5L6YL

Il13 in complex with tralokinumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
YVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-13
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL01
1U8IB 4KMTH 3QNZA 4XPGL 2GYSA 3GIZH 3ZTJH 5BVJB 4QHMA 1HHIB 4OGZA 1VKXA 3X3FL 2BSED 1YEGH 4Y2DA 1A6AA 2GAZB 1L7TL 1CD0A 3GRWA 4NZTL 5D2LA 1BREA 4QNPF 1OGAA 1A5FH 4JRYE 2V2WA 1C16A 5HHNB 4LDEB 3UX9B 2CLRB 2GJ6B 2XN9D 2X89A 5ITBL 1OAXL 2MTPA 3SKOB 2AAVA 3FO9A 5LJYH 1ZMYA 1YYML 1SMAA 2F15A 2X4RA 4EI5A 1S7WB 1TZGL 4MA7H 5FDYA 3STBA 4JLRB 2H8PB 2FIKA 2B5IC 3P11H 1S9XA 5E95B 5LAXB 5BV7C 3S6CA 2JIXA 3VH8B 3LD8B 1YEJH 4OTXL 1GC1L 3IDNB 1UYWH 4KJYA 4UBDC 3G08B 1MI5E 5AAWA 3GO1L 4HQQL 3LSOB 1RVFL 4GOSA 2GJ6D 3DI2B 1JHKH 5GSVA 4HK3N 3EFDL 1A9EA 5IK3A 4NUGL 3VMOA 4BKLA 2NY5C 3KPOB 4QHUB 3BVNA 3ARGB 2G5RA 4ZD3H 4XPAL 1IT9L 1Q94B 3R1GH 3FQXA 3HZYB 1AR1D 2VDRL 4R6UA 3BE1H 1Z9SA 4PB9H 4P57A 3MA9H 4LEXH 3PWLB 4KZDL 1UQSA 4GXUM 5DQ9A 2B8OT 4O9HL 4HWEL 3GSNL 1KB5B 1NGPL 2OK0L 1KBGH 1CLZL 4ZXBD 3U30B 1AJ7L 4JPWH 1V5JA 2R29L 4O4YH 2OL3L 3SDAC 1RQ5A 1NC4D 4R3SA 3BW9A 3N85L 2OR7A 5DZOA 5DK2B 4EEEA 3BFOA 5HGAB 4DGYL 1CLOH 1M4KA 3CVHL 4XNUH 5TE6H 3QI9A 1F97A 1MLBA 5DD3H 3ILPA 4MA1B 2ATKA 4J4PD 1S7QA 3VCLB 1T80A 5ICZB 1TETH 1LNUB 3WDJA 4NKIH 4RFEA 3B9AA 5DHVH 1BM3L 4NZJA 1AXIB 5TDNB 5CLWA 4PY7B 3WUWG 1ZGLM 2R0WL 1A4KA 1S7VA 4OF7A 3H9SA 4AH2B 2ADJA 1NDGA 3QNXB 4G5ZH 4GW5A 3Q3GB 1FVDA 3BH8B 5E8PA 5IK3B 3H9HA 2F54E 3HG1E 3VW3L 4IOFC 1KGCE 4A6YB 2VZVA 1D5IH 5DQJA 2W0FB 1HINL 4Z7UE 3FRPA 1GSMA 5DUPH 3TBVA 4MJ6A 1A1OA 4FQIL 3ZDZE 4NHUB 3P9WB 4LSQL 4X4XA 4XWGH 1SY6L 3VA2C 3GMPA 3GM8A 1YEEH 2R4RH 3MRNB 3UBXA 5B8CC 3VXUD 1NFKA 1R5VA 5I1JL 1N6QL 2CDFB 2D9CA 2Z8VC 3DJ9A 4NRYB 2J8OA 3KLAA 2HFEA 3WE6B 3SKOA 3ALXA 4WWKA 3T1WA 2D7QA 3R0NA 4Q2ZA 3N1FC 2P46B 1FL6A 1CT8B 4CMHB 5ICZA 4NNPL 1CGYA 2CIKB 2EE9A 4HH9A 3HR6A 1OB1B 4Y4KB 5GRJH 3CUPA 3VFMA 2F5BH 4ZUSA 4LOUC 5BW7A 1AKJA 3S88H 2E7CA 4M5YL 3B2UC 2IANE 3GSOB 3NFPA 5DR5L 1S7TB 3LY6A 3VFSB 4MB3A 4UDTB 5DRXA 4LLDA 1VFBB 2BY0A 5EB9A 3MJ9H 4EQ3A 1OAZH 3U0TB 2Z35B 4P2OD 4NC2B 4CADA 4L8SA 2VZSA 4V1DD 2AK1H 4YFDB 1RZFL 3ZKMD 2DI7A 2HLFC 5FA3B 1IZJA 4BKLB 3CJJA 3M17B 2VR5A 3LEVL 3VD3A 4MJ6B 2I5YL 1AGCB 4B7IA 2NY7H 3HS0B 1FH5L 3DUSA 3O11A 1JZ8A 3B43A 2VLJD 1ZGLB 4M8VA 1QNZH 1NCAL 1EFXA 4X9FA 3QUYC 2FR4B 4JFPB 4K07A 3WUWB 4YIQA 4NRYA 3C8KB 1H5BB 3NVQA 5JQHC 3RNQA 2AK4B 5D7IF 4PBXA 2IFFL 5BXFB 1I3RB 4BFIA 1HDMB 3DHJA 4Y5XC 3QIUB 4DAGL 1J0KA 2J4WL 3O2WH 4IOIB 3GSWA 2C1PA 4LPWA 4OKVB 1MNUH 4XCNA 5DHVB 4DEPC 4Q6IC 4WI7A 5I1CH 4XHJD 2OJZL 2ENYA 3LS5L 3MODH 5GGQH 5SWZD 4OZFG 3T0VA 5ICXB 1L7TH 4OGAC 1ONQB 2XXCB 5KSBF 3GSRA 4JGMA 4XNZB 3QEGH 3GHEH 5HYFA 1HEZB 1MAJA 5EORH 4XP5H 4MJIA 3GJEA 1QUNA 3QEQD 4NFCA 3KDMA 1ZE3C 3M1BA 5FYLH 3KS0H 4Y19E 1A3LH 2VE6A 4L4VB 3RVWC 5FKPB 2OZ4A 1CE6A 5ID0B 5HY9A 3CFDA 3P11L 3ZKQD 1NFDA 4N1EA 4P3DA 3KWWA 4LCUA 3PP4L 4L3EE 1N4XL 1G7LB 3L3OA 2DWEA 3T2QA 3NH7H 4HUVA 3QUYA 4H0HB 3MO1A 1KCVH 2VZ3A 1NMBL 3MJ7A 3ETBF 4IRSD 3BQUC 2PYEE 3TCLB 4RGMB 2PF6A 4ZFGL 4NUGH 1FPTL 2KBGA 1E4XI 4PRBB 2DM7A 4MHHI 4XPHH 5I1EH 2CQVA 3CZFA 4KC3B 5E1AB 4JZNA 2IF7A 1F6AA 4HJ0D 4GQ9H 4KGLA 1KLGA 4WWKD 1IM9D 1KCRH 1QR1B 3C8DA 1Y18B 4N8CL 4RBPH 1XEDA 3SGKC 1V8HA 1PX3A 4KRPC 4PYHA 4YFLF 1T1ZB 4HFUL 4M1GH 1RULL 5FF6B 4N0CD 4HUXA 1UKSA 4ZUTB 2A77L 2WP3T 3HAEA 4XCYB 3NBNA 1OGTA 4G5ZL 5FCUL 5C0CE 3WKMH 1XF2B 3C9NB 3UAJD 5D7LB 4MX7B 4GMSH 2VDPL 3AREA 3JUZA 3BN3B 4PRDA 2PO6C 3U4BH 4KWUA 4PJ5B 5GIRA 1KJ2L 3IJYA 3VGBA 1DFBL 1CGVA 3UDWA 5C0ND 3T0WA 3LKQA 5TGBA 2NNAA 2B5IB 5BVPH 5JQ6H 4P9HH 5I18L 4IM8A 3MRPA 2ZKHL 5I1IH 1NCWH 3D18B 1NUGA 3SO3C 5J1AB 3RKDC 2FB4L 1OTSD 1Q1JL 3TYFB 2WUBH 5CEXB 5GZNC 5I1JH 1RZKH 4BFEA 4ODUA 3G5XA 3FHAA 3LDBB 4KK5D 4FQQA 3U0WH 2BNRB 5C0AD 1U58B 1NEZA 4PJ9C 3T65A 4F7MB 2YSSB 2A9ML 4OZFH 3UPRA 1HOCA 3Q6GH 2EDLA 1J05A 2CUIA 2X9XA 1CE6B 1ED3A 3O6ML 3LH2L 3NZ8B 1NMAL 1YEFH 1N7MH 1J0ZA 4XCYA 3WFEH 1Q9WB 1OAZL 1FYTD 5DJ0A 2X4PA 1UB6A 3QFJB 4OCYH 4U31A 5LCVL 3AREB 4EVNB 4KGJA 3MRRB 3L5WA 1CZ8H 5J3HD 5D71H 3UBXG 4Z95L 3P0VH 2YRPA 5T1LD 4NZRH 4GG8B 1RJYB 3C60B 1GHFL 2AQ2A 1A1MB 3WFDL 1MEXL 2XFXA 1BOYA 2XQBH 3TBTB 3VG0H 4HMCA 3F58L 2XZAH 3ZE1F 1UM5L 1DQDL 4AEIL 1G7PA 2X4SA 3WV0A 1BZ9A 4FFZH 4MXWL 1KFAH 3O6LH 3FQTA 2NY1C 2P7TA 3CH8A 5K33A 4C57C 3C6LA 2DDQL 1E4JA 3M45A 1QR1A 4QHLB 5C0EB 3PGCA 4X5XB 3H9SB 3O4OC 4JFDE 1JPTH 4JFDA 4M03A 2AI0L 5F72S 3D3VD 4KK8C 2XZZA 5DK0B 2OSLB 4PRHB 1W2KT 3SDDA 4ODSL 3BXNA 4NCC1 3RBGA 4YX2L 2W60A 2NY2B 4ZPVB 1AFVH 2ZCLL 2ZNXA 4OZHF 3HC4L 5IJVB 5E2VL 1IGJA 3AS1A 2O5XH 4G42B 1H3TA 4F7PB 1R24A 9CGTA 1PG7W 3OKOB 5LWYL 3W0WB 3MODL 1NGYA 1IQDA 1YYLH 3GBNL 1TCRB 3UBXI 4NQCA 2HFEB 4JO3L 4XP1H 1J1XH 4ISVB 3R0MA 4XP5L 5JPMB 1U3YA 5EZLA 3RWIA 3GKWH 1T2XA 3MBXH 3MRPB 5T33L 1XZ0B 3SN6N 1EAPB 4HS6A 4JFEB 2N1KA 3WIHH 3QIBA 3ULUF 4AIOA 3FQTB 1SEBB 3F7VB 3BZ4B 4MXVF 4ZPTB 4Z7QE 4X7FC 1Q9OB 2J3SA 4LLMA 1YECL 2Q86A 5KOVC 2MQCA 2VJXA 5F1NB 2BSSA 3KPRB 1YMME 2WP3O 1PD6A 3G6JA 3QUMH 5FOBA 1XIWB 3GK8L 5HHXL 1Z3GL 1NEZB 2AW2A 1OM3H 1RV6X 4HKZB 3MRKB 2YXFA 1S7SA 2AJSL 2XZQH 2ZUXA 4IMLB 4PJIB 5IHLB 4YDLC 3TM6A 4URTB 1QO3B 4LFHD 3QXUA 1MQKL 2F54D 3CX5J 3A67L 5EN2A 5K59F 1VA9A 2Y36L 3RVXC 5I1EL 5IFHH 4ZFGH 3QDJE 5IHZA 1I9IL 3RP1A 4C55A 4LPTA 3RVUC 1UB6B 1JNHA 2OMNA 3QFJA 1NSNH 2IAMC 1CG9A 2P5ED 3L3DB 3VDAA 3CX2A 2E7LC 2X4TA 3WHE0 4PJEE 2CLRA 2MQ0A 1PX4A 2Y06L 3ULSB 1JVKA 4OLVH 1PYWA 4H8WL 2MCG1 5L9DH 4J8RA 2MWCA 5BQ7A 1S7WA 4G9DB 1HDMA 3VXSE 2R69L 3DYPA 5FO8A 4LK4A 4S1SH 1VHPA 3ZL4L 2E27H 1MUJA 3QZWB 1IM9A 4NC1C 2VL5B 2GY7B 5D1XA 1QZ1A 3LCYA 4GAJH 1WC7A 4WHYH 3RUGF 1DEEB 2PXYC 1Q0YH 4YDKH 4WUUD 1F4YL 4YBQD 2IH3A 1VACA 3NIDF 3WKML 5JW4M 4K7PH 5D4QA 4TRPL 3I02A 3L3KB 3OXSA 2ZZUT 2ZSVA 4Y5XA 1GGIH 5ILTL 2FBOJ 4HIXH 4P9HL 1PVHA 5EIVA 2EDEA 5HI3D 3LHPL 2ZUVA 2VLMD 3ARDD 2F19L 4P46C 3KJ6H 3NCBB 1IGJB 1E6OL 2BSRB 5GPRA 2ITCA 1P9MA 1S9KC 4O58H 4PJFA 2X4TB 3RVVC 3QT2A 4FZEH 4Y2DC 1WJ3A 4QTIH 3T0EA 2KDGA 3O6FC 4XVTL 4G80A 5T3ZL 4LCUB 3O8XC 4YDJA 3VRJA 4X8JB 4JFQA 2NLJA 5IMMA 1NFIA 1DBBH 5I1DA 1AHWC 1MHCA 3GSNB 2P8MB 3QUXD 4Z7WE 2XZCL 2VXUH 5KSBA 1NMAH 1S7QB 5HHOD 4I0PC 1C12A 1HSAA 1L6XA 4J3OC 4KUCD 4ZAKA 3RZCD 5DJYA 5GSRB 4LSDA 1XR9B 5GRVL 1WCBB 15C8H 3QQ9C 4RGNB 4RAVB 1DEDA 3EJYC 1VACB 2DMCA 1IE5A 3Q3GA 1ADQA 2Z93A 3SKUD 4KK6C 5C0GA 5E2TH 4RRPA 3H42H 4M1DL 4TPRH 4G43B 5JOPD 2BFVL 3HE7C 4WFEE 2DIAA 1JNNL 4MQ7B 3WFCL 4G8GD 5IT2L 5CJQH 1QFWI 4OCRH 4OLZL 5KTEH 3BUYB 3MRFB 4U1NA 1ITBB 1RZKC 4LSVL 4HT1L 2H3NB 4PJGE 3OXRB 4PREA 3VFPB 3UTTD 2OXGA 4P99A 5INCA 4JB9H 1P7KB 2FEEI 3PGDA 2IG2H 1H8OA 1A3QA 1W72H 3O3DB 2XOTA 3ULSA 4YDJB 1XGPB 3C9NA 4MZ2A 1NCNA 4P2QE 4QRUA 5SWZB 1U8PB 5C07A 4MSWA 5E4IA 3O6FA 4CUCA 3GSXB 4JFZH 1JPTL 3B8YA 3LPFA 3AMLA 3ISWA 4GKSA 4WFGD 5GGVL 5BJTA 4GRWE 4HH9B 4P4KC 4BH7A 4DZ8A 3TFKD 1NLDL 1FNEA 1N64L 4MJ5B 3DX6A 3LKQB 1D5BA 3GSOA 5TGBB 5DJXA 1I9JH 5T1DH 3WLBA 2AXFA 3S37H 2X4NB 3ZE2E 4HWBH 3V6ZB 5E0QA 1K5NB 1H9VA 4YHKH 3QCUL 3X3GL 2V2XA 2PO6A 2D31A 3ULVD 4U6VH 3EFFB 2E7MA 1YYLL 2Q7YB 5IHUL 3QWOB 1X5FA 1XCQA 1XT5A 1IGML 5J89A 3CD4A 4XT1C 2BY1A 5HDBF 2JCCA 5DI8A 3KPRD 2BSRA 3G5VA 2FH8A 4BM7A 3D48R 1CR9H 3OR7B 1E4XL 3RWFA 4YC2B 4LF3A 3VXMB 1KPRB 5IP4A 4GKZA 3SGEI 1OWWA 5BZDB 4LHUA 3T4AB 1INQB 5F7EH 4QRUB 2APVA 1WCQA 5SWZA 1R6VA 3OB0K 3KG5A 4OCWH 1LDPL 2DN7A 5E5UB 1HWHB 1NANH 4XPGH 1MJUH 3QIUA 3FO2A 4RISL 5EOCH 2NMSA 2R9HD 2UV3A 3T0EC 3P0GB 3ARRA 4ONFL 4N0YL 4DGIH 2BCKB 2IANB 1D3CA 1MSPA 4OLXL 4LPYA 4OCMC 1ODAA 2X4NA 4XBGA 5E8NA 1K6QL 1ZA3B 2C4FT 3PHQB 1GZQA 2JB6B 2X1OA 3N1GC 3VMPA 1OF2B 1NSNL 1GXEA 4WHDA 3V8CA 2HFFA 3EO1A 3NPSB 4NQXB 4D9RE 4PJ7F 4LCCA 2FJHA 4PJ8B 1YJDC 4X6EA 4AK1A 4TTDD 1XCQB 5KVMC 1AI1H 1SVZA 2COQA 4XC3H 3V5DA 1FC1A 43CAA 1INEH 4Z18A 4Q0XH 3GMMB 5C0BD 1E4KA 2AJUL 2A9NH 4ZPVA 1T7XA 1CFVH 4WUUB 3RWFB 4DTGH 2FX8L 2QQKH 4F15B 5EWIL 3B6SB 3V6OA 4UU9A 4NQUA 3VA6A 2FRGP 5DF0A 1GPOH 4OM0H 4P2OA 2EZ0D 4G6AC 3OKEA 4P59H 1MWAB 1WFUA 3ULUL 5F89A 1UM6H 3GSVB 4NCDA 4G7YL 3ULVF 5BS0B 5HPMB 3ARDB 5GXBB 3KPPB 4APQD 2AJXL 2JLLA 4OZ4A 4RMRA 4WY7L 3UYRL 1MLCB 2JTDA 2AABH 1OAKH 4GAFB 3AMKA 3GSQA 3SKNB 4MD5A 2EDHA 5JOFB 2HKFH 2QADC 4HBCL 2FEDC 5GRUL 1IGYA 4JN1H 1BEYH 5KSAB 1JPSH 1PGRB 4FP8L 3DPBA 4IS6B 4TUOA 2EYRA 2MHAA 1MJJB 3KLDA 3G6JF 4U6HA 4RZCA 4JJHA 1A9BB 4LPUA 3RWEA 5E4EC 4WCYH 2AEWA 4K3JH 3WFHB 4JZNB 3EYUL 5CJOL 3O3AB 1FCGA 5FYJU 4CL7A 4YHNB 3VH8G 2R29H 2XKSA 3IFPB 3RX5A 1A21A 4XVTH 4MNQE 2LAAA 3OAZH 1WT5C 3NA4A 4ORGB 4AMKH 5LXGL 4FG6C 3RL2A 4K9EH 1NBQA 4K94C 5DD3L 2R39A 1OLLA 2APTA 2P48B 5JMRA 4S1RH 1FSKC 1NBVL 1OCWL 3RAJH 2XZCH 4IIQA 1Z6JT 1NAKL 2HVKA 3EKCA 4IDLA 1KB9K 4HD9A 1EK3A 4ZDHB 5BZDA 2OP4H 4G8FB 1UACH 4TSBH 4KHTH 1G84A 2FHFA 5SX4I 4YDIH 3BKJH 4EQ2A 3FQUA 1S8DA 1N8ZB 5KJRL 4PRIA 5D6CA 2FHBA 1D5IL 1I85A 1W72A 1CK0L 2XWTA 1HCVA 3I2CL 4LNRB 4ZOCA 4M7ZB 3IDXL 1L9NA 4O2FA 3CSPA 4YUEH 2BCKA 4FQIH 1CTNA 1JYWA 2NX5E 2FX9L 4TNWK 4LSVH 3QDAA 3K0WA 2J6EL 2EXWD 3BWAB 4NPYB 5MI0B 4OV5B 4UQ3A 1JMZA 4TNVK 3OF6D 5D1XB 4P5TA 1RU9H 3TH3T 3BPLB 5HHQB 5K59E 4IRJA 3EYSL 3IFPA 1AKJD 5D96C 4JB9L 4OQTL 4DKFL 4PJXE 3VFOA 3VXUB 5I2IB 1YY9D 5TFSH 1IC7L 1M7DB 4F2MA 1A14L 1WQVT 1UJ3A 3OKDB 4U3XA 3B5TA 1FNFA 3BEWA 1UENA 1CXHA 3OBAA 4L9LA 4NGHH 3TT3H 4JQXC 3BN9C 1EVTC 4XP9L 2XTJB 3ULUE 2GUOA 1Q72L 3QWQB 5T3XE 3WSQH 3ZHLA 4XHJC 3REWA 1KTDB 4PGEB 3QIBD 5HD8C 4Y2DB 3BDYL 3O2DL 2GAZA 4PJ9D 3VFNA 4NOBA 4AIXA 1DVFD 4TSAL 4LARL 1DE4B 3H9ZA 2VSCA 1RPQA 4WUKH 4PLJC 4OT1H 4ZS6C 1KEMH 3V4VL 2EIDA 2JKXA 3O2VH 4Y2OA 4HUWA 5F3BB 1U93B 2F8OA 2G60H 2NLJB 3UJJH 2K7PA 4I5BA 2PUQT 1WFOA 4NHCL 3HLAA 2EYRB 4DUVA 3DARA 3IDYB 3EW3B 2CIIB 5I74C 1BQHA 1G1YA 5KAQF 3F7YA 2BNUA 5IF0B 2J88H 3JWNC 4K2UL 4ZSOA 3JWOL 4Q6YA 1EZVX 1KIPB 3O81A 1OGAD 4J3TA 4IOSD 4M4RA 1UM4L 5CEYB 3RNKA 4QRRA 4N90D 1DBJH 2Y07H 5FGCB 2X1XR 2W60B 3H8NA 4PRPD 1R3IL 4F57H 4ZODA 4PTUB 1DL7H 2C7UA 3HMWL 5AYUH 2CLVA 4ELKA 5IB1B 3QISA 4ZS7H 3LMJL 4MQXD 3V6OE 1QRNE 4UZGA 2EDQA 1BQLL 2QLVB 1QFWL 5INCB 4PJ7B 1I7RB 3LRSA 1IAIM 1MPAL 2W0KA 4LAQH 2BK8A 1UWGH 4I5BB 1QSFD 2PYFA 2A9NL 1WSST 5DA0B 3W11D 4PRPB 3QUKA 2GKIA 3KLHD 1HHKB 4W81A 2HMID 1MCOL 3ILPB 4QY8A 4P3CL 1D5BB 3PDGA 1XGUA 3T0EE 4Q97A 1ZLUH 1M6OA 4H88H 3UTZB 4ZNCD 2VNCA 1W0WB 4CAGA 2JB5L 5CP7A 4EBQH 2CLZB 1REIA 3NH7L 4ODHH 4JREB 4UTBH 1S7SB 4IMLA 2IAMD 5HDLA 3O6KH 1JWMA 2PO6B 1QSFB 2D31B 4JN1L 2O5ZH 2R2EB 1MF2L 4NKMB 1CD1A 5IB1A 4PV8A 3VWJA 2W0FA 2FYYB 2P8PB 3EBAA 5IB2B 4S2SA 2JCCB 3MXVH 2JJSC 2WANA 5GRZA 5C3LD 1LO2H 2A6DB 3PQYD 5FUOL 4E41B 4U0RC 3UC0L 2HG5A 2XG4A 5CHNB 5L88L 1MCDA 3GMRA 1NCCL 3L5XL 3FQRB 3RIAF 2CDFA 1UJ3C 4G9FE 5EPMB 4K9EL 4QRTB 4QRPD 1MFDL 4I3GA 4MNHB 5KN5A 3KPLB 4MNGE 2CGRL 4TUJB 5IVOA 3BP4B 2B39A 3A0OA 4WWKB 3HLAB 3WJLC 1IAIH 4Z7VB 1RI8A 1SYVA 1BJ8A 1FL6B 2EDTA 5D72L 4FHBD 1MIMH 1FZOA 1NCTA 2NW2B 3UTTE 1MJ8L 3UTTA 4JM2B 2R0ZH 4UQ2B 5K9OB 4Y1AB 1QBBA 3BIBX 2C3HA 5H8DA 4U6YA 2UWEA 5BCAA 1OQXA 2CMRL 3U0TA 3LDBC 5GS0H 1YMHA 5FCSH 3BDXA 2AEQH 5F7WC 4HV8A 2GJZA 3IXAA 1FZMB 2CD0A 2EIZA 1TPXC 4PRID 1JTPA 1A7PL 1BQSA 2ITCB 1RD6A 2DI9A 3HS0A 4K94H 5IQ9A 3RA7H 3WCYA 3DUSB 1IAOB 2FGWL 2ZKHH 1T83A 5D1ZD 2FJGA 5IEKB 4PJEB 2AQ3A 4FFYH 3TIEA 4FABH 4LCWD 3ILQC 3MOBH 1IC7H 1WAAA 2Z31B 4G8IA 3D0LB 3H6JA 4NO3B 2AXHA 5IEHB 1K2DA 4M7ZC 5I1DB 2PKDA 4HS8L 5TFSL 3CPLA 2ADIA 1DLFL 3UP1A 4GBXB 1JK8A 3QR2A 5B3JE 5JXEA 1DVFB 1Z9MA 4MHHG 1Q72H 2NW2A 3BIKB 5KSAA 1WWAX 1PZ5A 3VXQA 4R2GB 5K9OA 1MCFA 4JG0L 1A3RL 4HCRL 2HP4A 2APWA 1T4KA 3DIFB 3ZYJA 1B0RB 4JRXE 1FHGA 1R5WA 3U6RB 3DMMD 3KPSA 4M6OH 3V5KA 3NGBB 4D9RD 2GCYB 3P4NA 5HSFA 1MRCL 1GOHA 3BDYH 1J9CT 2R0LL 3CSYB 2WV3A 5E6IB 3JTTA 1NUNB 1CLCA 5ELIA 1LP9A 1IC5H 3MUZ1 3EOBB 1YEIH 2AJZA 3IJHB 4L8BB 5TE4L 4HIHA 2AP2A 2WZPD 5JUEL 3IJSB 2VDNH 3VFPA 5I19H 1KIRB 1MAMH 3L7FB 3BO8A 4LKXA 4K2UH 2H45A 1C7TA 2C3VB 1I3VA 2YKLL 3CFDB 3QH3A 1FZKB 4JQIL 2WWMD 5TDOB 2B7DT 5IJKC 4V1DB 1WF5A 3O2DA 5IQ7H 4OM1H 4PV9B 5KANG 4RIRA 4ZOEA 3PWJB 2VWEE 2VDML 1WZKA 1CFNB 4UT7L 5AYUL 1K8DB 4QRRE 1AFVL 1PLGH 3SKMB 5IVXB 1G9ML 2JK5B 4ODTH 4UAOC 4JY5H 2UWEF 2P5EE 1FL5B 1F02I 1F8TH 5FYKL 3LEYH 3O4LA 2AXFB 3QULB 1E6JH 1T89C 5E5RB 5MP6H 2DQDH 3VD5A 5L2JB 3P73B 4ERSL 4KRNA 4NQDD 4M9OA 4OZFB 1FSKB 3DURB 3JTSB 1K5NA 1I8LA 4FNLH 4JQVC 4L5FL 2MJWA 1CDGA 1K4CA 1DANU 2VAAB 5C2BL 2R8SH 1AE6L 2F53A 4HPOH 5J6GA 3EYVB 2BHUA 2EDFA 3S36X 2BVYA 3IXAB 4YGVB 2DTML 4ZTPL 2VH5L 4U0QB 3L7FA 1J8HD 3GKWL 3UZVB 4P3CH 1GIGL 3DGGB 1KENH 1JTOA 1U95B 2CPCA 4YZFF 3IKCA 3KPNA 3QH3B 3T04D 3L3JB 1ZKAA 4R4ND 5A3ID 4YO0B 5E99L 5JDJA 4WHCA 2YRZA 5C07D 4MAUH 3SPVA 3O9WB 1RVFH 2ADFH 5ERWB 2Z0BA 1QLRB 2Q8BL 5B8CA 1UH3A 2VISB 5C2UB 3D39D 4I48A 4OSUL 5M94B 1FDLL 1MFEL 3C2AH 3RWCA 1D6VL 4I18C 4OCXH 1NAMB 4IRJC 3LRHA 1BGXH 3MA9L 3U9UA 4Z7WF 5FUOH 1AHWA 5EIQA 1UZ6E 4W68A 3OKMA 1WFNA 4OZFA 2C1OA 4G8GE 4PJCA 3P4NB 3UPAA 2J8UF 3EDJA 3LN4B 4OFVA 5ALCL 1P2CB 4UB0L 3WXWH 3LQZA 1HHJA 4IRSB 5ACLA 4X6EB 3DX9B 4MAYB 2DM2A 4J2XA 1KJ3L 3LB6D 1U8JA 3VXPB 6CGTA 5FO7A 4R97C 1JFQH 1MIEL 4LNVA 1YNLL 2HH0L 1MIML 3PE9A 1FNHA 2MKWA 2XY2A 5EU3A 4S1SL 4YHLH 4BELD 3QSKB 5DGRA 3GBML 1FZKA 5HHMB 5A16A 5SWSB 3OHXB 3V79C 1FZJB 1I3GH 1S9YA 3TA3A 5DGQA 1WWCA 3VG9C 5EBLA 1IAKA 2B0SL 2HRPL 3K2UL 5F6HI 5FUZH 3IDJA 4UT9L 4WJ5B 3PXJA 3O3EB 5T1LA 4UV4L 1DZBA 2GJ6A 3EJZC 5ESQB 4PD4J 4P0DA 3CX5K 1HH6A 2P49B 4XCFL 2VQUA 4R8WH 3TWCL 2PYFB 2Y6SD 3D0VB 3CDGA 1MJJA 2XRAH 1GCFA 3H9YA 4XWOD 6FABH 4MMZC 5L2JA 1G7QA 4JKPH 4GLRI 4YHMH 3AS0A 3VGHA 1II4E 4RGNC 4WDIB 5EOQL 5IMKB 5BMFH 2VAAA 2B20A 5T3ZH 1AD0A 4FS0A 4HWZA 3MJGX 1Y6KR 2JJTC 1FL3A 5EFIA 2BX5A 2VO5A 4OCLC 1JV5A 4HF5H 5E1HB 1NCUA 2CK0H 4OZGF 1I8KB 4ZUVB 4GRMA 2ZP0T 5DHYB 2XNAB 4XMPL 1A9EB 4GKOA 2WIIA 5T1MA 4RFOL 4NZTH 4KJWD 1RK0B 3I6KA 5CMAA 3S88L 1UXSB 1N5AA 2A74B 3OKLA 5C3TA 3EO9L 4MXVE 5C09B 1MVUA 5IB5B 4EI6A 1KTLB 3UJTH 3O9WA 4HIIB 1I7UB 3K1DA 2HT2D 5E2TL 5T1LB 1C16B 2P45B 4PJAF 3UO1L 4YHOL 3MRHB 1DN0A 3R8QA 12E8L 3ULVC 5I76A 1UA6H 2I07B 3CCHA 5HGBB 3TF7C 2VN7A 4MNHA 1KG0B 1LP9E 4RGMC 1F90H 4JVPA 5L8KB 1X5KA 5ENWB 3ES6B 5HGHB 1I9EA 1YEIL 5TE4H 3U9UB 2IALB 1SYVB 5DWUL 1FIEA 3GJFH 4UT6L 3HB3D 4H26A 4JPKL 1H3XA 2X9WA 1MY7A 5T3XL 3UTTB 4XTRD 5TDNA 4Y1AE 3LEXA 5JZ7C 1MJ7L 4LLMB 3P4MB 3QFDB 2XXMB 5MERA 4OZHE 1U8JB 2XN9B 3VWJC 4V2CB 1ZA6A 4AEHH 1T83C 4ZFFA 4TUKH 2XNAA 1AO7D 4CKVX 5I8CA 3BQUD 35C8H 3BAEH 3EDFA 5HVWA 2HLAA 2FBJL 3FO0H 5HI4D 5CMAB 1QFUH 2CRYA 4LPVA 2F58H 4MA3B 5FGCE 4FQ2H 3V5HA 1DBKL 3OHXA 5C09A 3QDMD 1F4WL 3LN5A 2YMXH 4EOWH 5CSGA 2UVEA 2R8SL 5CFHA 5EU4A 4CVWA 4ONOA 2P8LA 1K3IA 1UH4A 3TIEB 1TQCB 4A2MA 4OD2B 5C2BH 4DJMA 5CIPH 3BW9B 5B38B 3KPQB 4U05A 5DK2A 5D5MA 1CYGA 5IHUH 5KVFL 4AM0A 5C0JA 4XP4L 1CN4A 3C09B 2B4CC 3HG1A 3KHOA 4NBXB 2OJEA 5EU6E 1TQBB 2RCSL 4Y4KA 3SQBA 1RJLA 5L0QB 4YE4H 3VFTB 1NCDL 4I77H 3Q1SL 4Y19D 5F96H 4ZXBB 3WNMA 4O51B 2RFXA 3OPZL 3QB7C 2ICWA 3D3VE 4LQ1A 4F58H 1UWEH 3QWRD 2R23B 3HRZA 5IG7A 3NTCL 4YH6A 3RX8A 3HAEG 1XH3A 3RDTB 2Q8BH 1WEJH 1K8IA 5GGTH 4YEEA 3RU8H 1J5OH 3PABA 4Q9RL 2QADD 4XVSL 4A6YA 1ADQH 1A0QL 4S1DC 4LVNC 5HVHC 4ONFH 1HKFA 4RA3A 1N3NB 3WS3B 3P9LA 1IGTB 1HE7A 1QSVA 5KZCB 2W59A 2SEBA 4B5EA 3MUJA 1LEKB 4OLWL 2D3VA 4OCXL 4X4XB 1RUQH 4P23C 5I0ZA 2MKLC 1U6AH 5I66B 1I7TA 3OGCB 1EJ6A 4WTZA 3DO7B 2HJFB 3L3IB 4KQ3L 4MXQD 4YIQB 4NIKB 2AXJA 3LKSA 5HGBA 2E3VA 2PW2B 4KQ4H 1L4IA 4RIRB 1NL0L 1D9KC 3O41B 3VD4A 4NNPH 4XGZB 1JUFA 1JPGA 1U41A 3DLQR 5F9WC 1MCNA 1P5UA 3TGXA 1MFAH 1BFOB 4APQA 2J2ZA 1YUHA 3BRFA 1PAMA 1EAJA 5BO1L 5TE7L 5DRZB 5EZOH 1KYOJ 3VFGL 1C12B 3WIIL 1WITA 2R2BA 1AH1A 1FP5A 4JDVA 5SV3A 5FYJE 1YMMB 4Q9BA 5D1ZB 3MV8A 3TJEH 4OI7A 1E27A 1QFOA 1J12A 1KJ2A 1RUKL 2O5YL 1WBYB 5IVZA 5GGUB 3BZFA 4PGZA 5F1KC 5BS0D 5FA3A 2AS5M 3PUCA 4YK4B 5D5ME 1QNZL 1DLHB 4S2SB 1XF3A 1SQ2N 4U1NB 3L7EA 1UQSB 3P30L 3EZJB 1MI5A 2ZUYA 5HGDB 1KB5A 1AXSB 2EECA 3ZT6A 3DTXA 4JKPL 4KY1L 4R2GD 2R56L 1EFXB 1ULVA 3EZ8A 3ULVH 3L3JA 1CBVL 3EIFA 2NW3B 5DJCB 1D5ZB 5T1KB 3MRDB 3VU2A 4Z8FL 1JUFB 4AL8H 4TSCH 4WI4A 1DQJA 1EBPA 1E4WL 1UJTA 2ITDA 4KZEH 1JNLH 2K3TA 3LN9A 5DRZA 3BP7B 3FCTA 3BPNC 2ZUQC 5CSZB 5FYJH 1FZOB 5DD6A 3NMEA 4B0MM 3EO9H 4RFEB 3MLWH 4UDUB 4APQC 3DX8B 2UVFA 3GSWB 3CMOH 3Q48A 4W6WB 2ADJB 3LIZL 3QDGE 1WZ1H 1HI6B 1MCWW 1FGVL 1HSBA 2H6PA 2V17L 4CNIB 3TN0C 5GJSH 2IFGA 1F6AB 1KGCD 1Z0NA 3HUJF 4A6YH 3FFDB 1DBMH 1NLBL 2CDEB 1FAIL 4MAYA 3STZA 3Q6FB 3FB8B 2EIZB 2Y25A 1N3NA 2Q7YA 3F58H 1IGTA 3ARED 3RZCB 1LD9B 1WUNT 4PJDF 1PG7X 4M5ZH 1IC1A 1LEGB 5ALBH 3O0RH 5HVHB 4U7KA 5FHAH 3G5VB 4BQ9A 1CDIA 1L7IH 3C60C 1T3FB 4Y4FA 2PYED 3MUGA 1AP2B 1B90A 1IRAY 2Z31A 4G8IB 3QUYD 5J1SC 1DBAL 4BSVA 1IQWH 4NQDB 1LK3L 1A2YA 2BC4B 4KTYA 4OLUL 4L3ED 1RURL 1DANT 1JGUL 3EGSB 3BP7A 1ETZA 3HPJB 1VESA 2VXQH 5CINL 3QEQB 5FKAA 1FO0H 4DOHE 4GO6B 3D25B 4W6XB 5B39B 1CCZA 1IAII 5DJZA 4NN5C 5MEOB 1ZTXH 1MCRA 1CGWA 1KUMA 1WV7T 3QEQE 3T4YB 1G7HB 2O5XL 4JDVB 3QPQC 3QCVL 4FQXD 3BJLA 1MQ8A 1HN1A 3B9DA 3CFBB 2NY3D 2XTJD 3MOQA 4JPIA 1CVSC 5D1XC 3KYOA 4M7KH 4GSDL 4PJ9B 4YPGA 3UDWC 4YWGL 2NR6D 4X6CB 5EG6C 1HZHH 5HDQH 1C5CL 1OLZA 1CLOL 3CVHH 4XNUL 3S35L 3T65B 4DVBB 1CS6A 4XP4H 3WJJC 5E9DE 4N8VG 3TNNB 5IESL 5EU6A 4OD3L 4ZO8A 4V1DA 4D0BB 4KV5E 1OHQA 3B6SA 2W9DL 3GGWA 4I77L 2BJML 3BIAX 2W91A 4WWKC 5KZCD 2Z91B 5BS0A 4FTVB 4N0UA 5K9KB 1DN0B 2XQYG 5EBMA 2NY6D 3FFCD 5BVPL 1DQLH 2VXTH 4OI8A 2C1PB 4OKVA 1NCWL 1RUQL 5F7YC 3VXMD 1G7HA 1I9IH 2QEJA 3IU3A 4MCZB 2F53E 1ZVSA 1FJ1A 1Z0MA 1XMWA 1DQMH 3WNPA 1JCKA 2DQGL 2KPNA 2X1PA 3NAAH 4G9FA 2CKBH 2F53B 4Z7VF 4Z77B 5J6GB 4ZAKC 5KANI 3OAUL 2Q6WB 3FFDA 1H3PL 1JHLH 1IM3A 4M61A 1U3ZA 2JELL 3AVEA 3EJZD 4LPCA 3CC5A 1A6WH 2AJYH 4G6FB 4IRZL 3O6MH 5BO1H 4QXGH 5EZOL 1U58A 4NNYB 2IAND 4UI2A 5HYJE 5DVOA 3UROR 4OTXH 5FKPA 3HI6L 1NFDB 1J05B 1R3KB 2NR6C 2WW8A 3S36L 1N0XH 1EHLL 4UNTA 4P2QA 4FN0A 5DJDA 3F5WA 4Z0BH 4HXAL 3PNWB 4KTEL 4EBQL 5DD1L 3HZMA 2F53D 5GGTA 3HZVB 3HE6A 2XQBL 1PKOA 3BKCL 4OAWB 4U1HA 3CFJA 1NEUA 2R2HB 3D25A 4L4VE 3FFCA 3HPLB 4Y4HA 4ODVL 4Q74A 4EI5B 3P30H 1BVZA 3LHPH 5F9JA 2F19H 2O93L 5DYOB 1Q9KB 3QRGH 2H8PA 4AQOA 5GGVY 2YHGA 2FD6H 2XWBA 4PUBH 3ORJA 4R96A 4CW1B 2QQLH 3B2VH 3QFJD 2EKSB 1T7ZA 3FMGL 3T1FB 4UQ3B 1I1AD 1NCCH 3L5XH 4ZXBA 4Z8FH 5E9DD 4O51A 5IROC 2R56H 1NH6A 3QJHA 2BSSB 1YJDH 3V52L 5TH2B 2FX7H 3V6BR 2EDKA 3QRFM 3E3QC 5MEPB 3R8BB 2AGJL 4PPTA 4LEOA 3KPOA 4QHUA 3MJ8B 5ISZE 1IEAA 3M07A 3TBVB 2BOCB 5DMIH 1R3KA 1CLYL 2QBWA 2NY5L 4P57B 3WXVL 2AEIT 5IJVA 5D7LA 3GEWB 1WFTA 5ITBH 4OZHA 1HYSD 3NGBC 1HYRC 4RMWA 3OKOA 4ZUUB 1MCJA 2UZXB 3GJFA 3ARVA 2WINB 4MS8C 2WBJB 4M3JA 3UTSA 4KXZH 1XR8A 4FQ1H 4RFNB 3QP3A 2HWZL 2I60H 2XKNB 3MRLA 4GBXC 2X9YA 3BQUB 3QDJA 3V4UL 4JG1L 3LV3B 4QLRA 4K94L 1IGFL 3O8XD 3SCMA 4GW4A 4HKJB 4G8GB 1AKJB 3SE3C 4JDTH 1SJHA 4FFYL 1LK3H 3F7YB 3VFSA 1NCBL 1Q9OA 1JV5B 3L9RB 4CBPA 4JAMA 3NPSC 2BNRA 4LCWB 1EJOH 4OF8A 5CP3H 3MPCA 3OJ2C 2IAMA 4MWFB 4ZSOE 4KVNH 1F4XH 5I1LA 4G7VL 1JE6A 5F1IB 4L4TB 5DR5H 2AV7A 2KL6A 1T6VN 1J18A 4HWBA 5HHME 1FFQA 1ZLSL 1AO7E 4LLQA 3GMLA 5DJAB 1U8LB 3UPCA 2BSTA 2P24A 5JW4R 2LABA 1QEWB 2AK1L 4G8EB 1H5BC 2DWDA 4PJFB 3GUTA 4OUOA 2X4OA 3UBXB 2DKSA 3HZVA 1MRCH 4JHBA 3EOYG 3QUZB 1PSKH 2X4QB 4D0DA 3P77B 4XMLH 2H32H 3LKRB 5JIKA 4AJ0A 1FBIL 5KAQG 3GSNA 5CEZL 2ZPKL 1CXLA 1B2WL 2X4SB 2CUMA 5CSBA 4OB5H 3HI1A 1HSAB 4HFUH 5EOTB 3PIQA 3U7WL 3B9VA 3ARBA 1CFBA 1JPFA 4PJXB 1ZWIB 4IDJH 3F6LA 4OD3H 5HYSB 2IFFH 5B38G 3MR9B 4ZFFB 3Q5OA 4G6ML 4LVOC 1KJVA 3MC0A 4ONHB 5A2JH 4PRAA 4FG6D 1CXFA 3RIAK 4PP1C 1M05A 1TJIH 3T2NL 4HK0A 3PHOA 4WENB 1BD2B 2DQJH 4GS7B 5JHDB 3OXSB 3NCYP 4F9PC 2HJKB 1P4BL 3NCJL 5EZIL 1PEWA 3D85D 3GMOA 2VN4A 4L4VA 3A6CL 4KKLD 4PP2B 5A1AA 1TZHA 2ORBL 1JN6A 5HY9B 1OGAB 2CKBL 5IV2B 1W8NA 2VR4A 1T3FA 4Y4FB 4WO4B 1L9MA 3THMH 5KW9L 1RZ8B 1UWXK 3VGAC 4HPOL 4U1MA 1F6FB 3ZT5A 3B5GA 5DMGC 3SDXF 2M8XA 4MAYC 4X9GA 4F8QA 3VXRD 3JXAA 1R3JB 4JLRA 4NM4L 2XA8H 1IC4L 3G9AB 3QEQA 2PTUA 3RBSA 3LS4L 3HI1B 5EOTA 3RHWF 4P2CG 2Y72A 2VIRB 4XXCC 4DWHA 4AT6B 1SJHB 1MELA 5HYQB 4JRYB 3HHRB 1RZIB 2OTUB 1FFPB 4NJ9H 2Z92B 5DFVC 3INUL 3MCLH 5FA4B 4JM4L 3KJ4B 4HK0B 3RI5F 5DEGA 1ES0A 4GG6F 2BVOA 3FQXB 2DKMA 4Q58C 1NCAH 1F2QA 2SEBB 3PL6B 3QWOA 4NBZB 3CVHA 3K8MA 1BGXL 2GJZB 4LLQB 2BNQE 1ZSDB 4P48A 3IKKA 2P43B 3OXRA 3PG2A 4ODVH 5HI3C 5GGRY 4X4ME 1NBZA 4FXGA 4MGXA 4EN3B 1Q9LA 5J9PB 2CR3A 3OR7A 4RNRB 4AYFA 4RGND 4HFWA 4YXHL 4X6DE 2CK2A 1RZ8A 4PLJD 4X7TA 1OGTB 2YA2A 5CEZE 1TJGH 3MA7A 5ITFA 3RI5K 4D94A 1MCPL 4DQOL 3L3OB 4EI5C 1NLDH 2Z91A 1MREH 4U3CA 3DSFL 2R15A 3U46B 4GKSB 5DMIL 3TO4A 3BUTA 4KROC 4YX2H 4QRSB 3S5LG 4MJ2A 4PRNA 1IL1A 3PQYB 2E8ZA 2VZOA 5JA8B 5L7XL 4PRBA 1T1XA 5IBUG 1FJ1B 4YHKL 2F8XC 2WBJD 1S7VB 2X5PA 1AGBB 4PD4K 5I75B 1EXUB 2FHCA 4PRAB 1U8NB 4O02H 3I85A 3JWDC 4M3KB 3VXSA 3SBWC 1U36A 2GI7A 5HHPA 2H1PL 2DI8A 3VI3F 5IW6B 5ACZA 4GXVH 3KPSE 2YD8A 4R0LC 3OR6B 1OARH 4DVRH 1MHHB 4I18A 4N8VB 2OTWB 4FQ1L 1VEMA 1KN4H 4FXGB 4EN3A 4LVHB 4K71C 1AXSA 1N59A 4K8RL 4Y1AD 3MRNA 5DUMH 4XX1G 4E41E 4NP4L 3EYSH 5GGRB 3JVGC 3F62A 4LGSB 3BRGC 1NGQH 3GIVA 1RZJH 1UYWL 2VABA 3H3KA 4RISH 1I4FB 2YA0A 2A9MH 3L5WB 2CK0L 4HQQH 4XCEB 2XY1A 3IGAB 5C6WH 1QA9B 2A0LC 4LFHG 5KSBB 3CFJB 5SX5H 1XGTA 2R2HA 5DD5L 1TQBC 2YUXA 3TPUA 3DVGA 2G9HB 3IRPX 4MVBC 2AXGA 4NQVA 4I3RH 5DRXB 4RZCB 3T3PE 3LB6C 2DLEA 2R4SL 4Y7MA 5F3HA 3U4EA 2W0LA 1JMXA 5JDSA 3OG4B 2BOBA 2HTKD 3WN5A 3H7BB 1DUZA 1YEDA 1J0HA 4H20L 4KTDL 1A4JA 4DFIA 2DLHA 3ZE0F 3V6OC 1KB5H 1DQDH 2DIBA 5E8OB 4AEIH 2X2YA 4JFHE 5B21A 4DN3L 1XFPA 3SDCA 4JY6B 4LRIC 3WS6C 4XXCA 1Z5LA 4X7SH 2ZG1A 4R26L 1ZGLA 3NPZB 1BWMA 1BJ1J 3T3PF 4P23B 5D7LE 3NABL 5T3XH 4F80A 5DDHB 2IEPA 2ED7A 1YQVL 3EAKA 5T3ZD 4DN4L 4YR6A 5CD3A 1P6FA 2DAVA 3ZYOA 4QOKA 1MJ7H 1OAKL 25C8L 3ZE2F 2VERN 4XCEA 3DVFA 5F89B 2PNDA 3QIUD 4LIQH 4M62H 4QTHA 4PJ8D 1F4YH 3O45A 1BEYL 2DQJL 4GG8A 1CF8L 1EIBA 3L95A 1EV2E 2GT9B 3U7YH 5B39A 4I48B 4MNQA 5FDWA 3AROA 5IFJA 3Q5YA 2XKNA 3U83A 4JO1L 4ZFOL 4OZIF 5DMGD 3C5ZD 4LMQI 1BVKA 1D6EA 5FB8B 1X5AA 4G8GA 3VXRB 4NQEE 5E08L 1ONQA 2GJJA 2BOBB 2ORBH 3O3AA 4P5MB 5F9WB 2P7TB 4C56D 4RMUA 3WLWD 3O4OB 5JMOC 2BXYA 3HCVB 1XIWA 3MNZB 2IH1A 1X44A 1JZ2A 3LH2H 5DLML 3WNKA 5DI8B 3G5ZB 4LKCA 4TOYH 3EOAA 4PRIE 2VE6B 2XTJC 4MCYA 1IEBA 5EU3B 4LASL 1KPRA 1KCLA 3GO1H 5LQBL 4RX4D 1VFAB 3OKNA 4XNXH 5SWSA 1TFHA 2MMXA 4POZD 2LU7A 2VABB 2DWDB 3DSNA 3BESR 3CFCH 2X4OB 2D7NA 1JYNA 3MO1B 2FO1A 1IMHC 1V3MA 3DBXA 4MXQC 3W39A 4BZ2L 3D39B 3L95B 4KPHL 4X9IA 3PWPE 5ADOH 1CXKA 1MAKA 1RHHB 5BQ7B 1U9KA 2OZ4H 4NRZA 5BRZD 5H94A 3K3QA 2YD5A 1F4HA 4QXUL 2XA3A 1P4IL 3VI3E 2J6EA 3MREA 1CD9B 2OTPA 2I5YH 3IYLW 3MRGA 4OLWH 1T0NB 1U92B 3I50L 3TNMB 4HS6B 1IM9B 3I3DA 4JFED 3N85H 1W0YT 5DEFB 4Z77A 1LO3H 3EO1B 1IM3B 1ZWIA 5HYJA 2Q86B 1FRGH 5IWLA 1NGXB 2CGRH 5E2WH 3CU7A 2IPKA 5E8PB 4NC0B 1KELL 1RMFH 4X7DC 4OIIH 4ODWB 5I17B 3HC4H 2ARJA 1F11A 1DUYB 5AAMA 3MV9A 5EN2B 1A6ZA 5MEQA 2OQJA 4NKOA 3NFNB 4H1LG 3RQ3A 1FNGB 1N5AB 2A74A 1GGBL 3OKLB 5IHZB 1EFQA 5BOPA 1MWAA 1TZHB 2FWOB 3HTLX 4XB8A 3UJJL 2A6JB 3DYOA 5D7JA 4AZ8A 4JFFB 4FTVE 5A2FA 4PJ5E 5D8JH 4X8JA 3IJYB 4DCQB 3C87A 1WIOA 5I76B 4PR5B 5T33H 1SY6H 1OT2A 5I1HL 5FYLL 4L4TD 4JCLA 2YBRB 3ZKSD 1SHMA 1S9VA 2VDLL 1BFVH 2VIRA 2DM4A 4Y2DD 5CCKL 4GG6E 1E4XH 4GFTB 4LCIL 3HR5B 1T7VA 1MCWM 4EDWH 1P1ZA 1T66D 2KZWA 4XNMA 5F7EL 1RIUL 4HC1H 3K80A 3S5LA 1YNTA 1TMCB 1FYHB 3IB4A 4ODWA 5I17A 3ZHDA 3KXFA 1X7QB 1JWUA 1ES0B 3P9MA 5TQ0L 1W8OA 3CDCA 1NMBH 4XRCA 1TIUA 4NKMA 2NY1D 3G04A 4XPFL 3C2SA 4Y5XB 4M02A 1A6ZB 3FT2B 4ELKB 3P2TA 3IETA 3CVHB 4M93C 3EYFA 5DEZA 3V9FA 2VLKE 5F6IB 4XNQB 2CKNA 2VC2H 5FV1L 4JRXD 4KAQH 1IKFH 4GBXD 4JPVL 4X6DB 3QIBC 5HD8D 4TVPH 2HG5B 5I71B 4LQFH 3AAZA 3DRTB 4ZUUA 3PWPD 2ZSWA 4QHNB 1KB5L 1XGPA 5D1QB 4CN6A 1BZ7B 4KUCF 4MJIE 3SJVB 3UTSB 3N50A 3SHSA 3MFFA 5CLTA 4HZLA 1MCOH 1RZJC 4Y16C 5FOJA 3DO3A 3STLA 2DQIL 4O00A 4YC2C 1U92A 4NN5B 3MROA 1NKRA 5LAXA 1V7NL 5TDPA 5DJYB 3CLFH 3K4ZA 3CK0H 4XNMB 5D7JD 2DJSA 4KJYB 2E9BA 4U0RB 5AZ2H 2A1WH 3CLEH 1OTSC 3BH9B 1NC2B 1QSED 4WO4D 1UM6L 2HT4D 2ZCKL 3R06B 4Y4HC 3ULUD 1S7XB 2NX5B 1ZVHA 4OF0A 1AD9A 2YEZB 3RDTA 3EOTH 1EO7A 1I9JL 4LLVB 3TBSB 2R2EA 1LO2L 5JO5A 5GJTL 4R2GC 4O4YL 1WVZA 3IFNL 2Y1VA 2BSTB 1GRWA 4MQXC 1A7NL 2DJ4A 3W0WD 2EDBA 2E8YA 4PGEA 3TVMB 5IMLA 5J11B 1V3KA 4WI8A 3QUZA 3ARQA 3KWWB 1KXQE 4JFFA 3U1SL 5CD5D 4I0CC 4OCNC 4NQCB 3MFFB 3O3BB 5DURD 3ME0A 5EBWA 1TZIA 3TA3C 2PW2A 1HZHL 1BM3H 1AC6A 4TUJA 2NX5D 4QRQA 3E1F1 4ODXB 3KXFE 5EC2A 2JIXD 4POZC 3TCLA 3QIWB 5DLMH 4R7NB 4JFXA 3KLHC 1BP3B 3CFKB 4UIKL 4YHIA 4KKBC 3FQWA 4HDIA 1QLEL 4U6XB 1IKNC 4XBGB 5E8NB 2J7LA 4UQ2A 1B0RA 4GMTH 2KH2B 2VLRA 4KPHH 5DS8A 5SX5K 5EO0A 4HGWA 4ELME 2YZ1A 1DUZB 2W9EL 3M8OL 3QHFH 3HNVH 4N0YH 4P5TD 1UKTA 2G2RB 3ARFB 2CLVB 3ARZA 3BSZH 3QXDB 3RTQC 4HLJA 3NA9H 4YXLH 3VGFA 4XAWH 4KROD 2OZ4L 4NNXA 4X80L 3SE3A 3X12A 4YXKH 3RL1B 3ECBB 4GAYB 1MHEA 3AS3A 1EEZB 2BRRL 2LTQC 3MLUL 5IQ9B 2WQ8A 4HKXA 1KCRL 4FFZL 4LHUB 1PYWB 3MV9D 4MX7A 4PV9A 3ZKXB 1KIUA 4DKFH 1A6PA 2XIDA 1AQKH 1CFVL 3KPPA 1Z9LA 4AG4H 1T2JA 3WMSA 5EC2B 3EYQC 4XVUC 4JO2L 5EWIH 5T1DL 5MHSE 2NZIA 4ZNEA 2YWZA 4I0KA 4JJ5B 3MQIA 1ERNA 1OAYH 5FCUH 1J88A 2Z8RA 2IANA 1T1WB 4PJXF 2IPTL 1S5IL 3QCUH 3X3GH 4BQ6A 4BZYA 2D2OA 3D18A 3HI5L 3U4BL 5K9QI 2GCYA 4PJCE 4P5MA 1QRND 3TC9A 3DXAE 1QP1A 4KUZH 4M6AA 1KNOA 1PDKA 1MAML 2Z9TA 4WGWB 4Z7UB 1QBMH 2FJHB 4PJ8A 3QG7H 5I18H 3ALWA 3HMXH 2HKHH 5HJ3A 4Z7NE 1A6UL 5F93C 3AXLA 4XH2B 5DUBB 3SDCD 2DLFH 4R90H 4ZYKA 3BEVB 3H0TA 5I15H 1OGAE 5KS9F 4FQCH 1T1YB 2GFBA 4TQEL 1FGNH 4MD4B 2FEEL 3IF1B 2DD8L 4NO2B 1U8MA 1Q8MA 1LE9A 2CDGB 2NY1B 5JW3H 3QQ3B 3GI9H 5EZJB 4RGOH 1PLGL 1KIQB 4P9MH 2EE2A 4LHQB 4NQDA 3ZYIA 3MRBA 1XCTA 5I1CL 3V0WL 4CMMB 3UEZA 1AXTH 5E8DL 1NUDA 3WO3B 2X4UA 1A1MA 3PP3H 2QHLA 4G3YH 3SKMA 5DC4B 2UYLA 1U8HA 3MFGB 1AGEA 4PGDA 1BFSA 4HCRA 1FLRH 1P84J 3LMJH 4JGJA 3WFHA 1GAFH 4NT6B 3RVUD 2IBZX 5DEFA 4D0CA 1NJ9B 4KAQL 3LQAC 3N9GL 3KGRA 2GSGA 4GS7C 1UA6L 2D4DA 1V7ML 4XBEH 1WBZB 2G2RA 1M7DA 4F2MB 3X12B 1AGFA 5DZLA 3I3EA 2R69H 4GRWB 2X41A 4JDTL 3IKCB 4FFWC 2MCPH 2A1WL 3REWB 1ZXQA 4P3DB 3QQ3A 3SDAB 3WUZA 3ZTNL 2EIBA 1XF4B 1YPZE 2YXMA 4KJQC 1B88A 3MLPA 2V2TB 5IW1A 1XGTB 3BGMB 1F3DJ 5AD0A 4FTVA 3GSUA 4GJTB 4XAKD 1IT9H 1FNEB 4MJ5A 3DX6B 5I30H 4Z5RA 3RKPA 2R2CA 2NY2D 4Z7WA 5I8OL 1CGTA 3DIFA 3WXWL 3MBEA 4P2QD 3ARDC 4OT1L 1A7NH 1QBLL 2BNUB 4I2XE 4FXKB 4PJCB 5H37H 1HXYB 2V2XB 5L6YH 1AIFB 4P2OC 1B0GB 5DXWA 4GRLC 4MA8L 4L8DB 2IQ9L 3CC5B 1U8KA 1NAKH 5J1TC 2EYTA 1OD9A 4IHOA 2Q76B 4PTUA 5IKCB 5FFLA 1QLEH 4MNQD 5E00B 2ZG3A 4LF3B 1A6TA 4TNWF 1NQBA 4LDLB 4WFED 5F6IC 4GMTL 3T4AA 2Q8AL 3MACH 1IBGH 5IIEA 4UV4H 4GRWF 5LVEA 2Y07L 3Q5TA 3V0VB 3JVGA 2V2TA 3V4PL 5IW1B 3MUHL 5DVMA 3VDBA 1MQKH 5GGSA 5C0DB 3PL6C 3BKML 2X4UB 2Y36H 4M1DH 3QIWC 4GKNA 1QLFA 1CU4L 4WV1A 2FECI 2DOCA 4Z5RB 4G9DA 4ZXBC 5F9OL 1NBYB 5C8JA 2BRRH 5DTFB 1QFHA 3TZVC 3A6CH 4CVZA 2C4FU 5JHDD 1SJEA 2EE3A 1MFBH 4X99A 1K9TA 5HHMD 3VXRA 4K7FA 3PJSB 1FIGL 1MPAH 4X80H 2VUYA 4WFFE 2DF3A 3NCEB 4NT6A 2CH8A 3TV3L 2BZDA 5FGSA 5TDPB 1M6OB 4HF5L 5L9DL 2FLBT 2W0PA 2WNGA 4RWYL 3W9DB 1WBZA 1KULA 3WN5C 5IVXE 5C0BE 3G5XB 3JWOC 2N7BA 4OBRA 2C3WA 4Y16A 3EOAB 3TN0A 2FL5A 2PYEA 3LKOA 2VKXA 3C6LC 1T20B 2EDDA 4XB7A 5GZND 3GI8L 4NN6C 1Z9OA 1RK0A 3BP6B 3I6KB 3UJIH 1WGOA 4RMTA 4NZUH 5ISZB 3D85A 3S96A 5A2LH 3CXHK 2CRMA 4JE4B 5EUKB 1BHGA 1CFQB 3VG0L 5F6HJ 5I6XB 4F7TA 1HHHB 1XF4A 2BVUA 1KTLA 3X17A 1QLRA 2CRZA 1K3ZA 1RZFH 1RUKH 2GITB 4OZ4B 4U2ZA 3U9PH 4YHYB 4AEEA 2AKRB 3SDCC 1BPVA 3DRQB 3HMXL 5D7SL 4WEBH 1CGUA 3CAFA 5J12C 3FL7A 4LVHC 5EBWB 4HHAA 5CILH 2Q3AA 4M6NH 3TYGL 1MHCB 1NAMA 4NM8H 1PQZB 3LKPA 4QRQB 3QXWA 4Z7VA 4LLYA 1EA9C 1FGNL 1SJEB 3UC0H 4KK8D 2FIKB 4XCCH 3QBTB 4TVPD 5F1SA 1I1AB 4JHAL 4PLKC 1IAMA 2EC9U 5ISZD 1DP0A 1FCCA 1XR9A 3A6BL 3VWKD 3S3SA 2A83A 4RMVA 1QOKA 3F6IA 3DNKA 3SO5A 5CP7B 2UWEB 1DL7L 2F74B 2R23A 3HRZB 5D2LE 3REVA 3FO0L 3BX7C 1YNKL 4LSTH 1CIUA 1EFXD 3DROA 2VKWA 4ZUWA 5HHVL 1A5FL 4K7PX 2V7HB 2JJWA 4NO0B 2FCBA 3AS2A 3IFOA 2R0ZL 5I1LB 1A6TB 2F5AH 5F1IA 1PKQA 2FO4B 3MUY1 1OSPL 3MV7E 1BBJB 5JOEA 4H0GA 2ZUUA 1GJIA 4GAGH 3MTRA 2H2SC 1LEKA 4LAQL 1HHIA 2WWKO 3MLSH 4M7LL 4XP1L 4ONGH 3SDYH 1CXIA 2V17H 4OCSH 5L0QC 4HKXB 1S8DB 4MZ3A 4TVSa 4AQ1B 3QAZB 4G42A 3HC3L 1I7TB 4TULH 1H3UA 5CHNA 4MDJB 5DO2C 3GMRB 1C8PA 4L4JA 3QYCA 3MSPA 1NC2D 4EDXA 3L1OH 2YUZA 4MSWB 1TCRA 5CWSB 4MYWB 4AM0B 4M7JL 3QI9B 5IGXH 1MLBB 3WDIA 4K3EH 5FHAL 2QR0A 4C83B 4HGKC 3SY0A 3T08A 4YDVA 1OTUD 1VADB 3EFDH 4WDIA 5IMKA 1R0AH 1U3HD 2EH7L 3NTCH 1KACB 4N9OB 5IBTL 3BYTA 1JZ3A 4Y1AA 1R5WB 4Y89A 3U6RA 5E99H 2RFXB 5F7LB 5JZ7D 4MAUL 3VRIA 1KJ2B 1JWUB 4M00A 2FL5B 2PYEB 3VFVA 4X6BB 1QSEA 1OP3H 1KNOB 2JE8A 5CBEA 3KYMB 4NDMB 4DZBB 4HUMB 1FPTH 2VLRE 2D03L 1ZTXL 4NWTH 3SE9L 1JPSL 2VAJA 2FIRT 1N5YL 4JFDD 2KKQA 3OJMB 4D9LL 4U6VL 2CDGA 4EDXB 5JUEH 3LKSB 4N1HB 3X13B 5HHOE 4FQXB 1LO5A 4H1LH 2WSKA 3MV9E 4PJ8C 3VD7A 3KNBB 1CR9L 1J0IA 1BLNA 2L7UA 2BVQB 5IM7B 2HTLD 5IBUB 1VSCA 5CJBA 3OJDB 5AWNL 4GBXA 4Y88A 1OP9A 5IESH 5I8KH 1NAMH 4I3SL 4UDUA 4F15C 4DN4H 1HINH 5IW3A 3P4MA 3QFDA 4K3GA 4DK3A 4UINL 1VFBA 3S8WA 1DEEA 1PG7H 3MGTA 2VLME 1CFTA 1B9ZA 1F2XK 1YEKH 5SWSE 2GSGB 1JI2A 1OTUC 4NDMA 1UXWB 4BUGA 3I02B 3FB8A 4LL9A 3RPKA 3OG6B 5GGQL 43C9B 4POUB 3IJHA 4JQXA 4HJ0C 2XWJA 1ORSB 2BVPA 2VDQL 3BDBA 4NKDA 1MFBL 4MQTB 5HYEA 4JO1H 3IDXH 3PWPA 3C5JA 2OBGA 2OR8A 4WUUA 4NHUA 3BO8B 2X05A 4EUPA 2HT4C 3E8UH 1MI5B 5ESVA 1R3LA 3ZO0A 1F3DH 2BNQB 4O5LL 1YPZA 4RWYH 3MUGB 3BGAA 1R5VB 4CJ1A 1A3LL 2DTMH 1ZGLP 2ED8A 4NJAL 2G5BB 4BSVB 5BZWB 5ERWA 1URLA 3VRJB 3BMVA 5IM7A 3SOBL 4EUPH 4BQ8A 4HC1A 1EEUA 3G6DH 3UAJC 1RUAL 4OZGE 5J6HA 5JOFA 2VLLA 4OM0L 3D2UB 4QGTA 3KLSA 3TO2B 2EYSB 4U6XA 5J12B 3WFCH 1WBXB 1WTLA 1A9BA 5F9AC 3RWEB 4R4NC 3ZHKA 1G9MC 4AENA 3RUGA 3NFPB 5A3IC 4A6YL 3W81A 1M71B 1U8OB 1WCBA 3MV7A 3DV4A 5C0CD 3DURA 2W92A 3JTSA 2Z35A 4BZ2H 4F9LC 5EH1A 4IRSA 3X14B 2J8HA 4B50A 1UXWA 4PJ9A 4FP8H 4NQSB 5FHBL 3T3MF 4PJHA 1OOAA 1J1PL 3QG6B 4NN6B 3ELAT 2CO7B 5BV7L 3QDGD 5IB2A 1ZHKB 3BUYA 3EJYD 4NHCH 2V9RA 2ICES 4OFKA 3QHZH 1FN4A 1SM3L 3MXWH 5TQ2L 3IT8D 3O11B 3EUUA 5DWUH 2YWYA 4QRPB 4DEPB 3TNNA 4XHQA 3FO1B 1ZHNB 2GK0A 3ZT7A 2VDKL 3NZHL 2IC2A 5E7FA 4KJQD 4QRTA 3ROLB 2XACC 5EBLB 5KN5B 5C0NC 4MJID 1T5XA 2HFTA 1Q0XL 2BC4A 3TJHC 2AGJH 1C5DB 2OJZH 5FYKH 3X11A 2V5YA 2PETA 3IXTA 1I3RA 4OIAA 4BFIB 2DS4A 5H2BB 1SBSH 1R3IH 5IR1B 4TN9A 5E2UH 1LO0H 4HXBL 3CDGB 3GHEL 3QEGL 3WFZA 1QFUL 2EEBA 2NPLX 1EEYA 3N0PB 4D2NA 1M71A 5C9JA 2KZ1B 3HNTL 3TT1H 1DFBH 4U6YB 2ZG2A 3OMZA 1IGMH 3D5OF 4YWGH 2GTWA 3FAWA 4IRJB 1K4DA 4E5XA 2FZ3B 2I9TA 4P49A 3IU4H 4CVXB 2V5RA 3BZFB 2NQCA 2ZJSH 4YUEL 1FL3B 5EFIB 2NTFA 1HEZA 2DYPA 1GIGH 1KENL 1U2HA 3S98A 1U3HC 1I1AC 5KVFH 3C5JB 3FB7A 3BEWB 3J7HA 1CICC 1JGLH 5JR1H 4NO2A 3OWEA 4Q6IA 3E6FA 2CJUL 1YPZB 1DSFL 4MB4A 5FXCH 1LMKA 1NMCC 1RK1A 1MVUB 4P2QB 5SWZE 3OZ9H 1K2DB 4W4NA 1IAKB 3C09C 5IBTH 5GGSY 4YHYC 4PJ5D 3CPLB 2YK1L 4GRLD 1KCSH 3KYKH 2FATL 4RFOH 3PGFH 4OZGB 2D7TL 5J6HB 3AC0A 5EBMB 3GMQA 5DRWB 5CZKA 2Z8SA 2VDRH 4HWNA 2B1HL 4NCC2 5D71L 5IFJB 4XI5C 3QNYB 3T77A 4AENB 3MLTB 3S37X 1GHFH 1J1OH 4QT5B 5AUMA 1CDBA 3QJFB 4YHOH 1CLZH 4R96B 2GQHA 1FYTE 1J11A 5ADPH 1VPOH 2AK4E 3ZE0E 3KAAA 3QQ9D 1PSKL 2BY3A 2QL1A 5C08E 3JTTB 1A1NA 3IAGC 1RULH 4U2YA 5L88H 2NZ9D 4L1HA 2VLJE 4Z6AT 3QG6A 1K85A 4M61B 3KPMA 4XP6H 5I8CB 1NL0H 3OB0H 3ZDXE 2DDQH 1UADC 2OMBA 1EHLH 1SBBA 2YPVL 1HOCB 2YR3A 2ADGB 4YDLB 5C92A 4ZO6A 1UXSA 1PKQE 4V1DE 1HHGA 8FABB 2JJTA 3B3IA 1J7VR 1A8JH 5DJ0B 3KYAA 3L5HA 4ENEC 3E0GA 4LDOB 3HKFA 3O4LE 4KI1A 3JWDL 1AGDA 5IUSA 1JL8A 4PRDB 5FM8A 5CZVH 2FB4H 1P4BH 4OFPA 5LWYH 3O4LB 4LSSH 5C70A 2X1QA 3QUXA 2NNAB 1YN7B 5T5FL 3VFUA 4QT5A 3KYNA 1S9XB 4GW4B 4HKJA 4IJ3B 1RUPL 4WHTB 4XBPA 2V9QA 5ABDE 3FTGB 4JPIB 3BKYH 4CRPA 1UWGL 1A1NB 5LKNA 1B0GA 3ULVL 1CBVH 1EO8H 3AREC 2CLZA 2EDYA 5ID1B 2NY2C 4CGTA 4NC1E 1BZQK 3K2MC 3JV4B 4WW2F 3GIZL 4NJAH 4NSKB 2Q76A 1KPUB 1I3UA 2DBLH 3FB7B 1A7QL 4OGYH 3TLRA 2NY5H 3WXVH 3KYMA 3C08H 1MFNA 4J3VA 3GK8H 5FYJL 1RUAH 1ZLWK 4LHJB 4R4FH 4X98B 3QIWD 1HXMA 3QCTH 4FQHB 2P24B 7FABH 3FOMB 32C2B 12E8H 3QUMA 3MLVL 5IOPB 3RUGE 2D7MA 1I1YA 2NXYB 1WEJL 3RU8L 1R24B 3RWJB 3DO7A 5FHBH 3FQUB 1AGDB 4LEXL 3RFZC 3M8OH 2VRAA 1QLFB 2DB8A 4OD2A 3V4UH 3QEUA 1J0JA 3C5SB 1FAIH 1JPGB 3TN0D 4JPKH 1SM3H 5C0JB 5T3ZE 4Z7OE 5J7CC 3KYNB 4RAUB 2P5WB 3OJDA 3RWIB 1FORH 1CIDA 3FKUS 4MAYD 4JM2C 2WBKA 2CKBB 2YA1A 3FOLB 3C6LD 3BZ4A 4Y19B 1HHJB 4KVNL 1XIWD 4J3XA 2ICWB 2BHZA 1DBAH 1IQWL 2X7LA 4UV7H 1WBYA 2ZUWA 3DWTA 3S5LB 1MCEA 1D9KB 1ZLSH 1NMCB 4ZQKB 3AU1A 3WD5H 3WHE1 4CN4A 1QO3A 3AY4C 4XRCB 1IARB 4LMQE 1MNUL 1Q94A 1LK2A 1ZOXA 3P0YL 4NUJB 5L7XH 3L7EB 1S5IH 1HQ4A 4FQHA 1CFQA 5MP6L 1F58H 5DQ9B 5IB4A 3QCVH 5DC9B 1J0YA 3RWGA 3RWJA 5L8LB 3VFNB 3I75A 5IJKA 2AKRA 3QO1A 2HJFA 3L3IA 2GTZB 4Z78A 5EORL 4NO3A 2DRUA 4GXVL 5F3BA 2NY3C 5D70H 1D9KD 3LKPB 2LVEA 5I9QB 4DVRL 3CVIH 3P3YA 3KR3H 4Q2ZB 4W4OA 4HJJL 3SJVE 2H41A 4R90L 3OF6A 3B5HA 5E70A 1MCHA 5B39G 4W6YB 3P4OB 4LP5A 5J13B 2XICA 1T89A 2EYSA 2VL5A 1AD0B 3JV6B 2QSTA 4KH2A 1TVBB 1N4XH 3ZZ1A 4ZPTA 5JW3L 3BT2H 4X9BA 1I8KA 4GW5B 4ZMAT 3BJ91 4DFHA 2AJVL 2I24N 4D8PB 1VB9A 3L3KA 4E42A 2YPKA 3H3BC 2UZIH 5EC1A 4HCRH 4OV6F 5I1KL 4WWID 3WO4B 1XIWC 1S5HB 1X9QA 2Y06H 4X98A 4WU7B 2ZCHH 3ARBD 2EXWC 4Q9QH 1EHAA 4KK5C 1ZLVK 4XPBL 2EO9A 1NBZB 1H3WM 4OLZH 2ZUTA 5LGJA 2X6MA 1I1YB 3GNML 4KKAC 4KHXH 2H2PD 1FFOB 2OI9C 4X7TB 2PTTA 3NACH 4U1MB 4YEFA 4JGUA 5TE7H 1LP9F 4H88L 5C07E 2AJUH 5I73C 4M1GL 1Q38A 3U46A 4C4KO 1EMTH 4HIEB 4LSUH 3ZSSA 1WT5A 3IAQA 5FO8B 2V5MA 4HG4J 2EDOA 5ICYB 4S10A 4XCNB 3C60D 1PW3A 1GPOL 5GSRA 4JM2F 3V0AC 1AO7B 1FVCA 3ZKND 4JKWA 3HAEH 4K3HA 1JGUH 3PV6A 1WC7B 5C6TH 5ICXA 1N64H 2NXZD 1AGBA 4HXAH 4KTEH 5C71A 3MGOB 3GSRB 1GZPB 3MV7D 1ZT1A 4UT9H 5EC1B 1E6JL 5C0IB 3HG1D 3ARFA 2YD3A 5K9JH 2CUHA 1YA5A 4JEGB 4NUJA 4RMSA 2V5SA 4KY1H 3MRIB 1OAQL 1FNAA 2VSDA 4F8TA 2VWEC 1H0DB 2OR9L 4LSSL 1PEZA 4I0PD 3IAPA 5IB4B 1DBBL 1WZLA 2WMPA 4Q6IB 4JHWL 3LOWA 1JGEA 1FFOA 2WUBL 5GGRA 3T0EB 4DGVH 2ZWLT 3C8KA 4QRRD 2DQUH 1DVFC 3LKRA 1N2RA 3G6AA 2L4OA 1A7OH 1BLNB 3MJ7B 4L29A 5GRWA 2B4CH 4LPXA 2EZ0C 4G6AD 3HG1B 4F3FB 3GDBA 1ZK9A 2IPUG 3TVMD 4LASH 3QDGB 1OP3K 3DX7A 4QRSA 4JZOB 3C08L 5E5MA 2CXGA 1AHWB 4KJWC 5CJQL 2AV1B 1MJUL 4TTGA 4LBEB 2F8VA 1KJVB 4P4KA 4WU5B 4J23A 3O8XA 1OP5K 5DFVD 1JRHH 5JDSB 1M05B 3HNSL 5KG9A 5F7MC 3KYOB 4D8PA 3VXSB 8CGTA 2IG2L 5F9OH 4NKDB 3KPMB 2WIMA 3U48A 1UEYA 2QSVA 1UM5H 2IADA 2GJ6E 3OR6A 4Y5VC 2LAGB 3MRMB 1JN6B 5IV2A 4PGCA 5I1AA 4EKXA 5EULV 3TH4T 1XF5B 1DLFH 1AY1H 3IF1A 1JF1A 2FGZA 5IEKA 2IBBA 3HAEB 5I6XC 3KHQA 5JPNA 5GQBA 2F54B 3EJJX 4IRZH 4O2EA 4L8SC 4YNYB 2DQTL 3G6AB 4WTWA 1NCBH 1VDGA 3BPLC 3WEXA 5JXAL 3OL2A 1QG3A 4LLWB 5JHDE 4OBSA 3VFWB 3WD5L 3O3EA 1I4FA 2ZOLB 1MRDL 1ZAGA 4U1HB 4M1CD 3HI6H 3WJJA 4F3FA 3P4LA 2ZCLH 4NGHL 3TT3L 4GMSL 2XN9E 4XI5D 1EGJA 4AT6A 4BH7B 3FT3A 3E2HC 3SO3B 1GGBH 2GK2A 4JFYA 2G75A 3BP5B 4FQLH 1Y0LA 3BMWA 4RX4A 3O2DH 4DW2H 1CXEA 4LRIA 4PG9A 2EKSA 4HW6A 5E1AA 1QRNB 3VXTA 1G0YR 3MGOA 1CDYA 1FAKT 5EU7E 2QQNL 3TYFA 4P2YA 3HE6D 3QJHB 2HFFB 4PJBA 3AM8C 4XZUB 5A40E 5DD0L 2DQHH 3V5DB 3EYOA 3VI4E 3WHXA 3B2VL 5T1MB 5JW4N 4M6MH 3IDMA 4U6TA 1ED3B 4P23A 3WDHA 2O61B 4NO5B 1WISA 3VXMA 2DLIA 1CVRA 3IS1X 5I73B 4YR6B 5CD3B 3MMEB 3QUMB 5CBAA 4KMTL 4OZHB 4OD1H 2VXTL 4PLOB 2AJVH 3LS5H 3TA3D 1O0VA 3BT2L 2Q1EA 1C5DA 5F44A 3HE6B 1N7ML 5LGKA 2LE9A 2QJDA 3MBEC 4G9FD 1UACL 3O45B 1G9EA 3D9AL 4X4MA 1JZ6A 4PJ5A 4PGBB 4OCYL 5GIRB 5KSAD 1SJVA 1ROWA 2E7HA 3LD8C 4FNLL 3RX7A 3T8XB 3C5SA 4MJ4A 5IFHL 3PQYE 3DX7B 3HZKB 5E03A 1CE1H 1A0QH 5JTWA 4YLQT 1OAUH 4ZOBA 1T21A 3VH8A 3DMMB 2NYYC 4E5XB 2UUDH 3B9KA 4FRWA 4LQFL 3TIDB 5J1AA 4UTAH 3G08A 1OF2A 1HILB 2M26A 4PJBB 4QXTB 1VGEL 5HYJB 2J6EH 3U36A 4KQ3H 3UCRA 2YC1A 4K23L 1KEGL 3WHXB 4XPTL 3DGCR 2OYPA 4MMXC 3ARGA 2MNUA 3D1MC 4PJHE 4IHOB 2YSSA 5I71C 3UPRB 5KSBE 4KK6D 3BISA 4LSPL 5K93A 1R0AL 3PWLA 4I8DA 3ROOA 4TNVF 3GIVB 4NZRL 4EZMA 3QDMB 5FAAA 5BOZG 3WLWC 4LLWA 3VFWA 3SEPA 3IGAA 4PJHF 4GQ9L 1ETZB 3EYQD 3HPJA 3ZSTA 2O5ZL 4PGBA 3BPOB 1RUML 3IVKA 1INDH 5J57B 1MLCA 2WWKT 2ZUSA 1DBKH 5CJ8A 1RHHA 1X6NA 3QHTC 5ALCH 5INDB 4NRZB 2XWTB 2F9BT 4L9DA 4O9HH 3IFNH 1TJHH 3FMGH 3PWNB 5C08A 4Y5YC 5ANMA 3LV3A 5AYQA 3MRGB 4YHPB 1HKLL 3RWDA 1T0NA 3W2DL 1KPVB 2FLRT 3PIQB 4N9GB 5EU5A 2PXYA 5C1MB 4ALAL 4QXTA 1KT2A 3ZKXC 4N90E 4DGVL 3WIHL 3GBMH 2PR4L 3B9KC 5I16B 2HJLA 4JY6A 2DMKA 1YNTB 3LRGA 1G7MA 2K9UA 3PABB 2ADGA 4KZEL 5JHDA 1T22A 5I8KL 4YBQC 1F11B 1YPZF 4OF3A 2FSEB 1T20A 4HS3B 3S4SG 4WO4C 2O61A 1MVFA 3S34H 3DXAD 3MLRL 1FE8L 3PXHA 4PG2C 4XCFH 4XNQA 2EKJA 1T6WA 5JHLL 1FG9C 1PG7L 3KJ4C 4HEPG 2JCCF 3W11C 4X6CE 4QTHB 4XWOC 1DTUA 4TPRL 1DE4A 4LCYB 4QHNA 4G6JH 4CMHC 4R3SB 4YFLI 5B22A 5KS9A 5MEND 1MFCH 3P77A 2AEQL 5D2NB 2MSPA 1IGFH 5LG1A 4MNQB 5DRNB 1F45A 1WK0A 1CD8A 1ZLVH 1CT8A 1TXKA 1PQZA 5JPMA 1OARL 5T3XD 1BVKB 1D6EB 5FB8A 4PJGF 3VJ6A 2PXYB 1A14H 1BIIA 2A73B 2R2BB 5FUCE 1LEIB 1W72L 4K8RH 4PJCF 3TIDA 3K74B 4ZSOB 2YRLA 2XPGA 1FFPA 1QACA 4JZJA 4JFFD 1G9NL 4OFYA 3VGAB 4ZD3L 4YQXH 1JWSA 3HE7A 4CADB 2D7PA 2QKIA 1QRKA 3A67H 3BH8A 5D93C 1KV3A 5CEYA 3GBLA 1T04B 3SE4A 3P0VL 3UTPE 2BDNL 3P9MB 5CINH 5C0IA 4HWEH 1QQDA 2YN3A 1QTYT 3ARBC 4WUKL 2DL2A 1GVIA 3O2VL 4TRPH 1MCKA 1PZUB 1FO0B 1OPGL 2IGFL 5CUSL 3BGFC 5J9PA 5B4MD 4XVJL 1F90L 1CGSL 3DTXB 4AEFA 1KTDA 2P5EB 4FQPA 2FR4A 3UZQA 3ARSA 4HAGA 3UMTA 1I7RA 5ITFB 1D5ZA 3HUJA 4HG4K 3MRDA 1SJXA 3RGVC 5DRNA 4BYHA 2HT3C 1A02N 4KU1A 2YD9A 4M6ML 5DYOA 1D5MB 5HDQL 2DQHL 2HT2C 2ID5A 1GH7A 1OB1A 4R26H 4H26B 1MUJB 3QZWA 1G6RB 4JZOA 4YBHA 4MDIB 1G7JA 1ZVYA 2OL3A 1FFRA 3MRCA 4IMKC 2ICWI 4UDTA 4K9EC 5E2VH 2H2PC 3Q2CA 2W9DH 2H6PB 3OKKA 4NOFA 5DSCA 1MRFL 5FA4A 3UTSD 2ATPA 3W0WE 2BHYA 4LEOB 3VRIB 1JP5A 4HLZH 1H3VA 5T1KD 3Q6FA 1QSFA 4G3YL 5D7IB 5GS0C 3D9AH 3WNOA 4ZFOB 4GRLA 4DZBA 3FRPG 1TZGH 4MA7L 1ORQA 4ERSH 3FN0H 3VWKB 3O3UN 1FNSL 2ESVE 1OP5H 1RY7B 1TITA 1GAFL 3DETD 3PGDB 5EO1B 5D7JB 1N6VA 2A38A 5EU4B 4NBYB 3LRSB 3QWRA 5D2NA 4WW2C 2MFNA 5F70A 4PR5A 4XC3L 3SE8H 2WUCH 3KPQA 3KNBA 2YZ8A 4QYOB 3K4AA 4NP4H 4ODXA 4D9QE 4LLUB 4TOYL 4XPTH 1NANI 4WI6A 4XPAH 3IS0X 3MRCB 3PWVB 4JN2A 4O2CB 3TJHD 4JFYB 4P59L 4JM2A 4Z0XB 4Z7QF 4RDQF 4S1DD 2E9JA 1KCVL 1S7RB 3S36H 5F88A 5C7XH 5BS0E 2VXQL 4MWFA 5CJXA 1E28B 2CO6B 3MCG1 5IG7B 4X9HA 4E42B 3PGFL 5CIPA 3EFFA 4K55A 4JO4L 2GSIA 1BJ1H 4OGXL 1HKLH 4DGYH 1Z5LB 2NTSP 3VWKA 3QUZD 2FNBA 5A43C 1KCUL 5CGMA 2RHEA 2YN5A 3RRQA 5JA9A 4M7KL 2PCPA 1EEQA 1RFDH 1XF2A 1MCSA 3U4AA 4R7DA 1YN6A 5CBAB 5L8JB 4ALAH 1C7SA 1DQQA 3SE4C 4L4TE 2YKLH 3U2SA 3V52H 5GS1A 3JZ7A 3GSXA 1U3HA 2PR4H 3QPXH 4KRPD 4YHZL 2D0GA 2DM3A 1CTOA 4HBQA 4WGVB 4U1IA 3DVIA 4WW2A 2ARJQ 1N6UA 3JBG7 5KVEH 2BJMH 5FV2A 1UGNA 3HB3C 4U1SA 4WHYG 3PV6B 1TVDA 1WBXA 4KI5E 1NC2A 3I6GA 4UUJA 3KPSB 5JLZA 4DGIL 3EO0B 5E6ID 1E27B 1E28A 1ZT1B 1NJ9A 4OLXH 5EUOE 2FGWH 3VWJD 2YEZA 4NQXA 2QADB 1YMHB 2WM0A 2IH1B 1D7FA 1UB5A 3SGJA 3MRIA 1MCBA 4GQPH 1MHPH 3MLYH 1ZHBA 5EU6D 3NZ8A 4PJFF 3OSKA 2ZOKA 4KMQA 5FO9A 1S78D 1JHLL 1T1YA 4UILL 4PJAE 2C3VA 4Q0XL 3OKNB 1VFAA 4WFGE 3VWKC 2X70B 3F5WB 4JCMA 1TTFA 4QXGL 5D7KE 2WAHA 1DQTA 4JFEE 4WI5A 4D3CH 1TZIB 1X3DA 5T1KA 1NEZG 5FUCC 2C5DC 4YQXL 3C60A 5FGRA 4U1IB 4WW2B 3GSQB 4EUPG 4I3RL 3K7UA 2J8UB 1EUUA 3D2UD 3IXTB 5H94B 1Y6MR 4HDIB 4G7VH 2I9LB 2BDNH 1EDQA 5IMOA 3CSGA 4GRWH 4IS6A 1XAUA 4NZUL 5ANMB 3QULA 2OTUA 2E6QA 1L0XA 1T4KB 1JHTB 2PTVA 4N8CH 3ZE1E 2W9LA 5FM4A 3BHBB 3ARWA 3T0AA 1G6RL 3DVNB 4TYUA 3U0PA 1UB5B 3RY5A 3SDXA 4JFOB 4IOFD 3I50H 4JVUA 4FFVD 4L8CA 4PJ7E 2A6IB 3CH1B 3RJQB 2E9IA 1U8QA 2BNRD 2ARJB 4JFZL 4M43L 3MJ8A 4KVCL 2VDMH 3ULUH 1RURH 2ZPKH 5LXGH 4DAGH 4J6RH 3ZTNH 2FSEA 2OQJB 1EHNA 4NKOB 5J13C 4OB5L 2AI0H 4NWUH 4O2EB 4KDTA 3T2PA 1NDMA 1TQCC 1NBVH 3RAJL 3MJ9A 4IDJL 3AUVA 3V0VA 1NGZB 1DBJL 4Z9KB 1EZVY 3FN9A 4FQXC 1LDSA 3RY6C 3KPTA 4DCQA 3TO4B 5I8OH 1GGUA 3X3FH 3S4SA 4GKNB 3MZTA 1UCBH 2E5EA 2R1WB 5BRZB 1NGWA 2F58L 5DRWA 2PN5A 3QXVA 4TUOB 3SCMB 1EAPA 4JFEA 2YD6A 1BOGB 3MLTA 4OV5A 2A0LD 1FYTA 2P44B 4KKLC 3C5ZA 1FNSH 3VFRA 1IZKA 1B0WA 3DUUA 1J1XL 1YYMH 3GM0A 1T0PB 3SE8L 3VFOB 1BQHG 3LSOA 3U1SH 4X5XA 4ORGA 3D69B 4OZIE 4N0CC 3KR3L 3LAFA 4LCCC 4K3EL 4JFHD 3QAZC 1QBAA 3SGKA 2UY6A 2GFBB 4F9PA 1QQDB 3WNLA 5SWSD 4ZFZB 1I8MB 4KXZI 2DBJA 4RFNC 2NY6C 4IRJD 3DXAA 4ZDHA 2X70A 4Z76A 3B2UD 4N0FA 1HH9B 4XPHL 1S7UB 4UTBL 4LU5L 3TBWA 1P4IH 4WJ5A 3SGJC 4RSVA 4HUWB 3S4SB 3DRQA 5ESQA 3FHQA 3DVGB 4FQJH 1AGEB 2VXVH 4WV1B 5HVFB 1B4JL 1T7WA 2Z31D 4LLYB 5DC0A 4KFZC 5SWQB 2Y7QA 1AC0A 5F3HB 3U4EB 1XGRB 5F7NC 3ARBB 3F7VA