5L6YL

Il13 in complex with tralokinumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
YVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-13
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL01
3B2UC 5BZWA 2OYPA 3VG9C 4D9LL 2X4NB 3UTTD 1QSEB 5E7FA 5FA4B 4K23H 3QUYA 5BS0B 3LY6A 4QYOB 3ULUL 3I3BA 1VA9A 4PRDB 4JFDD 2E27L 1JV5B 2R1YB 1IGIL 1ED3A 3D2UD 5C3LD 4XP4L 1HXMA 4NBXB 1PZ5B 1RIHL 3QDJD 2Z93B 4BZ1L 4LF3B 4KTEL 4QRUA 4MD4B 4KTDL 3B9AA 3K46A 4S11A 2VDMH 2ESVD 3RVUD 4NGHH 2Y7QA 5BQ7B 1T04B 5F7DA 4ZS6D 4M93B 4KRPD 2DDQL 1LO0L 2D4FA 1S9YB 2B5IB 5HXMA 3MOAH 1SJEB 3VRJA 2PYEA 3NCEB 5AG8A 3ME0A 4LPWA 1AI1H 1WF5A 2PO6B 2AJ3B 1MFCL 4HLZH 1XIWB 3H0TB 2DF3A 2Z92B 2VDPL 4YX2L 1KULA 2EIZB 4AIOA 5C0AD 3VWKA 4WHYG 4YPGB 3P77A 5I66A 4HUUB 2X1PA 4CMMB 3RKDC 1M71A 3N85H 3QCTL 1RJLB 5I1CL 2FZ3B 5FV1L 1PZUB 4ZXBD 6FABH 5KS9B 3EYQC 5F3HA 4Y4KD 1I9IL 4R2GB 4YUEH 5GISL 3WFDL 1BJ1H 3ARDD 1IM3A 1T21B 1G6VK 5T5FL 5JOFA 2CJUH 4M3JA 3MQIA 4HT1L 5H8DA 5IOPA 5AYUH 2ICWB 3RWGA 3INUH 2Q7YA 4G9FD 4OUUB 1CGUA 5GZOC 3FB7B 3O3EA 1OSPL 3ZKND 3WHXA 3RWIB 4JO1H 4ZFZB 4R97C 3GSVA 2X4OA 1NC2B 3PWPA 1QHOA 4MQSB 3QIUD 4O2CB 5C9KA 5JIIA 5T3ZE 1II4E 4NN7B 3FMGL 4JY6B 5HI3C 3HI6L 2GY5A 4M48L 5TF0A 4FS0A 5JORA 1I1YA 1MAML 3SKMA 1H3VA 1AR2A 2J5LB 4HWEL 1VGKB 1NBZA 2DKUA 5TQ0L 3RWFB 4BZYA 1T03H 4BA8A 2EKSA 3RJQB 5D7SH 4TRPL 4FABH 4LLDA 5I19L 3TESA 4KHXH 3WIFB 4MXQD 5DJ0A 4HC1H 1JZ6A 3RDTD 3OKKA 4NFCA 1FAIH 3QNZA 5CKAA 1FO0L 1CIDA 1B4RA 2H45A 1X5LA 1KG0B 3U4EA 2Z0BA 5IVNA 4NSKB 4FXKA 5GZNC 4JZOB 1TTFA 5DUML 3NA9H 2VZTA 4HIHB 4DWHA 3MO1B 5TE4H 1H15A 5SWSA 1RUQL 1LO4L 3T2NH 4Z0BL 5ETUA 2A74A 4BFBD 3VD7A 4PG9B 1MHHA 3QUXA 1Y6MR 3IXTA 4IS6A 3VFTA 5BMFH 4OZFG 5CZXD 4MB4A 4NRYA 1JYWA 4PJCE 3AMKA 4QCIA 2PYFB 5C0DB 2PO6A 4NFBA 1DP0A 4LAQH 5JMRA 2YPLA 1L7TH 4O2EA 5T33L 2A6KB 3NAAH 1NLDL 1DR9A 3GJFK 1WBYB 2UY6A 4IEFB 1Q94B 5AWNH 2F5AH 3PP4H 4QXUL 1YEHL 2Q87A 4H8WL 4ZFZA 5K93A 2E7LC 4NN7C 1P4IH 2GJZB 2PW2A 5ICXB 1FNEB 1AD0B 2AABL 4UT9L 4XB8A 3W9EB 4Y5XB 2DLTA 3K1KC 3FB5B 5AZEL 1QA9B 2I9TB 2I9LA 5C09E 4R7NA 2X42A 5KSBE 1WEJL 3GMRA 2VDKL 4X7TA 2MTPA 4JFEB 4XP4H 2ED8A 4GG6E 1IM3B 4OZHB 1PG7H 1CGTA 2H1PL 1Z9SA 3UTSE 4E41D 3QB7C 2QQLH 2Q8BH 1HSAA 1IGJB 2IBZY 3DNKA 2CDFB 4JQXA 5IW3A 5FA4A 5H94A 1FZMB 4LLMB 2EE3A 3MREB 4JRYE 2EDYA 4NN5C 5TDPB 1JGDB 4OJFH 1AKJD 5GRUL 4JGMA 4GAJL 1FFPA 2Y23A 5ICZA 3TCXA 1JZ8A 1ITCA 3T1FB 3BH8A 2A9NH 4PRIA 1OWRM 2BSED 3BHBB 5F1SA 4P2CG 1ACYL 5FO7A 1MJ8L 5IW1A 3UJJL 4M7KL 1RMFH 1M7DA 2HLAA 5LCVH 3D25B 4DTGH 4KRLB 5B4MD 3Q6GL 2EDKA 2QADB 2PYEB 4ZS7H 3IS0X 5L6YH 5JW3L 1EZVY 3HG1B 2PNDA 3QQNA 3KJ6H 1DEDA 4MQXD 4RBPH 2VKWA 3BMVA 1ORQA 4OKDA 5FM5O 3MRDA 3FO2B 1X5GA 5D2LE 4RGMC 4L5FH 2C3HA 3AGVA 3VXMD 5HI4C 5C2BH 5EUOF 4GFTB 4O2FB 1OTTD 5ECJE 2IANA 3C5SB 1CFBA 4WW2A 3TBTB 4CU7A 5T3XL 4ETYA 1QYGH 5ESQA 3C5ZC 3LRHA 2GJ6A 3B9KC 2P8PA 3JV6A 4O5LH 1KIPB 3RDTC 3VG9B 2Y1VA 1FBIH 4DOHE 4NGHL 4FQ1H 2I07B 1XR9A 3KPMA 2W0FB 2VR4A 1P4LA 15C8L 5BS0A 1FGVL 3O6FC 4HGWB 1QFWL 3UZEA 1D5IL 5D1XD 4MXVF 5TGBB 3GM8A 3S37X 1FLRH 2Z35A 1SYSA 1AO7A 3DRTA 4M7KH 4KI5F 5HYQB 3E6HB 5F8RC 3TJEH 3WFEH 5L7XL 2OJEB 4DQOL 1X9QA 1BOGB 3IDXH 1PVHA 1ZANL 4OD2A 1CBVL 3LKOA 3KJ6L 4XVSH 3RPIB 4IOFC 2NY2B 3O2DL 4LNVA 4X5XA 2EIEA 1P69B 1M7XA 2OXGA 1LHZA 2FGWH 1IC7H 3E8UL 1OSZA 1ZT4A 4D0DB 4MMXC 3ECBB 4S1SL 4P2QB 5AD0A 5C0BD 5A3IC 3OB0K 1T20B 4JRXE 1VHPA 2XYCA 3SE3C 1ZVSB 4GH7B 1FBIL 2KQNA 4OF0A 1T83A 5FDWB 3NA9L 3BGMA 3ULUE 4HMEA 1E27B 2R0KL 4P46A 3AAZA 1F4YH 3U9UA 1T4KB 2JCCF 5ADOL 4FFVD 5IR1B 5I8KH 4KKAC 4YQXL 5ACLA 3RQ3A 4XP6H 4KPHL 1YEFL 1S7QA 2ICES 2N1KA 3PL6D 5T1LB 3EBAA 1TJIL 5C09D 3I3EA 1ZTXH 1RK0A 3B2UD 5DUPH 3WEXB 2FX7H 1MY5A 4PRHB 3S88H 2HT3C 1A1OA 4OFDA 4OZIF 3UPRB 1OCWL 4JFDB 2QLVB 3EHBC 4KROC 4WUUE 1RK1A 2CMRL 3HFML 4WY7L 1XGUA 2OCFD 3CCHA 3ZYJA 4U1MB 3VXSB 2FGWL 4HIXL 4XCCH 5LAXA 3QFDB 5CMAA 3H9HA 3NTCH 4MNQE 4L3CA 4NJAL 4PFEA 5KZCB 1CLYL 2BNQB 1J1XL 3P4NA 2R1WB 2Q6WB 2F8VA 5KSAA 4AH2B 2BSRA 3BSZH 4WCYL 3T0EC 1Y18A 4RMUA 4IRSD 2OR8A 3SGJA 3PDOA 4NM8H 4V2CB 4EI5D 3TJHD 3VE0B 1V5JA 5FO9A 5I8OH 5KAQG 3GJFB 2HVKA 1BECA 1RVFL 4IRJA 4P57A 1NFKA 1IEBA 3KNBB 5CEYA 5EUOA 4M1GL 1NAKL 1RZFL 1YDPB 2DYPB 3C5ZD 3DRQA 2FX7L 3VMPA 1NCBL 2PETA 2C9AA 3O45A 3LQAL 2A83B 1W0WB 3PF2A 1I8KB 2AI0H 4UZGA 3NOIA 4OCSH 5CKGA 2Y5TA 5F3BA 5MEQB 5KVDH 4DUVA 4EN3D 3O9WA 3B43A 3L5XH 3BYYA 1S7TA 1A7QL 5GGTH 1ZHBB 2ARJB 4Q9RL 4D3CH 4KJQD 4LSUH 4YXHL 5C07D 2XQBL 3CMOH 4YBLC 4YDLC 5HI5C 4QRTB 4S1DD 4EI5B 4WI4A 4PJBF 3BN3B 3D85A 3KPOA 5CSBA 4PRBA 5DVOA 2QSCH 3LKNB 5I1IL 5DC4B 3LMJH 1NGPH 4XC1H 3OWEA 2K7QA 3MLZL 1JNNL 2CRZA 5ICYA 4JO3L 4ZUVB 3MRHB 4QTHB 5HHNB 2Z35B 5CCKH 5IHBA 3KJ4B 1I85A 4QY8B 1WC7B 3MXWL 3KVQA 3KPMB 2RBLA 5LXGH 2Y36H 2AQ1A 3LKPA 4OCYL 3QI9D 2FLRT 4GW4B 1MSPA 3C5SA 3TBTA 3WFEL 5L7XH 4G8FA 3KPLA 2WWMD 1P84K 4MA7L 4G8EA 3MXVL 3G04A 5DD0L 3RP1A 1T7XA 1T5WB 3PE9A 1UXSB 3MRDB 5IHZA 3GNMH 3HR5A 2BJML 1EMTL 5HYJA 2CR3A 4JKKA 3RTQD 3VH8A 2XA8L 5F6HI 4GAYA 1KPVB 1A3RH 2WBJA 4GLRI 3LB6C 1NSNL 3QBTB 2NY4D 4DUXA 5JPNA 4BFEA 5FHAH 5I73C 1OAUH 2A1WH 3VJ6A 4XI5D 3ARBB 1DANT 3C8KA 5B8CA 5CS7A 5E1AB 4HUVB 5FO7B 4OLZL 5K9QI 2B0SH 5J8OA 4JM2C 3IDYC 1X5AA 4HEPG 3TBSA 3FB8A 3BXNB 4L8SA 2ZUTA 2IG2L 4R8WL 3NCCB 5HPOA 1CLOH 2ZJSH 5TE7H 5I74C 2W65B 5J1AA 3P0VL 1GZPA 3NPSC 4WWID 4ZUTA 4NO5A 4NNYB 1UQSB 3QHTC 2EDJA 4LCCC 2AK4E 1XCQA 4ZOBA 1JFQL 2VL5A 2Q76A 1OB1B 3D3VE 5I2IA 2YPKA 3QFJD 1BIIB 2FHBA 1G0YR 4ODVH 3UBXG 1S7SB 3C6SA 1UJTA 4LKCB 2CLRB 5ANME 4ZD3H 3U0TB 3W9EA 2PUQT 1A2YB 3GUTB 1EVUA 2F15A 2GJZA 2V7HA 2W92A 2WQ8A 2MCG1 5F1IB 3C5JB 2F19L 3GIVA 4LVNC 4UDTA 1K6QH 5GS1B 2IPUG 2OTWA 1FHGA 1EFXB 4XPAH 1YN7B 3MRMB 1DQJA 5D1ZA 1KLFA 1IAKA 4XAWL 5I17A 3DBXB 4MNQD 5DQ9A 5C0DA 3L9RB 4L9LC 2ZSVB 1GRWA 1A6AA 3V79C 1D9KB 1L6XA 1MI5A 4H88L 5IB5A 4I0PB 3MRNB 1KEML 4P59L 4NIKB 1MCWM 2ZSWA 4MD5A 4O4YH 2VZUA 5EO1A 1IBGH 1ZLWK 3EDJA 1FRGH 1WITA 4OCNC 2CIKB 3SCMB 1QFWI 1AKJA 3MSPA 1U8KA 2JELH 2R0WH 5IVXE 3DLQR 1WZMA 4XNYH 3IJYB 1F02I 4XVUD 4HC1A 2BDNH 1ZA3A 3ARQA 3ULSB 4CMHC 3CX5K 4JO2L 5GSVB 5KN5A 4RRPA 5J11C 4MJIB 4TOYL 4LFHG 2LTQC 4NO2B 1OF2A 4LASL 1UA6H 5D1QD 3IDGA 5DURD 5EIIB 3CZFB 1RZ8B 4HJ0C 4ODHL 5IBLC 3GHEL 3GIZL 4TTDD 2AJYH 2DWDB 1BM3L 4LLYB 2W59A 4NQEB 5J9PA 4X4MA 3N9GH 3ULUH 2AABH 4UT9H 1R5IB 4U1LA 1OAQH 3ZKMD 2R69L 3STZA 2EH7L 4KK9C 3L3HB 4UOW0 4LPVA 4YR6B 1HK6A 3EFDH 1A7NH 3AB0B 5MEND 2IAND 3WKML 2IQ9L 3RUGE 5C70A 3TYGL 4ZTPH 4EVNB 1SMAA 3MZTA 4MB3A 4O2CA 2OTWB 1YMMA 2P5WE 3VDBA 1E4JA 3GSVB 2XN9A 3LAFA 4YDIH 4MWFA 1JK8A 3FB7A 3TVMD 1DQQA 4P9HH 4QRPE 3GMPB 3Q0HA 4OD3L 2X5PA 3OQ3B 2BSSB 3D0VA 4HWBA 4YHLL 3IDIA 4NM4L 5EIVA 1U91A 2HMIC 3BKYH 3T0BA 4O51B 5JOFB 2GIYA 4GQ9L 2E8YA 1T21A 1PQZB 3VFGL 3WNKA 2HFGH 4PJ9D 1KC5H 5AWNL 5C0IB 1UQSA 4DKEH 1K9TA 2W60A 4X6FA 3PGCA 3LD8B 3C6LA 4XAKE 3RNKA 1RUAL 5FFLA 3FTGA 3U0PB 3IU4H 4F7PB 5GRVK 3V6FB 2P5EE 4WJ5A 1EVTC 4Y2OA 1U8HB 1CL7H 3VXTB 3ESUF 4GSDH 4HUUA 4CMMA 5EBLA 4OCMC 3O2WL 3REWA 1RURH 3LS5H 4FZ8H 4Y4FD 4XC1L 1OAKL 4QWWD 1TZGH 4JZJB 3P9LA 4NQCA 4IDLA 1ZLUH 3RA7L 4OI9A 4MXWL 1MHCB 4OGYL 2FDBP 2ZP0T 5GHWL 5A43C 3DTXB 3MRQB 4BSVB 4NUGH 2VAJA 2NZIA 2GITA 4M61B 1UACH 1V8HA 3LPWA 3U30C 5SWZE 1K8DA 1I85C 3GI9L 5FCUL 4LF3A 3FFCE 5E6IA 4QRQB 5FCSH 2CDEB 1EHXA 1OTUD 3WFBH 4FTVE 4YHZH 4D9QE 5F7EL 4C54A 5F1NA 5CBEB 3VXQB 5F7HA 2XZQH 5E4EB 5CLTA 3WO4B 5CEZD 3ARXA 4E41E 2BC4A 5TDOB 1YC8A 3QCUH 3GMQA 4G8IB 4MJ6B 4Q58C 1QSEA 2A0LD 1GZQA 1K5NB 2XKNA 5BJTA 4I1NB 4GUPA 4M6NL 1RIHH 3L3GB 5MERB 4NBZB 5DMKA 4ELMA 3HMXH 4JANA 4Y4KB 2XA3A 1NEZG 3ZLQC 2WBJC 4LCUB 2IG2H 1F45A 3U7YH 1NH6A 3RL1A 3MACH 3QJFB 4W4OC 4X6EA 4YK4C 3RL2B 3IVKB 1D3CA 1T7YA 5BZDA 4BK4A 3ULUC 2R2CA 2W9DH 3FQUB 3U48A 1S7TB 1VFUA 1KCKA 5I6XB 2XIDA 3O11B 1YNTB 1E4XI 5MEQA 3OKEB 3QR2A 4K7PH 3TWCL 1I8KA 4DEPB 2J6EA 4MCZB 3S88L 4OLVL 43CAB 4QRSA 4ZD3L 2P5EA 4LLUB 1OCWH 1MCRA 3UTPE 4OQTA 3OKOA 1CR9L 5CIPA 2DM2A 3X11B 4L8DA 5DGQA 4IRJB 4WI6A 1WIOA 2JTDA 2VLRA 4R0LC 1G7HB 2FD6L 1OM3L 3T65A 3I9GH 4KHXL 1I9RH 3BUYA 5TFSH 1C7SA 1XF4B 4ZTOH 2D0FA 4PV9A 1QR4A 1BQHG 4PJ8C 5GGUB 3WDIA 2DQIL 3SQOL 2BSRB 3C87A 5J13C 4QRPA 3CFBA 3N1MC 2R0KH 4QHKJ 5D1XB 1F90H 2XN9E 1PYWA 3ULVC 4GW1B 4ZO8A 2P5WA 4FFVC 1RUQH 4HBCL 1CICD 3MROB 1NKRA 3G5ZB 4J6RL 3RVXC 3H7BA 3T2NL 1MFAH 2GY7B 3LEYL 4UQ2B 4N0CD 4TVPH 5IBUG 1QLEH 1P4BL 4KKLD 5IV2A 4HPOL 2HKFH 5E94B 4NWTL 1WJ3A 2L4OA 4CL7A 3LCYA 2N7BA 2VQUA 1BVLA 3KXFE 3UP1A 2X09A 4QRRB 1FNGA 2VR5A 1DQDH 1JMXA 4HH9A 4RQQB 4KKBD 5L2JB 1MJ7L 2ESVA 3QUKA 3JTTB 3FO9A 1A6WL 4KKCC 4IIQB 4TRPH 2C1OA 3CSYA 4PJAE 3AU1A 3IKCB 5E5RB 4ZSOA 1OPGH 4X98A 4UNVA 1AFVL 2GSGA 4U6YA 4WTXA 4Y4FB 3KWWA 5HYIA 1JWMA 3T0ED 1J0ZA 3BKMH 4GRLA 5AZEH 4NNXA 5C0GA 4KVNH 3V6ZB 4JM4H 1TJGH 1FG2A 3VGFA 4U7SA 3WLWC 1T0MB 2J5LC 3HUJE 5A16B 4MCYB 2Q1EA 4K07A 4X5XB 4CU6A 3EGSA 3SKOB 1HWGB 3Q2CA 1RHHB 2FJFB 5DO2D 2QR0A 5EOTA 4RCAA 4CADA 1CIUA 3AMLA 4JFED 1BZ7A 5CJQH 1T22A 4XNXL 5B21A 4H20L 3G5YA 1T2JA 1KNOB 1VEOA 5FO8B 4DKDC 3TPKA 2OJEA 1KC5L 4N0UE 4FXGA 4DTGL 2AGJH 1HSBB 2DI8A 2Z8RA 3TV3H 2ESVE 3JZ7A 1FSKC 5DRXB 4X5WA 25C8H 3SPVB 1XGPB 1NCWH 4EDWH 3V7AG 2J8UB 5DHYA 2Z91A 3ZKXB 1QNZH 3LSOA 2VUYA 3EZJB 3KS0H 4G5ZH 5CBEA 4F7TA 5FGCB 1AE6L 1RUMH 2VLME 4Z7VE 4PREB 1IGTB 5DZLA 2BXYA 2AJZA 4RAHA 2BNQE 5F9AC 5T1LD 5JNYA 4NQED 3T8XA 3N1GC 4NQSA 4BH8B 4F80A 1K8DB 5FGRA 1AXSA 3VU2A 2R9HD 5DURB 2G60H 5DR5H 5F7NC 1HCVA 3S4SG 4KK8D 1DSFL 4Z5RA 5F6IB 2HJFB 1E4KC 1BVKB 1HHGB 1I8IB 1KIRB 3WL9B 1IGCL 2J4WL 4X99B 3L3KB 4FQXA 1DE4B 4PGDA 2AJVH 3SDCA 4EUPB 5K9OA 1J8KA 1BBDH 1M7DB 4P2QD 1D5BA 4N5UA 3QYCA 2FWOA 3OV6A 4ODSL 3RDTB 4PJGA 2BXZA 5KW9L 3QJHA 3UROR 3UJIH 4U6XB 1C7TA 5KVFL 4OCRL 3V6BR 1QLRA 4MLIA 5H94B 4OFKA 1A6UL 4CN4A 2AJSL 3MV7B 5IESH 2LU7A 4KKCD 4HK0B 5GRJH 4E42A 4UV4L 1JF1A 5T5FH 3MV8E 3DX8A 5EUKB 2X4RA 5JHLH 3B3IB 1VEPA 1JPFA 1XGQA 4LSQL 2YK1L 5I76B 1MFNA 3TNNA 3IDNB 4Y5XA 4X4ZA 4MAYA 3U4BL 3G6DL 5C6PB 4K3GA 3O3AB 5DEFB 2VRAA 5HYSB 5B3NA 1FG9C 5FYLL 3I6KA 4LIQH 1MRCH 4KUZH 4C55A 4LGSB 2A6KA 4MDJA 4O2EB 1FH5L 3UYRL 4JFFD 1CFNA 4Q74A 4X6CF 5HHQA 5GS0H 1EX0A 3L3HA 4YR6A 4JPWH 1RUKL 3MV7D 4PS4H 3L7EA 4GT7A 5BV7B 1RPQA 4E41A 4G80A 3CLEH 2P24A 1KLGA 1QEWB 1WFNA 3O41B 2ICEA 3HC0B 1MFBL 1N4XL 4NKIL 3RAJL 5LGJA 4FQHB 3DVNA 3UTQA 4YC2B 4YUEL 3OB0H 2X10A 1NBVH 3GMNA 4AT6A 5CSZA 1BFTA 1UKSA 4X8XA 4QNPF 4UUJB 4NO0A 4R7DB 4FXKB 2LE9A 3D1MC 4HJJL 5ALCH 5C08D 5DUMH 1KT2A 1HHKA 4YDJA 3NFSL 4WHTA 5GGRB 1U8IA 3QNZB 4LHUD 2FJHA 4NQCD 3BPNB 1G7QA 4Y5YA 1F3RB 5D1QC 1X6LA 1BWMA 2EKSB 1GOFA 4LIQL 5I0ZA 3FQRB 4ZFGH 1NBZB 2LVEA 4M1CD 1IEHA 4WIQA 2FX9H 5HGHB 3QT2A 4I0PA 4NCC2 4HWUA 2NX5B 2VABA 3EKCA 3CFDA 4JKWA 2DKMA 4KK9D 2BNRB 1F3JA 4J3TA 3N1PC 2YD3A 4FQCH 3WNPA 1IVLA 4JY6A 2GK2A 4HWNA 1S7XA 3RVTC 1UWEL 1E6JH 1MQKL 2V6HA 3BJLA 4EI6A 2F5AL 4K7FA 5D7SL 5GS1A 4Z77B 5D93C 4LSUL 1A4JB 2HT2D 3QRFM 4G7VL 4C59B 1C5CH 4XHJD 1MWAA 4F2MA 5EU3B 4OUUA 1CL7L 2Z4QB 1A02N 5IB4A 3RWGB 1KPRB 2DN7A 2DMKA 1MIEL 2D2OA 2EXWC 3LQAC 3PHSA 1YQVH 5ACZA 1BIIA 1TVHA 1UGNA 2VL5B 3B2VL 2HTKC 2BY2A 5IB1B 4G43B 1NGZA 1CGXA 2X7LA 1IQDA 3A6CL 4ELMF 4P9ML 1FFOB 1V3JA 1XZ0A 1DCLA 1K3ZA 3LH2L 4LCWE 5EU7C 5KSBF 5CLWA 4R8WH 2H6PB 1J8HE 3F7YB 1U8QA 4GG6F 2FNBA 4ONGL 4Q6IA 1CLCA 5E00A 3RZCA 1HN1A 3JTSB 3O6KH 1T1XA 2PTTA 3ARDA 3X12A 2H8PB 1KCVH 1YC7A 3QXAA 4ISVA 3ARBA 3L5XL 4NCC1 2P47B 3WFBL 5JPNB 1ZLVH 3ZSSA 1R5WB 1PDKA 4D9LH 4Q9RH 2IH3A 3IF1B 3VXNB 5D4QA 3VGGA 4GKZB 3EJZC 1MLBA 4P49A 3DETC 1Q72L 3DGCR 1B6DA 2OL3A 1MY7A 3OKDB 4N0UB 3N85L 1EMTH 2ADGA 4HFUH 4IBLT 3W0WB 2L7UA 2W1NA 3QIUA 4LLQA 2Y7QB 2R1XA 3QXVA 5AG9A 3SDDB 4XBEH 1JZ3A 3RFZC 3F5WA 1MCEA 3V5KA 3VRLE 1AGBB 4XPBH 2XWJA 4OAWB 5GRJL 4JVWA 3TF7C 1WZ1L 4MS8D 3WIIL 1HHJB 3MLWL 4XAWH 4OI8A 4ZQKA 1UT9A 1HKLH 1MPAL 3VXRA 3T77A 1ES0B 3DHMA 3RWEA 3DV4B 4MA1C 3VXSD 3FOLB 4L1DA 4IRZH 1NGWB 3OR6B 5D7LA 5C6WH 4KJWC 5H37G 2A73A 4PJ9C 1A7BA 5FYKD 5EWIL 4S0TD 2CK2A 2NYYD 4UBDD 3GBNL 2NY6B 2NY3B 5BZWB 2HLFD 1BBDL 2IFGA 4ERSH 3GSOB 3CD4A 1P84J 3D39D 5CJBA 2YR3A 1RZGB 3NN8A 4KMTL 2MNUA 4P5MA 5C8JA 5JQ6H 3O6FA 3LKNA 2ZCLL 4ODXA 2BRQA 2A77H 4FQXC 5JXEC 5SWSD 1MIML 5D2NB 5C0BE 4IRJD 4AY0A 5T1KB 1C08A 3CLEL 3NH7H 1HILA 5FDYA 1B2WL 3RAJH 1JHKH 5EPMA 1JPGA 4PJDA 4LSRH 1A5FL 3W11C 2YEZB 3I9GL 3BP4A 4MLSA 1CD0A 1T80A 3H3KA 5E5MA 3GJEB 4GAGH 4YFLF 4HG4J 1DBJL 5L8KB 2EH7H 1DJSA 4K8RH 3BPOB 5CZXC 1EO7A 3OX8B 3G6DH 1H0DB 5K9KB 2NY2D 1YDPA 3WD5L 1KPUA 2BFVL 5EC1A 3WBDA 1I3RB 2YKLL 3IGAB 3FQXB 3T04D 4F7MB 1G84A 4NT6A 4JG1L 2IFFL 4ERSL 5BCAA 1MCSA 3MRPB 4ZFGL 3V7MA 5KSVA 4WU5B 1ODAA 1PY4A 2E7MA 4O58H 4U1SB 5KSBA 2ENYA 5B38B 1V3LA 2DQTL 1CK0L 1FJ1B 3BKJL 3MA7A 4EIGB 4ONOA 2DMCA 1F3DH 4W4NA 4XNZC 2BK8A 5IQ9A 3O0RH 4MMZC 3WE6A 5ITBH 2ATKA 4MDIB 2OBGA 1ZSDB 2QHLA 3P0GB 1D6EA 1CGWA 1CDCA 1CG9B 1ZT7A 3MMEB 3HNSH 5LAXB 4RGND 3QNXB 5DJ2B 1HDMA 1NCDH 1EHLL 1RZKH 4X8JA 1NBVL 2GHWB 4CVXB 4HPYL 5IEKB 3KPRB 4XMKL 5F7KC 3BP7A 3KPSA 5I30H 3FQWA 3SKJL 4GKSB 5I1EL 5DMIL 2DQFB 3ZYOA 2DQIH 2O61A 2QSCL 3ESVF 3KLSA 3VFWA 4PJ7B 1EERB 5I1IH 4QTIH 3HLAA 3SE4A 3WEXA 1RQ5A 5I6XC 3ZHDA 1A6TA 1FIEA 2VWEE 2Y4SA 4D2NA 4I18C 5J11B 3W81A 5GJSL 3T09A 5T1LA 1DVFB 5IKCB 2FBJH 4BELD 4NRXA 4KPHH 3PWPD 4NKOA 1IL1B 1BQHB 5SWSE 2QQLL 5EU6E 5D7JA 5TF1L 2XV6B 1S7WA 4XCEB 2XQYK 3MRLB 3AAZB 5FOJA 3DMMD 4KK6C 3VXMA 3BGMB 4TSBH 1U3HA 5ALBL 1OVZA 5M94B 1A7PH 2Y36L 1JTTA 1DQDL 1DQTA 5I73B 1RJCA 2D3VA 2BVOA 2AK1L 4XCNB 5DEGA 4NNPL 1J0JA 4I3GA 4UAOC 4D0DA 4PJ5E 4LASH 3RNQA 4LDOB 2QQNL 5DZNA 5SWZA 3HE6B 5TQ2L 3T3MF 4HUWA 3THML 5JMOC 1MHEA 4P4KA 3SCMC 4K94H 1KN2L 4OD2B 4PJAF 1TVBB 3MLYL 5CD5C 3BOVA 1QFHA 2QV2A 4NCDA 5DRZA 3SN6N 5KBNC 4YIQA 1L0XA 3IDMA 1M6OA 1ZHNA 3TVMB 5E7BA 2FGZA 2IC2A 3H42L 5EZJB 1SYSB 4LSSH 1TJHL 3RHWF 2Z31A 3MODH 3PGDB 3EO0B 3WXVH 3HUJF 2I07A 1VDGA 1XGYH 4YHLH 5DRWB 4H8WC 5D7IB 4L4JA 3QNYA 4PGBB 3T3ME 1IT9L 5D70H 4WW2B 3F6LA 5DJCB 4CBPA 4JFFA 1MF2L 4R90L 2F58H 4YHNA 4TUJB 4TSCH 3TYFB 4FG6C 4YHMH 5CEZE 4OZIA 5BVPL 2C7UB 3BQUA 4XVSL 2AK4B 3V4UH 4CNIA 1EEUA 1ADQH 1NANI 3P9MB 3OR7B 5GGRY 3EW3B 3DJ9A 3WFHB 5C08B 1DDHA 2R15A 3SE9H 3WUWG 2PR4L 1LWRA 1G7IB 4OZGA 3WV0A 4NO3A 4S1SH 1RU9H 4I2XE 2V2XB 4U6HB 5E2WH 1YYLH 3K8LA 1KEGL 4PG2A 4L4TA 1LNUA 3OG6B 5C0EA 2KKQA 3INUL 5JHDE 4IRZL 4XZUA 5TDPA 2I60L 2BZDA 4N5ED 1A1MB 2FYYB 2CDFA 3AREA 1RULL 3L3JB 5E95B 5DQJA 3OAYH 4RIRB 4ONHB 1X7QB 1QKZL 5DVNA 1J5OH 3S98A 5F7EH 1EHNA 1SYVB 1A6PA 4PLKC 4X7TB 4I9WD 5I8EB 4LRNL 4G6ML 4PJ5B 1TMCB 4XRCA 3HRPA 4MD0A 2PW2B 5ICXA 3U1SH 3U79A 4F33A 3HZYB 1BEYH 2IJ0C 5JW5A 3PV6A 3RGVC 2LQRA 1J0IA 3QHZL 2OZ4A 1YEDB 2R2HA 2DWEA 4UV4H 1D6VL 1DVFD 3I6LD 4L8CB 3DX7A 1S8DA 3KGRA 4AIXA 1K4DA 2GEEA 4XC3H 1SEBB 4PTTB 2OSLA 1BLNB 4FN0A 2DLGA 5I1LA 3U7YL 4U1NA 3BDYH 2VB5A 4JFPB 3G5VB 1UFUA 1G9NL 1NCAH 2R23A 4KKAD 1MHHB 3PWNB 3SO5A 2ATPB 5DSCA 2ARJQ 2DBLH 3MLVL 1ND0A 4PJAA 2IANE 1ZOXA 5D93B 4RGNB 1EAPA 3QO0A 5FOBB 3FHAA 5E99H 5FUZH 1RI8A 4AEFA 1JMZA 2ZOLB 4N8PA 5F71A 3PIQB 2F54A 3UBXA 4JPWL 4LHJB 4ELKA 1JI2A 1HQRB 3B5HA 1TCRA 1PEZA 2XRAL 4PLKD 5HYSG 3O0RL 1LP9F 5GGSY 4Z7QF 5DJ8A 5IHUL 2ZUSA 3MRJA 1ZGLP 2OP4L 3NIGF 2CK0L 2VKXA 4OFYA 1BD2A 3MNZB 3LKSB 2KZ1B 5F93C 1F2QA 3RGVD 3DO7B 1HQ4B 2Y06L 4W81A 1ZAGA 3BPCB 4XWOD 2VXTH 4L3EA 2OTUA 4ZPTB 1UM5H 2IF7A 3KPPB 3HE7C 4DEPC 4H88H 3WXWH 1H8SA 3UMTA 3ETBF 5E0QA 4LCWB 4QNPE 1FNSH 2A6DA 3LQMA 2VLKB 3BZ4A 4B41A 3QI9C 3LZFH 3OAUL 4XVTL 1FYTE 4X80L 3BZEB 1QSED 2EZ0C 1EGJL 2PXYC 5GHWH 3FO0H 4AEHH 5C09A 4NYLB 4YXLL 3SGJC 2UV3A 3VW3H 1GAFH 2RHEA 3GEWB 2DDQH 4GAJH 2NLJA 4D8PA 5C0NC 1B0GA 3LQAH 4JB9H 1JN6A 3MRGB 2ERJC 1N3NA 4YNYA 1T5XB 5IMLA 3QIBD 3SDAD 5T5NF 4URTB 2IGFH 3WJLA 3D39B 2BVYA 4TULL 5D1XC 1LVEA 4Z8FH 3CVHB 2RFXB 1HINH 1YPZE 3PUCA 4XCYB 4C58B 2NY4C 1CD1A 2X4PA 5F7MC 1RUAH 2YPLE 4Y2DB 3P4MA 4KVCH 1RD6A 3EYUH 4OZHF 4J8RB 4PJCA 4U31A 1RFDH 5HHOA 3QO1A 4NC1C 2V9QA 5JW4M 1TQCB 1MJJA 3NCYP 4LEOA 4ELME 2H2PD 1PSKL 3K4ZA 4QXTA 3MBED 2WIMA 3CDGA 4N0FA 5CGYD 4ETQB 4NPYA 1OTSD 4FMFA 4C56D 2DJ4A 4OLZH 3MV9A 4NP4L 4YDIL 2A0LC 4KQ3L 2VLRD 3K4DA 1A9EB 1PEWA 3HMWH 3GGWB 1Q9WA 3UPAA 3U4BH 3ULVF 3S37H 1NGXB 5LGHL 4ONGH 4Z78A 1HXYB 2VITB 3FJTA 3QQ9C 1TNNA 4HIEA 5FF6B 4U1HB 5L9DL 3CFKA 3KAAA 4BQ8A 1N0XH 4M7LT 3BRDA 1Z5LA 4JG0L 4OM1H 3MXVH 4HUXB 2L7JA 1MI5D 3PHOA 1JV5A 1NAML 3O3DA 3AC0A 4ODWA 1Q0YH 5CWSA 1U3JA 4Q9QH 3VRIB 3FT2B 2VE6A 4P4RB 3NZ8B 5EN2B 3IU3B 1N2RA 1KELL 4G6FD 3OJVC 4WI5A 5EIQA 4Y2DD 3D85D 2EKJA 4HF5H 2G75B 5JIPA 3T0EE 5I19H 2CLZB 4H5SB 4MQ7A 1OAZL 2Y07H 3OKMB 2BSTB 4NQCE 4PJHB 5E2WL 5CP7A 4XP5H 1CDBA 2B4CC 2X4TB 3L5WA 1XGRB 1KYOJ 5C08E 1VFAB 4PJIF 4HV8A 1R24B 2Z8WC 4XWOC 5EBWB 3U9PH 4LKXB 4I2XB 2H9GB 2WINB 3WD5H 4ZDHB 5GIRB 3DPBA 2HJLB 4L4VD 3TZVC 5DJZA 4DJMA 1CDGA 4DN3L 3V8OA 3ARPA 2F54E 2FBOJ 1AI1L 1CT8A 1NC4A 1YEFH 5J12B 5TE6L 1U8JB 1CL7I 4PRPE 5D7KE 3HCVB 4AQOA 4CVZA 1A22B 1FN4B 4U0RC 5AUMA 2AXFB 1U3HD 1TTGA 2FEDD 3MFFB 1MRFL 2MFNA 1FGNH 2YD6A 3QPQC 5EU4A 1E4WL 1B90A 4LARL 1JZ4A 2BDNL 2MOVA 2ZPKH 3MRIA 1MCKA 5INCA 4RMWA 3LQZB 4BFIA 5EO9B 1SVCP 1MRDH 4M6OH 3TC9A 2XN9D 1CFVL 3SBWA 3OZ9H 1VKXA 3TT1L 1KXTB 4S10A 1I9EA 3EJZD 1YMME 3OGCA 5GISH 4XCCL 3DETD 5J4MA 4JDZB 4P2OD 2H32B 3RZCC 3OBAA 1NUFA 4RFNC 4WO4B 3DHJA 2ITCB 1DLFL 2DQGL 1DUZA 5C6TH 2YRPA 3SQOH 5DJXA 4F15C 3DUUA 4PJ9A 4Q0XH 1IRAY 5HSFA 1F90L 2B1HL 1EBPA 1S7VB 1ETZB 4NQDB 5CBAA 4XT1C 2YUZA 1AGEA 3IETB 1A1NB 3KS0J 5DUBA 3HC3H 2ICCA 2J6EH 3MJ8A 3FT3B 3ZO0A 1M7IA 1MJUH 3GSUA 1M05A 3ROOB 5HJ3B 2J8UF 4OBSA 2WP3T 1NCNA 5E8NB 4DGVH 4KKBC 1K2DB 5LQBL 5BXFB 2AI0L 2BRRH 3ULVH 1R3IL 3DGGB 3QUZB 4UINH 1QBMH 2CLVA 5KVGH 1MFDL 2BY0A 1G9ML 3TZVB 3HG1D 3TV3L 2YZ8A 4K3DH 4TVPD 1AO7E 4WFHD 4ENED 4FFYH 2Y06H 1MCQA 1J1PL 1KCUH 4KC3B 5IROC 3VCLB 1T6WA 4KJPD 1IFHH 4LVOB 2VERN 2CUIA 1U8NB 3HI5L 4KXZI 3W39A 4PJ5D 4K55A 4DCQA 4QTIL 3DXAA 3PWLB 1S9VB 4M7ZC 1BFOA 3V0WL 1CFTA 2J8UE 2RIKA 2HN7B 3M1BA 5DK3A 5GSRB 5I1JH 1DBML 4TPRH 4QHMA 4EIZC 5A3ID 4X9GA 4JZNA 2ZUUA 4JO3H 4AM0B 3KPQA 3ILQD 1NCTA 2XTJB 4LSSL 5EOCH 3SDXE 5IT2L 3LKQA 1UWGH 2XTLA 4AM0A 3HAEA 1QFPA 2FIKB 3KDMB 4XNXH 4FZEL 2EDXA 1H3TA 5DWUH 3S34H 3K2MC 4L9LA 2R4SH 1FAKT 1UG9A 4YHZL 4Q9CA 1MF2H 4MJ5A 3IDXL 2IAMC 1NFDB 4GAFB 5B39B 2CRYA 4FQJH 4RFEB 5F70A 2JJSC 3O4OB 4LHUG 3T1WA 5GS2D 2YXMA 4HCRH 4I5BB 3BIAX 5MENB 2XA8H 1EEZB 5ESVA 2JJTC 2XNAA 4JPKL 3UTSA 1G7PA 3VFVA 3GB7A 3U7WH 4LPTA 4QRRE 4GAGL 1OARL 4MXWH 3LKRA 5AZ2L 5DRNA 1J05B 3MA9H 1DLHB 3MACL 1OSPH 4QT5B 4YEFA 4IIQC 4PJ8B 1S9WA 5ERWA 1JYXA 1A7OL 1ONQA 5CJQL 1FVDB 1F8TH 2DQDH 4X5LA 3MFGB 1KCRH 1B4JL 4L1HA 1QFWM 4NKMB 1JFQH 4MAUL 5EZOH 3Q6GH 4QRPD 1JGLL 1D5ZA 1I75A 1V7NH 5DTFA 1E6OH 4WO4A 5EU6A 4M3KB 4DKAA 4OGAD 5GGVY 3S3JA 5D6CA 3C6LD 3IDYB 3S35H 1KENL 1SJHB 3ZDZF 1N64H 3A67H 4OTXL 1WFUA 3S36H 5CEXB 2VXSH 3QCUL 1T2XA 4U1IA 2MQCA 3V4UL 1CVSC 4GXUN 1MFBH 1KIQB 5T1MB 4A6YA 1MRDL 4IDJH 1ZWIB 3DARA 1K4CB 3L1OL 3VWKC 4DOHB 1QRNA 2JIXB 2NY6C 1HOCA 3EO9H 4FABL 2DMBA 4MQTB 4XWGH 1I4FB 2FD6H 4UB0H 3MFFA 3KPSE 5C1MB 2F5BL 4GG6B 5LWYH 4L3ED 4UDUB 1X5IA 5AZ2H 1HYRC 3MTRA 5E9DD 1EFQA 5ESAA 1R3LA 1YPZA 3HUJB 4F7EB 4JRYD 1NCCL 1XR8A 1CT8B 3ARGB 4GBXB 1EDQA 1IJ9A 3D39E 4YHIB 4N1HB 3OKLA 3IAPA 4PJFB 3S4SA 3VMNA 1QLFB 2X4QB 4HUKB 5B38G 1F13A 5KSUB 4ZDHA 3V4PL 4ZFOA 2O5YH 3S96B 1R24A 5EBWA 5C0JA 2YSSB 1XF5B 3T2PA 1Q9KB 2EE2A 4ZUWB 3W2DH 2P48B 4L8BA 1FP5A 4MAUH 4N0YL 5EZOL 2QEJA 3MV01 4NQXB 3RVWC 3HS0B 4MJIE 2D03H 1ERNA 3LRSB 2DIBA 3H2WA 4LSTL 5BO1L 4APQB 1C16B 4I0KA 1AD9B 2EYRA 3NH7L 1K8IB 2I25N 2FSEA 1DBBH 4LEXH 5C0FA 3LEXB 2VMFA 3UC0H 3S7GA 1A7RL 3DUSA 3DURB 3KYOB 2DTSA 5IIEA 2E9IA 1D6VH 1VFBA 5I71C 4IJ3C 5DD3H 4PG2C 12E8H 1HH6A 4YE4H 3CH1A 3V8CA 4LVHB 4NQDD 4PR5A 1Q9OB 4EZMA 3MLXL 3BO8B 3CGTA 3PHQA 4YPJA 1NEZB 4XVUC 2HFTA 4ZAKA 1EXUB 1KEMH 5TE4L 3MBEA 4XXDB 4TSAL 1N7ML 5HVFB 3QXDA 1KTKE 3I02B 4N68A 1FNAA 4HQQL 2WWKO 3TBVB 1FRGL 3KYNA 2GK0A 1I7TB 2BOBB 1UXWB 4OSUL 3QFJE 1XEDA 3D3VD 2NY0D 5T3XD 5F88B 3ZTJH 4XPHH 3F12A 3G6JA 1JYVA 2CO7B 4U7MA 1IMHC 1SMOA 3LN4A 2G2RA 4FQCL 2WIIB 3BGFC 3ULVL 1U6AL 4WTZG 3OAZH 4HWBH 2AJUL 3LV3B 1DVFC 1Y0LA 1J8HB 3PJSA 4MA7H 5DK0A 4S1DC 1YA5A 4PJIB 2XXMB 1AQDA 4I0CC 2D0GA 3T4AA 4JQXC 4W6YB 1SBSL 5L6YL 3FONB 2LVCA 3AM8C 5DD3L 2X1QA 2FJGA 5T1KD 4FNLH 3VXUE 3SDCD 1MIEH 1JHTB 4LLWA 4PJGF 2WUBL 5H35A 1OAUL 2A1WL 1B0GB 4LCIL 4X6CB 4QO1A 5F9WB 4X80H 3QUZC 5DVLA 4NYLA 2NY6D 4LFHD 3P30L 3GRWA 4M03A 1QQDA 3FCTA 3QWOB 3SKNA 4JFOA 3MRBA 5HPMA 3CUPA 5JO5A 4YHPB 4OD1L 4DGYH 1DSFH 3EOBA 1QBLL 1FGVH 4U1JA 1NUDA 3JSSA 3MRCA 1Y0LB 3LV3A 1G7JB 4H1LA 2J4WH 1A7OH 1YPZF 4Y5VA 2WIIA 2KBGA 4HIJB 3B6SB 5IFJA 2ZUWA 1IGML 1FVCA 4F3FA 1W0YT 1C12B 4QGYA 2HG5B 3VFPA 3O6LH 1A7QH 5CJ8A 3KLAA 2H2SC 4L4TE 1XF3A 4AJ0A 4PY7B 5DHVB 1IM9D 5BVJB 1BZQK 3E3QC 4HKZB 4CN1A 4RISL 4A2MA 2LV4A 1JNHB 1U92B 3RX8A 3O2WH 4JKLA 5ISZB 4PRNA 2QQKL 1PKQE 4S2SB 3TFKC 1JNLH 5CINL 5I1KL 1HQRA 3PHQB 3VWJA 1KJ2A 4X6DF 1ITBB 5CD3A 4ELKB 1NCUA 1OTUC 3ULVE 4JVUA 1ZHKB 5CCKL 5L8JB 1INEH 5CUSL 4X6BA 5C07E 1BAFH 3KYOA 5IIEB 4KK5C 1U36A 1FO0A 3TIEB 3AVEA 3N06B 5LGHH 4ZUSA 2DTMH 3V0AC 2RGSA 3GKWL 3B9KA 3F58H 4X7SH 2IALB 1WZKA 4HXAL 1EUTA 1WGOA 2MCPL 4ODTH 4WWKD 4JAMA 3F6IA 2XPGA 5JDSB 1PX3A 3CK0H 1DL7L 4PRHD 4MZ3A 3W2DL 4XP9H 2FHFA 1NUNB 5E56A 3MCKB 4HKJA 3ARSA 3OPZL 2I27N 4KY1L 5SV3A 4N8VG 4N0CC 1YN6A 1YEDA 4HUNB 1JJUA 3GSNA 1UC6A 5TDNB 3TA3A 3UYOD 2YC1A 3D0LB 4PJXE 5MEPB 2E9JA 3SDXB 1E28A 3AY4C 4KHTL 5DJYA 4NOBA 4FFZH 2YD7A 4DN4H 3Q5TA 1HEZB 5JXEA 3MJ9L 1ZXQA 5E2JA 5TFSL 3TA3C 4NQDE 3TBWB 3WN5B 4CJ1A 2H26A 1TITA 4GG6A 3M8OL 5CSGA 4DVRH 3V6OC 3PXHA 4N1CA 4Y19B 4HJGA 4M5ZH 5E2UL 3EFDL 2NX5D 3HC4L 3L95B 2K1MA 2B1HH 5DQJB 2I60H 4WFFE 1P9MC 2VLLA 2YD4A 1KIQA 1ADQA 5EDXA 1CDHA 3QEGL 4A6YB 5E8OB 1H8NA 1MAKA 4S1QL 1AC6A 4QHUA 4IRJC 4PBWD 2NY5H 3VFSB 4Z0BH 5SWQB 2DLHA 1PBYA 2KDGA 1VPOH 4HFWA 1G6RL 4JHBA 2EDNA 1ZA6B 5LVEA 5KSAC 1LE9A 1G7IA 1OTTC 5FUOH 3QPQD 1A7PL 4X0KB 2P1YA 1D5XB 3KYKH 3QIWA 1OGTB 3DX6B 1FVDA 2WUCL 1JUFA 2IGFL 4KI5E 3QQ3B 4M6OL 5F97E 4XH2A 3WKNA 4PRHE 3MNWB 4CNIB 5ID1B 1SBBA 3QUYC 1KBGH 2P8LA 3BEVB 3G08B 1HNGA 4ZTOL 2BNUA 1C5CL 1PKQB 2IADB 4JY4B 3MV8A 1RIVH 2X41A 1CU4L 5DEZA 4UTAL 3WLBA 1D9KD 3ZTJG 4DUWA 1FFNB 4F7CA 4WRLA 1IAOA 4MNQB 4PJHE 1T3FB 4MAYD 3QSKB 4NZTH 5E2TH 4P23B 1FL5B 5JQHC 2X44D 5J6GB 5GS1C 3BIKB 3N1QC 4Y16A 1FNLA 4OIAA 1EJ6A 2NMSA 43C9B 4PY8I 3IAQA 5EZJA 2UWEF 1WAAF 4WNQA 3SY0B 5K9QG 4M6MH 4HS3B 5I9QB 4XP1H 5I8CB 3I6LE 4FZEH 4CAGA 4F37K 3QZWA 1CZ8H 5ITBL 4MSWB 2WLYA 3BPNC 3KR3H 4P99A 1EAJA 3GSWB 4UIKL 4AZ8A 1WT5C 3HE6A 3ARED 5SWZB 4ENEC 4FFYL 4HPYH 1KB5B 1KCSH 1LK3L 1U95B 3IFLH 3QCTH 4JZNB 2DKSA 5INDB 4XBPA 1IAII 2ZZUT 2HN7A 1T1ZA 2HFEB 3SJVA 4PYHA 3QDJA 1WWCA 2J3SA 4R6UA 3BPLB 3T4YA 4UTBH 3MLWH 3P30H 4BH7A 4HK3J 3QG6B 2CGRH 4GG8A 1P7QD 1HZHH 5DK2A 3VFNB 2GTWA 4BUGA 3U9PL 4MNHB 1FL5A 5DXWA 4PGZA 1A4KB 1QFWH 3QUZA 3O6KL 4NM4H 2X4UA 5DJAA 1V7ML 2PF6A 3GMMB 3DX9A 3HE7B 1P5VA 3O4LA 1A3QA 4P2RB 3O3UN 4J4PC 2ZCLH 3QI9B 4CVXA 1KB5L 4GBXC 4WWKB 1T1WA 5T3ZH 3SO3C 5IP4A 1EK3A 2JCCB 4UQ3B 4CRPA 4ZXBA 5EA0H 4OCRH 2BHUA 1D6EB 3DI3B 4FQQA 2E27H 1HHIB 3MLYH 4O9HL 4PJFF 1OM3H 1NFIA 4LLVA 5EFIB 1ZK9A 3JUYA 1FJ1A 1DUZB 1S7UB 1WTGT 5HGBB 5LWYL 3QA3B 4M8VA 1RZJC 5CD5D 2XACC 3T2OA 3HPLA 2YMXH 4F7MA 3OB8A 4QHUB 4CDHA 2EDDA 3IKKA 2BFVH 1I8MB 3JV4A 3QEGH 2O5YL 1HWHB 4KROD 4JM2A 1LMKA 2ADIA 4R2GC 1H3UA 1GGBL 1V7MH 4L8SC 5MEOB 4HJGB 2E8ZA 4XP9L 1NGYA 1CF8H 2G5BB 3D3VA 4LSDA 3KYMB 1B3JA 3TO2A 5CHNA 5ENWA 5I75C 1KFAH 4OGZA 4KQ4H 1AXIB 4PP2A 2XTJE 2WUCH 5GRXG 3VI4F 4Z7VF 4E5XA 1MJ7H 3TIDB 2OI9B 1JHKL 3ABZA 3VG0L 3DYMA 4DZBA 4YXKH 1C08B 4JKPL 1E4XH 1CVRA 1UJ3A 2HFFA 2NY3C 3GSXA 1TIUA 4EXPX 3FB6B 1UVQA 2A9MH 3WUWA 3GIZH 3GHEH 2X4TA 1Q9LB 1VACA 3RVTD 4OZ4A 3BVNB 4PGEA 3QEUA 2OQJA 4IRSB 3TT3L 4LHQB 1AIFB 5E9DE 4AYFA 3HC4H 2G75A 3SGKA 3HI1A 4JN2A 1HCFX 1S7RB 1YECH 3KPRD 1NGWA 3RPKA 3K1DA 4HZLB 3FT2A 3GSNL 5E6YA 1KXVC 5TH2B 1I1AA 3Q6FA 2YN3A 3B9EA 1T66D 2J7LA 3QISA 3WFZA 2B8OT 2FECI 2NXYB 4J1UA 4LP5A 2F53B 2GI7A 4AL8L 1DN0B 5D72L 4P2RE 4QOKE 4S2SA 3BKYL 3S34L 4JQVA 3N0PB 2VITA 2VDOL 4P2OB 4LLQB 2V17H 1AR1D 4ZOEA 4I8DA 4G9FE 1OLZA 4ODHH 5ITFB 3P9WB 4G7VH 2RQ8A 3IF1A 1T89C 4FP8L 1P1ZA 1SEQL 4PBXA 3VFUA 3VFPB 5GZND 1RUML 3BRGC 1A7NL 1RURL 4FZ8L 2XKSA 1I1FB 1KTLB 3QDME 5DJDA 5HHOB 2P49B 1T89A 3I6GB 4K3HA 5D71H 3WS6C 4YDVB 5JHDB 4Z7UB 4BZ1H 4AG4L 1LE5A 2H6PA 4J8RA 4PJCB 5ANMB 1BFVL 5HGGS 3R8QA 7FABH 1MFAL 3LEYH 5F7FA 5DFWH 1YUHA 1Z9LA 5ID0B 2WZPD 4WTWA 1TZIB 1UWGL 3IJHB 3QWQB 1NEUA 5DA4A 2K9UA 5JLZA 4Y4HA 4PRID 4RA3A 4NHUA 1JRHH 4C83A 4XVJH 4LPUA 1ACYH 1FQ9C 3MRGA 4HWBL 2XWTB 3IRPX 1FE8H 4Z18A 4LBEA 3FO1B 5H2BA 3ALXA 4N1EA 3EYFA 2IBZX 4D3CL 2ZNXA 4R90H 2X1OA 1A21A 2AV1B 4TUOA 1AR1C 1X5KA 2R56L 3FQTA 3W5MA 1WIPA 4BQBA 4KZDH 3STLB 4Z7NF 2CH8A 3O2VL 1I1FA 5CJXA 1G9MC 3MLUH 3ARGD 2NNAB 5DJ6B 3ZKMC 1MNUL 4JLRB 3BIBX 2IH1B 3ZL4H 5IJVB 3CX5J 3SE3A 2CUHA 5A2KH 4L3EB 4K2UH 2A6JA 32C2A 3UAJC 4KTDH 5KANG 1QYGL 4PJGE 1UWXH 3A6CH 1AGFA 1YQ2A 3EYVB 4KTYA 1INEL 2GK0B 5CUSH 3LKSA 1NGQH 5SV4A 3UTTE 1TLKA 3VXSE 3V2AR 3RZWA 5D7JD 3X3FL 2CDGA 3U36A 3QQ9D 1JGVL 4Y8AA 1F4WH 3PXJA 2M2DA 4PRAB 4FFWD 2ZJSL 1UEMA 4XVJL 4WUUA 2IPKB 3CFJA 3F7RA 1YNLL 2PYED 1CE1H 3BO8A 3RY4A 1NAMA 4C4KO 4WFED 2KQMA 1EO5A 2AGJL 1U42A 4KI5C 4YHKH 1KJVB 2YXFA 1WFTA 3RGHA 3QUXC 2H2PC 1U8OA 5JW4R 1T1YA 1CFQB 1QO3A 4OLYL 3ZZ1A 4TN9A 2AKRA 4JN1H 4MX7A 2OJZL 1VADA 1EO8H 1ND0B 4L29B 4PJAB 5I1CH 5A2FA 3V95A 1QVOB 4BQCA 3D69B 4X6DE 1QHPA 4Z7VA 4MNGB 1OOAA 3SGDI 3T0WA 4U1NB 2QHRH 4E41B 1L6ZA 3LRSA 5CJXC 4YHOH 2QTEA 5DD1H 1KLUA 2YRLA 1IC5L 2ZOKB 5T3XH 3V52L 3VXOA 2XKUA 4NQXA 1NDGA 1OARH 2F5BH 3OAYK 3PDDA 3O6MH 1CD9B 4ZUWA 1ZS8A 1J10A 3S36X 1LEIA 1VEMA 3GSXB 3VFUB 2OZ4H 3G9AB 4P59H 1BD2D 3V4PH 4H26A 4F33B 3RGVA 3AM8A 3K7UA 3NABH 4S1RL 3ELAT 1LEIB 2FEDC 2E7HA 5IVXA 4PD4J 1KCRL 1TJIH 5E99L 5FUZL 4HLZG 2BVQB 1V7NL 3FT4B 4NRZB 3IFOB 4HK0A 4I48B 5EOQH 2X40A 2DD8H 4Q2ZB 1F58L 4G3YH 5FK9A 5BOPA 3VRLF 1ZWIA 4MNGA 5T1MA 2X9YA 4PJEF 4BFGA 3CFCL 3G5XB 3RIFF 1HE7A 1BQUA 1T2QL 3DYOA 1U8PA 4MX7B 4L4VE 3V5HB 3WFDH 4TVSa 3RWCA 2NW3A 4ZSOE 1FAIL 3HI1B 3RDTA 4XMKH 4YEEA 2Q86A 5C6TL 5KSAD 4ALAH 3CVIL 5IBTL 5C2UB 1MLCA 1MFEH 4IOSD 5IB2B 4L4TD 4XPGL 3ISWA 5C0CA 2EXYD 1HNFA 1UVQB 5I1JL 4TSAH 1ZT1A 2EYSB 35C8H 4H25A 2HJFA 1CLZH 2B1AH 2WW8A 4P3CH 4K3EH 1RVFH 2ORBL 4EOWH 4LVEA 5JA9A 5HGDB 4NC2B 4DK3A 2I5YL 3LKRB 3LPFA 1G7LA 2HTLD 3MZGB 3R1GH 3VFMB 3ARDC 4G42A 1R3JA 1UKTA 4J4PD 1QFUH 2AJZB 3HHRB 4MA8H 3HAEH 5DT1H 3HA0A 4UINL 4JJHA 5DRWA 4RGOL 5GRZA 5DF0A 2AXGB 1HH9B 3R06B 25C8L 2VZ1A 1LK2A 3OJDA 1P53A 5EZLB 4JQIL 1CU4H 1MCDA 3CVIH 4IOFD 2J1KA 2P4AB 3CXDL 5B22A 4WCYH 4L5FL 1OP5H 3VMOA 5J6HA 4IMLA 4C56E 4UBDC 3S5LB 4PP1C 3EDFA 1S5IH 1A47A 1NJ9B 4EDXB 2Y6SD 3MCG1 3P11L 4OKVB 4R2GD 5FA3B 5F9OL 3BFOA 1YUHB 2ORBH 5TF1H 4EOWL 3ZKXC 3FFCB 2I5YH 3JV5A 2AEQH 4RNRA 5A16A 5KVEL 3RY6A 4AIZB 3B83A 4LK4A 3IAGC 3I6GA 1LO0H 1H3GA 1UACL 1CDYA 3CX2A 2HJKB 3SDXF 2OXHA 3QPXH 3ROLA 5KG9A 3NACH 4X98B 3VCLA 3H9SB 3SDYH 4YXHH 1D5MA 4OFYD 3AU1B 3HKFA 2ZCHL 1JL8A 3AB0C 2HT4D 3J7HA 5HYJD 1IL1A 1O7VA 4L4VB 3C09B 1KN2H 1NC4D 4HMCA 1BOYA 5EC2A 3RIAK 4OV6F 5I0DA 2C1PA 4OGAC 3CZJA 1FFNA 4F7CB 1SQ2N 5IMKB 4HGMA 4M4PA 4NOFA 7CGTA 3NZHH 5GJTH 4J1UB 5DMGD 3BP7B 3MUGB 2EE9A 3D48R 2VAAA 1M05B 2V5RA 2P8LB 3ALWA 4FTVA 4UT7L 2ED7A 4Z7OE 3FFCA 5DYOA 4V1DA 4LDLB 1QR1A 2BVPA 1ZSDA 1RZIA 4HKXB 2A9NL 2ATKB 2EECA 3BW9A 4MDIA 5D1XA 5FA3A 2JF1A 3GKWH 2AEIT 1IARB 3CFBB 1AIFA 3Q3GB 3GSWA 1PKOA 2YRZA 4IRSA 4YX2H 4O58L 1MCIA 1LE9B 2J88H 4WDIB 4ZUUB 2F58L 4OZ4B 4U1SA 2IPUK 2D7MA 1MRFH 1J1OL 1KB5H 2B39A 3QDMB 1G7HA 4ZMAT 3ARZA 4ZPVB 2ED9A 4OLXL 2FL5A 4HFUL 2JB6B 3FQXA 1J11A 3MX0A 4Y16C 1HYSD 4IDJL 4HS8H 5INCB 1QPPA 3BIKA 2UZIH 4LPYA 2YA1A 2EC8A 3WIHL 4PJEA 5HHXH 1EJOL 2FATL 2C3GA 2P5EB 2EICA 1LDPH 3ZKSD 1AHWA 1RIVL 4EN3B 4OZFB 4MNQA 5E5MB 4JRWA 3KYMA 3MCLH 2GFBA 4C56A 4E9LA 3WFCL 3JWOL 1CXIA 2ADIB 5CJOH 2FIRT 3NFSH 3BDYL 3SDXA 3NCYS 3WKMH 1T0NB 3BP6B 1NFDF 2DYPD 4K7PX 4X6EB 3IVKA 2DTML 4MQXC 1CLZL 4X7SL 5T1KA 1X5YA 1B0WA 1YJDC 4Z6AT 1AJ7H 3GSNB 1RJYA 4NQVB 3L5WB 1B9ZA 2HKFL 5C0CB 4DQOH 1OGTA 2R0ZL 2EIBA 2XPGB 3O2DA 5E2VH 3REVA 1INQA 1Q0XH 5DT1L 5IHLB 3WNMA 4HFWB 3BDBA 4MXQC 1E4XL 5TPWL 4BKLA 1KCLA 5IJKA 4O02L 4OLEA 1T1WB 4HC1L 4H8WH 4OT1L 4X4ME 2ENSA 4MA3A 4JRXA 3CMOL 4ZQKB 2QKIA 4N90E 2A6IA 1JVKA 5EORH 1MUJB 5JHDD 5E6IC 3O4LB 3BAEL 1INDL 1A6VL 4NRZA 1ZGLB 3FT4A 3GHBH 2H26B 4GW5B 4F9LA 5HD8C 1L0YA 3ZDXE 3EYSL 2VISB 3RA7H 1N5AA 1V3KA 3RTQA 3PNWA 4PD4K 1J7VR 3CC5B 3OKNA 5JA8B 1W0VA 2Z31C 5KS9E 4TVPL 2LABA 1RZFH 1D5MB 5IT2H 4BH7B 1WZLA 4XTRC 2OM5A 4WVRA 4EI5C 3M07A 2ITDA 4AEIL 3CH8A 1MCCA 2HRLA 2QL1A 4R4BA 3MOBH 3UTSD 1FVCB 3U7AA 3SJVB 1A6ZA 3NCJH 3X12B 1AQKL 1NMBL 3ARBC 2PTTB 3REWB 2HFEA 2G9HB 4CKVX 1KLUB 5BS0E 1GVIA 5JDSA 1P7KA 5F7WC 5INDA 3FL7A 3EOTL 2MKLC 5FYKL 4FQLL 3V4VL 3MGTB 2BVTA 2GJ6E 1KGCE 1KCUL 1ZHLA 4KUCD 4M93C 3W9DA 4HDIB 3KPNB 3QWRA 5FYJD 4U6VH 4X6CA 1RZ7H 1I8LA 1YQVL 3FOMB 4XBEL 1ZHKA 3O2VH 2H2SD 5D2LA 1XIWC 5I1GL 4XPBL 3MLUL 1FNSL 3X3GH 3V0VB 1UH3A 5ILTL 5AYQA 1JP5A 3SJVE 1RIUL 5FM4A 4PJIA 2IMNA 5FIEA 1EEYA 1TZHA 4NBYB 4P5KA 3DV6B 2WANA 4GOSA 3RVUC 3NIGE 3ARGC 1AQKH 1NMBH 4JPIA 3MJ7B 4KU1A 5KTEH 1R3JB 2O5ZL 2VH5H 5E9DB 1DN2A 4P48A 2MHAB 3HPJA 4Z95H 3MR9A 1P2CA 1REIA 1SJXA 3KLHD 4N0RA 4Z7NE 2VLJE 3DV6A 3CZFA 3STLA 3DROA 1OAXH 2AJXL 2OJZH 2ZUXA 4U1JB 2DM4A 5HBBA 5KVFH 2VXVH 5JO5B 2WWKT 4MJIA 3L3IA 1TQBC 1ZT1B 1NDMA 3QWOA 3SKNB 1QQDB 4XBGB 3RWHA 4NQTA 4JKPH 3VFOA 1FVEB 2YN5A 3E0GA 4CU8A 3DXAD 2WNGA 4P2YA 3IJYA 1MCBA 4PJ7E 1MH5A 3WIIH 3U2SA 5C3TA 2QADC 1OGAA 3DECA 4DVRL 3FOMA 2FR4A 3X3FH 5CAYB 4HXBL 5JLZB 2VC2L 2J8HA 4U1GB 1ZHLB 3W9DB 5HVGB 1IGCH 2ICEB 2ZUVA 3MRNA 5E8EB 3VGEA 3L5HA 2EZ0D 4G80B 2P7TB 4S1RH 2ZSVA 2XY1A 1BLNA 4K94C 4GKNB 3IFOA 4JFHD 1RHFA 5CZKA 1FLTX 3LEVH 4OZHE 1DQJB 4XPTL 3E6FB 5DGRA 1MCJA 1EFXA 3HE7D 4BYHA 3I6KB 2YSSA 1UM6H 4PJCF 4HIIA 1N59B 2C3VA 2MSPA 4XAKD 4R4FL 4RX4A 4NN6B 1KELH 3GMLA 4QXWA 2GTZB 3KYNB 5F9JB 2YC1B 3FQNA 4HX1B 1QLFA 4XRCB 3S4SB 1BQLL 4PJFA 4HIIB 2E3VA 1MWAL 3C5ZA 3TNNB 1N5AB 2HH0H 4ZO6A 3BWAA 3E6FA 3ZDYE 1JPFB 1OGAE 2VXUL 1S7SA 3GZKA 12E8L 4YE4L 3MCLL 3DYPA 1U8LB 5JHLL 5JZ7C 1ZGLA 1OP3K 4PJXF 3MJ9A 3MV11 2BOCB 4PGCB 1HOCB 1X7QA 2JIXA 1U58A 1OW0A 2QKIB 2YOCA 2P5WD 2CKBA 3LDBB 4MA3B 1GGUA 1QLRB 5KJRL 1I1AB 2CIIA 4AG4H 1FYTA 3K74B 4BKLB 4QF1A 1PG7W 3FFDB 3TIEA 3F65A 5IGXH 1SJHA 3QH3B 5AEAA 1LNUB 1KN4H 1RZJL 4IOIB 3FO0L 4KJYA 2APXA 1AD9A 3LEVL 4MVBD 4NKMA 3U2SB 2HLFC 2DOCA 3QUMH 3FZUC 4N9OB 4BZ2L 5DDHA 2NW2A 4N8VA 4PGDB 4I3SH 4PRNB 4NKIH 1FE8L 1U92A 3CPLA 3K8KA 4XMPL 1XF5A 1Z0NA 1QSFA 3WO3B 3JWDL 4XNUH 3FN0H 3PP4L 3QXUA 5FYKE 1M4KA 4DVBB 2R56H 4XNMA 1LK3H 4UTAH 5IBTH 2MHAA 4P23D 4PUBH 4YHIA 4JEGB 3K2UL 3L6FB 4U4BA 3JWNC 2WLZA 2R39A 5IFJB 3GSQA 3TO2B 1EEZA 5FGSA 2ILLA 4NJ9L 5MENA 1AHWB 4A6YL 1TZHB 4P5KB 3BZFA 1AXTL 1N8ZA 1K4CA 3RVXD 2VDQL 3MRBB 2HRPH 5HPMB 1NGQL 2CD0A 1TJHH 4IMKA 2JB6A 4MJ5B 4QTHA 4F9LC 2FL5B 4J3WA 5H2BB 5FYJU 4LBEB 1J12A 5HDQH 5FM5M 3C09C 4G9FB 1I1CA 3NIDF 4MXVE 3RUGA 3D6GA 1IGMH 5DHVH 1JHTA 2FIKA 3OG4B 4M7JH 3CFEB 4JJ5A 4CVWA 3BPLC 1TZIA 5ID0A 4M9PA 3LKQB 5KW9H 1RZIB 1GCFA 4UIMB 2VN4A 4ZXBB 3TEUA 1JWSA 3MYJA 3TPUA 1NBYA 4MCYA 4OF8A 4FTVB 2D7TL 3X13A 4WWKA 1J05A 3MUGA 4G5ZL 1S9VA 1A6ZB 4YGVB 3GB7B 4R4BB 4Y19D 4ODUB 2GSGB 4U6YB 4ZO7A 4FQIL 4LQFL 1ZV5A 1DUYB 4UAOB 3W11D 1RY7B 1I7TA 3EFFA 5F9OH 5ABDE 1XF2B 3AFLA 4MNHA 3U82B 3KHQA 4OGXH 5KVEH 1MEXH 4NWUH 4MZ2A 3ULVD 3FO9B 3JTTA 5JXED 3ZTNL 3IXAB 1KB9J 5D1ZD 3AS3A 4OZGE 1CZ8L 3NCFB 4YO0B 4F37F 1F42A 1MVUB 4OQTL 1MUJA 3BP5A 5EO0B 5D7IE 1KUMA 3C8HA 1IKNC 5HJ3A 3NMEA 4RDQG 5CP3A 1AY1L 4YBQC 4OZIE 2VR9A 4AIZA 4NHCL 5C0FB 4WHDA 1ZT7B 4M62H 1N4XH 1WWAX 5E03A 5FKAA 1H3WM 5K59F 1WBXB 3WIHH 4TNVK 3C9NA 4GKOA 1LP9A 1NJ9A 4MSWA 4KZEL 4WW2C 5HVHC 2EEAA 4ALAL 4JCMA 2YHGA 2G60L 1UYWH 4HS3A 4ONFH 4LIQE 4WV1C 3QG7L 4Q97A 1XF1A 1C5DA 5EZIH 1LK2B 3OJDB 5EZLA 1RULH 2APTA 3BP6A 3O8XA 5KJRH 5CIPB 3W0WD 4U49A 3OKOB 2O26U 3QHFH 3ILQC 3RWDA 5D96B 4POZC 4WI8A 4LLUA 2VIRB 4F7EA 4CW1A 1R3LB 4Z7OF 1WSST 3U0WH 5CHNB 1G6RH 5JQ6L 2NXZB 4ODSH 3NFNA 2UWEA 3CDYA 1NGYB 2G5BA 3OXSA 3HCVA 4CW1B 1IKNA 1BF8A 5E8NA 2DLFH 2VZSA 2Y5EA 3KPRE 3HFMH 3VG0H 3ROOA 1CCZA 3EJJX 3RL2A 4YXKL 2WV3A 2W0KA 1M7IB 3TN0C 4UT6H 3AXLB 4KDWA 1I9RL 3MNWA 1ZVHA 4JY5L 3VWJD 1J1PH 4JANB 1BOGA 4ZODA 3MJ6A 4ZUUA 4NJAH 4WDIA 4NO0D 3M8OH 4PJ9B 4HGKC 5T3XE 1B0RB 5DJXB 3HNVL 4ONFL 4PJBE 3C9NB 4WEBH 3RRQA 1UM4H 2K7PA 4OZFH 5KZCD 1WISA 5TGBA 1QR1B 5DYOB 4HGWA 4MJ6A 3V5HA 3QH3A 1T66C 2XFXB 3QHFL 4QF1B 2W0FA 1RJZA 5CWSB 2XZCL 4ORZC 1CDJA 3H9ZA 2VYRE 3ZDZE 3O4OC 4M4RA 4Q2ZA 3SHSA 2FB4H 3SJVD 4WGWB 3A6BH 4EKXA 4XCFH 2IANB 3EHBD 4O2FA 3LS4L 4QRQA 4U2YA 1UCBH 4YO0A 3PQYD 2C1PB 5DWUL 3NFNB 1AGBA 1U8LA 4JFZL 5FGBC 3IXAA 5IROA 4CVZB 3CFCH 1NGXA 4TTDC 2GTWB 5DK2B 3ARYA 1E28B 1YEEL 5DJYB 1KIUA 2VO5A 3O8XB 4OCLC 2GTZA 4WUUD 2E5EA 1C5DB 1NCWL 2ARWA 4U0RB 3VXNA 1UADC 2DAVA 4MJID 4LSPL 3P9LB 1P9MA 4NQCB 1ZS8B 3MGAA 3O4LD 4I3RL 3WXWL 4JM4L 4GRLD 4NJ9H 3WNNA 1T1ZB 5IG7A 1ZLSH 4C57C 2UZXB 3X13B 1LP9B 3MC0A 1U8QB 2P7TA 3LIZL 1NBYB 2VLJA 3FTGB 1MPAH 3BI9X 2CGRL 3IU3A 4Q7DA 4OKVA 1U3YA 4L29A 2R0LH 2RFXA 3WLWD 2FB4L 2APBA 4QHMB 5I1DB 5L2KB 2KPNA 4RSVA 3S5LA 2IAMA 3GRWL 4JFEA 1N3NB 1R3IH 4IMKC 4H1LH 1G1CA 5CD3B 1C1EL 2KL6A 4WNQB 3WHE0 1AD0A 3CFKB 3CXHK 2XG4A 5F7YC 4QXUH 43C9A 2N4IA 4XBGA 1JK8B 1I3UA 2HT2C 5F9DC 2AXGA 1KACB 2H3NA 2B4CL 5L0QB 1LP9E 1A9EA 1OP5K 3UDWC 2CLVB 4U33A 2VLKA 2A6DB 1S7XB 2EDLA 5C0CE 3G6AB 1T3FA 4RGNE 2EDQA 3DUHA 2YPLB 4DK6A 1XF3B 2WUBH 3UAJD 5HGAB 3T0DA 4QCIB 2HG5A 1A3LL 3VFMA 1LDSA 3OF6A 4JHWH 4JLRA 1R5IA 4XTRD 3BPCA 3RVVC 3UDWA 2P5ED 3IXTB 4NQEA 5J9PB 4UV7H 4ZFOL 1PKQA 2IADA 2YD2A 4DVBA 5J3HD 1RZ8A 3IDGB 5EIIA 3LH2H 3F8UB 2JIXD 4M6AA 2R29L 4HAGA 2OMNA 4F9PC 5DVMA 3HZVB 1CGYA 4OIIL 4NN6C 3CUPB 4YWGL 4QXGL 4UIMA 2Z9TA 3QQ3A 5TE7L 3MRJB 3MO1A 1X5FA 3P0VH 1YNLH 1KT2B 1WVZA 3EYFB 1WT5A 3ULSA 2NW2B 3OSKA 3DUUB 3ILPA 2WWMC 3T3PF 3C2AH 1WQVT 1N6QH 1L9NA 5D8JL 3RUGB 3QIBC 3SDAC 3UYRH 1PY9A 4TSCL 1JN6B 1Q72H 4KFZC 3UYPA 2XI9A 3ZHLA 4I0PC 4MHHI 3OGCB 3QCVH 3FFDA 5F7LB 2QJDA 1H3PL 1CICA 1FYTB 3QRGH 3U1SL 2PXYD 3OJMB 3PABB 5D7JC 1B2WH 3G5VA 2P24B 2QHRL 1N8ZB 2B5IC 4J4PA 5I1LB 1TPXB 5DD1L 2MPAL 1A64A 2DIJA 4I48A 4UILL 4NZUH 1A0QL 4MS8C 5I17B 4DFIA 3FRPA 2YK1H 5D1ZB 1HEZA 4UU9A 5F88A 3UPCA 2EXWD 5BV7C 2LAGB 2OL3H 4U05A 4I2XA 4R4NC 1A2YA 3OKNB 3CC5A 4XPFH 1N59A 2C3VB 4HV8B 3IDJB 3KLHC 2NY5L 2XZAL 2VISA 2Q7NA 4PLOB 5AAMA 1J86A 3EJYC 1X5ZA 5I8EA 4DAGL 1S9XA 1SYVA 4RRPG 4ODVL 1E6OL 4N8VB 1WCQA 1F4HA 1EH9A 3UXFA 4KH2A 5FM8A 4K9EL 1CR9H 4TVPE 3CJJA 1GZPB 1NL0H 3CLFL 2NY1B 3HG1E 1A1MA 2FYYA 3D69A 3GSRA 3NZ8A 1YEGL 1BQLH 4XZUB 5EH1A 5EG6C 4FFZL 1FO0B 1VADB 5D1QB 3BXNA 4L8SB 4YPGA 5C0EB 5D96C 5DFVC 5E1HB 1T1YB 3NGBB 3RKPA 4PB0L 5J12C 1U58B 3ARVA 1MFEL 1Z5LB 2F8OA 1MH5B 4CUCA 4PJEE 4G6JH 3EO1B 3HZKB 5C7XL 1H8OA 5C08A 2V5YA 3WFHA 1S8DB 4H0IA 1Q9LA 1VACB 5D2NC 2IQ9H 4LCIH 1RJYB 2HFFB 5CJ5A 4HULB 4BSJA 4Y1AD 2V9RA 4KI1A 4P9MH 3HZYA 2EDOA 3WNOA 4HPOH 1M1SA 1ZTXL 3BN9D 2RB8A 1BZ9A 2R0ZH 3ARGA 1QD0A 1L7IL 1PFCA 2X1WL 4UU9B 1C12A 4JDTH 2IPTH 1KTDB 5SX4I 5T33H 4OZFA 1A6WH 4GKNA 3NCBB 3KHOA 2IWGA 2VXQL 2FX8L 3BT2L 4ONHA 5D7LD 3FQTB 4JO4L 4OLUH 4X6DB 3QEQB 4YHPA 2Z31B 2QQNH 3PABA 3EYQD 2Q8AH 2X4NA 1H5BC 5DA0B 5HHNA 4WHYH 5EORL 4JQVC 5BOZG 3U30B 3QDMA 4J2XA 3D39A 1S5HB 5H35B 3BKML 5I1HL 1U2HA 1QSZA 2VDKH 5EU6B 2HKHH 4PRPB 4KVNL 2X89D 2NPLX 2DJUA 5I1GH 3B5TA 4EEEA 4K8RD 4NHUB 1KSRA 1NFIB 3ILPB 2FJFA 3ZT6A 4QRTA 2IQAB 2VL4A 5C09B 4HDIA 3RWHB 4HKXA 1I1AD 2A38A 3MUY1 3TO4C 1Y6KR 3HNTL 3RNQB 4YDVA 3KYAA 3U83A 3BEWB 4ORGA 4XCNA 5DEGB 1KTLA 2XICA 4P2RA 1GXEA 1JGUL 1W0WA 1BVZA 1U3HB 3MJ7A 4K3JH 3PWJA 8FABA 1YEKL 5ESVB 3QNYB 3NIDE 4LCYB 5EC2B 1W0VB 1EEYB 2HVKB 3EYUL 1F6FB 4M7LL 2H3NB 4MA1B 3RTQB 4DKFH 4IIQA 3ZT5A 1J0KA 5JDJA 1QTYT 2ESVB 1BFSA 4XXDA 4P9HC 4O9HH 1KYOK 2BHZA 3LMJL 1NEZA 3MGOA 3V0VA 5FUCC 3VXUD 2F53A 3STBA 3QDJB 1URLA 3AS1A 5MHSD 5LBSH 1UEYA 4N8CH 2UWEE 4CGTA 4NP4H 3LPGA 5E08H 4RAVA 5DR5L 3MLPA 1EAPB 3O6ML 3QO0B 5DFVD 4Q9BA 2NY3D 4G8GE 3DUSB 3EDDA 4U2ZA 1S3KL 1IZJA 1LO5B 4KDTA 1P6FA 2OTPA 2VLJB 4U7KA 1INQB 1BD2E 5CEZH 3C2AL 1G9NC 2G9HA 1OQOA 4KI5D 1K4DB 1XAUA 3FN9A 1J5OL 3DXAB 3PWLA 1XMWA 3PV7A 4L8CA 2X9XA 3QP3A 1TQCC 5BRZD 3S35L 5J1SC 4D0CA 5E2VL 3QCVL 3U46A 1W72L 2ZNWA 4OLWL 2AW2A 3BD4A 5JW5B 1S7WB 3O2DH 2OP4H 5D7IF 3L1OH 1DBBL 4LEXL 1H0DA 1BQHA 5K9KA 5C07B 3OKLB 5FDWA 1T7ZA 4YHOL 2M8XA 2EC9U 4WW2F 4OM0L 4QRSB 5JIHA 1VFOA 4C56B 5ENWB 4KWUA 3WFCH 5DMIH 4XC3L 2YWYA 3SE4C 2N7AA 5GRYA 4BQ6A 2RAMA 4GKSA 1NBQA 3QQ4A 3VXRE 3MV8B 1MHPH 4WI9A 3PL6C 4JRXB 3G08A 2YPVH 4A6YH 1OP3H 3RPIA 3EOAB 3S6CA 3H3PL 1GGCL 2XFXA 5JOPD 1CG9A 4H25B 4EBQH 3ES6B 4ZYKA 1F2XK 2VDLH 1S7VA 2F8XC 1MOEA 1D5ZB 3PWVA 5DTFB 2GT9A 3DX6A 3REVB 4LLVB 5IB2A 5BV7L 2V2TB 3A6BL 1W72H 1UCBL 2HP4A 1OLLA 1SM3H 3PWVB 2BNQD 2BRRL 1CXKA 1GZQB 5IHUH 4WU5A 3OR7A 4ZYKB 4V1DB 5TQ0H 3ES6A 1LQSR 1G1YA 1YEGH 1MFDH 3CVHL 3ULUD 3EOAA 3RWEB 1VKXB 4QHKI 2XTJC 4B50A 5K9JH 1YYMH 2VAAB 4KVCL 3H6JA 5JW4Q 3QDGE 1OPGL 4MAYC 3RVVD 1HHJA 2DM7A 5DJCA 5IMKA 5CILL 4OAWA 1R0AH 4IHOA 1VCAA 2W9EL 3ZKQD 3LS5L 2AXFA 2BNRD 2X4UB 5HDBE 3EYSH 3BQUD 2JE8A 2GITB 4LVNB 3PGDA 3RWDB 1W8NA 3GJFH 3GI8L 3RGVB 4LAJH 5JUEH 2APFA 3I2CH 3TA3B 2BY3A 2IH3B 3V9FA 1MEXL 3VI4E 4RMSA 4RWYH 4ZPVA 3BKJH 4MJ4A 2D4DA 2NZ9D 4L9LB 1WTLA 1OGAD 4R9HA 5L9DH 2HJKA 1MELA 3BD3A 2VUOA 4JO2H 1NDGB 1RZGA 1IT9H 2AJUH 1JGUH 1ZLWH 4NNPH 1QBML 5EBLB 1U3ZA 1MHEB 3HAEB 3TH2T 4KK6D 4XHJC 5DD0H 3UTTA 2XQBH 2BVPB 3BW9B 4FOMA 1NMCB 1AY1H 3JUZA 1AFVH 1JRHI 2DQJL 4EDXA 1QSFE 2AKRB 3U4AA 5I18L 3HN3A 4O51A 3QZWB 4DCQB 3LB6D 4X83A 5H37H 3VGHA 1KB9K 3VWJB 4OF7A 8CGTA 3MV9D 2IPKA 2RCSH 3CFJB 3OXRB 3HB3D 2YA2A 4X7EC 1QBLH 1T7VA 2FO4B 1G9EA 3TZVA 2Q3ZA 3NA4A 1DQLH 1XF2A 2D7NA 4JO1L 5DHVA 2MKWA 4LCYA 3EFFB 2H41A 2SEBB 5KTEL 1DUYA 3PWJB 5IWLA 2R4SL 2O61B 3BRFA 4ODUA 3D5OF 2VABB 4U1LB 3L7FB 5C0RL 5C0AA 1KTRL 1MJJB 4LLYA 1IAIM 5HGDA 4HZAA 1ZANH 1G7JA 1NAMH 3IFNH 4JFYA 3EOBB 1ZEAH 1JWSB 3MYJB 3PDGA 4LSVL 4Y2DA 5I74B 1GL4B 3TPUB 3IETA 1GIGL 3RIFK 1FFOA 3QIWC 2FJHB 1IGIH 6FABL 4XCYA 1PJ9A 1MWAH 2QADD 4X0KA 4NSKA 4DN4L 2MPAH 3VH8G 4PB9L 3J8F7 4C83B 1XIWD 2NW3B 3HNVH 4G9FA 4Q6IC 1RIUH 3ALPA 2NY4B 4X9FA 4LLDB 5SWQA 2VC2H 1RUPL 5ACMA 1BMGA 1F6LL 5EU3A 1IC1A 3FONA 1F4YL 1YECL 3R06A 5EO9A 3TBYB 2J6EL 3R0MA 3PQYE 5IVOA 1A6AB 3LN9A 2IBBA 4EI6B 5JORB 1LE5B 2P8MA 3BKCL 2AEPL 1KN4L 1RZJH 1QLEL 2W9LA 4KMTH 4Q6YA 5HVHB 1CFNB 5HTSA 3TBWA 4EUPH 1KTDA 3KPPA 5FGBA 2D9CA 1NC4B 3IFNL 3D2UB 2NY7L 4BK5A 4M5YL 2E6JA 3FAXA 2NY0C 1G7LB 2XXCB 5HGHA 1A14L 2X4OB 1WAAA 1OQXA 3C5JA 5L8LB 5ITFA 3D0LA 2ZWLT 1CFVH 5BS0D 3LRGA 4WFGD 1YEEH 3DMMA 5GS0C 4OB5L 1B6UA 5IOPB 3B3IA 1BBJA 2W38A 3O6FB 2WK2A 4XX1G 1YYLL 3HZKA 2ZG2A 3BISA 5DDHB 1JF1B 1UYWL 2QBWA 4M9OA 4KAQL 2CLZA 2UVEA 4G6JL 2E6PA 2ZOLA 4L3EE 4LU5H 2KUTA 1XT5A 4KJYB 1N7MH 3Q6FB 2X4SA 4GMTH 1BP3B 2CIIB 1GPOL 1IKFL 1JCKA 4ODWB 1U8OB 2CKBB 1K8IA 3FMGH 1NAKH 4YDLB 2EH8L 5FK9B 1PGRB 1C16A 2FWOB 3HI6H 4APQA 5FUOL 2BOCA 1FL3B 4JDVA 5C0BA 4JKMA 2RR3A 2F54D 3LHPL 4PGEB 4H20H 1GSMA 3BVNA 1S9XB 3F5WB 3H8NA 4Y0GA 5KVDL 3NAAL 2R1XB 2AQ3A 3BWAB 3DMMB 3GGWA 3IDJA 4Z5RB 1ZVYA 4DW2L 4F9PA 4H26B 4U6TA 4F58H 5BVJA 2VN7A 2AJYL 5KSUA 3HR6A 2PN5A 2YUXA 3K4AA 4MD4A 4E5XB 3N9GL 4PUBL 32C2B 1R5WA 5I1EH 2E9BA 5IFHL 1JBJA 4LSPH 2IH1A 4ISVB 5ESAB 4GW4A 3ZE0F 1IILE 1N6UA 2B20A 3T0AA 3LKPB 4QRRD 1HIML 3F7PC 1CN4A 3VXOB 1WICA 2ZOKA 3ZHKA 3IJSB 3EJYD 35C8L 2C4FU 3MRCB 2XQYG 4Y5YC 1UB6B 3DVFA 5E8EA 3QUYB 3TBYA 3GFUA 2Q8BL 1XZ0B 1GC1C 4OSUH 1CICB 1F4WL 4ZS6C 1H3XA 4CJ0A 2FCBA 2D7PA 4M6ML 5JR1H 2EEDA 1KOAA 4L4TB 3QUML 5EULV 2XWTA 3MOAL 3QA3A 2X6MA 1OGAB 4HG4K 3JVGC 5B3JF 2AV7A 1KPRA 4K8RC 4PP1D 4WEUD 3QPXL 4EUPA 3U6RB 1N6QL 1YY9C 3MLSL 1C1EH 3V6OE 2LAAA 1JHLH 1DE4A 4EI5A 1FVEA 1L4IA 3I50H 2LFGA 5ERWB 4JN1L 4FQQB 4GRWB 5KOVC 1FFRA 1EO8L 3HZVA 5ANMA 1X5JA 1X4ZA 5HVWA 2E7LA 4JFYB 3DROB 3QDJE 2JB5L 1P5UA 3EYVA 4LCWA 3JXAA 4MB5A 3TP4A 5C0AB 2A6JB 3UBXI 4PLJD 3L7FA 2ZUQB 1JWMB 3P4LA 1ZLSL 3F12B 3G6JB 4YFEA 3WDJA 5IJVA 1ACZA 2XNAB 4P2OC 4JHWL 1P1ZB 4LMQI 4JPIB 2DQUH 5HDOA 5DJAB 2CJUL 2SEBA 3BWUC 4WWKC 1BD2B 3CSBA 3BJ91 2C1OB 1UCTA 5IJKC 3ZSTA 4NWUL 2FO4A 4R26H 3I75B 4P2OA 5KVMC 5DD5H 4JFXB 1NFDA