5L6YH

Il13 in complex with tralokinumab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
237
structure length
232
Chain Sequence
b'VQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNYGQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTVSSASTKGPSVFPLAPISKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVGPSQTYICNVNHKPSNTKVDKRVESKYGPPSPSSPAPAKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-13
publication title Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 232
sequence length 237
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yH01
4Y5XB 3KLDA 4FZ8H 4XPTL 2A74B 2BERA 4PJAE 1A2YA 3HFML 3G9AB 4U3CA 5T1KA 3WFBH 4LDEB 1CICC 3JWDL 3DWTA 5DK2B 1CQYA 3H9HA 3VFTA 4KROC 4RX4A 1XF5A 3K46A 4LSQL 3MLVL 1MIEH 3C2AH 1QR1A 2IGFL 2Q3ZA 4EUPG 5E9DE 5EU6E 4P3WA 1U92B 1C1EH 1X44A 3WNLA 3V4UH 4ESKA 4HIXL 4JDZA 4P57A 1RULL 5GZNC 3S88H 3GNML 2H41A 2FZ3A 3P9MB 4OFIA 1JZ3A 1YEDA 2EXYD 1NAMA 1KNOA 4KI5E 1RJZB 3C87A 4IS6B 1DVFD 1Q9LA 4PP1D 3BRGC 3EDFA 2UZIL 5EU5B 1LHZA 3GK8L 1RUQH 1F45A 2NY3C 4XCFL 5DQ9B 1CLOH 3MLWL 1MJ7H 2AJ3B 2DAVA 3MLSL 4MLIA 2GQHA 3BYYA 1KB5B 3DGGA 1U91B 1EJ6A 3FZUD 3RNKA 2MPAH 3BQUC 3QH3A 3MBED 3T2PA 5GSRB 5AG8A 5I9QB 2R56H 1JNNH 1WFUA 2D31B 1XGYL 2NZ9C 3EJYC 3KXFA 2BC4B 2H9GB 1G6RB 5KSBB 3SDYL 3ZKMD 4NOBA 2WIIA 2BSTA 4YDIH 4M3JA 4H1LA 3AY4C 2EYSA 5C0DA 4BUHA 1G1YA 3JVGC 3LKRB 3QDJB 3O6FA 3LKNA 3PWVB 5DHVH 2PUQT 4OBSA 5D2LA 5LAXB 4JCMA 4MXVE 2HT2D 3VFPB 1OGTB 1S9VA 1OP5K 4U2YA 5FDWA 3VA6A 3L95A 3RA7H 4PR5A 4EVNB 3CLEH 5FYKU 2ADIA 3PL6D 1T21A 3VWKD 4WTZG 4Y5VC 1MHHA 3UTTB 4TSCL 4M48H 2PETA 2A1WH 4KHXH 3BZFB 3C6LC 1EXUA 4YK4C 1EHLL 3O81A 5EOCL 1T1XB 1DDHA 2Q8AL 4DKAA 4L8SA 3MA9L 1WF5A 4RFEA 4LU5H 4ZUTB 4OLWH 3CD4A 4NRZA 1WAAF 2I07B 5ANMB 5I8OL 2HJKB 2VDLH 4ENEC 3GSNB 4R26H 1CFNB 5HJ3A 4P9HC 5IQ9B 3PGCA 4MA1C 3IETB 1BJ8A 1YNLL 1L0YA 1JHKL 1JL8A 3MRPA 3ARBC 3TVMA 3QG6B 1IAIL 2VZOA 3LB6D 1YN7A 4GQ9H 1WZLA 5I8CB 1F5WA 3IKCB 3V6ZA 1TCMA 3DV4B 3LQAL 4QWWC 4AEEA 5EU3A 1F58H 1U58A 3BO8A 4HXAH 4NQCE 2V2XA 5E0QA 2E7LC 5DI8B 3W81A 1E4JA 1MFCH 2OLDA 1XCTB 4PTTB 4YAQB 4OCWH 5A2FA 1IGJA 2MMXA 4OLZH 2VLJA 1PG7L 4R2GC 4XZUA 1CU4H 3QA3B 4HG4K 2C4FU 4YUEL 2ATKA 1A14H 4FXGA 4U1GC 3DNKA 3MRJA 3N1PC 3UTQA 4QNPF 2EECA 3RJDA 3V9FA 1J1PL 3TH4T 2HJLB 4I3RL 4LF3A 3BPNB 1YMHA 1KTDA 1EO5A 4WFGE 1U8QA 1W72L 2OJZL 3BIAX 4OCSH 5ID1A 4X99B 1TJIH 1GZPA 3EOAB 1ZHLB 4LPYA 4Y4FA 1OCWL 3V2AR 2JCCB 4ONFL 1KCUH 3HNTL 4Q9CA 4RRPA 2RHEA 3FT3B 3S5LA 5C0IB 2CDEA 1AP2A 2OMBA 3MRRA 3RWFA 2CO6B 2V17H 2IBZX 4R4FL 5DSCA 4YWGH 1H0DA 4Z8FH 2WINA 4YDVB 1MCPL 3QXUA 5D1ZB 4MHHG 2DM4A 4IDLA 3EO9H 4IMKA 2YK1L 2YPLE 3Q0HA 3L1OL 5SWSB 4F9LA 2X70A 2X42A 3ZTJH 3UDWA 1SMOA 3V5DA 3EIFA 5C0FA 5KTEH 1IL1B 5EIVA 3LS5H 3MYJA 3BJLA 4ZFOA 5DRZB 3QAZC 4PJEF 1KSRA 2LU3A 1KJVA 5EUKB 4TVPH 5AAMA 1CD9B 4OGAC 1FDLL 2MNUA 3ESVF 1Z9OA 3ILQC 4PB0L 5FYLL 1T89C 4CU8A 3SE3A 3C8HA 3MODL 4K07A 4R4BB 3U36B 3HB3D 1UYWL 3QUZB 2QSCL 4DVBA 2DQJH 5BS0A 2VB5A 3QIBB 1ZS8A 3L5XL 1TZGH 2BVEA 2P7TA 2CMRL 4F7EB 2IQ9L 2YUZA 3HE6A 3S9DB 1KELH 4N0FA 2F54D 1S5IL 1BIIB 1CIDA 5HDOA 4U2ZA 5M95B 1NGZA 3F7QA 4HIEB 3RWEA 3TCLB 5DHVA 5T3ZD 3ULVL 2QR0A 1FSKC 5FK9A 1AJ7L 1C7SA 2DYPA 3MUGB 3EJJX 1FVCA 2KH2B 3UYOD 2NY7H 2W9LA 2GJ6E 2HN7B 4D3CL 5F1KC 3TLRA 3PWPA 2P8LA 4XWGL 4NWTL 4UUJA 1HCFX 2AABL 3SKMA 1T0PB 4C54A 3QP3A 3FCTB 3MR9A 1A22B 1FC2D 2R9HD 3B9KD 5CP3A 4ETQA 3ARXA 1MVFA 3BDYL 5FO9A 1MRCL 1WWBX 1PY9A 1KLUB 2G5RA 1JPST 1DUYA 3FZUC 3WSQL 3PQYB 3MBEC 5IVNA 3S3JA 2HFGL 1SY6H 2IANB 4XPAH 5CUSH 1UB6B 3MLTA 3BHBA 4MD4A 4RISH 1BZ9B 1BFSA 2OI9C 3ARDC 4H26B 3I84A 3RGVA 4HIJB 5FGRA 2Z4QA 4HULB 5J6GB 2EDWA 2EEBA 4LDOB 3BWAA 1QRKA 4XNYH 5B21A 2A38A 5DZNA 1WC7B 4MX7B 4RWYL 4PLNC 1YDPA 3SGKC 3I6GB 1I1AD 2JIXA 3LPWA 3MJ6A 5FAAA 3M45A 4BFIA 5KN5B 1A7OL 4FQXD 5JDSB 4Y16A 4ZPTB 3DOSA 5B3JE 3HPLB 2ZCKH 3CSGA 1RZFH 1G9NC 1KJ2B 4WHYG 4P2OB 3S34H 3VWKC 5ESVB 4ZO7A 3VFUB 2F19H 4OLUH 4PS4L 3IDXL 5F88A 2ARJQ 1ZLUH 2NY0B 3U4AA 1GSMA 1U3ZA 5AUMB 2APXA 5E2TL 1QBML 1RMFL 1NMBL 1PAMA 1WAAE 5KS9A 2P5EB 1FZJA 5F3HB 1EBAA 5ILTH 4WO4D 4GKOA 3FKUS 2QQKH 1XR9A 4PJ8B 2OR9H 4IEFB 1JGDB 2R1WB 3W11D 3K74B 2FR4A 4PRIA 4MQXD 2DLFH 4PLKD 3M17B 1G7HA 3HC4H 5HGAB 4QXUH 3C6SA 1IKFL 3UTPD 3SKOA 1X5AA 1S7TA 2DQUH 4EKXA 1I1RA 3RY6A 3HE7A 3QCTH 3ZSTA 3ZT5A 1OAUH 1SJHB 3D85A 4DUXA 3HZMB 4J6RH 3VGBA 3IXAA 3LS4H 1NMCC 3VXMB 4OGYL 1WIPA 5AYUH 5ICZA 3AB0B 4HK0A 2HKFL 1QHOA 1P4IL 5CIPH 2XXMB 2UYLB 1Z6JT 2ZCLL 4BH8A 2CQVA 3NFPA 1FFPB 1U8PB 4NBXB 4L1DA 1QBLL 3WUZA 1ZT4A 3OHXB 3JWOH 1JTPA 3I2CL 5E56A 1ZWIA 3PV7A 4Q6IC 2E7HA 4NQED 4IDJH 5I1GL 1ZHKB 5C6PB 3FN0H 1PX3A 3QJFB 4KHTH 4KAQL 5CZKA 1N5AB 5KANI 2Y5EA 3BN9D 1D5MB 4OF8A 1ZK9A 2OZ4L 3O8XB 4DKEL 3LEXA 3IKKA 1P69B 1O7SA 5I1HL 1W2KT 4GMTH 5E5UB 5F21B 1BVLB 4HIHA 3H3KA 3P4NB 1I7RB 1L0QA 1P7KA 3EOTL 2Y23A 3SGJC 1XGQB 4GRLB 5HXMA 4HT1H 1KJ3L 1B6DA 4GW1A 4D8PB 3SO3B 2W59A 5EBLA 5CAYB 5E8NA 4Q97A 2IPKB 4DZ8B 5KSAB 1M6OB 3X3GH 4PYHA 1LQSR 5D70H 4AIZB 4Y2DD 3KPRB 3BP7B 4PJEE 5HPOA 4AL8H 5IB3A 4ZTPH 1W0VA 2YR3A 3O0RH 5J12C 4I4WA 1PQZB 4YGVB 5DT1H 3SKNB 4JN2A 4V2BA 1QNZL 3A67H 1G9MH 3V7AE 1Q94A 3X3FL 4GAJL 3T4AA 1SY6A 2A83A 3C09B 4WW1B 4Y4KA 3BKMH 5ITFA 2GT9A 2EZ0D 1CK0H 2B1AL 4YHIA 2P4AB 4EEEA 5IFAL 4R3SA 3G04A 4QRPB 2HJFA 3LSOB 4OZFB 2RR3A 2YD7A 3RPKA 3DUSA 1YJDC 1QKZH 2FEDD 4XB8A 4AEHH 5DVNA 3HRZA 1A21A 3QNZA 4ZAKA 1SVCP 3TJEL 5LCVL 2F15A 3D0VA 3MRBB 1ZANH 4MQ7A 4P2RD 1IGFL 3LZFH 4CBPA 1JPFA 5FM4A 3RDTB 4PJCF 2R0WH 3FQUB 3U82B 3QNYA 2R29H 4LAQL 3WMSA 1FBIH 1QQDB 2R9HC 1KGCE 1Q72L 2DL9A 3BKCH 4FTVB 3OZ9H 1FZMA 1YECH 4NJ9L 3KPSA 3WJLC 3FOLA 3IU4H 1BLNB 1G7QA 4E5XA 5T1DH 5I1AA 3EOBA 4GW5B 3OKLA 2QSVA 4NQSB 4UU9B 3RZCA 1S7XB 1R3JA 3MV9A 4HKXB 4MJIE 1CG9A 2VQTA 4I0PA 4EXPX 4KDVA 5I2IA 4ZOEA 4N1EA 5DC0A 1CT8A 4MAYB 2JLLA 3MC0A 1SM3H 5TPWH 5MERB 4X6CB 4HUKB 4WV1A 1UC6A 3U7YH 1N6QL 1IKNA 5BW7C 3A6BH 4R4ND 4ODTH 4OUUA 5HY9A 4JRXD 4MVBD 4XNMB 4G6JL 3ZHDA 1QD0A 1KUMA 4LSPL 3ZKXC 3EAKA 1U95B 3X11B 4FQXC 1BM3L 3VJ6A 5K9JL 1IQWL 1B6UA 1J0KA 3L7EA 4D9QD 1IGTB 1V7MH 5DJAA 1GIGH 1MHEA 2VWEE 3RWJA 5T1LB 1ES0A 1WVZA 3EYUL 3DUUB 4MAUH 3U6RB 3FQXB 3KYOA 5CIPA 3WDHA 4QHNB 2W07A 3L3JB 3BEVA 4XMLL 5D7LB 3VG0H 3Q6GL 4HKJB 4X9IA 3NZHL 3LRSA 4YFLF 3EOYG 1U93A 5SWQA 3UMTA 4DCQA 1C12B 3NCEB 1L4IA 2BOBB 1K3ZA 1ZKAA 4MQXC 5I18H 4TUOA 5IBUB 4X7SL 1HH9A 5FO7B 1FL3A 4GS7C 3ULUF 1AGCA 5KVMC 2KQMA 1OTTD 4LASH 2G9HB 5B39G 3OPZL 2FL5A 2NCMA 4DUWA 1YMMA 3F6IA 3MUJA 2IPUK 4LSRL 3DSFL 5I8KH 3NFSH 4ACPA 3C2AL 3FN3A 3MV8D 4JM2D 4JN1H 2KZWA 1UEMA 5TGBB 2EDHA 2DRUA 4LKCB 4Y4HA 4KGJA 4FA8A 4ZDHA 4GG6F 5FHAH 4P9HH 2PTTB 4M7ZC 5FOJA 4QCIB 1I8MA 3S88L 3Q5TA 2OTWA 4JG0L 1DQMH 1WT5A 3W9EB 4PRNA 3TA3A 3FFCD 2HVKB 3P73B 1MFAH 3T65A 3NH7H 3RVTD 1CLOL 1R3LB 1MJ7L 2EXWD 5B22A 1NEZA 3HG1B 1DTUA 5FA3B 1CYGA 4YHZH 4JFHD 2NY6D 3QEUA 3PWJA 5CMAB 5F7YC 5C92A 2YUVA 5T1MA 3OX8B 3H9SE 2R56L 2PO6D 1JNNL 3P3YA 4JGUA 1N7MH 5M7QA 1FORH 3QZWA 4UV4L 5KVDH 5HYIA 3FB6B 4PJ7F 2EDFA 5LXGL 4UZGA 4PJAB 2UZYB 1UACL 4DZBB 2J8UA 2RB8A 4PY8J 4JE4B 4YDIL 4QY8B 4OGZA 4DW2L 4HKZB 4LP4A 5C0BA 2MCPL 1AE6H 3I9GH 1UZ6F 3BH9B 3DIFA 2BVQB 1O5DT 4K9EC 1CICA 4D2NA 4YPGA 2XZAL 1F6AA 1QTYT 3ARGC 1PDKA 2CSPA 4RGNC 2C7UB 3RA7L 3CLEL 5E9DB 1QFWL 3CXDH 5BJTA 2QSQA 4XPBH 1CVSC 3TBYB 3QFJA 3MA7A 3R1GL 1ADQH 3HTLX 3IFNH 3VXPB 4MCYA 4ZO6A 5EFIB 4M48L 3NPSC 3WNOA 1TVHB 2VITB 4OCXH 2A1WL 4KHXL 2EDEA 3ESUF 4WWKB 3EO1B 2IH1A 4U7KA 2VQ1A 5CHNB 4HAGA 4NNYB 4LU5L 4OLWL 1UENA 1JWMA 5ESQA 4OZ4A 1DBML 3L3GA 3CC5A 1CR9H 5GRUH 4W6WB 4X8JA 5I66A 5IQ7L 4NN7B 4OCRH 3U2SA 4CMHB 4C4KO 3P4MA 5IW1A 2FEDC 3BQUA 3V5HB 2H2SD 5CZVL 2DDQL 3WV0A 1KCLA 1FRGH 1WUNT 4F2MA 2BSED 2AV7B 1SYSB 1I8IB 4GQ9L 3EDDA 4ERSL 2ZUUA 4LQ1A 3DMMD 4JLRA 1A6VL 3EUUA 1QBAA 5J8OA 4ELKB 1F58L 3D69B 5E4EC 2P5WA 4Z76B 4NN6C 4OV6F 1UXWA 1P1ZB 2FH8A 4WEMB 4MNGE 3AY4A 1HH6A 4FABH 3JVGA 3AXLB 2AW2A 3UPCA 5IJKC 5F71A 3SDCA 4NWUL 4CVUA 4DTGH 3VGDA 4OCWL 3J7HA 4OLZL 1P9MC 2OQJB 4XAWL 3HNVH 2CUIA 5I75B 1YNTB 1CU4L 4JFEE 2Y6SC 1CE1L 1KOAA 2L7JA 1A14L 4ODUB 2VDKL 4LCWD 3ALXA 2VE6A 4G7VH 5C2BH 3K4ZA 4KK5C 1KENH 5INCA 1JNJA 1TJHH 2ADGA 4Y5VA 1NKOA 3IXTB 3WDJA 3S7GA 5F9AC 1TJIL 35C8H 3U0WH 3CK0L 4M7JH 4J8RA 5DDHA 2BY3A 3E6HA 4ZNCD 3JUYA 4GBXA 5GJSL 4X6DF 5HGDB 5B38A 3C6LA 4R4NC 2VUYA 1BHGA 5D1QB 2LFGA 1I9RL 4C58B 3DJ9A 1TDQA 4BSWA 3SGDI 1Q1JL 2ERJB 4YWGL 1JP5A 5JORA 4Z8FL 4Q9BA 3PJSA 3FRUB 1MCSA 4JO3H 2N1KA 5JO5B 4TRPH 1MRDH 3WFCL 1MCFA 5DYOB 1A6AA 1DE4B 5M94B 4OD3H 4FXLA 4NNPH 2J6EH 1EIBA 4HD9A 4Y19A 4OCMC 5E08H 4HHAB 3BGMA 4WY7L 3ARBA 3DVNA 5TQ2H 5KTEL 3DX8A 3T8XB 1E28B 1RUMH 3LS5L 4NZRH 5LGHH 3OKYA 3RVXD 4NQCB 1D5IL 3OKEB 1OD7A 3PDGA 1G9NH 4NKDB 3IAPA 4NOFA 4TVPL 1LNUB 2CJUH 1CZ8H 4ZOAA 2ZG2A 4WEUD 5DURB 7FABH 3ULUE 3UZVB 4UDUB 4NRYA 3GIZH 5FKPA 1EEYA 2NW3A 1G7PB 1AIFB 5L8KB 3MV9E 5GIRB 4N68A 2DQJL 3GSRB 1UH2A 2E9BA 5D7JB 4GG6E 1F2XK 3T0EC 4E41A 5HYSB 2YN5A 1KELL 4FG6D 4GKZA 2ED9A 2CXGA 3VD3A 4IOIB 5KSVB 1RIVH 1OF2A 4M1CC 3SDXF 5IV2B 4EXKA 5KOMC 4ALAH 2HG5A 1BP3B 2J7LA 3UAJD 1T3FB 1CD1A 3D9AL 1OWWA 1UA6L 3MX0A 1DBAL 5I1KH 5D93C 4OFDA 2FB4H 3QDJD 3D39E 5EWIH 1ZLVH 4PBWD 3KYMB 4YHNB 2YPLB 2DQFB 1VKXB 3RVTC 1BBDH 4UT9L 4J3UA 5DD3H 4OT1L 3H8NA 3GRWL 5L6YH 2C3GA 1BJ1J 3AM8A 5HGGS 2JB5H 1LEGA 1TNMA 1OAZH 4LEOB 4N90D 4CNIB 3A0OA 5GHWH 3QO1A 2XWBA 3OF6D 4PJ7E 1HHJA 5J1AB 2HLAB 3TO4B 3BD4A 4NGHH 5CUSL 1A3LL 1OSZB 3CMOL 3BPOB 3UTTD 1D5XA 3FQNA 2H6PB 2UVFA 4J3VA 4RISL 2R1YB 4ZYKA 1X5XA 4JPIB 1N59A 4RA0C 3PV6A 1AFVH 1U8KB 3VFVB 2VIRB 1UZ6E 1BWMA 4BQ8A 5MHSE 2AV1B 3WFHB 3Q6FB 5FCUH 2FJGA 1AR2A 1L7TH 4U6YB 3OR7B 1L7IH 3FQTA 1X6LA 1KPVA 4K23L 1ZMYA 1T89A 3DURA 2VXQH 3GMLA 3RP1A 3OB8A 2AKRB 5E03A 4NDMB 5IB2B 4FQ2H 5DJ8B 2X9WA 4HKBB 2B39A 3NA9L 3GSOB 1EX0A 5F7EH 1J0ZA 2GAZB 3HZKA 3QUXB 5IR1B 3W5NA 2ZCKL 2BDNH 4C4KT 5FECB 5EULV 2YZ8A 3S34L 4PJGF 3D2UA 4DN3H 1I1FA 3B3IA 4YBQD 5HDBE 1ZOXA 5GGUB 1ND0A 4LARL 4KPHL 2W0LA 3CFIC 1U8NA 2GJ6B 3P4OB 1T0NB 3QDGE 4UQ2A 2ITCB 3C60B 5EG6C 4X6BB 2WBKA 5ILTL 1DEEB 1GCFA 3QUYB 1SEBB 5L9DH 3N1MC 4MS8C 2OR9L 5CKAA 4EUPH 3OKKA 3ARZA 4KJPD 2DLFL 3F7VA 1T7VA 1JUFA 1RI8A 2PYEA 4QXUL 4WW2F 5BZDB 4XH2B 4X7TA 4YEEA 3K1KC 2I25N 4P46C 1TZHA 2W92A 4P5KA 1WQVT 3MBEA 2DQUL 2X10A 3OKOA 3KLSA 1IGIH 4C83B 1X7QB 5DRXA 4FXKB 2BVTA 2XQBH 1NDGB 3N1GC 1S3KL 3KWWA 4J6RL 3BP4A 3ARDA 3WHE0 1K3IA 3MRCA 5D9SB 5DK3A 4BZ2L 3ULVF 3FB5A 2WNGA 1K2DA 4UIMB 1YJDH 4K3EL 4MNQE 2J6EA 5T3ZH 1B2WH 3CFEB 4D9LH 1L0XA 1RK0A 1QR1B 5D1ZD 3FO2B 1DLFL 4A2LA 5KBNC 5DHXB 5C0CE 3SGKA 4FP8H 4UNTA 2VDNH 5TE4H 15C8L 1BECA 4ZFZB 5SWSD 1S7RB 1CD8A 2XKNA 3LPFA 4N9GB 4PV9B 3VWKA 1AHWC 1NAMB 1KNOB 2MHAA 5HI5D 5FGSA 1NC2B 1WFNA 4R0LC 4QXWA 4JDVA 3Q2CA 1JZ2A 3N06B 4M5ZH 1YUHA 4PJDA 3N85L 3QWQB 3ROOB 4U1LB 3FO1B 4XVTH 5I1DA 4Y5XC 2FIKB 3QQ9D 4F33B 5IG7A 4G6MH 2FSEB 4O58L 4GMTL 3R4DA 5J1TC 5SV3A 1JZ7A 1RFDH 2PXYB 5DFWH 3WIIL 1FAIH 2D7MA 2LE9A 2X44D 1WISA 3QUZD 4YXHH 4HT1L 3OAYH 2EO1A 2A0LD 3QIBD 4WU5A 2DKMA 3FQRB 4LLWA 1WWWX 4LLYB 2WIIB 2BSTB 4JVWA 3DX6A 4PP2A 2EYSB 4KJQC 4NC1C 4XAKE 5C0DB 3MLPA 2V7HB 3LRHA 3NCYS 2CDGA 1B90A 3O0RL 1CXFA 4K8RL 5TQ0L 2DMBA 1AO7E 5FDWB 1VGEH 1UCBL 4F3FA 3L95B 2GY7B 2CO7B 5J6HA 1DQTA 5C1MB 3MXWH 1KV3A 1T21B 4XHQA 3MGTA 1LO3H 2CLVA 5HGBB 4RAUA 7CGTA 3BP6A 5TDNA 3MMEB 4KVNH 5DO2C 3U9PH 3BKML 4OZFG 4Q6IA 1F4XH 3CDCA 4FQLH 5DGQA 4PBVC 1EXUB 3PQYD 3SDXE 3QXAB 3CZJA 4FG6C 4B5EA 2IAND 3KLHD 3CH1B 4L8SB 1F4WL 2E7BA 1CF8H 1XGTB 4NM4L 4H8WC 2QHRH 4S1QL 1A7QH 5I1JL 3REVB 4AEHL 4JFFA 4JKMA 2FX7H 5HJ3B 3PGCB 4NZUL 4P59H 3V0WL 3TIDA 4NQDD 1MCLA 3FHQA 4MMZC 3MRHA 4XI5C 1DQDL 1PKOA 4Y19E 1YN7B 4AZ8A 4AMKH 4JO4H 3SGJA 3KNBA 3BKCL 2YPVL 1KTLA 4KKAD 3V6ZB 3OZ9L 4JHAH 1YECL 4PJEB 4KQ4H 2OSLB 1U58B 2KDGA 1CL7L 1CTNA 2V9TA 3BO8B 1CFTA 4PJ5A 4KJYA 5AD0A 5HYQA 3AUVA 2HVJA 2F53A 4KK6C 1GAFL 1IGCH 4P2OD 5I6XB 5HDQH 3WUWG 2M8XA 4F8TA 1MH5A 5FUOH 4N9OB 2Q20A 1IGJB 3CZFB 4ONOA 4YHOL 1IEBB 4XP5H 3L5IA 3DRTB 1FZKB 2VSDA 4L8CA 3EHBD 5TPWL 5FUZH 1XH3A 4FXGB 3RWIA 1RQ5A 4EJ1C 1CFSA 1OVZA 3VXNA 3UTQB 3U7YL 3A6BL 3L7FB 4ODTL 2GW5A 4FFYL 1NL0L 4ONGH 4LF3B 4ZS7H 3WEXB 4OD1H 1U8QB 5ID1B 4E41E 3CVIH 1GZPB 4OI7A 4PJGE 2W65B 2EH7H 3GO1L 1ZLWH 3TH2T 2A9ML 4Y4FB 2R2BB 1FFOA 3GJFH 1BWWA 5HI4C 4XPGH 4M02A 5CD3A 1MLBB 4Y8DC 2Z8RA 5DUMH 4MDJA 5ERWA 3NZ8A 3K8KA 1DCLA 4K3JH 3BRFA 5FF6B 1H0DB 2WINB 3RIAF 2D9QB 4UIKL 4TPRL 3VXMD 4BFEA 3CH8A 1UH4A 2V5SA 4FMFA 4QHMA 3VG0L 3MREA 1KXTB 1KYOK 1IEAA 5ALCL 2X70B 5JZ7C 2DTSA 4JFDD 4M7LH 4Z7OF 1MAKA 3AREA 3MYJB 3MO1A 1HXYA 3O4LE 3OBAA 4R7DB 3F8UB 4POZD 5K9OA 4ZFOB 4JG1H 1GZQA 5JHDE 4YIQA 3WJLA 1MLCA 3UP1A 5HHVL 1ZGLB 4WWID 3VXRA 5C86A 4GW4A 4LASL 2HFFA 3P77A 1UT9A 1XGPA 4NC2B 5ADOH 2X9XA 3MV7A 3RKPA 1JNLH 4R8WH 3NFSL 3ULVE 5C0ND 4NUJB 3P0VL 4ZPVA 3MUY1 4X5XA 1VFMA 4DGIL 5ACZA 5LGJB 3LN5A 1H3UA 5FOBA 2X05A 4KRPD 4WFFE 5BW7A 2LQRA 3LQMA 1DQML 1EJOH 3HE6B 2PF6A 3QUMA 1JRHI 1YYMH 4YC2B 3PABB 4L5FH 2D03H 4FQIL 1KPUB 1NGZB 4FQXA 3NH7L 3QQ4B 2QR0B 5KSAD 5FK9B 1S9YA 4Z7WF 1RD6A 1FVCB 3KPRD 1JNHB 2LTQB 4U1IB 4YHZL 5L7XH 5FO8A 4GRWF 2O93L 3V6OC 3DX7A 4HW6A 1FL5B 4Q2ZB 1MFBH 5HI3D 5E2WL 2BMKA 3LMJL 1N7ML 1FORL 5KVDL 4ETQB 2XV6B 3B8YA 4L4TA 4LRNL 1IQDA 4NO3A 4S11A 3VE0A 4WJ5A 5J9PB 5JOPD 4WHYH 3QHFL 4MD5B 2N7AA 5BV7L 5FYJL 3IDIA 2AK4A 1A9EA 5F93C 3JTTB 1CVRA 32C2B 3O3DB 1IGYB 1FFRA 2DN7A 3I6LD 3RGVB 1MVUA 1T1YA 3RVUC 3ES6A 3TV3H 1ORQB 1A7RH 3BWAB 4H88H 1RZ8A 1QSZA 3DXAE 4XPBL 1Y6MR 3QULB 3IB4A 1ADQL 3MRLA 2WWMC 5GRYA 1NCAL 3QDME 4BELD 2IAMD 3F7YA 4O5LL 4CW1A 4NNXA 3CSPA 3IJHB 4CMMB 4X5WB 3RHWF 3IJSA 1U8LA 3I3DA 1RK1B 2FX9H 2BNRE 3OR6B 3ALWA 5SWZE 4FTVD 2AQ3A 3GI8L 5F88B 4LHUG 1S9KC 1A6TA 1OAXL 4NQEA 4PG9A 2DD8H 1DQQB 1CR9L 3SN6N 4MGXA 3BI9X 4OCRL 2QTEA 1FZJB 2ZUSA 5AWNH 1TTFA 2FATH 4RAVA 5C07D 1ZT1B 1T03L 5IVXF 3RTQD 5C8JB 2GSIA 4MAYD 2FR4B 4NO0A 4UINL 4UBDD 4AIXA 2DQIH 1NC4B 4MSWB 3QWOA 5IW6B 4LCCC 1GC1C 1TZIA 1S7TB 5DEGA 4GAFB 1QLEL 4R96A 3GJFA 3BZEA 2XWJA 4PYGA 3I85A 3MLZL 1RZKC 2KQNA 4YXKL 4XHJD 1JHTB 2I5YH 5TE6H 1KLFA 3IXAB 4APQB 3HNVL 3GM0A 3ARGA 1V3JA 2DQHL 4LGPB 4M8VA 4U05A 2FHCA 5TDOB 5AG9A 4UTAL 4PJIA 1IAMA 4P2OC 5HHNB 4PJBA 5T1LD 4JQXC 2XTJE 4G7VL 4JB9H 5DMGD 1CGSL 5C2BL 2E3VA 3HI6H 2NY0C 1PKQE 3EYQC 1KENL 4GKNA 43CAA 2JK5B 1TJHL 2A9NL 4BFBD 1ZT4B 2WSKA 2YA2A 3EHBC 5D7LD 4P3DB 1VFBB 5EUOF 4DAGH 3U0WL 1UKTA 4M7JL 4HFWB 3EFFA 4J3WA 1I75A 4WHDA 1Y18B 3S37X 2GK0B 4P2YA 2FJFA 4YHML 4PJ8C 2AJSL 3AROA 1C5DA 1CLYH 3NMEA 1CD0A 4JO3L 4YHLL 2C3WA 5GGQL 2DMKA 3MGOB 1WSST 3HRPA 2BSRA 5JIPA 3KPNA 3LEXB 4YXLH 3KPTA 3U0TA 4QHUA 1FQ9C 5E08L 3C2SA 3MV01 3DLQR 4HIHB 2DBLH 1YEIL 1RUML 1I4FA 4NZRL 5LGHL 1B0GA 4MNGB 2BY1A 1J8HA 2FBJL 5TFSH 2ENYA 3VFOA 4HC1H 1RZ7L 2GFBA 4RFNB 2CJUL 3SKJL 3T1WA 2Y72A 3VFNA 1BD2D 5IB3B 4XT1C 5IMKA 1E4WH 4AENB 1AR1D 1W0VB 5IJKA 5JUEH 3T1FA 4JFEB 2F53E 5F7HA 4KKLD 1JPGB 4I4WB 1P9MA 4N5EC 3D0LA 2IWGA 3UTZA 5HYSG 3O2VH 4YFEA 1NCDH 4F57H 2P24B 1NAKH 1TMCB 1FO0H 3G6AA 1P2CA 2VR5A 3EZ8A 2Z35A 3PUCA 4HJJH 3RVWD 2F5BH 4J2XA 3ZZ1A 3LN4A 4QRRA 1INQA 2UWEF 4RMVA 4HX1A 1Z0MA 5DZLA 1YPZF 3O8XC 1IGMH 2YMXH 4LSSL 4Y4KB 1RIVL 3SDAD 5ITFB 1PX4A 1CXHA 4ALAL 3DYPA 4DWHA 3LKQA 2R2HA 4YHIB 1V8HA 4WVRA 4V1DA 4LPCA 3O3AA 1EFQA 1DBBL 2CIKA 3G04B 2VSCA 1M05A 2FX8L 4Z7WE 4GRLC 1DN0B 5H37H 2YPKB 3QRFM 2BX5A 3ARYA 4MWFA 2X4SA 3VXQA 4JZOB 5KSAC 3WL9A 2VXSL 4AYFA 2XXCB 2JB5L 4HK3J 3QHTC 3S37H 1OAZL 1FIEA 5T33H 2HT4D 4XGZB 1FE8L 5E9DD 3AFLA 2BFVH 1F6LL 3HI1A 3OKMA 4TN9A 4U4BA 5D5MF 1I7TA 3STLA 2E27L 5ACMA 5BMFL 1AXSB 4NCDA 2GJZA 3I6KB 2AEIT 4KI5D 1E4KC 3FOLB 2D9CA 1MHPH 1S7VB 2M2DA 3GMQB 4MLSA 2Y4SA 4XWOD 5FCUL 2DQGH 5DQJB 4L29A 3QRGL 5JW5B 3RZCB 3DV6A 3MV9B 2VZVA 4QT5B 2DOCA 3C09C 3V0VA 3VRIB 3VXRE 3WHXB 2VXQL 2JE8A 1M7IA 3V4VH 2GUOA 4XXDA 4UV7L 3MV7E 1CT8B 4GG6B 4FQ2L 4KI1A 4X6EA 2DJUA 4XP9L 5C09A 5F7EL 3BOVA 3UPRA 5ICYA 4RFOH 5IF0A 4LHUD 1EMTH 4P49A 4WUKH 4PG2C 3P30H 2IPUG 3T0EA 4JFXB 2QQLH 4OUUB 1LE5B 2DTML 3O6ML 2ILLA 3S96A 1D3CA 2BHUA 1T5WB 3BP5A 1YY8B 2IBBA 3GUTA 1BIHA 3D39B 3VJ6B 1GOGA 3RDTC 1HEZB 4QTIH 1U8HA 4R7NA 4K55A 1MHEB 3RWJB 1ES0B 4D0CA 1MNUH 4M9PA 5L9DL 3KYOB 5J57B 1D9KD 3VFSB 4HV8A 2OYPA 5DFTA 4PJ7B 4RGMB 1XF3B 2V5RA 2AEPL 5F96H 5E94B 2AI0H 5IIEA 5SWQB 4DCQB 1R5WB 5FGBC 1JPTH 2VN7A 3AS0A 4L4TE 1VERA 3RI5K 4JM4H 2HLFD 1S78C 5TE7H 2R4RH 1BAFH 1LP9A 4MAYC 1KB5H 4I77L 3WS3B 1TQBC 4UBDC 2ED7A 4TUOB 5B4MD 1AGCB 3QG7H 1NUFA 2AK4E 1IAII 4UAOB 5EU4A 5D1QD 1YEGH 3OKNB 4H8WH 1RUPL 1G6RH 3CVHL 5T3ZL 1WCQA 2WWKO 2EE6A 1IM3A 3JXAA 3EFDL 3L3IA 4FP8L 4NFBA 4D9RE 4O9HH 3BMVA 3IDJA 5TE4L 4AEFA 3CPLA 1WTLA 5D71H 5ITBH 4K94H 2NQCA 2OTWB 4KJWC 5EUOE 5MP6L 3O2WL 4HC1A 4C56D 1VFUA 4NQCD 4NSKB 4CDGC 1E0OB 4MQSB 2IH3A 2Z93A 4M5ZL 3UTSE 2BVOA 4HIIA 4DN4L 5HGHB 4PJHA 1NGPL 3VRJB 2IADA 3ZYOA 5DEFA 5JOEA 1WLHA 1BQLL 2YSSB 5DURD 1UQSB 1QLFA 4G6ML 1FO0A 3PWJB 2FD6H 2FLRT 5T1MB 1RFDL 4XRCB 3WKMH 4KZEH 1FAIL 5FM8A 1T6WA 4JY6A 4M5YH 2QJDA 1OARH 2RIKA 5KAQG 4DGVH 2WBWB 3CSYA 1KB9K 3FB8A 2J8UB 4GG8A 4P46A 1EERB 3VXSA 5GS2D 5C0BB 4DJMA 3GBMH 3GSNH 3DIFB 2KUTA 4KTEH 2EDBA 1CICB 2Z8WC 4HUMB 4YPGB 3KJ6L 2G5BA 4MNQB 4X4XA 2D2OA 4OCYL 4KROB 2X4QA 1MJUH 3G5YB 4AG4H 3F7RA 1QFOA 4OQTH 5C0CB 3CUPA 5JQHC 4PJIE 4FFZH 5BJTB 1EDQA 2OJEA 3NACL 3TPKA 2YPLD 4RGNE 2R0KL 3HZVB 5E4IA 2UWEE 4KVNL 4MCYB 3U9PL 3GKZA 3MCKB 2Y07L 3TP4A 2B0SH 4LCWA 5DK0A 1YPZE 1IC5H 3MCLH 2XPGA 3DVGA 4KZDL 5CD5C 4HSQA 2IH1B 2IG2H 1ZTXH 1LD9A 1AHWA 3TO4D 2VQ1B 1CGWA 1CXLA 3RKDD 3KJ4B 4R0LA 4X4ZA 2ZOLB 3WIHL 1CF8L 3GIVA 4JKPH 2VR4A 1JWMB 1P7QB 5DS8B 2NY5H 4OZ4B 2FWOB 3L3GB 1IRAY 1BGXL 4Y5XA 5GGSB 2A74A 3TZVD 4U1KB 4EI5B 3V0AC 5I66B 3BX7C 4P59L 1ZLVK 2EC9U 5GJTL 3OB0H 3P4MB 5IW1B 3SE8L 3BKJH 5DK2A 3QPXL 5TF1H 3O6KH 3IFOB 1Q9OA 2BY0A 4JLRB 4KQ4L 5AAWA 3QUXD 5D5ME 2P5WB 1A7PH 1UXWB 4XPHH 5IKCB 4JDTL 3V7AG 1HH6B 1IGCL 1J8HE 3VI4E 5HDQL 1JYVA 3LPGA 1FN4A 1AO7B 4LCIH 3SDCB 2NR6C 3KPPB 4E0RB 2GJ6D 3H0TB 4NZTH 1IZJA 5JW4M 4HJ0D 3S3SA 4WWKC 3P9MA 5CJBA 4YEFA 3C60D 1F3RB 4H20L 1NCWH 2VE6B 5BVPL 1QLRA 3FT4B 3Q5YA 1FIGL 1JYNA 4TNWF 3QUYD 5C0RH 4M62H 4ONGL 2ADGB 5DQ9A 1I3UA 3S5LG 2AJ3A 4QRRE 3KLAB 3SDXB 2X1WL 5DDHB 3E6HB 2EH7L 4GBXB 4ELMA 1BQSA 4U1NB 2ZPKL 3C6LB 1RZJL 1YA5A 1S7QB 1NCTA 5GSRA 4YK4B 4Q6YA 2Q87A 2VUOA 4U3XA 4GXUM 1MCHA 2D31A 4K3JL 4LGRB 4BSWB 2BC4A 4V1DE 5T1KD 3WFEH 1G6RA 2MJWA 5KSBA 3UROR 4TVPE 1FNGB 1A6AB 5E1AB 1JVKA 1REIA 2VDMH 5SX5H 3S35X 1ORSB 2D0FA 4Y19B 4MA1B 4OV5A 3PWVA 1N4XH 3BGMB 3SE4C 3SKUD 4LEXL 2YD4A 3DX8B 5CJOL 1NMAH 4XC3L 1CLZH 5DJ2A 3VFPA 1EGJA 4HZLB 2E6JA 4ZFGL 4XVSH 1C8PA 3NFNB 5B3NA 1J0HA 4HWNA 5EPMB 1TJGL 3OWEA 4ZFFA 1NC2D 4M6ML 3UTTA 4TTGA 1JNLL 2C1PB 3GMRA 4NRYB 4R8WL 5KZCB 3HMXH 1EEYB 2IALB 3NABH 3BZFA 2LVCA 1ZE3C 5D1QC 3NIFF 3BSZL 4U1GB 3TM6A 2W38A 5EIQA 2ERJC 1T0MB 4E41B 5DJ0B 1EJOL 4PJGB 4TTDD 2PXYD 5C09E 5EO1B 4M9OA 5ANMA 2HJKA 3N9GL 1YYML 4L5FL 3PHSA 3S36X 3SQOL 3T0EE 1GPOL 3GSNA 1CFNA 1MWAL 1HNGA 5DMKA 5IQ9A 4EOWH 3IETA 2HG5B 4U0RC 3BGAA 4L9DA 3OV6A 3QG6A 4DK6A 1T2JA 3O3EB 2VLME 4JPVH 3A6OA 5L7XL 3O6FD 5I8CA 3IKCA 4ZSOE 4OQTA 3BKYH 4BK4A 1KJ2H 4HG4J 5GZOD 4R9HA 2LU4A 5I19L 5DI8A 1LEGB 4WW2B 3O4LB 4TNVF 2H1PL 4JO2H 4Z77B 5IT2L 2XWBB 4Y1AA 5IGXH 2F8OA 1HHJB 4DOHE 4YAQA 5JHDB 3SQBA 2XT1B 1SJEA 1IAOB 4RCAA 4HK3N 3QA3A 3OAYK 1D6VL 3TBSB 1N59B 5D7JC 4L3CA 1ZV5A 3QPQD 5TJWK 3W2DH 4QLRA 1LP9E 1FV1A 2OP4H 1ZEAL 3RAJH 3S35H 2HJLA 4XTRD 2FJGB 4NQUA 3TV3L 4H88L 1X5LA 4X99A 4GQPH 3EOAA 1ZHLA 1A7NL 2JCCA 1WTGT 2EIEA 4MA7H 5H94A 4DGYH 3FT3A 1SEQL 5BXFA 5KSUB 1I3VA 2G60H 2D7QA 5HHME 3HZKB 1BZ7A 4LLVB 4L8BB 3TVMD 4PIRF 1TPXB 4YDVA 3D2UB 4MD0A 4PPTA 1FYHB 4Z7UF 1KG0B 5GS0L 1XMWA 3QEQE 5SWSA 1U8NB 3RVVC 1QRNE 4WRLA 4XNUH 1X5IA 4K3DL 3VDAA 5JIKA 4YHYB 3GBNH 4UQ2B 1WK0A 1FFQA 3BZ4A 1G0YR 4LKXB 2XZQH 2AJUH 2OL3L 5AWNL 4FQJL 3V6OA 2FATL 2XKUA 2IBGA 5CJ8A 5F7LB 4HPOH 3NIGF 1HIMH 1YEJH 5EUKA 3S36H 2VLJD 4HQQH 3I3BA 1TCRA 1KCVH 1JUFB 3DBXB 3E2HC 2A2QT 2PYEB 4Y88A 3VD5A 4X7TB 1TZHB 4P5KB 3GZKA 4UOJA 1JPSL 4ETYA 1II4E 4R4BA 4M6AA 4NFDA 3VXSE 3KWWB 3G5VA 2QL1A 4X9HA 3ARDB 5DUPH 3QUXC 4Y4FD 2FNBA 5EBMB 4F7EA 1TNNA 4G8GE 1LWRA 3DXAB 4CGTA 2GITB 5C70A 3SCMC 2HTKC 2JJVA 1BIIA 4YDJA 3QDMB 3SBWC 4JB9L 4QHKJ 4HIEA 3NIDE 3TCLA 2YWZA 3I3EA 2VC2H 2HFEA 3LEYH 3MUGA 1KEGL 1QVOA 3IAGC 1IC4H 2YA1A 3AMKA 2Q86B 4F7TB 2BNRB 5JTWA 5CEZH 1T66D 3QUYC 2AP2A 2LAAA 5SWZB 2DICA 2X1XR 5I76A 3FCTA 4PRPE 2ARWA 3JV6B 3GMOB 2IJ0C 1ZLWK 4W6XB 1U3JA 1KLUA 1TFHA 1YUHB 2BK8A 5A40E 2RQ8A 3U1SL 3WN5B 3GJFK 4OFYA 1F97A 3HMXA 4O02H 3PQYA 4YXLL 5I1DB 1JF1A 1DUZA 1U8OB 2IANA 3GSWB 4JHWL 5IG7B 4JKWA 1UB6A 4L4JA 2K9UA 2J8OA 4JGMA 1BZ9A 4NO2A 4HIJA 3MACH 2E8YA 4OZFH 5BS0D 1N3NA 1G7MB 3RNQB 1TLKA 4LCCA 4JQIH 5FB8B 3DX6B 4PP2B 3HE6D 2X4PB 3I50H 2O5YH 2VLKA 3NCCB 4HWEH 3I6GA 4KC3B 1T20B 2ITDB 2QQNL 2CDGB 2XY2A 5EH1A 2VN4A 5JDSA 3ARWA 1GYAA 2XTJB 2R0LL 2DYPD 1NCDL 3QJHA 5EOCJ 1NAKL 1KJ2A 3TNNB 4LNRB 1PKQB 1KCRH 3VFUA 4JQXA 3PWPD 1YY9D 4M03A 1MCWW 3NIFE 1P5UA 2WP3T 4X0KA 4TSAL 2CLVB 1MCCA 1IGML 2NZIA 4RAUB 2YMXL 3G5ZA 5F97E 3HC3H 4KKBD 5GRWA 4NKOB 3SOBH 1HQRA 2P5EA 3RI5F 1LDPL 4PJ8A 2PXYC 3VU2A 2R1WA 4ELME 3M17A 4FNLH 5HGAA 3FTGB 1AGEB 3GMMB 3RWDB 5GGTA 5KVEH 3RGVD 1R6VA 4JANA 2X09A 2HKHL 4Z95L 1NSNH 4C57C 5HYJE 5DZOA 3TIDB 4B0MM 4LDLB 4JO1H 1IM9A 2AJZB 1NJ9A 1SJHA 2BFVL 3HZMA 3MQIA 1C7TA 1FAKT 1MEXH 3KNBB 3TEUA 1WCBB 2H45A 2JIXD 1KTLB 2VH5H 4X80H 5HHXH 5CLWA 5CSZA 4Y16D 3I75B 4HCRL 2F53B 2ED8A 1FFPA 1NFIA 1I7ZB 2DQGL 1ZLSL 1KN2H 3SE9H 4G8FB 3T77B 4LL9A 4LMQE 4KUCF 4X98A 4Z7NF 3H9ZA 4DQOL 3V4VL 3STZB 3LQZB 3QPQC 3TT1H 3VXTA 3C08H 1ZHKA 2AXGA 3C8DA 3QJFA 2ZSWA 2Q6WB 4UB0L 1CFSB 4FFWD 4L8SC 3RWIB 2WLZA 1T1WA 4IMLB 5D7SH 4WCYL 2I60L 1S9WB 3O8XA 4M93B 5KVFH 2B4CL 1X5ZA 2LV4A 4OZGA 1YEEL 4Z7WB 1FL6B 1BVLA 4Z7UE 1FFOB 1G7IB 5DVKA 1EV2E 1I7RA 4U3HA 3NAAH 3FONB 3HE7D 5ERWB 3V6FA 1QUNA 1XGQA 1MNUL 2NNAA 4GRLA 3V52H 1G0DA 5HYFA 4OSUH 3D85D 4APQD 2IPKA 4DZ8A 5KSAA 1JI1A 1VB9A 3MREB 4AIZA 3NIGE 5F96L 1BEYH 4HGWB 2VMFA 1MPAH 1JPTL 1T2XA 1VHPA 2ZJSL 1EPFA 4HS3B 2Q8BL 1PQZA 3AREB 4JM4L 4YGVA 2FCBA 1BAFL 2Z92B 5DRNB 2VABB 1KB5L 5K9OB 4Y1AE 3SKNA 4YZFF 1GZQB 2LVEA 4YIQB 1MFEH 1E4KA 1MLCB 4HS8L 2B20A 2XNAB 4S1RH 3QG7L 3VXRB 3KS0H 4GW4B 5K59F 1MCOL 1NBVL 1TENA 1YEGL 1XGPB 1QO3A 3MV7B 3F65A 2BP3A 4LQFL 4WW1A 4PJXF 3B5HA 1JMXA 3BDBA 3WBDA 3B2UD 4O9HL 3WLWC 1C5BH 5JW4N 3LN5B 4QRPA 3PWNA 5K9KB 1H15A 4K94L 4IRSB 5FOBB 1FPTH 3LSOA 4OZFA 4I18B 4PG2A 1AQDA 4CADA 5F1SA 3QUMB 1XF2A 1WBZB 2R2EA 3DARA 5H2BB 4F9LC 1FCGA 4RMWA 3DUHA 3RDTA 2J88H 3FQUA 3BPLB 5FYJE 1QQDA 4GOSA 4LGSB 1UZ8B 3FQWB 4TULH 4AJ0A 4GSDL 3NCJH 3DX7B 4JFED 4JZJA 2O26U 4IOFD 5DC4B 3WKML 3MPCA 5L88L 4GKSA 3OAUH 4GW5A 4YX2H 1OARL 4NQSA 1JGEA 4L4TB 1NGQH 3LDBB 1IQDB 2PKDA 4ZODA 4F37K 4HKXA 3VE0B 4X7DC 4OLXH 1LMKA 5FGBA 1E4XH 1KIQB 4OZHA 4JFPA 2BXYA 4LPVA 1YQ2A 4YDKL 3IDIB 2AK4B 2DQDH 4Y4KD 4RMRA 4WTWA 5MERA 5A2LH 1RZGB 4N8VB 4X5LA 3LRGA 1MVUB 1MJUL 4AG4L 4CVXB 4OLEA 1S8DA 1E6OH 4YC2C 4FFZL 1JHLH 1RZ8B 1U95A 3X11A 2DQEL 5F7WC 5EUOB 1IGTA 3F7YB 4M7ZB 3AMLA 4CW1B 1FJ1B 1QACA 1V3KA 4N5UA 3H6JA 1YY9C 4OLVL 1IC5L 3DUUA 1BFVH 3NCBB 3FQXA 3UTSB 1U8LB 2VKXA 1ZTXL 4EBQH 2WK2A 2D7PA 5BO1L 1XZ0B 3QISA 4JKPL 3KPSD 5C0JB 2NX5A 2NY5L 1U8JB 4U7SA 4EIZC 3G08A 4AQOA 4L3EE 2GTZA 2R8SH 2BOBA 4PJFA 5DVLA 5JQ6H 3RZCD 5LWYH 3MV9D 4PV8B 1HDMA 3R06B 1N0LA 3CX5K 4RAVB 3QIWB 4OFVA 1VEMA 4OQ1A 3O6KL 2AJYL 4NO0B 3MOQA 1XF1A 4JREB 4FZEL 2H32A 3QHZH 4C55A 5F70A 1TZIB 5DEGB 4UT6H 5LBSL 5TGBA 3MXVL 4LKCA 4O4YH 1MCJA 5CP7B 3IU3B 3ROLA 4LCIL 3ZYJA 2EEDA 2R4SL 2ZG1A 4PLOB 4NZTL 2VLKE 1VEOA 4G6FB 3D39D 3H7BB 4PJIB 1J86A 4RGNB 3W9EA 3RU8H 5L2KE 4XCCL 2F5AH 3TESA 3W0WE 2HVKA 3CLFL 3P73A 3VFWB 2UWEB 1PSKH 2XOTA 4M62L 3U4EB 5HD8D 2YD9A 1YPZB 4ODBD 1R3LA 1U6AL 4XMKL 4PD4J 4LCUB 4M1GL 4NRXB 3HG1A 3RWGB 5FA3A 4G5ZL 1T4KB 2FECL 4O2FB 1LO4L 1A1OB 3OX8A 3EGSA 5HPMB 1ZSDB 1CDBA 1C5DB 3DHJA 3FB6A 4P2CG 3S6CA 5MHSD 3WFEL 4PJAA 3HA0A 2CLZB 5C3LD 5GS2H 2BSRB 1AGFB 2BSSB 2VDML 1XGRA 4QY8A 4HKZA 3GJEA 1RU9L 3UBXB 4JPWH 5I1IH 4YDLB 4I3SH 2DJ4A 3QCVH 4APQC 4Y4HD 3L3OA 4LOUD 5D5MB 1U3YA 1QOKA 3MZTA 4U6VH 1J8HB 2DF3A 5E4EB 5DA0B 4NN6B 5EU6A 1R5VB 1JJUA 1GGIL 3L3DB 4YZFE 3TBYA 2VXTH 3VFNB 1JBJA 2V9QA 4QRQA 3VXPA 4OIIH 3TA3D 4G7YH 1LK2B 3T1FB 5K59E 2JJSC 4P5MA 1IEHA 3D0LB 2VITA 3UTZB 43C9B 5AZEL 3JUZA 4Z7VF 4XBEL 1KC5L 2WQ8A 5F7DB 4WWKA 3RQ3A 3EO1A 3T0BA 1P2CB 4NCC1 3RUGA 2Z35B 4NKQB 5CHNA 4NNYA 1LO2H 4M3KB 1AXTL 1J8KA 5FYJU 4QRRB 3TJHD 4FQPA 4LFHD 1IZKA 3B2UC 5SV4A 2EIZB 2HT3D 2MKLC 1AQKL 1CDUA 2CRYA 5JNYB 4V1DB 3V5HA 3OKDB 4IRJB 1IT9H 5FFLA 3QUKB 5C0BD 2AV7A 5F8QC 4OZGE 4CJ0A 4J4PC 1K5NA 2VDPH 3NGBC 1CICD 2X4SB 3BKYL 1VPOH 3D69A 4Z76A 4KROD 4M6NH 3BUTA 3AXLA 5C0CD 4UT7H 4G8EA 3H42L 4JO2L 3SE4A 4IOFC 5IGXL 4OKVA 1J18A 5DTFA 1JI2A 2WMPA 1I7TB 1YNTA 3STLB 1JRHL 2X89A 4HBCL 6CGTA 3W2DL 5GZND 1A5FH 2OP4L 4POUB 4HXBL 3RAJL 3S35L 3O6LL 4NYLB 4L29B 1T2QH 4RBPH 3IXTA 3THML 4Y4KC 2ORBL 1OP3H 1ZHNB 4KMTH 1Q9KB 1M7IB 1RHHA 3AC0A 1BREA 1VADA 5HGDA 1ZGLM 1AY1L 4HDIA 5D1QA 5EIIA 4EI5D 5C09B 1BX2A 3WO4C 2G60L 4G6AD 5ICYB 1OPGL 1JIBA 5IF0B 3C5ZB 5DJDB 3T0EB 3FRUA 5JO5A 4ZXBC 3BQUD 3UX9B 5DYOA 1FNSH 1OSPL 1DE4A 3F5WB 3S96B 3EJYD 4P9MH 4YR6B 4XAKD 3GUTB 5I30H 4XNUL 5E99L 1K85A 3PGFH 1A4KB 2P5WD 4L1HA 2BNQA 2VDQL 4ZSOB 3AS1A 1PD6A 5D72H 5D93B 4DKFL 4X6FA 4D0CB 1HYRC 3KHQA 2LAGB 5DVOA 3SDCD 3G6JF 3OKEA 2CRIA 1NCCH 1YEJL 4NKDA 4DFIA 3ULUC 4HV8B 4HQQL 2F54E 1NAMH 1LNUA 4DOHB 3VFRB 3F58H 1TQCB 3OB0K 3RZCC 5T3ZE 3TBWB 1UFUA 2C26A 1DSFL 3GFUA 1G7PA 3BUYB 3UXFA 3K3QA 4HH9B 4X4ME 5GIRA 1LP9B 4PBXA 1F02I 5J11C 5JR1L 4E42B 2OTUB 4OZHE 1KTKE 5D7JA 4GBXD 2BY2A 5D7IF 1SMAA 3C6LD 5HYSA 5I0ZA 5BQ7A 1H3PH 3BT2L 3CFCL 4L4VA 1RUKH 4X9FA 1MI5E 4IOIA 5KSVA 1G7JB 4K3HA 2WANA 4N0RA 1IM3B 4X8XA 3CXHJ 2CRMA 2IPTL 1F8TH 2E9WA 1CL7I 4FQHB 4X83A 1T3FA 1TVDA 1LE9A 3IDJB 1XR8B 5FYKE 3U7WH 1WZKA 4Y19D 3EDEA 3ARBD 4I9WE 4MJ5B 5CSGA 4OLYH 5FM5O 4YHNA 2YPLA 2DQFA 3QEQB 1QRNB 3KYNB 4O2EB 1GOHA 4LK4A 4HWUA 3VGFA 4N0UE 1RIUH 2ID5A 4RGMC 2X40A 2CKNA 3MJ9H 2BVOB 4LEOA 4LBEB 3VD4A 3TFKD 5BVJB 3K1DA 2IADB 4Z7QE 4O02L 2OMNA 3O9WB 2HLAA 5DD5L 1QLFB 2E8ZA 2JF1A 1OSZA 1N64L 3NCMA 5KZCD 2R1YA 4WI3A 2DLHA 3RIFF 3HUJF 3VFVA 5CCKH 2VIRA 4R2GD 3ORJA 4UAOC 5TF0A 3MACL 2AV1A 2V5TA 1F11A 1KACB 1UWEH 4JY6B 4NHUA 4NN5C 3Q6FA 5SX5K 3VXUE 5BRZE 5IUSA 4U6YA 5E2JA 3CSYB 3FB8B 3OR7A 2WIMA 1CDHA 1K6QL 4E41D 4EDWH 3VXSB 3FAXA 2AKRA 4JEGB 5IB2A 1OAQL 4KY1L 4G8GB 1E6JL 2FO4A 3GSOA 1RJYB 3ZT6A 3QUXA 2APFA 3UJIH 5IR1A 2G5BB 3EW3B 3T3PE 2H26A 1BQUA 1DN2A 5D4QA 3MRKA 1RIHL 3TIEA 2RFXA 1WZ1H 3ZDXE 3SCMA 4Z7VE 3CUPB 3SBWA 3UTPE 4GJTB 4PREB 1T0NA 3JBG7 3UO1H 5JXEA 2ITCA 3JWDC 3DETC 4YBLC 3SOBL 4Z0BH 4X6BA 4PRPB 5GGVY 1DEEA 3QUYA 3ZDZF 1B3JA 5JHDD 4JM2F 1LD9B 2J5LB 3VMOA 4R0LB 2LU7A 3BESR 3GIVB 1MAJA 4FNLL 4NC0B 3X13B 5FHBH 1Z5LA 5KVEL 1U2HA 2J4WL 3SGEH 3ULVD 5F9OL 1NSNL 4C83A 4I2XA 1X7QA 2PCPA 5DLMH 4CN1A 5FV2A 1WZMA 4FXKA 3MRFA 3ILQD 1NDGA 1LO5B 2H2PC 3EYOA 5IOPA 1OY3B 3GKWH 5D9SA 4F7CB 1MEXL 3MJ7B 4TQEH 1Q9OB 3HPJA 1BZQK 4OD2B 1HWHB 4UIMA 3D1MC 5HHXL 1B9ZA 2EDXA 1P7HL 3PDOA 3K8LA 1UWGL 3O41A 3CFEA 1HXMA 3D2UD 3FO2A 1KN2L 4L9LB 4ZUSB 3SE9L 1BQHB 1FN4B 4QRSA 2AJVL 2PR4L 4ZFZA 3L5HA 1S7RA 4OZIF 2YD5A 2WUBH 3TT1L 4NKIH 3HAEA 1R3KA 5CFHA 1T83C 4M6OL 4N9GA 1FFNA 4PV9A 1DQLH 3DRQB 3TN0B 1NC2A 3KJ4C 3HMWH 1QLRB 5D7SL 2MTPA 1WAAA 3RUGE 1F3DH 2FEEI 3ROOA 4U1LA 3FO1A 4HMEA 1Q0XH 2DQTH 1IE5A 3C5JA 2FIKA 2PYED 4NQTA 5DRWB 4EI5C 4F33A 3J8F7 4FOMA 4G6AC 2FSEA 4ELMB 2DQCH 1A47A 3BWUC 2PXYA 3TT3H 3RX7A 3V52L 3OL2A 4IBLT 1U42A 2PYFA 4OSUL 1HHKB 4YHKL 1OTUC 3ARDD 4B50A 1LEKA 1OOAA 2W0PA 3FQRA 3BGFC 1Z2KA 4LLYA 3G6JE 1J5OL 1ZVSB 5IVOA 1YYLH 4OV5B 2V7HA 3QDMD 4JFYA 3D3VA 3SDCC 3IS1X 2W1NA 2D4FA 5DJ2B 4QXTB 1P84J 1R5IB 1CCZA 2R0ZL 2W91A 4MCZA 4OF3A 5IFHH 2B7DT 4YE4H 2BNRD 2QQQA 3MJ9A 4M7KH 3DX9B 1VENA 1IC7L 2QV2A 3M07A 5C6TH 4TVSa 1A3RH 5CP3H 4K71C 4XX1E 2X1PA 4ZFFB 2JELH 4P2RE 5HGBA 4Z78A 4HUXB 1I9IL 2AEQH 3GMRB 3MMEA 5HVHB 1U3HB 2B2XH 5EBWA 1AI1H 4GBXC 5CJXC 2APBA 3SHSA 3LQAC 2CH8A 3QXAA 2Q7YA 4ISVA 3CH1A 4L8DB 3TH3T 1XGTA 4ZOCA 5T3XE 4P0DA 1ZA3B 3REVA 5ICXA 1B4JH 3OXSA 1OT2A 4Z7UB 2XZCH 4M7LT 5DMKB 2C4XA 5CGTA 5GPRA 2J88L 1UM6L 3VFGL 3AS3A 3ZYIA 2BNQE 4WHTB 4OI9A 4PJEA 1MREL 3IDUA 2BXZA 3TFKC 4JRXE 2OSLA 3O2DL 2XTJD 5E6IB 1D5BB 4AQ1B 1GGYA 4YX2L 1QYGL 3GMPA 3O45B 4ODVL 2AAVA 1NGQL 3HUJE 4NJAH 2NYYC 4WUUE 5GQBA 4OLXL 4Y1AB 3T3MF 1E4XL 3CZFA 2D7NA 1A6WH 3MZGB 1SJEB 1IEBA 3DRTA 1FZKA 2PW1A 1CDGA 4D0BA 2VISA 1B88A 5I73B 4L3CB 1FV1B 3L7FA 3OXRB 2CKBL 2VAAB 4Q9RH 3WEXA 4XB7A 3BAEH 1JHLL 5HBBA 2Z8SA 2EYTB 2P49B 2DM2A 4U1JB 2W65A 3BIKB 1G84A 3DTXA 4L4VE 4JFFD 5H94B 2R2BA 1TIUA 4LLQA 3X12A 1HOCB 5KJRH 1MLBA 4ZMAT 1OHQA 5BXFB 3VMNA 1EAJA 1NCBH 1XT5A 1BZ7B 1BFVL 3V5KB 5FF6A 4MD0B 3Q1SH 4G9FA 3Q5OA 3AM8C 4KRMB 5D7KD 4ZTOH 5DJYB 3ZDZE 5BV7B 4WW2C 3MV8E 2GY5A 4JRYA 3PIQB 2Z91A 5EOQH 2IFFH 4PJ5D 4HPYH 2F53D 3ZDYE 3KYKH 3BZ4B 1EA9C 2R8SL 3IFPA 2CUMA 3VD9A 4R7DA 2ADFL 5IESL 1A9BA 1FGVH 5DQDL 3GI9H 5E2UH 1ZGLA 4MJIA 4XMPH 1H8NA 1TCRB 1C16B 3ULVC 5E8DH 3FFCE 3F12B 3ARFC 3CNKA 3MRQB 3QHZL 5HHOE 5ADPL 4NUJA 1H5BB 3LN9A 4A6YL 2GKIA 5LGJA 1DBKH 3DYMA 4NKMA 3G5VB 1TPXC 3RWHA 2FYYA 5DHYA 3UYRH 1I8LA 4OZIE 3PABA 2B5IB 4YDJB 3RJQB 4U49A 1KPUA 1PSKL 1BJMA 2GTWB 2L7UA 1QSEA 3QQ4A 4LHQB 1PBYA 2HFEB 4YHYC 4P48A 1QVOB 2XTLA 3UZEA 5LQBL 1JNHA 4U1IA 2ZUQB 3U0PB 1JZ5A 5JPMB 4AM0B 2X2YA 3V6BR 4K7PX 1FL5A 4Q2ZA 2Y06H 5LG1A 5I76B 2NLJB 1NANH 1OGAA 3ARED 3QWRA 1MCEA 4S10A 4IJ3B 3UBXG 4L3EB 3WNNA 4LSVH 2YUXA 5J9PA 3SPVB 3VXRD 4PGEB 3V7MA 1M7DA 1JF1B 4MD5A 5C7XH 1DUZB 4XBGB 3MV7D 1HK6A 4NPYB 5L2JB 2DS4A 1DVFB 2ZCHH 3EYFB 4I2XE 3JTTA 1JMZA 1IFHL 32C2A 3O3DA 1IGYA 3MLRL 4NO2B 1CFVH 4S1SH 2R15A 1ORQA 2AEWA 3EO0A 5HVWA 1TTGA 1N3NB 4P23C 4IRSD 1H3TA 1L6XA 4H5SB 4LCCB 3QULA 3U9UA 2IBZY 2VLKB 3V4PH 4LCYA 1MCDA 3WD5H 4GXVL 5AZ2L 1J1XH 2ICWI 3IJHA 5L2KB 3BN3B 4CMMA 3K2UH 4X5WA 3NA4A 1UM5H 4U31A 1R24A 3QJHB 3W0WB 1S7WB 1RK1A 5DJCB 5GGRA 3GSVB 4OB5H 3OR6A 3ULUH 4X0KB 3WN5C 2BJMH 1HHHA 2VDRL 1DQQA 3G5ZB 4YQXH 1INDH 5B8CC 3H9SA 4L4TD 1HQRB 1P53A 2HWZH 5CGMA 3N1QC 2UVEA 4NHCH 5D2NA 3NTCH 4QHLB 1ZT1A 4JY5H 5C8JA 2XFXA 1A0QH 4YO0B 3VGAB 2AK4D 4LIQL 1IAIM 1VEPA 2ZG3A 3IRPX 1MFDH 5C0EA 3EYVB 3WKNA 3PP4H 1NC4A 4MSWA 2SEBB 1T7ZA 2A73B 5IW6A 1NLBH 4JANB 5F1NB 1M71B 2XY1A 3QIUB 1T5XB 5I1CL 3MNWA 4K7PH 3N0PB 1IM9B 1JHTA 1NJ9B 2G75A 4XNXL 4KXZH 4APQA 5E8EB 5TDOA 2XTJC 4O2CB 3D25A 4UOW0 5HYEA 1UM4H 2GI7A 3D3VE 5HHNA 5IK3B 3T3ME 5ID0B 2ZZUT 5CSZB 1A5FL 2EE9A 1WJ3A 1FP5A 4BZ1H 2R69H 1NFIB 1ZA6B 2JK5A 3GSQB 4QNPE 4K7PY 4X98B 3K81A 2EIDA 4P3DA 1VFBA 2AXHA 2UUDH 2JJSA 4HFWA 1Y18A 4XCEB 3VXTB 2GK0A 3IRZA 1DBJH 1T7WA 8FABB 2AXGB 4XCNB 5IMOB 2ZSWB 4J3XA 4ODHL 1T1WB 1YEFH 5C0AE 3MGOA 5JW4Q 5CWSA 3MUHL 1N5YH 4G3YL 4MA8H 1B0WA 4NO0D 1GXEA 1MRFL 3PHOA 4XCYA 4E9LA 4OZGB 1OW0C 4PJCA 4WI8A 4CJ1A 3W39A 3FMGH 5CJQH 1QPPA 2AK1L 3V6FB 1LO0L 4J4PA 1FNEA 2NNAB 4MNGA 1EO8L 5LKNA 1NCCL 5DD6B 3ARGD 1NGXA 2RBLA 1IBGL 4KTDH 5EZOL 1NAML 4F7MA 1YN6B 5CILH 4RGND 3VH8A 4LSDA 4AENA 4ZUVB 1KIRB 4JFEA 4IM8A 5JXAH 1JPGA 4N1CA 4RNRB 3JWDH 1MCQA 3MOBH 2P24A 4CVWA 1H3GA 5A3IC 1P4BL 3D87B 2OR7A 4KVCL 3IYLW 2QHLA 3MLVH 5F8RC 2BNUA 4WFEE 1H3PL 1QO3B 1Z9MA 2IGFH 1MHCA 4M93C 3WO3B 2VXUL 1F8TL 1FG2B 3RFZC 5I74C 1DJSA 1G1CA 3HS0B 3PWNB 3U7WL 4MDIB 2Q1EA 3PDDA 1H15B 5C9JA 1AC0A 5E00B 4HGKC 1DN0A 1AQDB 2YPKA 4OLYL 4ZXBA 2UZIH 4ORZC 4JZOA 3GK8H 4MHHI 4CADB 4Y8AA 1JFQL 2WM0A 4XCFH 5HVGB 1XF2B 1Q8MA 4QRUA 3MLWH 1RIUL 2R2EB 3MLSH 3OQ3B 1IJ9A 4PGCB 1J8HD 2VLRA 3CFDB 4XGZA 4G9FE 3WLBA 1X6NA 2VAJA 3LHPL 3T04D 5IP4A 3O11B 4JRYE 3AREC 1FVDB 2YEZB 3TIEB 2F54B 1AXSA 1W0WB 1VGKB 4JZJB 1UKSA 3I6KA 4GKSB 2C3VB 2Q76B 3CVHB 3SDYH 1S7VA 3GMQA 1UWEL 2Y6SD 2A6DB 1JGEB 5DQJA 3BVNB 5JW5A 3BXNB 5EO0B 1I85C 1OT1A 5DD1L 4OM1L 5SX4H 4QT5A 3VRIA 4QRRD 3WHXA 5H37G 3S8WA 4KK5D 4OZHB 4X4YA 4JFPB 4KUZL 4GG6A 1QEWB 1GHFH 1ACYL 1TQBB 1X5JA 3EDJA 2AS5M 4MMXC 1FLRL 4IRSC 5GGVL 2R2CA 3UJIL 1MI5B 4I18C 1YEKH 4V1DD 4IRJD 4JFXA 4GRMA 1S8DB 1WZ1L 1LE5A 2N56A 4OCLC 4Q0XL 1S7SB 1T5WA 1QG3A 1YY8A 4U1MB 1N0XH 2BOCA 1T80A 2AJXL 4TSCH 3UYPA 3D39A 5EA0L 1ERNA 3UO1L 1HEZA 1CXIA 3BPLC 1QSEE 4KKNA 1EHLH 1NQBA 4KDTC 2F74B 2Q8AH 1A6UH 1PLGL 4N0UB 3D5OF 4XP4H 5K93A 5FEBA 3IFLH 1FH5L 3VFSA 3FT2A 5I8OH 4HUNB 4PJ7A 4ZQKB 1XF3A 3LDBC 1K4CB 5E94A 1OGAE 2NX5B 3TWCL 5FHBL 4IRZH 1R5WA 2OM5A 3G08B 4FZ8L 2FRGP 3RWCB 2GTZB 4PJFB 5DLML 4LAJH 2QBWA 4B53A 1HDMB 1W8OA 3QXWA 3WS3A 3VXUB 5BRZB 3WFBL 2EC8A 3NN8B 4RDQG 4JAMB 4LPWA 4FQCH 2D3VA 5F9WB 4FFVC 1UG9A 5C09D 3OKNA 4Z18A 1MIEL 4X7FC 3T0ED 2H32B 4WO4B 5IBLD 1UXSB 4QEGA 4KK9D 2I26N 5CBEA 3ROLB 4Y0GA 1QA9A 4M1CD 1C1EL 4YUEH 3OJVC 3V4UL 3MLYH 3DO7A 4Z7VB 4HS6B 4RBPK 2BVYA 4I3RH 4ZFOL 2NY4C 3QDGA 3HMWL 4NSKA 1OP3K 2OJZH 4KMLB 2E5EA 1ED3B 2ESVE 2XWTB 1RUQL 2E7MA 5HGHA 1ZHBB 1OCWH 1Q0XL 3VRJA 4ONFH 2DQTL 2CDFA 1IILE 5ISZA 2YSSA 4XNQB 1UQSA 4MZ3A 4F8QA 5GRVK 5DGRA 1NGWB 2MPAL 2DQCL 2R1XB 3QIWC 4XRCA 3EGSB 3TT3L 4XVUD 5D2NE 2OCFD 2Q7NA 2BZDA 4YPJA 3PHQA 5GISH 4JREC 3L1OH 1QP1A 3MLUH 3P11H 2FIRT 1XGRB 1J87A 1F4HA 1YYLL 4JY4B 3GJEB 4HGMA 4M8QB 3WCYA 3ZKSD 5DC9B 4ONHA 3BW9A 2VLLA 4MNQA 3L3OB 3MJGX 5C0GA 2CD0A 3T2NH 3WNKA 3G5YA 2C5DC 5JW4R 1FDLH 3ZYZA 5IFHL 5C0CA 4YE4L 5C08E 5ESAB 5MEQB 4PB0H 5EU6B 5C6TL 1S7UB 1RJLB 4CUCA 1I3RA 3HZVA 1N6VA 3MODH 3X14B 4QRQB 3ZTNH 2YD6A 2AEQL 4NQDE 2O5XH 2MCG1 3MCKA 2B2XL 4P5MB 2QSCH 1AI1L 5H35A 4X6DA 4X6CF 2H8PA 3LKSA 4WDIA 1PY4A 1T83A 2CMRH 3V95A 1OB1B 3CU1A 2ZOKA 1CFQB 2IQ9H 4Y2DB 3RUGB 1W8NA 2ZOLA 2XZZA 4Y89A 1RY7B 4MS8D 4JCLA 1P7QA 5DS8A 3ULVH 2W60B 2VDLL 2FWOA 4U1SB 5GGSA 4R26L 4U1KA 2XZCL 4C59B 1RURH 4EI5A 4D3CH 4YDLC 4ODSH 4P46D 4XWGH 3LD8B 4JFQB 4YNYB 3VXSD 4I0KA 2P8MB 3GMNA 3IFOA 2ATPB 4G8GD 4PJCE 3G6JB 3CCHB 1HI6B 1K5NB 1URLA 3HR6A 4HXAL 1DANU 5IKCA 5EZJA 3RX8A 4N0CD 1MCWM 4NJAL 1X9QA 3F7PC 2D0HA 1AO7A 1MFCL 4G8EB 4OM0H 3KPPA 4OKVB 4E0RA 1U8MA 3H0TA 5DTFB 1A6WL 2YD8A 2MOVA 4JJ5A 5F9JB 1PYWA 2VR9A 4PRPD 5HHQB 1L9NA 2MKWA 3FT4A 4P2RB 3ZKQD 1MWAB 4Q9RL 1CXKA 4OCSL 4EDXA 3BAEL 3KLAA 4JFDE 3SDXA 4WGWB 2HRPH 4AK1A 5IMMB 1XFPA 1RHHB 1IVLA 5CJXA 2FGZA 1VADB 1CFBA 2QEJA 4U1NA 1KCUL 5J3HC 1YEHH 3NPZB 3FB7B 4HDIB 4IRJC 3O4OB 5EIIB 1S7QA 5KJRL 4YFDB 1BX2B 4MB4A 2DM3A 2V17L 4PTUA 4XVJH 1IARB 4G80B 4OIBA 2ZWLT 2V5MA 1FNGA 5E1AA 1HKLH 1QBBA 3Q1SL 2J8HA 5E24E 3EO9L 2ICWJ 1QBMH 1ORSA 1RMFH 1C08A 1NMBH 2GEEA 3B5TA 2Z31C 4U0RB 2BNQB 4HPYL 2Y1VA 4KJQD 1EEZB 4JRXB 2VLRE 4X6FB 2N4IA 1FGVL 4HZLA 3GI9L 4EN3C 1EHNA 3WE6B 2E7CA 1W72A 3LKOB 3HUJB 1IKFH 5TH2B 4XMPL 3NFNA 4WUUB 5E8DL 2XACC 2XN9A 1D5ZB 2EE3A 5EPMA 3TN0D 3MROA 3FFDA 2C1PA 4FQQA 1FCCA 4W4OC 1VFOA 2IALA 1N2RA 1ZAGA 1JE6A 5I0DA 4HF5H 2DI8A 5DO2D 1DBKL 3BDXA 1P6AB 2COQA 4UDTB 5GSVB 1TZGL 1EVTC 2HKFH 3OJ2C 3C5ZC 1T0MA 1P4IH 5DJ0A 5IBLC 2NW2A 4PJGA 1SJXA 5BQ7B 4Z5RB 5EO1A 4UNUA 3UYRL 5MI0C 4L4VB 4KK9C 1CN4A 3MCG1 5E8PB 2EDQA 5JOPE 2V2WA 3S4SB 4KI5F 2OL3B 2W0FB 1GGCH 1TETH 1LE9B 2NY7L 3O3EA 3QT2A 1FGNH 3K4AA 4KAQH 2YKLH 4XI5D 3MV8B 3G5XA 5IW3A 3L3KA 1TQCC 4WW2A 1QSFA 3L6FA 5CGYC 3O4LA 4U6XB 4LSVL 5I1HH 4Z77A 2P45B 4KK6D 4RMTA 5E1HB 5JHDA 2VXVH 1SY6L 2OS7A 1IAOA 4XPAL 4XVUC 4F9PC 3EOTH 4XXCC 3TBSA 2JJTC 2VL4A 3FFCB 1KJ3H 4J1UB 3SEPA 1SQ2N 2Q3AA 3HZYB 1F11B 3MYZA 5HHOB 4NHUB 3E2HB 2D7TH 3LKPB 3QFDB 3ARFA 4XNYL 5E5MA 5D6CA 4UTBH 12E8H 3V4PL 1QFWM 3WD5L 3ECBB 1J1XL 2FO4B 1WFOA 4QGTA 5KSUA 4OCNC 5C07E 4OZIB 1QNZH 3KR3H 3K2UL 4LLVA 1UM5L 2H26B 4L8BA 3B43A 1RZFL 5HI4D 2YZ1A 3MRKB 5D8JH 5IHBA 3M1BA 2RFXB 3X3FH 3TYFB 3SCMB 2F19L 2K1MA 4OLUL 5BCAA 1KG0A 4G6KH 5CSBA 3O9WC 4YQXL 1XF4B 2QSTA 5JZ7D 4LKXA 1YC8A 2ICEB 4WI7A 5CEXA 4Y1AD 1F00I 2QQKL 3NTCL 5ISZE 4JY5L 4ZNEE 3HC4L 3DBXA 3WNMA 3QO0B 5LCVH 2A6JB 2CXKA 2XG4A 3R0MA 1Z5LB 1NLBL 3EZJB 2CPCA 4I2XB 2PCPB 5HHPB 5F6IB 3QCTL 3KAAA 4K7PL 3MRFB 1Q72H 3EYOB 5IOPB 1OAUL 2WUCH 3LS4L 1TVBB 2O61A 5EBMA 4MJ2A 5AYUL 3DXAA 2ZUTA 2GITA 3HPJB 1A3QA 3ZE1F 4N0CC 1JF6A 4KV5F 4P23A 4NZDA 3K4DA 3RBSA 3PDOB 3QDMA 1KIUA 2YD2A 3O41B 2R69L 3BIBX 1HXMB 2BCKB 4S2SA 1HKFA 3EJZC 3VG9B 3JWOL 4PRDB 4QRSB 5ECJE 3DMMB 3K8MA 2Q86A 4F7TA 2BNRA 4MB5A 4WHCA 3HAEB 4TSBH 2A6KB 1R3KB 3PWUA 4IDJL 2NY1C 2IEPA 5SWZA 1DBJL 2IMMA 1FFNB 4K7FB 2J5LC 3FN0L 1KN4H 4KHTL 3NOIA 3JV6A 4OTXH 4X6DE 4XPFH 2DIAA 3GB7A 4G6JH 3GMOA 3JTSA 4LP5A 3WN5A 4WU7A 1BD2E 1BM3H 5K9JH 1IQWH 1EFXA 1FZOB 5IB5B 3C5JB 1U8OA 4K8RC 5B8CA 5F3BA 3GSWA 3EYUH 3IJYB 1J88A 1CDJA 1BFOA 3OMZA 3FMGL 1NFDF 4XMLH 2PYFB 2JKXA 1G7MA 1K8IB 3RNQA 1LEKB 3FL7A 3X3GL 5FB8A 2HP4A 5D70L 5D6DC 3RVUD 3QUMH 2X4PA 4L9LC 4AL8L 2OK0H 3GHBH 4ZTPL 4JFYB 3D3VB 1T20A 2ITDA 5JXAL 1HSAB 4X7SH 1H8OA 5DT1L 1JGVH 2WWMD 3MOBL 2ZUWA 3TNNA 4MCZB 4LNRA 1PKQA 4QF1B 2OZ4A 3A67L 1G9ML 3OPZH 3TN0C 1UB5B 4LSRH 3DSFH 1PZUB 4LVNB 4Z78B 5B39B 1LDSA 4PGDA 4L3ED 4NKOA 1KT2B 3D6GA 5EBWB 3RGHA 1CK0L 1MCIA 4OFYD 4JG0H 5C0AB 2Q7YB 1XIWB 1YNKH 4ISVB 4RZCB 3RY5A 5DF0A 1QKZL 1EEUA 1AGEA 2C4FT 3GMMA 3FTGA 3RWDA 5ICXB 1MQKH 3OXSB 1J0YA 3PWLB 1ZANL 3P9LA 3LZFL 1OW0A 2AJZA 2R0WL 4ODXB 1OQOA 2NXZC 2R29L 2VLKD 1FBIL 5A2IH 1E27B 1JN6B 1ROWA 4KUCD 2YRPA 1P5VA 1WCBA 4UV4H 4LRIC 2AXJA 5LXGH 3IU4L 1UACH 2FECI 5L2KD 5T1DL 3B9EA 2I27N 3D48R 3I75A 4UILH 3W0WD 3GMPB 1I7ZA 4G8FA 5DD0H 4DW2H 3T77A 2MCPH 1K9TA 2MQCA 4UQ3A 6FABH 5HVHC 1U3HC 2XN9E 2E6PA 2NY0D 3EYQD 3STZA 1YC7A 3LQZA 3H2WA 3NBNA 2XZAH 2PW1B 1SM3L 1GHFL 4D0BB 1U2CA 1RUAH 2VISB 2Q6WA 2P5ED 1JF5A 5EZIH 4MA3B 4CDHA 1YEKL 4IMLA 1JCKA 4XBPB 1QFWH 4BJLA 4PJ8D 4HWZB 2XKSA 2P43B 1S9WA 3R1GH 5B3JF 3P40A 1N0XL 5JPNB 5FKAB 3DTXB 4Z7WA 1FL6A 4HEME 4LLQB 5A16B 3ULSB 1G7IA 2EYRA 3X12B 1V7ML 3FONA 1GIGL 5IVZB 3QIUD 4K9EH 3QNXB 1A6UL 4MAUL 1R0AH 1IM9D 2JJUA 5KANG 1N8ZA 4XP4L 1A7BA 3IFLL 3L5WB 5E6IC 5DMJB 3N50A 4G9FB 1DBMH 4JRYB 5IQ7H 5FYLE 2Z91B 5IBUG 3MV11 4HGWA 4IRZL 4QXGH 2YXMA 1P4LB 4HS3A 1QSFE 3IFPB 5CZVH 2DDQH 1KIPB 2Z92A 5DRNA 3SJVA 2VABA 4J12A 5I18L 1A9BB 4ERSH 3QEHB 1A6VH 5I73C 4LVOB 4N5ED 2JB6B 4FQCL 2XNAA 4MJIB 4C56E 1I85A 4TYUA 3VWJC 4JVUA 5KAQF 5I8KL 5CS7A 4B41A 5ENWA 1INEH 3GBLA 4JN1L 4NM8H 4NWUH 3ZE1E 5D2LF 4KV5E 4EQ2A 4XAWH 3O8XD 4FQ1H 5FHAL 4P9HL 5CKGA 4I5BB 1ZT7B 1CE1H 4NKMB 4D0DB 5IHLB 5K9KA 2VTFA 5EORH 4IRSA 5I1LA 2VDKH 3MLYL 4I18A 3QQNA 1GVIA 3RWHB 2FYYB 5DHYB 3VFMB 5I17A 2UUDK 4GRLD 1WBZA 5H2BA 5BV7C 1AD0B 1MFAL 4RMQA 4QGYA 3CK0H 4U1HB 1QSEB 3ARVA 5GJSH 3SDDB 4P5TC 1WGOA 1PVHA 4PY8I 2X4TB 3MNVB 2EKSA 4KDTA 1I9RH 1UZ8A 3FQWA 5DJXA 3C5SA 3VGGA 1D7FA 3OJDA 1Q1JH 5CEZD 1MSPA 1T1ZB 3FO0H 3MSPA 5IVXA 3WFCH 1OGAB 5E6YA 1ITCA 3Q3GA 1UCTA 1NFDE 1X5YA 5GISL 4NT6A 3MLUL 1FVEB 3P11L 2R23A 3HC0B 1M7DB 3QQ3A 4WY7H 1KIQA 1H5BC 3GSXB 1AE6L 1I1YB 3I9GL 1EH9A 2UZXB 1D5IH 1RZGA 4G8IB 4N8VA 2FEEL 4OBRA 5I16B 3T2NL 4CVXA 4QRPD 3EO0B 2EDLA 1XAUA 2B5IC 1I9JH 1AGBA 3CXDL 4DK3A 2AERT 1CDCA 3U9UB 3MFFB 4LLDB 4LCYB 4P4RB 4QOKA 1JYXA 3IFNL 3ZTNL 1KPRA 5EUOA 3A6CH 2O5XL 1FJ1A 2ZUQC 4OCXL 3RDTD 1R24B 2ESVB 3UTSA 4LIQE 3D18A 3CX5J 5GGRB 1FLTX 2FH6A 1XZ0A 4IJ3C 4QYOB 25C8H 3ISWA 5JIHA 5C0JA 4NBYB 1U8JA 1HHHB 4RMUA 3D9AH 5GRUL 1UA6H 1DBAH 1RURL 1F13A 1ODAA 3H9SB 3T08A 2EXYC 4BSJA 4PV8A 4DEPB 3R06A 4G43B 4ODSL 5D2NB 1DVFC 4PP1C 3QIWA 3E3QE 1FRGL 2YN3A 4JKLA 2BVPB 1S78D 2AQ1A 4NQXB 1MIMH 2XFXB 4UT9H 2F8VA 4OT1H 3GRWH 3QI9B 5C0EB 2B8OT 3WHE1 1A1MB 3CX2A 1MI5D 2ICES 4FABL 4P2QA 1V05A 5CP7A 2DM7A 3MNWB 3IU3A 1A3LH 3CMOH 4OM0L 4XX1G 2G75B 4DTGL 1DR9A 5FYKD 2KBGA 5E95B 3O3UN 1Z0NA 4HLZG 1BBJA 3H7BA 5C08B 3D25B 3ZKMC 4I9WD 1EAPB 1AKJA 5EC1A 4I48B 4KJWD 3VFWA 4NQDB 2UWEA 2Z0BA 4K23H 3U4EA 3MUZ1 1YPZA 5DXWA 2HT2C 4LCUA 4NRXA 35C8L 2GJJA 3RWGA 1A8JH 2HRPL 3NA9H 2NX5D 1T4KA 4ZUWB 5J13B 1YEHL 4O2FA 1KXVC 4GUPB 5DJ6B 1A1OA 3RBGA 5HPMA 5IWLC 1ZSDA 3PL6C 3REWA 3VGAC 1ETZA 1GH7A 4X9GA 3VXUD 4XVJL 5BRZD 2ICCA 4LARH 4KPHH 2Z9TA 4TRPL 1MRDL 4WFHE 2CLZA 1HKLL 5CWSB 1AGFA 2BSSA 4OD3L 1Z9SA 4NNPL 5E7FA 2J6EL 2EEAA 2Y5TA 3QIUC 3UBXA 3PHOB 4XCYB 3UJTH 4PJCB 3W39B 4ODWA 5TQ2L 1F90H 3AVEA 4AH2B 5D5MA 1FNEB 4J3OC 3NGBB 4Z7OE 2ARJB 3MRGA 5F89A 1G9NL 1NGXB 3WIFB 5JIIA 1V7NH 4F7MB 1CZ8L 1R5VA 4M4PA 3L3DA 2DIBA 3KXFE 4BYHA 3VH8B 7FABL 3LB6C 2H3NB 1LK2A 3GIZL 2I9TB 2FJHB 2D4DA 1S3KH 43C9A 1A4JB 1Y6KR 1SBBA 4MJ6A 5F7DA 1MUJA 2CR3A 2APWA 4FS0A 4HF5L 4N8PA 3HG1D 5DUBA 4BZ2H 5D2LE 4K3EH 5CD5D 5MEPA 3INUH 3S4SG 4JFDB 4LVHC 2WAHA 2BNUB 4QRTA 1DLFH 1FYTA 4WGVB 1MHCB 2CGRH 2EIZA 15C8H 3PNWA 2EDRA 3MJ8B 5JNYA 4ORGA 1GGCL 1TETL 3OKDA 4IRJA 5A43C 5I1KL 1KCSH 3QUKA 2FB4L 3WO4B 5C9JB 1FGNL 5EWIL 4ZUUB 2YKLL 1DP0A 2WLYA 4ZXBB 3BD5A 4RGOH 1BBDL 5DD3L 3N85H 4GRWE 4QRUB 3DGCR 5L6YL 4HJGB 1XCQA 2VLRB 5KS9F 2Z31A 5GHWL 4O58H 1I8KB 3WLBB 4HFUH 1XGUB 4KRPB 5IHUH 5EU6D 5LVEA 2VXVL 3PG2A 4MB3A 3EYSH 4NGHL 1NBZA 3WIIH