AM4 A;  1W55 A;  2BO8 A;  2UX8 A;  2DPW A;  3F1C A;  5DEP A;  2WGZ A;  4ASJ A;  4D48 A;  1KRU A;  3FSY A;  3PMO A;  4IHG A;  2J0B A;  3NZ2 A;  3I0I X;  2PGY A;  3IXC A;  2IU8 A;  3VBI A;  4M4K A;  3FSC A;  2A8U A;  2VS3 A;  1H7E A;  2AM3 A;  4FRE A;  1FR9 A;  2GGQ A;  4FIX A;  4HO2 A;  4NAI A;  1JVG A;  2WLC A;  2J0A A;  4MYB A;  4FCE A;  4IRQ A;  3OH1 A;  1JYL A;  2RJ4 A;  3SXG A;  3FS8 A;  3SXA A;  4N6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...