5L6YL

Il13 in complex with tralokinumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
b'YVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-13
publication title Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL01
3LDBB 3RIFF 3PF2A 1W0VA 3RGVD 3R0MA 5F9AC 3NGBC 4IRJB 1XCTA 1A7RL 3UTSD 1G7LA 4S1QH 5IEHA 4MSWA 3G5YB 4RBPK 1YQ2A 1A6UL 1J88A 3SJVA 2F19L 2BY3A 1JGUL 5DYOB 4OIIH 1NFDE 4J1UB 4TUOA 5FGCB 2AXFB 4FP8H 4L8CA 1BM3H 4IS6B 1IC1A 4D94A 2CLVA 2WM0A 4I2XB 3BKCL 5CP3H 1MCFA 5CBAB 1JMXA 3WN5C 3I85A 3MREA 2XN9E 4LSVL 1QRNB 4YAQA 3RHWF 5KVGL 3NIGF 3CVIH 5C0BD 4D2NA 1G9NH 5E1AB 3K2UL 4JHAH 4YQXH 3GMOA 3U46A 2CMRH 2DIAA 4W6YB 1OGTA 2RFXB 3BGFB 4Y5YB 1EERB 1KCLA 3VJ6A 3VGFA 3C2SA 1J1PH 3QEQE 2QBWA 4K8RL 4YXHL 1ZT1A 3HRZA 2W65A 5K9QG 4YDVB 4JFQB 5M95B 4BZ2L 1OGAE 5D96C 4I5BA 5C0AB 3VFNA 4MNHB 4PJ7A 3HZMA 2X1QA 3HUJE 3PL6A 1KUMA 1N59B 5L8JB 3Q3GB 3VD7A 5HBBA 3SE8H 4JZJC 2BVQA 4JPKL 3WHE0 1Q94B 4NRYA 3FB7A 3UYRL 5DUML 3GIZL 4IIQC 4JDVA 1V05A 2B2XH 3FOMA 3QFJB 2PYFA 3V8CA 1EO5A 3QUYD 5JQHC 3IJYB 4P2OC 4X8JA 4XCCL 4L4JA 5C6TL 1AD9A 5ISZE 1CT8B 1JGVL 1GAFL 4YHZL 4OCWL 4RZCB 4YEFA 5DT1L 4Y1AA 4XNYL 1Z9MA 1GGTA 2PTVA 1MWAB 4OZGF 1NCAH 3RVXC 5JLZB 4UU9A 1NBYB 2VQ1A 4Y4FB 4TSCH 3CFBB 1MHEB 3VWKC 5IESH 1KG0A 2WQ8A 1RMFH 1CZ8L 4LSQH 5B38B 3QIUC 4DGIL 3LB6D 4GQPH 4F33A 4NCC2 2HWZL 3QWOA 5DTFA 1FPTL 3VGEA 4PTUB 4Y8DC 2XNAA 4Z7VF 4Z76A 4JHWH 5D7JC 5IFJA 1T1WA 4U1MA 1YEGL 3RVWD 3IXTA 5IMMA 3F58H 2VL5A 3ZDZF 3H3PL 3UBXG 2DLFL 4PJ5A 3D69B 5I9QB 4WFFE 2X7LB 1YPZF 4APQA 1DQQA 1C5CL 1A5FL 4UTAH 3T2OA 4ODVH 1GH7A 1Q38A 1DQJA 4P2OD 4D3CH 2E8YA 5ITFA 1LO3H 3KS0H 5KANG 1EGJH 5GGSY 4DN4L 4UI2A 5JXAL 1I7ZB 4N8VG 1JN6B 1JHKL 5T1LA 4YGVA 3KPLA 1IC5H 4N5ED 3WIFB 5L0QC 1ND0B 4G7VL 5EZJB 4NBYB 1BD2D 5EWIL 1VKXA 1JE6A 4I48A 1A6AA 5C0DB 1QSEE 3NMEA 4GQ9L 1VFBA 3QIUD 1BGXL 1IM3B 3ZTNL 1T5WB 4MNGA 3GSRB 1XCQB 1I3VA 3G6JA 4K23L 4Z77A 1KTLB 4J6RH 4BKLB 5I76A 1YEIL 1ADQL 2GCYA 1EHLL 3IFPA 4M02A 3BOVA 5GXBB 2JK5B 3WEXA 3RZCC 4PJ8C 5FUZL 2X4RB 4UT9H 4KMQA 4C4KO 1OLLA 4JKPH 1W2KT 5F6IB 2DJ4A 5KG9A 4K3JH 4N0UA 1H3VA 3RPKA 1BZ7B 1RURH 3LS5H 3QWRD 2EDBA 4W6WB 5I1AB 5JIPA 3MRNA 2K7PA 2HJKB 5KOMC 3BZEA 3U4EA 3AU1A 2B1AL 3OHXA 4RWYL 4CU6A 1P1ZA 1T89A 4HX1A 3WFCH 1TENA 4OZ4A 1DLHA 5E1HB 1KCSL 4XBGB 1JNJA 1HXMB 4UMGA 5FGSA 1X5ZA 3OGCB 1RUKL 2NCMA 3SKUD 3MV7B 2BRQA 1PQZB 3BN3B 3G5YA 3MRIA 2CXKA 4OI8A 3RTQA 2C3GA 3EO1B 1HKLH 4ODTH 4HT1L 5DYOA 1DBML 4I3SL 3OKEA 4WDIB 3WLWC 1KENL 4LPTA 4M9OA 1AO7E 3B5GA 1OAYL 3T3PF 1C5DB 2CXGA 4PGEB 5AAMA 2ATKB 1NGXB 3LQAL 1TPXC 5DZLA 4I2XA 5C08B 3OPZH 5DO2C 3RZCD 2OTWB 5CBAA 1P4LA 5K33A 1EA9C 3QDMB 1QRNA 3MPCA 4Z7WF 3CZJA 4OLVL 3TT3H 1A7RH 4M7JL 5IHBA 4OZHB 3QPQC 3MLXH 3ARBA 2F19H 4TOYH 4L3EA 1I1RA 1T66C 2VR9A 5IROA 3IF1B 4Y5YA 3WYRA 2IWGA 3LSOB 3L6FB 5JORB 4MAUH 5E94B 4KKCD 5IW6A 3NFPB 1KN2H 2D2OA 5CZKA 5D7KD 4JFQA 2ZKHL 5EU6D 43CAB 5ID1A 3RY6A 4DJMA 3I6KA 2B4CL 5C0AA 5EO1B 1IMHC 3LEVL 4NZRH 2WAHA 4NFDA 4HBCL 3Q3GA 3V4VL 5KVGH 3LRSA 1I8IB 3WLWD 2NX5E 1OP3H 1XGPB 2VLLA 1FIGL 5KSUA 5DD3H 4Z0BL 5FYLD 3VXNB 3K2UH 3L1OL 2AK4D 5TE6H 5DZOA 3LKRB 3W9EB 2ZUTA 1BOGA 4RMQA 3PUCA 5D7LE 1KIUA 12E8H 4QCIB 3QR2A 1BZQK 1BP3B 1WQVT 3IJYA 5SV3A 4HS3A 1IRAY 1CT8A 3PQYD 1I9RL 2VN4A 4K8RH 4UNVA 4RZCA 1MIEL 2WW8A 5E8EB 1R5WB 2HMID 1MWAA 5I1JL 4PGCB 3QPQD 3UX9B 2FBJH 1AIFB 2EC9U 3FTGB 1T66D 4R4FL 4KROB 4NQDD 2XA3A 3BRFA 3T3ME 3VXMB 4XBPA 4LSUL 1OM3L 2YN3A 3UYRH 1GXEA 3GIZH 1EV2E 2VC2L 1JZ7A 1TCMA 4XP5L 5C7XH 3IFNL 2VKWA 4JKMA 4X98A 1NFDB 5HDLA 5C6TH 1JGVH 3EJZC 3NA9L 2YSSB 4JM2F 4OCWH 1P84J 3G6DH 4EN3C 5C9JA 5CKGA 1HXYB 4M7LL 4EVNB 1B9ZA 4TRPL 3GBNL 4XPTL 2X7LA 4BJLA 1MJ7L 3LKNB 2CGRH 4FXLA 4LHUB 3WJLC 5MEQB 3MGAA 1OOAA 1FAKT 2FR4B 4QHMB 3NPSC 4LDOB 4LGRB 2D0FA 2HWZH 4R90L 4XC3L 5BJTB 1WBZB 4XMLL 1JN6A 5HD8D 4OCRL 1WVZA 1A7QL 4ERSL 2VDQH 1JGDA 4PUBL 2F9BT 5L2JB 5EZJA 1ZTXL 3B9AA 4PLJD 3VXOB 2ITCA 3QEQB 4XXDA 5C0DA 1I8MB 1MH5B 4NKOA 1P53A 4GG6E 2HKFH 3H3PH 3IVKB 1FNGB 1UXWB 1IM3A 1OGAB 1T5WA 4NQCD 3UPCA 4JPWH 3KPSD 1XIWD 3AS1A 3HI1B 3CDCA 4LSRL 3BGMB 1DJSA 2NY7H 1PKOA 2ARWA 3FFCD 1C5CH 2YUXA 1CN4A 1KTLA 4BKLA 3B4NA 3GIVA 5JHDE 2Y06L 1HIML 1RK0B 2JK5A 4UUJB 1AJ7L 5JXAH 3WE6B 2CO7B 1DANT 1GIGL 4BH7A 4EN3D 2X4RA 3DX8B 1U3ZA 5IT2L 1A9EB 5I74C 5D6CA 2PCPB 3LPFA 3WXWH 2MPAL 4LNRA 5ISZB 3TBWB 3BYYA 4L4VD 1KC5L 5GRXG 3HG1A 3X3GL 5I1AA 4GQ9H 2BNUB 1IILE 4DZBB 3CDGB 1WWCA 3IXAA 4IJ3B 3ZTNH 1FFNB 1NQBA 3HS0B 5L2KD 4OM0H 4WEBL 3I6LE 4MA7L 4Y16C 5ICYB 1XR9B 5FAAA 4RAVB 1ADQH 4HWBH 3MACH 4U2YA 3UXFA 3V52L 5FUOL 5JO5A 2XG4A 3FKUS 1E27B 2ARJB 1BIIA 3MV7A 2XZAH 3WS6A 2R0KL 1Z3GL 1WWAX 5FUZH 4U1GB 4WV1A 2CSPA 4QTIL 3STLB 3P30H 3N06B 2GK0A 4F8QA 3MLTA 3CXDL 3B2VL 1PG7H 4M7ZB 5F7WC 2H6PB 4HPOL 1C5DA 4A2LA 4XNUL 4PGEA 2ATKA 4OCXH 4PRBB 1I1YA 3TN0C 1DVFB 1A6WH 5IFAL 3L5JA 4U4BA 2BOBB 4AIZA 1N6UA 3QDMA 4HMDA 2I24N 4K3EL 1RUKH 1WICA 2DI8A 3E2HC 4PRAB 2R69L 5GGVL 2VLKB 2AABH 2AQ1A 4P9ML 5F9WC 4U6VL 5CAYB 3DIFA 2VE6B 4HT1H 5F89A 1EAJA 3BUTA 4XHJC 4WI5A 3SJVD 4I3SH 5BRZE 3ECBB 5BZWB 1KENH 2AXHA 3BP7B 1OAYH 1DUZB 3V5HA 5E94A 2W0FA 4PJFE 3S37X 4CW1B 4JFHD 1PAMA 1A7NL 3QBTB 2IANA 3OJMB 43CAA 5E6YA 3WXVL 1K3IA 4NNPL 5TGBA 4P2RB 3PXHA 5EO1A 2A6JA 4X5WA 3DPBA 5DFTA 1M1SA 5GGQL 3A67L 1I8IA 2DYPB 4J3TA 3ZTJH 3MUJA 1C12A 4R7DB 3LKRA 5C0RL 4TUJB 3FRUB 1UENA 4NKMB 1FV1A 4TSAL 1BVLB 1KNOA 3OR6A 3V0WL 3OZ9H 5CZXC 1BLNB 2HFGH 4S2SA 4CN1A 1OTSD 5FDWA 3FT3B 4ZQKB 5IB5A 1QQDB 1TMCB 2XWJB 5MI0B 1FRGL 2ZKHH 5LVEA 1H0DB 3T0VA 5DRZB 5K93A 5GRJL 4PGCA 4WJ5A 4EJ1C 4U1HA 3B9KA 4OCYL 5E2TH 1CS6A 3MMEA 4HBCH 4XHJD 3V4VH 3PL6D 3VXMA 4PJ9B 1FL3A 4Z0BH 4F2MB 2Y6SD 3UAJD 5C09B 1RUML 3HRPA 1T21B 3S88H 4Z7UE 4XAKE 1N5AA 3S36L 4UDUA 5BW7A 3QDJE 3MLWH 2B20A 1T04A 1WWBX 4PJAF 1I9RH 3BIKB 3UZQA 3WSQH 1AO7B 4YDIL 3ARYA 1H5BA 4PB0H 4DFIA 4RFOH 1HXYA 4Y1AD 1U3YA 5I1JH 4H1LB 2CUMA 3LKNA 5TFSL 1R5IA 3MRHB 1LP9B 1U8HB 4LSUH 4WTXA 4MYWB 3HAEH 5GGTL 1VPOL 5BJTA 3IFNH 1CFTB 3Q0HA 4XMKL 1DBAL 4KU1A 3DHJA 3PHSA 2IBZX 5DUBB 4TTGA 2DM2A 2V9QA 2VLJB 2AEQH 4X4YA 3SGJC 5IB1B 1I8MA 1MH5A 5D2NE 5GIRA 1OCWH 2CUHA 3ULSA 2V6HA 1KXTB 3AM8A 3C6LC 1FNGA 1HINH 4TRPH 4XPTH 4AEEA 1CF8H 3MJ9L 1GGUA 1V8HA 4KJYB 2ESVA 1Z5LB 4PJ5D 2ZOKA 2BHZA 2BHUA 1HQRA 2BVYA 3NFSL 3MCKA 4APQD 1YEDB 1HSBB 2NX5B 4V2BA 1MJUL 4N90D 2D7MA 5FUCC 4UUJA 4NC1C 2O5XH 4FZ8H 4ZO7A 4KAQL 4PV8A 4R90H 4XC3H 2G75A 4OCRH 4QRQB 3ZE0F 4L8SC 1A7QH 5D7LB 5JXEC 5CUSL 4CADB 5T1LD 4YO0B 2VWEE 4MQTB 4Z6AT 3TBWA 3P9MA 3FQWA 2NW3B 5KVDL 2FHFA 4R6UA 1UM4L 2BNUA 3P4NA 3CDGA 2JJSA 1HHIB 5EUOB 2G9HA 4LSRH 3STBA 5ICXB 3MOAL 1LEKA 1UB5B 2Y06H 2VLRE 2ADFH 4XMPL 4YBHA 2C9AA 2F5AH 1CVSC 2ARJA 3MRFB 2W38A 1ETZB 1ZSDB 1GIGH 5IT2H 3QNXA 5D1ZB 1S5IL 5IJVA 2VO5A 3KPRE 3VG9C 4Q2ZB 4TVPD 3ARTA 1MFAL 1KC5H 4ETQA 3WFDL 4ETYA 1MCJA 4JQVA 3CC5B 5EBLA 3UJJH 2Z92B 2P5EE 1JPTL 3FB8B 4Q9QL 1DVFA 1VDGA 2OQJA 1QA9A 3C9NB 1F4HA 2OXGA 2FDBP 4GW4A 4BQBA 3HZVB 3P9LA 4NQVA 3VGBA 3VFUA 1ORSB 3V52H 2LE9A 3CNKA 4NNYA 4XPHH 5FUOH 1ZHBA 2XRAH 2R0KH 1KF9B 4PRAA 1Z3GH 5CINL 4ONFH 3TWCL 3N1FC 2VLKA 3BEWB 5IF0A 5INCB 5I0DA 3WS3B 3CFEB 1KJMA 1VB9A 3RTQD 2NPLX 2BOCB 2RQ8A 3O4OC 5D1QC 1EGJA 5HHNB 5C0NC 5HSFA 4LASH 1FVDB 4XP9H 1QLEL 2IPKB 4M48H 2KPNA 3EYSL 4W70A 1E6OL 4Y4HC 5IFAH 3EYOA 2QSCL 4LP5A 1CD1B 3S97C 3L7EA 3JV4A 4P2RA 1B2WL 4LLMB 3H42H 2C1OB 1KTDA 5JHDB 1QRND 4RFNC 3WO4B 1JZ8A 4TUJA 3UDWC 5IFHH 5E8DL 2AJVL 3VRLE 4H0GA 3ARBD 4L3ED 4Y4KC 1U6AH 4TVSa 1J0KA 1LO2H 1BLNA 3V6OC 5C07E 3JVGA 3FT3A 1QQDA 3ARGB 2JJUA 2BNQB 1T22A 3MUGB 4MCYB 5L8LB 2AGJL 3IJHB 4NYLA 5DRZA 2V2XB 4NNPH 3UTOA 5I19L 4D0DB 2EDXA 1LK2B 4MXQC 3WNMA 5C0AD 4NRXB 4JFOB 5CGMA 5GGQH 1I8LC 1FGNL 3UTQB 2ZG1A 4ZUVB 5AZEL 4G6AC 4F2MA 2YWYA 5IB2B 1ZVSB 5C0ND 5C09A 4OI7A 2C3XA 2EDJA 1T21A 1EAPB 2W60B 2IH3A 4TSAH 4P5TC 1IFHL 4U6HB 2BCKB 2FX8H 2R2HB 2MNUA 2NY5L 3P9WB 3R4DA 1S9YB 5FKPB 1WC7B 2D7OA 3V0AC 1A21A 3KLAB 1TZHA 4NOBA 3V4UL 4J3WA 2CR6A 2HN7A 4RX4A 2LAAA 1HH9B 4GRWH 1KJVB 3IDGA 1S3KL 4H1LA 1OP3K 1NLDL 3LS4L 3OTTA 5MHSE 1TQBC 3TGXA 2IQ9L 3GO1L 4HLZG 2BY2A 1LP9A 1U8HA 3LVEA 3MRHA 4O51A 3ZDXE 5I73B 4PRDB 2NY1C 4GRWE 5BVPL 4XVTL 3O2DA 4A2MA 5I8EA 3Q5YA 2GKIA 5HYJB 1JRHI 4ZUWA 3QG7L 1JHLL 4MXQD 3TVMC 4L8DA 2F5BL 2VLJA 1EBPA 4FFWD 4YDIH 4PJFB 3PG2A 4LLYB 1IBGL 4NRZB 4G6AD 2P8PB 4X4XB 4P2QB 1MLCB 3L3GB 1J05B 3HLAB 4H88H 2HLFC 4PJXE 4U3CA 2CRZA 1E0OB 5GGVY 4JJ5A 1YEDA 3L3HB 1G0XA 1QFUL 5E4IA 2DBLL 3ZT7A 3RUGE 5E4EB 4LU5L 2IPUG 4MQXC 4QRQA 2MQCA 2AP2A 4NGHL 5IEKA 3RI5F 5DRNB 4YO0A 1FZOB 2EYSB 3UO1L 5EPMA 2Z8WC 4ZUSB 5D8JL 1KB5B 4GLRI 3EJJX 1CGWA 2WUCL 1DN0B 3WS6C 5L88L 4MJIA 1HHIA 2J3SA 5EUOA 5J11C 3MJ9H 5TH2B 1PVHA 3U9UA 2VITA 1CFVL 1G6RL 4KVNL 2ZUYA 3CVHL 1M05B 4EBQL 3LKOB 1HCFX 2CQVA 5ICXA 1B6UA 3NFSH 1UB5A 1MJUH 1LWRA 1YDPA 4FTVA 4I77L 3MRFA 7FABH 1MF2L 4NHCL 1ETZA 3BE1L 1ZSDA 4I9WE 2OTUB 4KK6D 2AJSL 3W81A 4G8IA 3P0VH 5CCKL 4Z7UB 3A6CL 1NMCB 5D2LB 5CUSH 3DVFA 4Q2ZA 2HLFD 3PWVB 4UIKL 2QADB 3HMXL 4JCLA 4O5LH 3CC5A 4PRPE 4DEPC 4AEIL 3HG1D 2Z92A 2K1MA 4OLEA 3FB8A 2X4NA 2V17L 3Q1SH 3HZVA 4QHNB 1E4KC 3CU7A 1F8TH 3HR5B 1ORSA 4XNXL 4DZ8B 5MENA 2OZ4L 2FGWL 4S1SL 4DAGH 1YNTB 4Z7OF 3VXRE 1U95A 5FHAL 1NEZB 5CS7A 1MCHA 2PXYA 5IBLC 3C09C 1S5IH 5IR1B 3PWJA 3WS3A 3DVNB 3W5NA 5HDBE 1MFAH 4JFEA 4XP1H 3C5ZB 4K55A 1AGEB 3FFDB 5KS9E 1T4KA 5DJ8A 5HHNA 3FJTA 1DBBH 5D72H 1S9KC 4AL8L 5D2NB 4ZFOL 2A6DA 1FVDA 1WJ3A 3LH2H 1JPTH 2IPKA 3JV0A 4O4YL 5IV2B 3VFGH 4N0CC 1D9KB 1QKZL 2E3VA 1OWRM 5AD0A 3ULUF 1AGCB 4M1DL 2FBOJ 2E7BA 4P3CL 5JW4N 4P9HC 2NTFB 4XTRC 3S4SG 5CINH 1R0AH 4TSBL 4NO5A 3RWEA 3VA2C 2ZNXA 2VMFA 1KIQA 2E5EA 2ZUVA 4OLUL 2GAZB 3B9KC 1NDGB 3IDMB 4J3XA 3K4DA 3DO3A 3RU8L 5D6DC 3FQUA 3ARGA 4X6CB 4RDQG 1FYTA 3KYNB 1LE9B 4A6YA 2NY4B 4J3OC 2BNQA 2E7LC 3EYSH 4MCYA 1CG9B 3ZSSA 1JNNH 3IJHA 5IBLD 2KBGA 5F7DA 2V2XA 2IAND 5DMGC 4D0DA 5BW7C 1LK2A 1I1CA 2GFBB 2B1HH 3ZYIA 4BQ6A 5BOPA 4LCWE 5DMJB 1A3RL 5T1MB 2VLRB 3UTQA 3PGDB 3M8OH 4QRRD 3T1FB 3QJFA 4CU8A 1NFDF 2J8UE 1S7XA 1XF2A 3TIDB 1EAPA 3EOTL 5F1NA 1IGML 4U6HA 2BCKA 4N0CD 3MV9A 1OARH 4UAOC 1RD6A 5FKPA 4S1DC 1WC7A 4JREC 1LILA 4LARL 2A6IB 2J6EL 3KLAA 4Q74A 2HKHH 2P7TB 4UZGA 3VW3L 3N50A 1F90H 4ZOEA 4JG0H 1FYHB 2P5EB 2LVEA 1HH9A 2YKLL 3SKMB 2R4SL 4GMSL 1CTOA 3O6FA 1TZIB 4JRYE 1FGNH 3B9KD 5AZEH 2VSDA 2EH7H 3V5KA 1OLZA 3VXMD 3T2NH 2QHLA 2IAMC 4GT7A 4OTXL 3DX9B 2NXYB 2NY5H 4PD4K 5HYJA 1RUQH 2E7HA 3TBYB 3KLHC 1K5NB 1FSKC 2Q8BH 1BFTA 4OZIA 1M7XA 4G6JL 4LCUB 1A2YB 2Y7QA 3HUJF 4X4XA 1FLRL 1VGEH 4P2QA 3QEGL 1NLDH 2EIDA 1J05A 3HLAA 3E3QC 3LRGA 2IQ9H 3GO1H 1QG3A 4JZNA 3X12A 1KSRA 4MA1B 2VABA 3L3HA 3O4LB 2FATL 2WQRA 3DHMA 3KS0J 4LRIC 4LPVA 2DQUL 1FZKB 3LZFL 1UJ3B 3VD9A 3OKKA 5GQBA 4H5SB 3QG7H 1IARB 1JHLH 3EZJB 1FZOA 5C07B 2AJZA 3QEHB 4XCNA 4ZUSA 5D93C 1IBGH 2VL4A 3BH9B 1KB5A 3ZHKA 3JBG7 3T0DA 3GSWB 3OSKA 1CLZH 1KPUB 3C5SB 5TH2A 4AK1A 5C70A 2Y25A 4EOWH 4D9LL 2ESVD 3LKOA 4DUVA 4ENED 3ZT6A 3UTZB 4L4TA 4GAGL 3T0BA 2DBLH 3JUZA 1N0LA 4LU5H 2EE6A 2FX9H 2LAGB 4RMWA 5D2LA 3T0XA 5E6IC 1WSST 3W11D 3BXNA 3PWVA 3VFVB 5D8JH 4RFEB 2Y23A 2GEEA 1Y6KR 4NM4L 2ADIB 4CVXA 1Y18B 4ODSH 2Q7YA 4R97C 1ROWA 2RB8A 2P1YA 1RHFA 3QUMA 4KVNH 3CVHH 1EVTC 5IIEA 3QXTA 3VFPA 2IGFL 1Q0YL 4QHNA 3R8QA 4X8XA 4EBQH 1CK0L 2BJML 1CE1H 4O2EB 1S78C 3F12A 4GRWB 1YNTA 4NHCH 1NEZA 2AJSH 1MUJB 5IR1A 3P73B 4KRMB 3DVNA 3M17A 3A6CH 2DF3A 4PG2A 2HVJA 3C5ZA 5DSCB 5DD0H 4UIKH 3FFDA 3QZWA 3HMXH 1YUHB 5T3ZL 3CFDB 1TCRB 1YNLL 4JRXD 5EH1A 5IV2A 5SWSB 4PJXB 4NHUB 1Q9KB 3VG0H 4HULB 1DVFD 3IDYB 4RWHA 3DURB 2BVTA 1AGCA 1IAKB 1KEGL 2W0KA 3O8XC 2ID5A 4PJCA 2HT4D 2FWOA 5FHAH 4UV4L 1NGPH 1IEAB 3V4PL 1AY1L 1FQ9C 5FECB 2VLKD 3L3KA 1IC7L 4QRPA 2QQLL 3Q6FB 5JW4M 4KPHL 4X6DB 2GAZA 4M62L 3IDMA 3MTRA 3CMOL 4X6CA 4WI4A 2N4IA 1BFVL 4F58H 3KJ4B 3M07A 1CG9A 1J1OH 2A6KB 2BSED 3OKDA 4KUCD 3O11A 1G9MC 2MTPA 1QKZH 4I0PA 4ZAKA 5IG7A 2GFBA 4P3CH 1U58B 5E95B 4P2RD 1KPVB 5LBSH 4U49A 2ADJA 1IE5A 4PJAA 3SPVB 3IRPX 3KVQA 3MUZ1 2XY1A 5HI4D 5BV7L 4HMCA 1JYXA 2P45B 3VFRA 3PGCA 5ECJE 2GJ6E 4KKAC 4OLUH 4M1GH 3MX0A 5DVKA 4AYFA 3RX8A 4M3JA 3FO9B 1FAIL 4PGBB 1RZJH 2AJ3B 4G43B 1LO5A 3NABH 4EIGB 3QIBC 5CSGA 2HRPH 1KB9K 1QFWI 1E6JL 1G1YA 3BPOC 1I7RB 1OSPL 1A22B 1TZIA 2G5BB 3O6LL 1A3RH 5HXMA 3MUY1 4OF0A 3ET9F 3BPLC 1WAAE 1K85A 1A7PL 3B5TA 4H26A 3IDXL 3EOTH 1ZWIA 4EDWL 1IGMH 5C09D 3BAEL 3DX9A 4DKAA 3R1GL 1JV5B 3VXQA 1ZLVH 4LARH 5KS9B 3FQRB 2J6EH 3VW3H 3OGOE 4MS8C 1V7ML 4LCUA 1S7RA 3MJ8B 1A2YA 1G7IB 3TCLB 5GS2H 2NY0C 3FO1B 4TUKL 3TH3T 4RX4D 3DTXB 2OL3L 2CLRB 3JV6B 4OZFA 3OXRA 2CKBL 2EO1A 3GK8H 3O41A 4LK4A 1DZBA 1MVUA 1X5FA 1T2JA 3O4LA 2QQQA 2G2RB 4P59L 4JO2H 2VERN 1FZKA 1UJ3A 3BH8B 3FN9A 5D5ME 1OHQA 5IQ7L 3VXUD 5I6XB 2OR8A 4KRPB 4MDIA 5C07A 4QHLA 3DGGA 1VEOA 2X1OA 1K2DA 3N9GL 5DDHB 4N1EA 4WCYL 1FLRH 3GSWA 1I1AB 1FL6B 1KPUA 3O6KL 4R26L 3C5SA 3QEGH 4XWOD 1EUUA 5DRWA 3T3MF 2C3VB 3H6JA 2JE8A 3U9PL 1IC4H 3T0AA 4OAWB 3UTZA 1S5HB 4F8TA 1T6VN 4OGAD 4JHZA 2FECI 2FATH 5T5NF 4NQEA 2J8UB 1HH6B 4PJEB 2XACC 3VXSE 2DQUH 2NY0D 2I9LB 3DX6B 4KDWA 1D6EB 3S34H 2NW2A 4L9DA 5MP6H 1GZPA 2I26N 5B3JE 5HHVL 5J1SC 2W9DH 1QSFA 3DSNA 3OR7B 1E4WL 3FZUD 4M9PA 2R0LL 4X99B 2I9TB 4NWUL 3NH7L 1QRKA 4FOMA 1GL4B 3I9GL 1IQWL 4PGZA 2X4SB 4MJID 4XVUD 4QKXB 4D9LH 4JPIA 4JRYB 4O2EA 4GAGH 1P5UA 1DQLL 1EEZB 4CN4A 2VLMD 3QQ3B 3BWAB 1ZGLA 3EKCA 4FTVD 1MUJA 3QSKB 2HVKA 3BP4B 4Y5VC 4HH9A 5GS3A 4GG6F 1A14H 3CCHB 5DI8B 1GC1L 2IADA 3BKML 1TCRA 4HIXL 3B9EA 4NM4H 1CFSB 1KEML 1TVHA 1BJ1H 5SWSA 3HPLB 2IGFH 1Q0YH 4NHUA 4IMKA 4WEUD 1LO0H 2HA1A 3DURA 4KI5E 1CBVL 2J8OA 1UCTA 2W1NA 3I84A 1MCBA 4PFEA 4ZPTB 2EE9A 4YR6A 3BKYL 3V95A 3NOIA 5MEND 2EDWA 1IEAA 1HZHH 1ZA3A 1ZLWH 5FECA 2PXYD 4P4KB 1EBAA 3MLYL 4X6FA 4U1IB 3CU1A 1F4WL 4X6DA 4DK6A 3P2TA 4JFED 4XVSL 5T3ZH 5GPRA 3S3PA 3QHZL 4RIRB 4WWKA 1S9VB 4LHJB 4JM2C 4PREB 1TTGA 1MHPH 4C56E 2A6KA 2QEJA 5T3ZE 4GXUN 3SO3B 3ARDA 3CSBA 3AROA 5GRUL 1U58A 1KEGH 5IVZA 1KPVA 2COQA 4XP6H 5EC2A 1MCNA 3NFNB 1GPOH 4HS8L 3CDFA 1U3JA 4JFXB 2F74B 3WFEL 1XH3B 1IVLA 5ADPL 1GGYA 2QQLH 1KYOK 4KPHH 3G5XB 3O6FC 2R2EB 3CMOH 1LDSA 1YEJL 2GY5A 3FO9A 1BFVH 3U30B 4PGBA 3ARGD 4G43A 4CMHB 4JDZA 1FYTD 3ILPB 4X9IA 4PD4J 2BNQD 5CEZD 4JM4L 2YA0A 4V1DA 1I7RA 3AVEA 4RMVA 2G5BA 3EAKA 2FO1A 1TJIL 2WWMC 1P9MA 5F7EL 5BV7H 3RPIA 5J3HC 4L8BB 1X5XA 2BDNL 3K1DA 3H0TB 4JM2D 3SKOB 1V3KA 3U7WH 3AREA 3L3OB 2P5WB 2A83B 5DEZA 2ZUXA 3LKQB 4DVBB 1JV5A 3MV9D 3RWFB 2VDRL 3KWWB 3QAZB 4NQTA 1T20B 3TNNA 1G7IA 1QR4A 4LVNC 1TJGL 5H37G 1WCBA 3CDYA 1E6JH 5BQ7B 3CPLA 4BSWB 2DQCH 4OLXH 3O6LH 3BISA 5EZOL 1MJ8L 3O6FD 1JRHL 3AUVA 4XPBH 1EJOH 4UNUA 3IDXH 1WBXB 3EO0A 4EDWH 3BAEH 2VAAB 1JFQH 1BFOA 3GSQA 3R1GH 1H9VA 3C8HA 1GGCL 5B39A 4PS4H 3BH8A 3ZKXB 1FN4A 1U8QA 1UFUA 2NY3B 3FB6B 1RUPL 5HYJD 3WFZA 2I60L 1HYSC 4HKJA 4KK9D 1V7MH 1OB1B 4N8VB 2DQFB 3EDFA 2WWMD 1RJZA 1ACYL 5GISL 3DVIA 4TUKH 5ESAA 4KK8C 4YH6A 1I1AA 1FL6A 3KYAA 4HZLB 3ZKMD 3EYVA 1KPRA 3HTLX 1PZ5B 2OL3H 5DQ9A 3VRIB 3ZYOA 1E4XH 4F15B 2BVPB 4OAWA 4UOW1 1S5HA 1I3GL 4JE4B 2X5PA 4Z7UF 3NTCL 4ZXBA 2NNAA 4JFDD 4PJEA 3S6CA 3TPUA 2B39A 3NCEB 1ZANL 1D6EA 4JG1L 1RIUH 4HJGB 1CDJA 1A1MB 3OR7A 1U3HA 3U7AA 3O3EB 3R06B 1U8NA 4X7SL 2I9TA 4WCYH 3V5DB 3O6KH 4MQSB 1CFNA 3F7YA 4PG2C 2CJUL 3PJSB 4ZPVB 4KKBD 3EFDL 5DFVC 3U9PH 2YPKB 4AH2B 1OAZL 1CDGA 1EEZA 3FMGL 3UTTA 1M7IB 2E9JA 1HYSD 3QQ3A 4L4TD 3BWAA 3P11L 3MO1B 4M6OL 1OP5H 5LGKA 4I3GA 4ZOAA 5DC9B 4KK8D 1IGJA 2J2ZA 5DRXB 2DLTA 2VXTH 4D0BB 3D85A 1A6ZA 2FLBT 4EUPG 4NQXA 1YJDL 1E4WH 2E6JA 1GGBL 3A6BH 4X7TA 1T7VA 5T3XL 2YUWA 3CX5J 3I9GH 1T7XA 1QBBA 2YR3A 4YHNA 5C8JB 2C3HA 1PG7W 5HHPA 4FHBD 4AZ8A 1UH3A 1FFOB 3TA3B 1DQLH 3B6SA 2WBKA 2NY2C 3LD8B 4KZDL 4NO3A 3SCMA 3LCYA 3D9AL 4O2FB 3MV01 1MCOH 2BC4B 5D71L 5CJXA 4F7PB 4WO4A 5HI5D 1FFRA 2R0WL 4ZAKC 1UM6H 5A16B 1GC1H 5EOCH 3C5ZD 5DVLA 4BYHA 4QRTB 1UACL 3BP5B 3HI5L 3VGDA 4RIRA 5H8DA 1BX2B 3MOBL 3EGSB 3PP4L 4G5ZL 2MKWA 5IB4B 1DTUA 5T33L 1EFXB 1HDMB 4Q9RL 4KGLA 4M4PA 4PRIE 1NFIB 4FA8A 3DO7A 4P49A 4GXUM 4ODUA 3T0EE 5D4QA 1S7TB 1XH3A 1MRCL 2I5YL 3QG6A 5DQJB 4W68A 1QD0A 1EO8L 3GGWA 1YY8B 1F4WH 4OFDA 3RWGB 3DBXB 4QRPD 1BAFH 1D5XB 4XVSH 1NJ9B 5KSAA 1Z9LA 4JANB 3QHZH 1DQML 2NY6B 1LE5B 2NY2D 3WNLA 3HE7A 4I0CC 3ILPA 4PTTB 1MAML 2NY4D 1CQYA 3LV3B 3KXFB 2WNGA 3C08H 4RGNE 3BN9C 3QO0B 3SDYL 3FCTB 1K8DB 1RIHH 3JXAA 4I0PD 4ZAKD 5FYKD 3RX5A 3ZL4L 3KLDA 5I1EL 1ZEAL 1N4XL 1JYNA 1HHKB 2HTKD 2XTJC 4X0KB 3WFEH 5J1TC 4IDJL 1G7HB 4KRNA 5ADPH 4ZYKA 2UWEB 4ODXB 4RGOL 5ACLA 2P5WA 2A83A 5DEGA 2WANA 3LKQA 4DVBA 2WIIB 5IKCB 3RWFA 4M6NL 1YEJH 3BEVB 3GI9L 1AGBA 3VI3E 4MAYB 1MCSA 3QIWC 5GS0C 5DEFA 1WIPA 3UTSE 2EEAA 4OQTH 3F7QA 4K71B 5SX5H 5BQ7A 1CE6A 3TYFA 4IRSA 5DK0B 4IRJC 4Z7NE 2L7JA 3HC0A 4HHAB 3UBXA 5F7EH 2X4TA 2BDNH 1T1YB 1WBXA 2LTQC 2VAAA 2XXCB 4JGUA 4L3AA 4NP4H 5LGHL 4PJGE 5BCAA 3HMWH 1HI6B 2NXYD 4HXAL 2Q3AA 4TNVK 3BW9B 4N8VA 2DQFA 2OSLA 4HCRH 4BK4A 1AI1L 1XGRA 5C0BE 2AW2A 4C56B 1CXFA 1PZ5A 1D3CA 3VRIA 1CD0A 3IU4L 1RPQA 5DJCB 1JRHH 2R1XA 5D7SL 1D7FA 4QHUB 1KIRA 3RKDD 2X4QA 4QLRA 1ZLVK 1H3XA 3O4LD 4G6FB 4WW2F 3CD4A 1RZKC 1ZA6B 1CGTA 3EO9L 5GS0D 4Y5XA 3ZZ1A 4HJGA 1RUPH 2PO6B 4R3SB 3TESA 1UZ8A 2ZOLB 5T1KA 3LN9A 4ALAH 3R06A 3MRGA 1ACYH 3S96B 3WIHL 4LPCA 1RAMA 3V5DA 1DE4B 2YC1B 1ODAA 1R24A 3ZDXF 4GS7C 3ARVA 5K9OB 3DROB 4GRWF 3VDAA 3PJSA 4XPFL 4ZPVA 3BP6A 3U83A 2YPKA 5FYJU 1B6DA 1XZ0B 1I3GH 1RZ7H 4R0LB 5E2WL 1VFAB 3O81A 1RUAL 5F70A 3L9RA 4Z95H 4OD1L 4DCQB 3SHSA 4CVUA 4M5ZH 4GLRH 3UJTL 1RIVL 4NQED 2AI0L 3EYQD 3VDBA 4JG1H 2X44D 1N6VA 2A1WH 4D0BA 2K7QA 3U4BL 5BV7B 3G08A 3VXPB 4XBEH 3DV4A 1MIMH 1TFHA 1X5AA 4X7SH 3W9DB 1QSFD 4PJXF 1HSAB 5LAXB 1R3IH 1OY3B 5EC1B 5C8JA 4KQ4H 4JO1L 2XT1B 3K8MA 2KL6A 3EFDH 4LLWB 2LABA 5LCVH 4YHIB 5JOFB 1FFOA 3RUGF 3PXJA 1WBYB 1RSFA 4WWKC 1F4XH 2YEZA 3TO2B 1MLBB 4F7PA 2HLAB 1S9XA 2VISB 4LVHC 1U92A 1YJDH 4Y8AA 2H2PC 5TDNB 3DUSA 1BF8A 4FQJL 1BOYA 3REVA 1KBGL 2HT3C 5EBMB 1KYOJ 3RWDA 3O6MH 3GNML 5SWSD 4M03A 1EFXA 1HDMA 3BQUA 4XGZB 3D9AH 1NFIA 4QRSB 5D71H 1INDH 1S7TA 3GBLA 3SKNA 4P57B 5DQJA 3O9WA 3L5WA 2CPCA 5DA4A 2R0WH 3RWGA 3DBXA 1D5XA 1NJ9A 4P4RB 1FO0B 1P9MC 4YIQA 1FG2A 4JQIL 1S7VB 1U8LB 5CGTA 4WI3A 3JWOC 5LQBH 4JGJA 3HKFA 4WWKD 4PTTA 3PWUB 3PP4H 3KXFA 4G42A 4G5ZH 2BVOB 3AREC 4OLYH 4HIJB 1QFHA 3QO0A 4K9EC 3RWCA 1K8DA 4NT6A 1ZLWK 3ARDD 3EIFA 4KTEL 3GSVA 3DYMA 1S7WB 4POZC 4XAWH 3OAUL 2H2PD 1VFUA 2X9XA 5GRYA 1MCLA 1G7HA 3F7VA 2I5YH 4RDQF 2UWEA 5FHBL 1EO8H 5KSBE 4HMEA 2R39A 3BYTA 1H3WM 1GOHA 2WIIA 3IAGC 4QYOB 2XIDA 5HVHB 1DQMH 3BEVA 1QFWL 4KJPD 3S5LB 3SE4A 4PJBF 1AHWB 5I1HH 3WKML 2FO4A 3G6AB 1MAMH 4WUUB 2BSRB 4CVZB 2O5YL 9CGTA 4WW1B 4GAFB 3MRCB 1CGSL 2QSTA 1OSZB 3H7LA 3LN4B 4V1DD 4MDJA 3QT2A 4PV9A 5DK0A 4KJQD 5I1EH 1ZEAH 3P77A 5INDB 2YD4A 4YPJA 3ZE1E 4HK0B 1T1YA 1NSNH 4IDJH 4EI5A 4JO4H 4YHOL 2EDOA 4H8WH 3STZB 3L7FA 1HI6A 3ARED 4GSDL 3EOYG 4YHML 1N3NB 3RVUC 3WUWB 15C8L 3BW9A 5I8OH 4PJDB 3ULVL 2P8LA 4ZXBC 4POZD 4UDTA 3SDXE 3CXHK 4Y2DA 3BPNB 4XT1C 1FZMB 4M61A 4MA8L 4HIHB 1JGEB 4TPRL 1GVIA 3IDNA 1Q0XL 1YNKL 2BX5A 2CH8A 2VXUH 1U3HC 4PRIB 1FORL 2D0GA 4QHUA 3WIIH 3BZ4A 2DM4A 1TETH 3T0EB 4JLRA 3BZDA 3OWEA 5LGHH 5EU6E 5D7KE 5FOBA 5FYLH 2ZCLL 4HXAH 1W72L 5F97E 5CIPH 3T8XB 5IQ9B 4YHPB 3GJEA 3MFGB 2YC1A 3QNYB 4KTDL 4OF5A 2ZNWA 5FYLE 5I15L 4U0QB 2AK4E 2FECL 1T5XB 1I1AD 1QFWM 2VUYA 3IU4H 5EUKA 3V2AR 5D1XB 3L3DB 3VFMB 4R0LA 1KLUA 3I2CH 3U0WL 8FABA 4CBPA 3KNBA 4PY8J 3CH1B 3H9HB 3ULUC 4N0FA 5DR5L 3PQYE 1OT2A 2HTLD 4M43L 3RVUD 1AQDB 4FQIH 1DDHA 4ZTPL 1QOKA 4NO0B 4LSTH 3TH4T 3MA9L 4DCQA 3EO9H 2BSTA 4ZXBD 4M6MH 4KY1L 1AQKL 1NGWA 3VXPA 4NQDE 3RKPA 3WIHH 4QWWC 4MD5B 3SCMC 3W9DA 1W0WA 5LAXA 1U3HD 3UTSB 1JPFB 4M7KH 2EIBA 1X5KA 5CJXC 2CK0L 3NCJL 2O61B 4LLWA 3QDGD 5HJ3B 1RZIB 3WD5L 4BFGA 2UVEA 1EHNA 2X70B 1DUYB 3UTTD 4QXWA 3UJTH 2FH8A 1MLBA 3DUHA 1HNFA 2AI0H 2HLAA 4N9OB 3MROB 1JF6A 4PJGB 5IK3B 2CIKB 2ZZUT 4R2GC 3U4BH 3D39A 5IHUL 4LLQB 3D85D 1R3HB 5ETUA 5TDNA 2JB5L 5HVFB 2GITA 2VDMH 1BQHG 1OP9A 4F37K 2Z31A 4Y2OA 3AAZB 3IDJA 2FHCA 5T1DL 5JW3L 5FDYA 4LCCB 1OP5K 1WUNT 1RZ8B 3QUZA 3WJJC 1G7MB 2XKNA 1EMTH 2FNBA 5GJSH 3VGGA 5GSRB 5EULV 1QACA 2VKXA 4QWWD 3SCMD 3HE7C 3NGBB 4MWFB 5DJYA 2AEPH 1Y0LA 1J1XH 2WBJC 2AQ3A 4NQCE 5CWSA 3L3IB 4PBWD 3KPSE 1QEWB 3MR9B 4WO4D 2X40A 4F7TB 3EJYD 4P4RA 1FO0A 3FFCE 4AG4L 3EDKA 4XB8A 1IGTB 2DQJH 2Q6WB 2EKSB 4MHHI 3WDHA 1U8LA 5I8KL 4UT6H 1JGLH 3IDUA 4HC1A 1NGYB 3PWUA 4UQ2B 2BVOA 2WUBL 3MFFA 4CDGC 2EXYC 5FFLA 3ARWA 4U1JB 3HZYB 2BERA 3DRTB 4R2GD 4K7PL 4WGWB 5H35A 3H7BA 4L4VE 2Z4QB 1JWMA 5FB8B 4UINL 5FYJL 1A4KB 3F5WB 2GTWB 1I1FB 5FKAB 1QLFB 3KR3L 5L2KE 2IQAB 4QYOA 2O93L 3T65B 5KSAD 4P3DB 5EO9B 3T4YB 1YQVH 1BREA 3G6AA 4WUUA 5JDSB 3HE7D 1NGQL 3FT2A 4WW1A 3QP3A 3JWDL 4JEGB 3LN4A 5D96B 4JPVH 4KTEH 2XZQH 4BUGA 5EOTB 2GSIB 1CVRA 4DQOL 4U1GC 4HK0A 3MNVB 1LGVA 2VXQL 4JZJB 1K9TA 1PLGH 4F7MB 2VDNH 4AENA 3UPAA 3V7MA 4IIQB 3Q5TA 2DICA 2P5WD 2EXYD 3T4AB 2YK1L 1QFWH 1U8MA 4HV8A 3TV3L 5DK2A 4DOHE 3WUWA 2RJMA 5B4MC 4P2OB 2QQNH 4PJDA 3FT4A 3QPXH 4JHBA 4IRZL 4U6YB 2CRMA 1BZ9A 5F44A 1DQDL 4HIHA 4Y5XC 1PGRB 1JGEA 1KCRH 3SJVE 2AK1H 4QXUH 4IRSD 5KZCD 1BD2B 4M5YL 3IFLL 3VWKB 5F3BA 1A7BA 1D5IH 4UQ3A 4JFHE 3MRQB 3QIUB 1YEKL 3D18B 5I17B 4KDVA 4YHMH 2X42A 4LOUD 3U48A 5SX5K 1LMKA 1R5VA 1NCDL 3OAZH 4YEEA 5IQ9A 3T8XA 4Q9CA 4YHPA 5D7JB 1EXUA 3GI8L 4MJ5B 1T5XA 4LAJH 1WAAF 2DQTH 3S37H 3VMOA 3VFMA 5CEXB 1YNKH 1A8JH 1N6QL 1MWAL 4RBPH 1AR1D 5CMAA 5F21B 5B4MD 4NO0A 2F8XC 2BFVH 5J1AA 1CCZA 1MJJA 5KSBB 1L7TH 5C0EB 2FSEB 4EXKA 5B8CA 2ZCLH 4WU5B 5B21A 2DQGL 4PJ7E 4ONGL 4AM0A 5C0GA 5CP7A 4MD5A 2NTSP 5T1KD 4ONHA 1JPFA 4OD2B 3C8KB 3DYOA 5IMOA 3PHQA 4HF5L 3K3QA 3ZLQC 4AQ1B 3IU3A 1SJEA 5HJ3A 4RRPG 1RZIA 3VI4E 4DKFL 3U0WH 5DR5H 3DUUB 4OQTA 2X70A 1ZHKB 1ZOXA 4P48A 4PGDB 4ZTPH 3UC0L 5D5MF 1UVQA 3MA9H 4ODHH 3MGOB 5KVFH 3RZCB 4J23A 1AQKH 3QUXC 4Y1AE 2NR6D 5IK3A 2CIKA 2EYRB 1O7VA 3I50H 1UXSA 1JNHB 3UCRA 2OLDA 4NZTL 1NUGA 4GJTB 5L9DL 4DKEL 1R3HA 3OXSB 1TZGL 5JPNB 1C7SA 4OSUH 4HPYH 4JFYA 1CI5A 3BRDA 3SDXB 2CK0H 3AAZA 3N1QC 4WI8A 3DGCR 1KLGB 3O9WC 1HWHB 2JB6A 3J8F7 4P0DA 3LN5B 4FQCL 4HCRA 1FDLL 2EYTA 1MFEL 3ESUF 5F7KC 2WBWB 2EDLA 5F88A 5EU3A 3TBTB 1CDCA 5CFHA 2ZWLT 1MFBL 3GUTB 4QGTA 5A43C 2PF6A 1MEXL 3FQNA 4KVCL 1QEWA 4PJ5E 4ZD3L 1IAIH 4Y88A 4F7TA 3I75B 4HJ0D 1VEPA 1X5JA 1IGTA 1AR2A 1NCBH 3U1SL 1XF1A 3MXVL 4OV5A 4N90E 4J8RB 2AK4B 1XAUA 4HWNA 1TPXB 5GZND 5FF6B 3WN5A 1P7KB 2QR0B 3PQYB 1EFXD 3SE4C 5FB8A 4LCIH 3BQUD 4POYA 1HILA 1A4KA 3F5WA 4Q97A 2AEWA 1I1FA 2AJYL 4GXVL 4LVOC 3ZE2E 5DD5H 4GUPB 3UMTA 5DA0B 4S10A 3RVVC 1QLFA 4PJHE 3O9WD 3SKJL 4AG4H 4MNGE 4UB0L 4NFBA 1RU9L 4D8PB 1KJ3L 5JUEL 3ZDYE 3G6JE 3LQZB 5I8KH 3ESVF 5CLWA 1UGNA 4TVPH 5EO9A 2W9EH 4KZEL 2NY6D 3T4YA 4WHCA 5I1CL 5ID0B 3P0YL 4KI5F 5JDSA 4K8RC 1NMBL 5I1GH 5DJAB 4JR9H 2AKRB 1C16B 4DTGL 3KXFD 2IPUK 1JHTB 4TVPE 2GUOA 2IG2L 4KUZH 4WRLA 1T2QL 3ROOA 5EOTA 4HZAA 5EIQA 4UINH 2ED9A 3GKZA 4N0UE 5CD5C 5DMKB 5F3HB 4JZJA 2NLJB 2YUZA 5D7IF 3WLBA 4Y2DC 4F7MA 2YN5A 3N85H 2ERJC 4JN2A 4OCMC 5FUCE 4NC1E 4Z8FL 4BH8A 3KR3H 1H3TA 2J8HA 3T4AA 3F7PC 4G8EB 2JCCB 3GRWL 1IGFH 4YXLL 2XZCH 3GMLB 5HHXL 1LEGB 1NGQH 2H1PH 2K3TA 1JK8B 4HUXA 4QOKB 3FN3A 3SEPA 1LNUB 4OF6A 5FCUL 1KFAL 4EI6A 4O2CB 3BZFA 4ZO8A 1BD2A 4DQOH 1T7YA 1SYVB 3VWKA 2XFXB 2BRRH 4HJJH 1RFDH 4LBEA 3VH8B 2V5TA 4X9FA 3GMRB 4EI5D 4NQCB 2PR4L 5I17A 2AJUL 3EBAA 1R3KA 3KPSB 4I2XE 4P46A 1XF5A 1N7ML 3TV3H 3FFCB 4PRNB 3WUZA 1H15B 3BHBB 1YEFL 1QRNE 4LKCA 5D7JA 1TLKA 4KHTL 3HPJA 4QTHB 2FL5B 4HUMB 5DD6B 4CUCA 4EN3B 4Y2DD 5TDOA 5KN5A 4L3EE 4FQ2L 4FN0A 4L4VB 3RWJB 2X1WL 4OB5L 2IJ0C 3AXLB 3CLFL 3RAJL 3MRJB 5F7MC 5E5MB 4ZS7L 3QXWA 4S0SD 4U2ZA 1B4JH 3CJJA 3NPSB 4LDLB 5DC4B 4WU5A 1I7TA 4CRPA 5F1SA 2R56H 2XQBL 5C0AE 2MQ0A 1NCDH 3EZ8A 2DD8H 3I02B 1IKFH 3DRQA 3GI8H 3C8KA 1BIHA 4K7PY 1RVFL 4OBRA 5GGTA 3P40A 4KKNA 4MNQB 3T2PA 4MD4A 2V2WA 1UH4A 3DUUA 4OIIL 1ZHKA 4PGDA 3RJQB 4F57H 1A4JB 3MGOA 3DXAA 4PJ8A 2IPTH 3CFIC 3UTPD 1QBAA 4JY5L 2EYRA 2Y5EA 3FO0L 5I74B 3OXSA 4DOHB 1WEJL 4CJ1A 3PWNA 5JPNA 5AYQA 1R6VA 3V6OE 1W0VB 2RR3A 1XCTB 4WVRA 1KLGA 3MRBA 5HPMB 1G7LB 4MSWB 2M2DA 1Q9LA 1G9NL 2CIIA 5I73C 5F9JB 3SJVB 4ZO6A 4IHOA 1JTTA 4JHAL 4YQXL 4X7EC 1MCIA 4Y16B 3E8UH 3MLSH 4TUOB 3UC0H 4TNWK 1ZE3C 4L8CB 3F62A 2SEBA 1A64A 3GUTA 1GZQB 1MCPH 2D03H 1F45A 4L9LC 1WIOA 2DN7A 5FK9A 1TZGH 3MREB 3D39D 5TF1H 2DQEL 4YAQB 2KH2B 4J8RA 8CGTA 3MV8B 3RX7A 2Z31D 3TN0B 3LQAC 3TLRA 4C57C 5IM7A 5B38G 2YPLB 4YNYB 4FQCH 2B2XL 3QUZD 1OGTB 2QR0A 1JYVA 1WF5A 5SX4H 3OB0H 3VJ6B 4WHYH 4Z78A 2D7NA 1MFBH 3E2HB 5HGHA 1LDPH 1NLBH 1MEXH 2W65B 4KQ3H 1WT5C 3U36B 1NCAL 4I5BB 3VFNB 4D8PA 5IJKA 4P2YA 3U1SH 3HZMB 5DVMA 3MJ6A 3MJ7B 3X3FL 3PABB 3PL6B 5FOJA 1MQKL 3OQ3B 3Q6GH 3MNWB 1IGCH 5SV4A 4JY6A 5GRVK 5IESL 2BVQB 2IBGA 2W0LA 5ID0A 1RMFL 1DBKL 4LSQL 4NRYB 3FB7B 2AKRA 1KT2A 1CIUA 1J8KA 1JHTA 4S11A 3FOMB 2B4CC 3BJLA 2PYFB 4LKXA 5F3HA 3HG1E 1UM5H 1ZHNB 2AJYH 4GXVH 3PWPA 4Y1AB 1RHHA 2G60H 4FXKB 3F58L 4YHYC 2QL1A 4UB0H 1RU9H 1AP2A 1P4BL 1Q9WA 2EE2A 4P23A 5JUEH 4MZ2A 4OJFL 4G8EA 4KZEH 2JCCA 2H45A 2WP3T 4UTAL 1LEGA 5EU4A 4D3CL 3MV7E 1LO3L 4QOKA 4WUUD 2EXWC 1EGJL 4DTGH 4ONOA 4HFUL 4F33B 2IG2H 1D5BA 1XF4A 3MRDA 4O2CA 5DTFB 2YZ8A 5HDOA 5ICZA 4ZFGL 2XNAB 3VE0A 4FQXC 3MNZA 1SYVA 1P6AB 4OF3A 3GMRA 5IMMB 1CXKA 4LLVA 5IHZA 4PJ5B 1F58H 2VB5A 3TJHC 5D2NC 4KKLC 5HGAA 1NC2D 3N1GC 1MCQA 2DI7A 1DQQB 3BHBA 4YXLH 5HHXH 1I9JH 1DQJB 4QTHA 5ITFB 5DD6A 5C3TA 5FCUH 1CDYA 4MZ3A 5B8CC 2Y07L 4O9HH 4X80H 4JKPL 4K3JL 3UYPA 2W91A 4I48B 5E5MA 1RURL 3LS5L 5E99L 1A6AB 2AJUH 2VWEC 2V7NB 4PJHB 2IANE 2EXWD 1N7MH 2Q3ZA 5E9DB 3BDBA 3G6JB 3AS3A 2HRLA 2FJHB 3WFCL 3I02A 4LLUB 5E2VL 5I76B 5KVEH 2GCYB 2VZSA 2B7DT 3IFPB 1WZ1H 4GAJH 3ALWA 1ZXQA 3WEXB 5DJDA 2F58L 4W4OA 3IKCB 5JOPD 1HYRC 4FQ2H 3GSUB 4MNQA 3R8BB 5TPWH 3FRPG 4YFLI 4X4MA 2EDYA 4ODTL 5IOPA 4HKBB 3TJHD 5KG9B 4PJGF 2Y1VA 2HFFA 3CLFH 4N0UB 3MRNB 2R15A 3REWA 4LRNL 1JTOA 3F8UB 2FIRT 5I1LA 3B2UC 3OPZL 1UWXH 2XQBH 2YD6A 3OHXB 4L8SB 1P1ZB 4HX1B 3KYOA 3QXAA 3D2UB 4U1LA 3VXME 5DWUH 4JKKA 3TT3L 1SJHB 5HPMA 2APXA 5TDPB 4LMQE 1RVFH 2DLHA 4HEME 2OTPA 3MRIB 3IETB 1VFMA 3RTQB 4UIMB 5EBWB 5F9JA 1G6VK 2OM5A 3MLXL 4TOYL 1WWWX 4Y16A 3OKEB 3I3EA 2WK2A 3E6HB 5AZ2L 1W8OA 4MAUL 3V7AG 4JFFA 4TTDC 2W0PA 3EW3B 1GZQA 2D0HA 4JY5H 2OXHA 3BFOA 4KDTA 1KN2L 3FO0H 4PRHB 3VG9B 1WEJH 1G6RA 1P4LB 1I3RA 4NZRL 5BZDA 3MV8A 5DD3L 1RJYB 3TN0A 1NCCL 2YPLA 5TE6L 1GHFL 2E7CA 4YNYA 3ARBB 4JCMA 4L3EB 4LFHG 3FL7A 4NCDA 1QUNA 3MRLA 12E8L 4RGMC 3NCYP 4BQCA 2CDFB 5IW6B 1BEYL 3OKOA 5ID1B 3U36A 3I6KB 2JELL 3AC0A 2ESVE 2FBJL 3MJ7A 4NBZB 2DQEH 3O4OB 3PABA 1OD7A 3MNWA 5DJXA 1UYWL 3GMQA 3LRSB 2OZ4A 2VLLB 4LHUG 5ITBL 5KSUB 4LSSH 3GM8A 4TTDD 4Y4HB 2FGZA 2DQHH 2J7LA 1FC2D 4M8QB 1BOGB 3E3QE 1N5YL 5C7XL 3BDYH 4FZEH 4HS3B 4OCNC 5CILL 1RULL 1NC4B 1U9KA 1ZHNA 3DMMC 3G6DL 4FFZL 5E5UB 4ZFOA 4FXKA 4WW2C 2MMXA 3AFLA 1MCCA 4FABL 4KMLB 2RGSA 2DDQH 1W0YT 1TXKA 4ZSOB 3X3FH 4Y4KB 3DI2B 1MQKH 2GW5A 1U36A 3G9AB 4KV5E 3GFUA 2CGRL 4XBPB 4Y19B 3MV11 1DBKH 4P46C 1XMWA 1NMAL 4X98B 1HHGA 1KGCD 3AS2A 4OM1L 2VDQL 4ZFFA 1N8ZA 4JRXE 5C9JB 2HKFL 1YYMH 3NACH 5I16A 3NIGE 1P4BH 4P5TB 4JPWL 4OJFH 5C6PB 2NY7L 4AEHL 5BS0B 4PGJA 5K9QI 5I71C 2Q7NA 3LHPL 3W39B 3KAAA 1FFPA 2VLKE 4HFUH 1MSPA 4PY8I 1MI5A 5IMKA 3S36X 4A6YL 1TQBB 3RVXD 4ZFGH 5CEZL 3WXWL 1JGDB 4TQEL 2EDEA 3RWHA 1PFCA 1PKQB 5KBNC 2ITCB 4XXDB 3VWKD 4NKOB 1U8JA 2Q8AL 1INQA 2YS4A 2V7NA 4PJHA 3OG6B 5F7UA 5MEOA 5E9DA 5F1OB 4P46D 4OM0L 4J2XA 4P2RE 5LKNA 2FJHA 4LLUA 4BZ1H 5F9DC 3TVMB 2BXYA 3GIVB 1NUDA 4HWBL 3MACL 1IQDB 3SGJA 5CLTA 2UYLA 5D7JD 2XZAL 3C6LA 4BH7B 2Y07H 4HWZA 3IKCA 5F93C 3GSUA 1FC1A 3P30L 5D6CB 2DMCA 5KAQF 2A73B 4L29B 4HKBA 1PG7L 4LNRB 3TO4C 5E99H 3HG1B 3ES6A 2XKSA 4NPYB 4U6XA 2FCBA 2VH5L 1FNAA 4OCXL 4JFPA 3IXAB 1CICC 4AY0A 3WCYA 1A6WL 1HQ4B 4L8SA 4MMXC 5JXEA 4LPWA 5A2KH 2KKQA 4NQUA 2DRUA 3RQ3A 5E2VH 4LLDB 3O0RH 3QXDA 3H9SA 3D2UA 1CGXA 5JO5B 1T0PB 2R9HC 3LKSB 3UBXI 1BIIB 3B83A 1SJHA 3DWTA 2F58H 3E6FB 5TDPA 5C09E 3IETA 1M71A 4UIMA 2AABL 4WV1B 5EBWA 5J11B 3V79C 2GK0B 3MLTB 5HY9B 4PYGA 1JI2A 4H1LH 5KANI 2HP4A 1A6TB 3E6HA 4XXCC 5C0CA 1B0RA 2APBA 3MLPA 2J4WL 2Z8VC 1F5WA 1AC0A 1BECA 4LRNH 4QF1A 5CSZA 2JF1A 2XG5A 1VA9A 1I1YB 5IVXF 3DXAD 4PJ8D 4LP4A 4GRLA 4PRHA 2H32B 2V5MA 3O2DH 4AIZB 1V3MA 5EZIH 1LP9E 5FM5M 1MRDL 4FFVC 3TO4D 2E7MA 4DEPB 1B0GA 1PY4A 1RJYA 5HHOB 2X4UB 1IZKA 3DIFB 3SN6N 1KB5L 2PN5A 5F89B 3VWJC 2DKSA 5IJKC 2XXMB 3OZ9L 2R2BB 4PRPD 5AZ2H 2HFGL 2AEIT 3GBMH 1S7UB 2VLJE 3V5HB 2W0FB 4DN3L 2CDFA 1FVCB 2ICEA 1YEEH 2VR4A 2ZUSA 3C09B 2QHRL 4BQ9A 2IANB 4KRPC 4MB4A 3RL2A 1EPFA 1RZFH 4HKXA 5TGBB 2D7TH 5EOQL 5D1QA 2A6JB 4X5WB 2MCG1 2N1KA 2Z0BA 4QRRB 5E2TL 2KDGA 5HTSA 4RMRA 1C12B 4HH8A 3AGVA 5D7IA 1NCCH 4GBXC 1GHFH 4Y4HA 1BPVA 4ELMF 4M8QA 3GJFA 1FV1B 2V5SA 3S88L 4P23C 5DO2D 1G9EA 3OR6B 1KNOB 4U6TA 4LAQL 4F3FA 1CD8A 5DJ2A 1RJLB 3MLWL 4S2SB 5FDWB 4ISVB 4YGAB 5IB5B 1NC4A 3OKLA 3THMH 3WSQL 3KJ6L 2X6MA 1BEYH 1P7QB 4MJIE 2ICES 2OR9H 1C7TA 5EUOE 4PB0L 3UDWA 2XI9A 3B9VA 4RFOL 2JELH 3IS0X 4WJ5B 4XVJH 4ZSOA 4U1HB 4Y4KA 3B9KB 3MMEB 1DLFL 1I4FA 1UYWH 2VLME 3T77A 3V6OA 3U0TA 5ITBH 3QCVL 1FL3B 4Y19A 2ZP0T 4FTVE 4NJ9L 4AEFA 3OB0K 3T3PE 4PBXA 3HHRB 4J4PC 1N5AB 3QULB 1N5YH 4UDUB 4YC2B 1IM9A 5FA4B 2AV7B 4B41A 1T04B 4YDLB 1I8LA 5CILH 5JDJA 1RULH 5FA3A 3VFWA 2AEQL 1AC6A 4FFZH 1H5BB 4RAHA 4KI1A 1WTGT 1OCWL 4FABH 3BJ91 3PWPD 1HINL 4P5TA 1CF8L 5MERB 3ELAT 5HHQB 4UAOB 4P23D 3D25B 4OFVA 2NY5C 1R5IB 5BS0A 5MENE 2Z91A 1WV7T 1UT9A 3W39A 1KCUH 2BHYA 2O5XL 4FZ8L 4QOKD 3GSNB 1XGTA 1NMAH 1I85A 4FMFA 4JFEE 4OM1H 2PTTA 5T5NG 4YXKH 1PKQA 4X4YB 1FG9C 4CJ0A 2IALB 5GIRB 4FXGB 3ULSB 4W4OC 3VA6A 3WFBH 2IAMB 3V8OA 2ESVB 1OTTC 4LCYA 2ZOKB 4G6MH 4DK3A 4AEHH 3TVMA 1HQRB 4U1SA 1FSKB 3UJIH 2GT9A 3MCKB 1IQDA 3EJZD 4OLWH 3IFOB 2ADFL 3LHPH 1UKSA 2F5AL 1F42A 4PV8B 1A7OL 2G75B 3QQ4A 5CHNA 4A6YH 1H3UA 2YD3A 4HDIA 4E9LA 5CEZH 4TQEH 4GAYB 2A73A 4L29A 3VCLA 1P2CA 1ZT7A 3P9MB 3FQWB 4UV7H 1J5OL 1F6AB 1FYTE 4NPYA 3P4NB 2Q8AH 2EDDA 2BNQE 5GS1C 3UJJL 4DVRH 5CEZE 2MCPH 2G9HB 4GW1A 4K2UH 1HQ4A 3JZ7A 1EO7A 1NGZB 1SJVA 4CAGA 4LLDA 5LWYL 1NBQA 1QVOA 3MBEA 1LEKB 3MBXH 1WITA 3QUKB 4WNQA 3H3KA 4XPHL 3LKSA 2OI9C 1YEHL 4EUPA 2XRAL 3E6FA 4C83A 4XH2A 4OUUB 4ONFL 3QNXB 4KDTC 5IJVB 4HGKC 4XC1L 4XX1E 1T2XA 2VDKH 4XWGL 4MNQD 5HY9A 3MV9E 3BD4A 3TFKC 1OTTD 2B0SH 5F1IA 4BSJA 4ETQB 1A6TA 4JRXB 3TH2T 5IUSA 2VH5H 5EBLB 4LASL 3D3VA 2WZPD 3ZKNC 4XP9L 4M48L 4R4NC 1H3PH 2OQJB 4XCYB 1QA9B 2H32A 3QAZC 4GW4B 2MWCA 3P9LB 4NQVB 3H42L 3VFUB 4URTB 2ADGA 4NNYB 3ULVF 1ZHBB 4F80A 1J8HA 1KELL 3B8YA 1CLOH 4R97B 5HHOA 2X4UA 5IF0B 4BZYA 1KJMB 5IFHL 5HYJE 1E4KA 5BOZG 5CEYB 5TQ0L 3BO8B 5I18H 2P48B 1U6AL 2R2BA 1LO2L 5DC0A 4Y16D 1UWXK 1S7UA 1C5BH 4OZIE 2H9GA 2J4WH 35C8H 3HA0A 1SM3L 1FVCA 2CD0A 4PJ7F 4JFFD 2YZ1A 5I2IA 3U2SA 2H8PB 1FNEA 5ENWB 4P2QE 3EYOB 3L7EB 1UC6A 3JV4B 4QRRA 4JAMA 3TFKD 1KTDB 1MRDH 2BNRB 4PJIF 4CNIA 4F15C 3MV8D 3V6ZA 1U8IB 5J8OA 3MRRA 1KB5H 5FGRA 5SWZA 3TN0D 4R4ND 2YPLD 2FX8L 1RJLA 3O8XB 4ISVA 3O3AA 4DN3H 5C71A 3FO2A 3M1BB 4M1CC 3AB0C 2QHRH 2M1KA 1T22B 1P7QA 2ICWA 2E27H 5E7BA 4NYLB 5EIIB 3VFSA 4U7SA 5EOQH 1QZ1A 2X4OB 3CFKB 1UZ6F 5L8KB 5D6DA 1K4DA 4Z7VB 1WZMA 4L4TE 1CQKA 1Z2KA 2E7LA 2ZSVA 1HEZA 2UY6A 1CFQA 2IH3B 3QULA 3RWIB 4LAQH 4YBQC 1YC7A 5D2LE 2GHWB 5FA4A 2AV7A 4GO6B 3UZEA 4J7RA 3QUMH 3WO3B 1YPZB 3ZTJG 5JHLH 3KJ6H 3FB5B 1TZHB 1XT5A 2FD6L 2HN7B 5ALCH 4MX7A 3AMKA 3IDGB 5J13C 3UPRB 5MERA 4H88L 5HHQA 1DLFH 3D25A 5GGRB 4WU7B 3RIFK 2ZPKL 4O51B 5CZXD 3QCVH 3GSXA 5DURD 2GJ6D 4NJ9H 4U3XA 3SOBH 2WP3O 3BIAX 1UCBH 1SY6A 5TJWK 5J57B 4D9RD 3ARFC 4M1CD 1T1ZA 1LQSR 3QIBB 5I8EB 1TTUA 4G80A 3GSNA 1E4XI 1X6LA 1EZVX 4DGYH 3VXUB 3SDAA 3JTTA 3BPOB 3JWNC 4K94L 3ZE2F 4WY7H 4ZUWB 1OD9A 1KCVH 3HNTH 4L8DB 2DLGA 3BPLB 1QTYT 2IALA 4FXGA 3BI9X 3SGKC 4MQ7B 2IAMA 3KPMA 5IBTH 5L7XH 4PB9H 1MPAL 1OAQH 4WUKL 4YBQD 4OGYH 2NYYC 4E41A 4PJCE 3ZMRA 4JJ5B 3RHWK 3IFOA 5FO8A 2KZWA 7FABL 2NY0B 1L9NA 4LQFL 1L4IA 3OJVC 1E4JA 5K59E 2RCSL 3P0VL 4HS6A 1BBDL 4QRPE 5IEKB 4GAYA 3S35L 1MI5D 5ADOL 4GMTH 4NZUH 2XZZA 3BDXA 5EPMB 4U0RC 4X6CE 1F6AA 5FYKH 5I1DA 3HAEG 4O5LL 1S7QA 4MJIB 4I8DA 3SQOH 5DHVA 4LRIA 3U9UB 1JWSB 1ZVYA 2VITB 3Q1SL 1NGZA 5FYKE 1FGVL 5E9DD 3KPNA 2RIKA 1F8TL 3QUKA 3S9DB 1CGYA 4FTVB 1YDPB 1KCKA 4PJAE 4DAGL 1FNHA 4YHLH 5A1AA 5IWLC 3OKMB 4OUUA 3VFOA 1A7OH 4G8IB 3L5IA 3EHBC 3C6LD 4GRLC 4XP1L 4RCAA 1CR9L 1J5OH 2H26B 4XNZC 2NYYD 4JRXA 1DBBL 5D72L 4Z7WB 1JUFB 4HUVA 1G7JA 3LH2L 3QJHB 2X4NB 5DUPH 4XI5C 4XCYA 3VFGL 1IEHA 2E6QA 4YX2L 3SE3C 5C2UB 5E6IA 3MLRL 5LWYH 1B90A 4WFHD 5JXED 1RV6X 5MENB 4K71C 4PLKC 2DKMA 1R3JA 1YEHH 3BSZH 3H9SD 3P3YA 3D2UD 1U95B 3SDCA 1R0AL 3QISA 2PXYB 4X7FC 4KI5C 4XC1H 3PWJB 1P5VA 4XWGH 5DJ6A 1TJHH 4JFEB 3INUH 5CEYA 3BO8A 2DLEA 2ZSWB 2XTLA 1T4KB 5DJ8B 2EC8A 5I1KH 4OZFH 3PDOA 2A6DB 5C0CD 3J7HA 2H8PA 1E28A 2L7UA 5ENWA 4YPGB 2VN7A 1JNNL 1SMAA 5GS0H 4Y5VB 3EHBD 4Z18A 4GRLD 4PRHD 5AD0B 3IT8D 2B1HL 3U7YL 2BNRA 1KELH 3M8OL 3RDTC 3CFCL 3IGAA 3O4LE 4NO5B 1EUTA 4XB7A 1V7NL 3TNMB 4K3HA 3RWEB 1X44A 1U8IA 1J9CT 1KIQB 5EU7E 5KSVA 3ZYZA 1DN2A 3JTSB 4OZGA 5TQ0H 3V9FA 4G9FB 4NKDB 1OARL 3O8XA 5DQDH 3FQUB 2W9LA 4FQPA 1SM3H 1FYTB 2HKHL 3M1BA 4A6YB 1NDMB 4HGWA 1F90L 1B0WA 4JG0L 2PO6C 2JJWA 3HZKB 2XA8L 5F7DB 5EIIA 4M8VA 2BSSA 3CUPA 2X4OA 2FEEI 5AUMB 1VSCA 3CFKA 5D1QD 5E8PB 1Z0NA 2A9MH 2Q87A 4Z7VA 5H94A 3QJFB 4XZUB 4JM2B 2EH7L 4NQEE 3IAPA 1S7XB 3T2NL 1XF2B 2ED7A 5F1NB 3T2QA 1NBZA 4Y4HD 3RWIA 4ODBD 5K9KB 4IOIA 3MV9B 1KOAA 1RUQL 4ZUTB 5F8QC 4ESKA 5BMFH 5HI3C 1YPZA 1QSFE 3UZVB 3HE6A 4P5KA 2Q8BL 2X10A 3FB5A 1PJ9A 2ZUWA 1CXLA 1NC4D 5JQ6H 2OJEB 3RDTD 5BV7C 4XPGL 1VGEL 3UPRA 2C4FT 4R8WH 4JFZH 4N1HB 1G7QA 3SDDA 1I85C 4B50A 5GGRA 1U8OA 3O6FB 3IJSB 4WU7A 4OFYA 3EFFA 4M6AA 4Y4KD 3UROR 5FO7B 1ZS8B 3S3SA 2BMKA 5FO9A 1S8DB 3V5KB 5FEBA 1DEEA 5DMIH 4Y19D 3QIBA 4Q9BA 3VRJA 3VXUA 7CGTA 1ULVA 4BFBD 1IM9D 2AV1B 3LKPA 3LIZL 3VFTA 3VGAC 1U91A 4OZIB 4GW5A 4XP4L 5FIEA 2FD6H 2Y7QB 2OR7A 1JIBA 2UZYB 3MRPB 1CLZL 1UQSA 2EO9A 4MQ7A 5JIIA 5SWSE 2PYEA 2R0ZL 2ZCHL 4P5TD 3C2AH 4EOWL 3SO5A 5F9OL 2ZPKH 4XCFH 4NM8H 4JZNB 3X12B 2VABB 5BXFA 5BS0D 4JFDB 3RA7L 2AJXH 2P43B 3QCUL 4UOW0 2FX9L 2BP3A 4L5FH 3P0GB 1LHZA 4LQ1A 3D6GA 4K94H 3OKKB 4X6DE 3SY0A 2UY7A 2P42B 2AJZB 3MBEC 4XCNB 2YBRA 4WFGD 1NANH 2A2QT 5DS8B 4EQ3A 2NY1D 1FZJA 4ODSL 3OJDB 1F00I 5GHWH 1YN7B 1JWSA 4QNPF 1MPAH 5JR1H 4WUKH 1EEQA 1L6ZA 1CE1L 1MHCA 2V2TA 2R1YA 4L4TB 4LSPH 3TVMD 4PR5B 1FNSH 1YMMB 3U6RB 1NAMB 4LQFH 3OKMA 1N2RB 2KQMA 4CKVX 4G9DB 2F53A 2RCSH 2Q76A 1BBDH 1IT9L 2Q20A 4WI2A 4UTBL 5IVXA 1NCTA 1NCWL 5I1IH 5IVNA 3S35H 5ADOH 3BXNB 5DD0L 4JRWA 4HUWB 2H26A 3W0WA 4JB9L 4WHTA 4Z7WA 1DANU 4CVXB 1JUFA 2BVEA 2XWBB 4G8GB 1GSMA 2Q7YB 2FYYA 3QJHA 3NZHH 4MA3B 3QUMB 3JWOH 4MQXD 5IIEB 2EC9T 4V1DE 3VFPB 3VG0L 1FGVH 4LSDA 4OZHF 1X5HA 3F12B 3QA3B 2AVGA 5EORH 3MBED 4HIEB 1BVKA 4BSVB 3LMJH 1NGPL 5CSBA 3M17B 1BQHA 3QI9A 2HVJB 1CR9H 2ZSWA 3QZWB 4DWHA 1VGKB 2VAJA 4POUB 3QH3A 1TQCC 4F58L 3NN8B 2X1PA 1RZGA 3D3VD 4YPGA 1J1OL 1T6WA 1AKJA 1P7HL 4YX2H 4Y5VA 4ELMA 3MLRH 5E08L 4DFHA 5JW5B 2VRAA 4PJCB 1GC1C 2XV6B 5LBSL 2FWOB 3W5MA 3TNMA 3HFMH 1J8HD 5CZVL 4OCLC 1SBBA 5HHOD 3L3KB 4QRPB 3JTSA 2FH6A 3EDEA 1O0VA 1KJ2H 4M1GL 4G9FA 2XWTA 4H25A 4NKDA 4EIZC 3T0EC 3EYFB 4QRUB 2NY2B 5I30L 4YK4C 3ARQA 3LQMA 1NDMA 5ANMB 1RZJL 1MCKA 3DYPA 3D0VA 3NABL 3OKDB 3HZKA 4Q7DA 4OT1H 2HRPL 3O11B 4I0PB 4ZAKB 5IG7B 3KPPA 5AUMA 2CDGB 3U7YH 1FVEA 4MVBC 5E8PA 3TC9A 1VEMA 2ADJB 4KJWC 3CFCH 4PJAB 4RGNC 3CZFB 1V7NH 2FB4H 3DLQR 4GG8A 3PIQA 4JM2A 4XZUA 2NZIA 4PJEE 3VFRB 3PGCB 3KPQB 5EZLA 5K9KA 4G3YH 5SWZD 1MQ8A 4ZUTA 4NO2A 3GHEL 5DJ0B 5MEPB 1OWWA 5HYIA 4Z0XB 1PW3A 3U82B 4XTRD 2NZ9C 1LO5B 4NJAH 2OJEA 2Z35A 3QFDA 3PDGA 2XA8H 4Z7OE 3QDGE 1P7QD 2P4AB 3RGVC 3SDAC 4CU7A 1IGYA 4X4ZA 1L0XA 3IJSA 3LEXB 3B3IA 1MCWM 4BFEA 5FO7A 3GK8L 1ZS8A 1BJMA 1MHHA 1IAOA 3UTTE 1VADA 1S8DA 4H26B 2O5ZH 2EIEA 1FH5H 2RHEA 2OK0L 1ZWIB 5HGGS 5F7HA 4JO2L 3T04D 5HGDA 5SWQA 3OF6A 5DMGD 4K3DH 1NBVL 2VNCA 2AV1A 3VXQB 4BM7A 1ZK9A 2KZ1B 3BIBX 1EFQA 2ITDA 2ZUQC 1S7RB 1DBJH 2A77H 4XPGH 3BWUC 3MRPA 1C1EL 2APWA 1QBML 1MFNA 4OZFB 3OXRB 3ISWA 1IC4L 4JGMA 3O41B 3C8DA 4S1DD 4JFDA 5B3NA 1MVUB 3QIWB 1IKNC 4LCCC 4YDJA 2NZ9D 3B9DA 4U1KB 4EZMA 1MY5A 3CX2A 3ALXA 2CUIA 4NQSA 3S34L 3LIZH 5EN2A 3SDAD 5MP6L 1BHGA 5C0JB 4OQ1A 4MDIB 4EDXA 1VERA 2W9DL 4QHLB 4XP4H 3DGGB 5DS8A 1K2DB 1N0XH 5ACZB 1X6NA 1BQLH 2LTQB 3OJDA 4YBLC 1YN7A 4KV5F 5DRWB 4I0KA 3WHXA 2R0ZH 1PBYA 2ZCHH 3SE9H 2IAMD 5C3LD 4HIIA 5FGBA 5F9OH 2XQYK 3Q48A 4OF8A 3X14A 4NZDA 3KLHD 3RA7H 4PR5A 1YMMA 3QQ9C 3QCUH 4E41D 3GKWH 3U6RA 1NAMA 4LHQB 4NQEB 1N2RA 4G9DA 2CKNA 3QUYC 4QT5B 2LV4A 2ARJQ 1LD9A 2NW2B 43C9A 1A14L 1GZPB 1MREL 1QSFB 4HUWA 4RRPA 4JO3L 2D9QB 5JMRA 4G8GA 2XWBA 3SDCC 1H8SA 1T03H 3V0VB 2FLRT 4MA3A 2UV3A 1CDHA 3O3BA 1LO0L 1AH1A 4JPIB 4R7NA 3LB6C 3QA3A 2IBBA 1AFVL 4HIEA 1ZGLB 4BSVA 2EDHA 1IT9H 4GS7B 1HZHL 5HYFA 1CL7H 3EOBA 2HVKB 4UTBH 1CLYH 1NCWH 5JOEA 4HH9B 2P5WE 5CD3A 3RVWC 5DZNA 5T5FH 4KUCF 5AG9A 3L5XH 3C60A 1VGKA 1W72A 2IADB 1L0QA 4JB9H 3TBSA 1OAXL 2CLZA 4NN7C 1J0JA 3U79A 5GJTH 3GM0A 1TVHB 3QQ9D 2MSPA 4AJ0A 3NN8A 1MHPL 2DTSA 4PJIA 2DWEB 1H8OA 4DGVH 4CGTA 3P4MA 3O3DB 2JJTA 4IEFB 5JW5A 1WZKA 2ZJSH 4TN9A 5E6ID 1YJDC 1AGDB 1DSFL 4XP6L 4YR6B 1J86A 5F71A 2C7UA 1GPOL 2R1WB 2VZTA 1ZA3B 3NCBB 4N5EC 2AERT 3SDCD 1HNGA 4IOSD 1EVUA 4U7MA 1LK3H 4X6FB 25C8H 3S3JA 1CWVA 1JCKA 3EYFA 3MODH 4QRUA 1S78D 2I25N 4WWKB 2DQDL 5ANMA 1QNZL 4NDMA 4PY7A 4B5EA 4LVHB 4RA3A 2QSVA 1U2CA 5HHMD 3ARDB 5E08H 2AXJA 2R4RL 2CDGA 5IVZB 2HJFB 1LEIB 3HE6C 5EC2B 1C08B 3CZFA 1QPXA 2BNRD 5CZVH 1I3UA 3QWQB 1QHOA 3KPQA 2VJXA 3CLEL 3U7WL 5F6HJ 2FJFA 2VIRA 3SDDC 4HLJA 1A6VH 4WTWA 1Q1JL 5DJ0A 5I30H 5MEPA 3QCTH 4Z0XA 3O8XD 3BPCA 4HUUB 2HJLA 3ALPA 4FMKA 4JDZB 4UILH 5F96H 1GOGA 3TYGL 5T3XD 1LP9F 2JIXD 5DHYB 3FONA 4V1DB 1NKRA 4XRCB 3LEXA 2DQCL 3BKJL 4OLXL 5KTEH 4PIRF 3BD3A 1I9EA 2YD8A 4XPBL 3RPIB 1EJOL 2VTFA 2E6PA 1JFQL 3AREB 3GB7B 4PS4L 3GHEH 1HK6A 1QSVA 4WIQA 3LPWA 2ZCKL 1PDKA 3TNNB 3HE6D 5ALBL 1WCBB 3MLZL 4KKAD 4H8WC 3CPLB 3CMGA 4OBSA 4JVUA 3KHQA 1E4XL 2H3NA 1OAUH 3SDDD 2J88L 1MOEA 4OFYD 3QIWA 4Q6IA 4ZMAT 3G04A 5C86A 1FBIH 3EO0B 2OK0H 1FO0L 2C4FU 4N0RA 1BJ8A 4U1KA 3K80A 1BFOB 1F4YH 1UWEH 3GSQB 3QIBD 4CDHA 5B39B 1FN4B 1RIUL 1U8QB 1NBVH 4KKCC 4HC1L 4IRJA 5C0JA 5TQ2L 4LEOB 5EUOF 4HKJB 4N0YL 3D0LB 4NN6C 4U7KA 1RJZB 5ACZA 5ESAB 1KJ2B 3GZKA 1II4E 1O5DT 1C1EH 3EYVB 1KPRB 1URLA 4J1UA 1QBMH 5DQ9B 1IGIH 4Q0XL 2AXFA 2X89A 3H3BC 4IS6A 2PYED 2AS5M 2PW1B 2F8OA 1JWUB 4MS8D 4ZXBB 2NNAB 2DI9A 2K9UA 2I07B 3TPUB 4QXTB 4JKWA 1ORQB 4QT5A 4OKDA 3UP1A 3KGRA 5I75C 2VXTL 2HMIC 1KXQE 1VENA 1A6UH 1U3HB 5E1AA 3A6BL 1U8NB 4WTZG 1KTKE 1TIUA 4OF7A 3V0VA 4YE4L 1JGUH 3WDJA 1D5MB 3IS1X 3QDGB 1CFNB 2RFXA 3K46A 3F7YB 3KXFE 1SVZA 3QI9C 2MQ3A 5EU5B 2GIYA 1AXSB 4WI9A 3WKNA 2DLIA 3Q5OA 3UTTB 1NKOA 3BKCH 4YDVA 3S8WA 2F54B 3MRKB 1MCOL 3O2WL 2LQRA 4LSVH 4MNHA 2UWEE 1IGJB 3S98A 5E2UL 2F53D 1N59A 4NBXB 1JZ5A 3D85B 1A6ZB 1MREH 4HQQL 1UM6L 4NQXB 5EOCL 4JO3H 1Q94A 3PNWB 4X7TB 3HNSL 3W0WD 4NN5C 1INEL 4YHNB 2DWEA 3K81A 1ED3B 2DS4A 1QP1A 5KJRL 3QFJA 1IAII 3W2DL 5HHPB 2IMNA 3O3DA 1M6OB 4YXHH 4R4BB 3B6SB 1AFVH 1AGDA 2DQIL 4NO3B 3SCMB 3TZVC 5HD8C 3IRZA 4BZ2H 2R1WA 2ICCA 1G84A 4Q6YA 1T83C 5JLZA 4OUOA 1NBYA 4WO4B 4Y4FA 3WFHB 3CFBA 1AXTL 4PLJC 1MHEA 5CJBA 3QI9D 1BAFL 3OX8B 4JPKH 4I18C 1OAXH 1PEZA 5B38A 5DUMH 1XF3B 5J12C 1XIWC 2MOVA 2BZDA 2EIZB 4QEGA 4PTUA 4XCCH 3C08L 1GAFH 4E42B 4R2GB 4YHZH 1AKJD 5B22A 1MNUL 1RIHL 2HJFA 5DT1H 1YZZA 4JDTL 1LEIA 1DSFH 2NQCA 4XNYH 1ES0B 1C08A 2EKJA 2E9WA 3DO7B 3D69A 4ODUB 3QG6B 2XN9B 1J87A 4AMKL 1UADC 3VU2A 3GGWB 4X5XB 3RI5K 3TM6A 1CZ8H 5KSAB 4G9FD 4DGIH 1T3FB 2DQDH 2FEEL 5EO0B 4HUUA 1QNZH 1I7ZA 1FCCA 2BY0A 3TZVD 3HE7B 2CRYA 3DOSA 1FPTH 2Y4SA 5FXCH 2WBJB 4OQTL 3WIFA 5DHYA 2C3WA 1ND0A 1T1XB 2R4RH 2D7PA 4XRCA 5IB3B 1D5ZB 2C4XA 1YEGH 5GGSB 1NUNB 4KXZI 2DLFH 2EE3A 3GSRA 1XCQA 4ZYKB 2WWKT 3UTPE 3CLEH 3HUJB 3GB7A 4OZIF 1A5FH 4NP4L 1QHPA 5EB9A 4PJFF 5DEGB 1Q1JH 3HMWL 3C5JB 4DN4H 4U33A 1AGBB 1JHKH 4HCRL 5DEFB 3TYGH 2N7AA 3QQNA 4G7VH 4OKVB 2Q1EA 4X6BB 5EWIH 1CE6B 3BKJH 3TYFB 1BZ7A 1G7PB 4IRSB 5KZCB 2DL9A 2ENSA 4OGZA 5KW9L 3HC0B 3UBXB 2HJKA 1J12A 1ZKAA 3DETC 1BGXH 2X4TB 5DFWH 2WV3A 3RNQB 4K23H 2X09A 3QHFL 5TF0A 4XBGA 1YEIH 1HXMA 1EHLH 5FGBC 3D39E 3OGCA 4N8CL 3BGAA 4QHKJ 2ZCKH 4NKIL 4LEOA 3OF6D 3D0LA 1PQZA 2DMBA 4ALAL 5ALBH 4Z9KB 2OSLB 4KH2A 3EO1A 4U1NB 1KJ2A 4YHKL 1XGRB 5J3HD 3UEZA 3H9ZA 5E03A 3MLZH 3OL2A 4WDIA 4OFKA 3HR6A 1U0QA 1YA5A 2PW1A 2APTA 2J88H 1RZ7L 1NGXA 3DSFL 2R1XB 5C08A 1MELA 5D2LF 2VZ1A