5L6WC

Structure of the limk1-atpgammas-cfl1 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
ACGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Of the LIMK1-ATPgammaS-CFL1 Complex
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords LIM domain kinase 1
total genus 43
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 5l6wC00
2FGHA 3FFNA 1WM4A 2W0IA 1T44G 3CJCG 1QPVA 2FH2A 3EGDA 2NUPB 2FH1A 2VILA 5DD2A 1P8XA 3EH1A 2LJ8A 1C0GS 5KYWB 2NUTB 3EG9A 4KEDA 3EGXB 1VKKA 4CBUG 1WNJA 5HVKD 1CNUA 5IVUA 2FF6G 1PD1A 1CFYA 3EGDB 5FAFA 3L50A 5FAEA 1YVNG 1HQZ1 1TMWA 1PCXA 1COFA 3CI5G 3EGXA 1SVYA 1UDMA 5A1MA 4LIZA 3EG9B 1T3YA 1NPHA 2KVKA 1T3XA 2XF1A 1DEJS 5KYWA 2L72A 4Z94G 5L6WC 2NUPA 1RGIG 1NMDG 1M2OA 1AK7A 1D0NA 4KEFA 1C0FS 1PD0A 1X67A 1F7SA 4S10C 3FG6A 3EFOB 4JD2H 5KYNA 2NUTA 2LXXA 3TU5B 2MV2A 5KYYB 2XFAA 1P8ZG 1NM1G 2I2QA 1ESVS 1D4XG 4KEEA 1JHWA 1KCQA 4PKGG 3FG7A 1T2LA 5KYUA 1WFSA 3A5LS 2FH4A 2QTVA 1M2VB 3A5OS 2FF3A 1SVQA 2FH3A 4PKHB 1NLVG 5KYXA 1H1VG 3A5NS 4CBXG 3A5MS 1V6FA 2MP4A 1EQYS 3CJBG 5KYUB 1J72A 1SVRA 3CIPG 4BEX1 1YAGG 3DAWB 1AK6A 4CBWG 1Q8XA 3EH2A 1VFQA 4PKIG 2HD7A 5HVKB 3EFOA 1M4JA 2MOTA 1AHQA 3Q2BA 5KYYA 2VIKA 1M2VA 1Q8GA 3FFKA 5KYXB 2LLFA 2VACA 1MDUA 1TVJA 2D8BA
chains in the Genus database with same CATH superfamily
2FGHA 3FFNA 1WM4A 2W0IA 1T44G 3CJCG 1QPVA 2FH2A 3EGDA 2NUPB 2FH1A 2VILA 5DD2A 1P8XA 3EH1A 2LJ8A 1C0GS 5KYWB 2NUTB 3EG9A 4KEDA 3EGXB 1VKKA 4CBUG 1WNJA 5HVKD 1CNUA 5IVUA 2FF6G 1PD1A 1CFYA 3EGDB 5FAFA 3L50A 5FAEA 1YVNG 1HQZ1 1TMWA 1PCXA 1COFA 3CI5G 3EGXA 1SVYA 1UDMA 5A1MA 4LIZA 3EG9B 1T3YA 1NPHA 2KVKA 1T3XA 2XF1A 1DEJS 5KYWA 2L72A 4Z94G 5L6WC 2NUPA 1RGIG 1NMDG 1M2OA 1AK7A 1D0NA 4KEFA 1C0FS 1PD0A 1X67A 1F7SA 4S10C 3FG6A 3EFOB 4JD2H 5KYNA 2NUTA 2LXXA 3TU5B 2MV2A 5KYYB 2XFAA 1P8ZG 1NM1G 2I2QA 1ESVS 1D4XG 4KEEA 1JHWA 1KCQA 4PKGG 3FG7A 1T2LA 5KYUA 1WFSA 3A5LS 2FH4A 2QTVA 1M2VB 3A5OS 2FF3A 1SVQA 2FH3A 4PKHB 1NLVG 5KYXA 1H1VG 3A5NS 4CBXG 3A5MS 1V6FA 2MP4A 1EQYS 3CJBG 5KYUB 1J72A 1SVRA 3CIPG 3DA7A 4BEX1 1YAGG 3DAWB 1AK6A 4CBWG 1Q8XA 3EH2A 1VFQA 4PKIG 2HD7A 5HVKB 3EFOA 1M4JA 2MOTA 1AHQA 3Q2BA 5KYYA 2VIKA 1M2VA 1Q8GA 3FFKA 5KYXB 2LLFA 2VACA 1MDUA 1TVJA 2D8BA
chains in the Genus database with same CATH topology
2FGHA 3FFNA 1WM4A 2W0IA 1T44G 3CJCG 1QPVA 2FH2A 3EGDA 2NUPB 2FH1A 2VILA 5DD2A 1P8XA 3EH1A 2LJ8A 1C0GS 5KYWB 2NUTB 3EG9A 4KEDA 3EGXB 1VKKA 4CBUG 1WNJA 5HVKD 1CNUA 5IVUA 2FF6G 1PD1A 1CFYA 3EGDB 5FAFA 3L50A 5FAEA 1YVNG 1HQZ1 1TMWA 1PCXA 1COFA 3CI5G 3EGXA 1SVYA 1UDMA 5A1MA 4LIZA 3EG9B 1T3YA 1NPHA 2KVKA 1T3XA 2XF1A 1DEJS 5KYWA 2L72A 4Z94G 5L6WC 2NUPA 1RGIG 1NMDG 1M2OA 1AK7A 1D0NA 4KEFA 1C0FS 1PD0A 1X67A 1F7SA 4S10C 3FG6A 3EFOB 4JD2H 5KYNA 2NUTA 2LXXA 3TU5B 2MV2A 5KYYB 2XFAA 1P8ZG 1NM1G 2I2QA 1ESVS 1D4XG 4KEEA 1JHWA 1KCQA 4PKGG 3FG7A 1T2LA 5KYUA 1WFSA 3A5LS 2FH4A 2QTVA 1M2VB 3A5OS 2FF3A 1SVQA 2FH3A 4PKHB 1NLVG 5KYXA 1H1VG 3A5NS 4CBXG 3A5MS 1V6FA 2MP4A 1EQYS 3CJBG 5KYUB 1J72A 1SVRA 3CIPG 3DA7A 4BEX1 1YAGG 3DAWB 1AK6A 4CBWG 1Q8XA 3EH2A 1VFQA 4PKIG 2HD7A 5HVKB 3EFOA 1M4JA 2MOTA 1AHQA 3Q2BA 5KYYA 2VIKA 1M2VA 1Q8GA 3FFKA 5KYXB 2LLFA 2VACA 1MDUA 1TVJA 2D8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FGH A;  3FFN A;  1WM4 A;  2W0I A;  1T44 G;  3CJC G;  1QPV A;  2FH2 A;  3EGD A;  2NUP B;  2FH1 A;  2VIL A;  5DD2 A;  1P8X A;  3EH1 A;  2LJ8 A;  1C0G S;  5KYW B;  2NUT B;  3EG9 A;  4KED A;  3EGX B;  1VKK A;  4CBU G;  1WNJ A;  5HVK D;  1CNU A;  5IVU A;  2FF6 G;  1PD1 A;  1CFY A;  3EGD B;  5FAF A;  3L50 A;  5FAE A;  1YVN G;  1HQZ 1;  1TMW A;  1PCX A;  1COF A;  3CI5 G;  3EGX A;  1SVY A;  1UDM A;  5A1M A;  4LIZ A;  3EG9 B;  1T3Y A;  1NPH A;  2KVK A;  1T3X A;  2XF1 A;  1DEJ S;  5KYW A;  2L72 A;  4Z94 G;  5L6W C;  2NUP A;  1RGI G;  1NMD G;  1M2O A;  1AK7 A;  1D0N A;  4KEF A;  1C0F S;  1PD0 A;  1X67 A;  1F7S A;  4S10 C;  3FG6 A;  3EFO B;  4JD2 H;  5KYN A;  2NUT A;  2LXX A;  3TU5 B;  2MV2 A;  5KYY B;  2XFA A;  1P8Z G;  1NM1 G;  2I2Q A;  1ESV S;  1D4X G;  4KEE A;  1JHW A;  1KCQ A;  4PKG G;  3FG7 A;  1T2L A;  5KYU A;  1WFS A;  3A5L S;  2FH4 A;  2QTV A;  1M2V B;  3A5O S;  2FF3 A;  1SVQ A;  2FH3 A;  4PKH B;  1NLV G;  5KYX A;  1H1V G;  3A5N S;  4CBX G;  3A5M S;  1V6F A;  2MP4 A;  1EQY S;  3CJB G;  5KYU B;  1J72 A;  1SVR A;  3CIP G;  4BEX 1;  1YAG G;  3DAW B;  1AK6 A;  4CBW G;  1Q8X A;  3EH2 A;  1VFQ A;  4PKI G;  2HD7 A;  5HVK B;  3EFO A;  1M4J A;  2MOT A;  1AHQ A;  3Q2B A;  5KYY A;  2VIK A;  1M2V A;  1Q8G A;  3FFK A;  5KYX B;  2LLF A;  2VAC A;  1MDU A;  1TVJ A;  2D8B A; 
#chains in the Genus database with same CATH topology
 2FGH A;  3FFN A;  1WM4 A;  2W0I A;  1T44 G;  3CJC G;  1QPV A;  2FH2 A;  3EGD A;  2NUP B;  2FH1 A;  2VIL A;  5DD2 A;  1P8X A;  3EH1 A;  2LJ8 A;  1C0G S;  5KYW B;  2NUT B;  3EG9 A;  4KED A;  3EGX B;  1VKK A;  4CBU G;  1WNJ A;  5HVK D;  1CNU A;  5IVU A;  2FF6 G;  1PD1 A;  1CFY A;  3EGD B;  5FAF A;  3L50 A;  5FAE A;  1YVN G;  1HQZ 1;  1TMW A;  1PCX A;  1COF A;  3CI5 G;  3EGX A;  1SVY A;  1UDM A;  5A1M A;  4LIZ A;  3EG9 B;  1T3Y A;  1NPH A;  2KVK A;  1T3X A;  2XF1 A;  1DEJ S;  5KYW A;  2L72 A;  4Z94 G;  5L6W C;  2NUP A;  1RGI G;  1NMD G;  1M2O A;  1AK7 A;  1D0N A;  4KEF A;  1C0F S;  1PD0 A;  1X67 A;  1F7S A;  4S10 C;  3FG6 A;  3EFO B;  4JD2 H;  5KYN A;  2NUT A;  2LXX A;  3TU5 B;  2MV2 A;  5KYY B;  2XFA A;  1P8Z G;  1NM1 G;  2I2Q A;  1ESV S;  1D4X G;  4KEE A;  1JHW A;  1KCQ A;  4PKG G;  3FG7 A;  1T2L A;  5KYU A;  1WFS A;  3A5L S;  2FH4 A;  2QTV A;  1M2V B;  3A5O S;  2FF3 A;  1SVQ A;  2FH3 A;  4PKH B;  1NLV G;  5KYX A;  1H1V G;  3A5N S;  4CBX G;  3A5M S;  1V6F A;  2MP4 A;  1EQY S;  3CJB G;  5KYU B;  1J72 A;  1SVR A;  3CIP G;  3DA7 A;  4BEX 1;  1YAG G;  3DAW B;  1AK6 A;  4CBW G;  1Q8X A;  3EH2 A;  1VFQ A;  4PKI G;  2HD7 A;  5HVK B;  3EFO A;  1M4J A;  2MOT A;  1AHQ A;  3Q2B A;  5KYY A;  2VIK A;  1M2V A;  1Q8G A;  3FFK A;  5KYX B;  2LLF A;  2VAC A;  1MDU A;  1TVJ A;  2D8B A; 
#chains in the Genus database with same CATH homology
 2FGH A;  3FFN A;  1WM4 A;  2W0I A;  1T44 G;  3CJC G;  1QPV A;  2FH2 A;  3EGD A;  2NUP B;  2FH1 A;  2VIL A;  5DD2 A;  1P8X A;  3EH1 A;  2LJ8 A;  1C0G S;  5KYW B;  2NUT B;  3EG9 A;  4KED A;  3EGX B;  1VKK A;  4CBU G;  1WNJ A;  5HVK D;  1CNU A;  5IVU A;  2FF6 G;  1PD1 A;  1CFY A;  3EGD B;  5FAF A;  3L50 A;  5FAE A;  1YVN G;  1HQZ 1;  1TMW A;  1PCX A;  1COF A;  3CI5 G;  3EGX A;  1SVY A;  1UDM A;  5A1M A;  4LIZ A;  3EG9 B;  1T3Y A;  1NPH A;  2KVK A;  1T3X A;  2XF1 A;  1DEJ S;  5KYW A;  2L72 A;  4Z94 G;  5L6W C;  2NUP A;  1RGI G;  1NMD G;  1M2O A;  1AK7 A;  1D0N A;  4KEF A;  1C0F S;  1PD0 A;  1X67 A;  1F7S A;  4S10 C;  3FG6 A;  3EFO B;  4JD2 H;  5KYN A;  2NUT A;  2LXX A;  3TU5 B;  2MV2 A;  5KYY B;  2XFA A;  1P8Z G;  1NM1 G;  2I2Q A;  1ESV S;  1D4X G;  4KEE A;  1JHW A;  1KCQ A;  4PKG G;  3FG7 A;  1T2L A;  5KYU A;  1WFS A;  3A5L S;  2FH4 A;  2QTV A;  1M2V B;  3A5O S;  2FF3 A;  1SVQ A;  2FH3 A;  4PKH B;  1NLV G;  5KYX A;  1H1V G;  3A5N S;  4CBX G;  3A5M S;  1V6F A;  2MP4 A;  1EQY S;  3CJB G;  5KYU B;  1J72 A;  1SVR A;  3CIP G;  3DA7 A;  4BEX 1;  1YAG G;  3DAW B;  1AK6 A;  4CBW G;  1Q8X A;  3EH2 A;  1VFQ A;  4PKI G;  2HD7 A;  5HVK B;  3EFO A;  1M4J A;  2MOT A;  1AHQ A;  3Q2B A;  5KYY A;  2VIK A;  1M2V A;  1Q8G A;  3FFK A;  5KYX B;  2LLF A;  2VAC A;  1MDU A;  1TVJ A;  2D8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...