5L6YL

Il13 in complex with tralokinumab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
YVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-13
publication title Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l6yL01
5EOCJ 1BQSA 3EYQD 4ODXB 4BZ2L 2Z8SA 1KJ2H 4WUKL 4CMMA 5TQ2H 2XICA 1SYSB 4JM2D 4XNYH 2Q7YB 1HINL 5I66B 3BKYL 5E6IB 4NO0A 5TDPB 1N7ML 5KSAA 4JFHD 2K7QA 1EO7A 3MSPA 3NCFB 2D0HA 1PKQE 1BEYH 1I7RB 3QXUA 3QB7C 3G6DL 3QEQE 5D7KD 3SQOH 2PO6B 1DDHA 3BKML 2ITDA 3QXWA 1U58B 4KK6D 5KVFL 3L95A 1ZANL 5GGTH 4HKZB 1XIWD 3NIGE 4QOKD 1I3GH 3D18B 4X99B 1F3DJ 5C8JB 1NC2A 1LO3H 2P8LB 5JW4Q 3HR5A 4M1DL 4RGMB 4YHYC 4JFFA 2IQAA 4MB3A 1AHWC 3MRNB 1UADC 3E3QE 4IMKA 1H5BC 5JOPD 1LK2B 1GC1L 1FL3B 2O26U 3TA3D 1XEDA 5T3ZE 1FZMA 3WIHH 1ZV5A 1T3FB 1A3RH 3TBVA 3MLSH 4Y5YA 5KG9B 3O9WB 1ERNA 2AXFA 5FUCE 4U1HB 3WUWA 5C09D 5B38B 5CHNB 2A6DA 4IRJD 4N1CA 4PB9L 4LCIH 4RGNB 1VGEH 1XF3A 3P11L 4LKXA 4JFEA 3PJSB 4QRRB 5C0DB 4XPGL 4GRMA 4UDTB 1TLKA 1D5BA 1FLRH 3QJHA 1I8MB 5GS2H 2WBJD 4NO5B 3U79A 2BNQE 5I2IA 5IT2H 3BYTA 4IJ3B 4RISL 1WZ1L 3QQ4A 2R1YA 3QUZB 3BHBB 4X7TA 2GHWB 1R5WB 2B4CL 4LLDA 3AS0A 1WVZA 2EH8H 3TT1L 2BJML 5H94B 4OZGA 2Q20A 4XMLL 4JQXC 3UAJC 2FH6A 4L29A 1HKFA 3QI9B 4B53A 1CE6A 3QEQD 5EU5B 2DTMH 2P42B 2NY5C 1NCCL 1UCBL 4CKVX 4Z76A 2FHBA 3O6KH 1CLOH 25C8L 3TO4C 1C1EH 2P8PB 4BFGA 3PP3K 4L4VE 4KC3B 5HSFA 5EN2B 4LCCC 3EW3B 5D2NA 4GS7C 2H32B 5C0GB 1E4KA 1GVIA 4U31A 2UZIL 2FD6H 3L3IA 5T3ZD 4G3YH 2AXHA 4P59L 2GK0A 1J05A 1K4DA 3UC0L 1YEJL 4OZGF 1E27A 3GHBL 3VFTB 5SX5H 3V5KA 3PL6A 1ZSDB 1FJ1A 4Y4HA 5JORA 1X5ZA 1PX4A 2F58L 3KR3H 4HIJB 43C9A 1HXYA 4ODTH 3VFMA 3QFJB 4KXZH 1D9KA 1YYLH 1G7PA 2J4WH 1NMAH 3BX7C 4U4BA 3C5SA 5D1ZD 3MCKA 2AGJH 2C1OB 1RJLA 4HJ0D 1VGKA 5T1KA 5L9DH 2Z4QA 2RGSA 3NN8A 4EKXA 4QRQA 2G5RA 2Y36H 4LEOA 5F71A 3V6ZB 1RUKH 5SX4I 1GC1C 1Q9OA 1JYVA 2H1PH 3VXNB 1NEZA 3HMXA 4P2CG 4XCEA 4DEPB 3ROLA 3QDME 4J3UA 1U41A 1QEWB 2FNBA 3B6SB 4I5BB 3DX8A 5KSBE 4U1SA 1KPRA 5HGHA 1RURL 1BFTA 3KPTA 1Y6KR 2EEBA 3QCTL 1UH4A 2Y07H 4P99A 4ZOAA 5AWNH 5JPNA 3VXRA 1DP0A 2R23B 2EE9A 2R0KL 4G80B 2Z31A 4L4VD 5FFLA 3BD4A 4NQCA 1LE9A 5EBLB 4ENED 4GUPA 3B2VH 4RX4A 4U1LA 4OZHA 5F7EH 5DFVD 3LHPL 2D9QB 4IM8A 4LLUA 2JELL 1NKRA 3WN5C 3PG2A 1UXWA 4PRPA 4P48A 1P69B 4IRSD 2QJDA 1FHGA 5DDHB 5LVEA 5JTWA 3HZMB 3OKKB 2XWBB 3WKML 3VE0A 4EDWL 4K3DL 2HVJA 3KPPA 4WO4B 5GJTL 5TF0A 3IU3A 4CW1B 3KPLB 4U1NA 3DMMA 5C1MB 3FHQA 2FL5A 3DRQA 3QRGH 2A6IB 3B8SA 4XNUH 1QSEB 3PQYE 1CGUA 2XXCB 1MY7A 5CCKL 4MNHB 1N8ZB 1S9VB 1KCVL 1W8OA 1X5AA 4OZHF 1I8LA 2ZKHH 1YEKL 3ZYJA 1DUZA 5IMKA 3TF7C 1T5WA 2C4XA 3ZTJH 5GGVL 1RVFH 3QDMD 1F8TH 4YPGA 1JZ8A 4PG2A 5T5FL 1MREH 5JHLL 1MUJB 3ALXA 3F58L 3PGFL 5TH2B 3GJFH 1TZIB 1T1WA 5IROC 5C0BD 3REVB 3BXNB 4G7YL 4ODWB 4F33A 4M8QA 1MHPH 2D7NA 1OP3K 4DKFL 5DRNB 1E4XH 4JDTL 4KU1A 1EGJH 4XP4H 2ZUUA 1FFOA 4C56A 2QHRL 5C0AD 1TETH 1G7HA 5GRXG 3VFPB 3WXVH 2HH0H 3EOYG 5GISH 4XMPH 2VITA 1UFUA 4JR9H 2ZG3A 2VZSA 1KB5B 3MRCA 1X5JA 4Y1AB 3IU4L 4GLRH 5FGCE 3OPZH 3FB6A 3UTQB 4AL8L 4LNRB 1EUUA 1Z3GL 1KOAA 3KPOA 3OSKA 3GIZH 4MDIB 3ARBD 3M17B 1F90H 1VEOA 2E9JA 2IMMA 3I9GL 3AXLB 4XB7A 3ZKMC 4R3SA 1FNAA 1WFUA 3MBEC 1C08B 2JJSA 4WJ5B 4Q6YA 4NKMA 3O2WH 4PRDA 2FGWL 4M5YL 1INQA 3O41B 4KDTA 4WWKC 5C0RL 3MX0A 3UTSE 2X4PA 2C1PB 5L2KB 3FO1B 4XH2A 1IE5A 5F1IA 3QPXH 3MLRL 3O9WC 3QAZB 2LU3A 1FFRA 4UU9A 1FC1A 4X4MA 3O6FC 3PQYD 2R0LL 3WDJA 4P57A 1FGVL 3BPNB 4X4XB 3X3FL 1V3JA 4KVCH 5DURD 1DQLL 3JZ7A 1ZWIA 5DO2D 2JLLA 3L9RB 5CEXA 5BRZD 1ZXQA 4MD4A 3KVQA 1HH6B 1TZHA 5I8KL 5LGJA 5FA3B 5E2TL 1GJIA 4MSWA 2XN9D 1TZGL 3V4UH 3DX7A 2HFEB 3SPVB 3IF1A 1EHXA 3CFIC 5A43C 1TJGH 4FFZH 3QUZC 4I2XB 1NBZA 2PN5A 4ZOEA 1CXEA 3RBSA 2BVPA 4L5FL 2ZUTA 3FFCA 4UOJA 3FOMB 3IXAA 5J13C 3GM8A 5DEGB 3ES6B 3MV9E 3QDJB 4G6JH 5D7LE 1NLDH 2Z8WC 4APQC 1I1FB 1CFTB 1CYGA 1JWUB 2VC2L 4MQ7A 5FHBH 4PJ9B 3KXFB 5CEYB 1FORL 3NVQA 3GBLA 4DW2L 1L7TL 3VDAA 4Y19E 3TN0C 1U91B 2VXSL 1P1ZA 2VUYA 5FUOH 2DQDL 3PHOA 1XCTB 4RFOH 3ZTJG 5DVLA 2GFBB 4PGJA 4RAVA 1IFHH 4JKMA 1A7RL 1OGTA 2B7DT 3PP4L 1N6QH 2MQCA 3UX9B 3C5JA 3UTSD 1AGBB 4CVZA 3OHXA 1DVFD 4KTYA 4WUUB 4F7CB 3TVMD 4JY4B 1MFAL 1M6OA 2FLRT 4OIIL 3GSRA 2AXGA 5DUMH 4P2OD 3O3EA 3EOBB 4YDIH 5AYQA 4ZUSA 3E6FB 3WJJA 1R5IA 3HUJB 3FOLB 2FBJH 3ZKNC 3PNWB 3OKOB 3AB0B 3B9AA 2O5ZH 4N1EA 2OP4L 5E70A 4K94C 5F8RC 4YDKH 4OGXH 3UTZA 1XF4A 3I6LD 3O2VH 2V2XA 3FCTB 4YZFE 1F6AB 3WD5L 3AVEA 2HWZH 4BH7A 4YHOH 1FNSH 4QWWD 2ZCLL 3SQBA 3LH2L 4NJ9H 4BYHA 4PJAA 3IJHA 5DWUH 4ZUWA 3MODL 4M93C 3IDJA 4N90D 3HI1A 2WP3T 2EYTB 5GRUH 5BS0D 3N1PC 1JUFB 3G9VA 3RWHB 5F7HA 1LD9B 1BZQK 1EDQA 3MV9D 4P4KA 3RGVC 4FQLL 5F7YC 2DQCH 3CVHH 2AEIT 1FAIH 1GZPA 1NGPL 2G9HA 2FB4L 4KKLD 3VMNA 4N0CD 5KZCD 3MUHL 3TV3L 2XWTA 4JHAH 3VWKA 4ALAL 1BMGA 2CXKA 1YN6A 1T1YA 4P5KA 3W5MA 4WRLA 2OL3L 1RUQH 2DQTH 3W0WE 4OIAA 1A9BB 3I6GB 3OAUL 4I3GA 35C8L 1CTNA 1FAKT 2ZOLB 4P3DA 2YA0A 1P2CA 1CLCA 2NLJB 2DQIL 4PJAF 4X8JA 1KJVB 1MJ7L 1YMMD 3MOBL 3C08L 4HFUH 1B6DA 3RIAF 2AP2A 1ZE3C 1GGCL 1MCOL 1Q9WA 4OBRA 3MA9H 4G9DB 4PPTA 4JFYB 5INCB 4OIBA 4LHUB 3QIUB 1T0NB 5F7FA 1JHKL 1XZ0B 3QUXC 3ULVE 4LMQE 3VA2C 2UZYB 2I9LA 3MRGB 1RUMH 3G5ZB 1PYWA 4WFHE 1BBDL 3SDDA 3GSXA 5IB1B 5JW3H 2EYSA 3P2TA 4Y4FA 1DL7H 5FO8B 1NAMH 5JR1H 2W59A 4LPWA 3HB3D 2CPCA 1UWEH 2JJWA 1MNUH 1P9MC 5ESQB 2BHYA 2ADJA 2UYLA 3GSNH 4JZJB 4XP6H 4YXKL 1KGCE 1KEGL 1H15B 1ZHKA 4LPCA 3MLVH 3PXHA 4QXTA 4NKQB 1A3QA 4XXDB 1T0MB 2X7LB 3MUJA 2A83B 5SWSA 5SWZE 4WEUD 1MCDA 4OLVH 2EDXA 4BQBA 1JN6A 3B9VA 2CIIA 3OKYA 1S5HA 5SWQA 1A22B 2YZ8A 4K3GA 3BH8B 3EO0A 1A6TB 2PTVA 3IDIB 4ONGH 3VXQA 5DK2B 4WEBH 5I1GH 4ZXBB 1AQKH 2A77H 5TGBB 1NGXA 4HUUB 4PJFA 4NQSB 3QFDB 3AS2A 1CICC 1KCKA 3CFBB 4MJ5B 5HJ3A 3LQAL 1BIHA 1FNFA 1RJCA 3X12B 3UDWA 2VLMD 2X9XA 2P4AB 4HH8A 3WLWD 4L8SC 2PYEE 4JFDB 3QDHA 5DR5L 3MRIB 3SBWA 1EHLH 1VERA 4L3CA 4MCYA 1KIQA 4YFEA 4ODHH 5GGSB 5DC9B 5MI0B 4FQ2H 2R56H 3CCHB 4YHLH 4JJ5B 2WK2A 2EC9T 1X5KA 4ZFOL 1OARL 43CAA 5DMKB 1U3ZA 3BWAB 3V7MA 2B8OT 4WFHD 3TNMB 1LP9B 5DJ6B 5I8CA 1KG0A 1FSKC 3THMH 3LB6C 5FYLE 1A7OL 1BD2A 3QAZC 2DIJA 1VACA 4M02A 4AY0A 1DBKH 1PQZB 2HKFL 4HLZH 3RAJH 1NGZB 4HJJH 4PJFF 2NYYD 4TUOA 2HTKC 1UM5L 1KCSH 2XRAH 1RUPH 3L7EB 2BRQA 2Q7YA 5CUSL 1ADQA 4PJDB 1OAUH 2FCBA 3I75B 5E6IA 4OCWL 2FEDD 5TFSL 5HYJE 5I18L 4Z18A 4LSPH 4R90L 5L8JB 3ULUH 4FQ1L 3B9KC 1BWWA 4Y5XC 1IM9B 1ZLWH 3S88H 3CFDA 1I7RA 3ARFD 4PJIE 5SWZD 4Y2DB 5FO7A 3ZE1E 3EJZC 2YUVA 2EDOA 1AO7E 5DHVH 1CGSL 2EDYA 3DOSA 1U58A 4LPXA 3MLWH 3N1MC 3QUYD 4HKZA 5D7SL 2ESVA 1PG7L 4X99A 4LAJH 1KJMB 4FTVD 1DE4B 2VH5L 4OAWA 1IZKA 1F6LL 3QCUL 1OD9A 3CPLB 2V5RA 3C6LD 4PJ9C 3P4MA 2Y6SD 1YEGL 4ZO7A 5BVPH 1LK2A 1U8OA 2OZ4A 4IMLA 1JV5A 2PYED 1ZA3B 4KUZL 1GAFH 1V5JA 2DD8H 4JRYB 4FQHB 3O3AA 4JQIL 3VWJA 1CT8B 4ZAKC 5T1DH 4PRHB 1HNGA 4NOBA 1ITCA 3A67H 3PJSA 1G7QB 1PEWA 1X7QB 5C0DA 4G8EA 4ELKA 1VCAA 1XGPB 5B22A 1E4WL 4HWNA 3S3SA 2B1HL 5SV3A 1TITA 5FYLD 1QSFE 4U1JB 3MNVB 1WUNT 2Q76B 3ILQD 1H3TA 1AKJD 3P77B 1U95B 5JIHA 1T6VN 3H7LA 3AUVA 3F7VB 3BHBA 4YWGH 1T7ZA 2NX5B 2WQRA 3LQAC 4ZPTB 2HA1A 1MCJA 1A4JB 2DDQL 3U82B 4XZUA 4OGYH 3OJ2C 4M62L 3C60D 4LCWB 4LSVL 1I1RA 2NY4B 3ZZ1A 1J1XL 3QI9A 1INEH 4HAFA 1FO0H 5EU5A 2FX7H 2N4IA 4NUJA 4WV1B 4M43L 4GAFB 3MYJA 1JGVH 1MFEL 2XQBH 2P8PA 3BGFB 4CDGC 5HVGB 2VXQL 3E2HC 5EN2A 1W0WB 3CVIH 1I9RL 1F45A 5F93C 5HGBB 1U8KB 5GRWA 4H8WH 1S7WB 4M7JH 5C0GA 4NQED 1KUMA 2A2QT 4Y8AA 1KT2B 1WBYB 3VH8B 4HKBB 4GFTB 1SBSH 2DQEH 1ODAA 4AJ0A 4KHXH 2XG5A 4HMEA 2AJXL 5D7JA 1OM3L 2WQ8A 3GJFA 1WBZB 3D3VA 1ZTXL 5E8DL 2WZPD 2DLGA 2Z93A 2HTLD 2Y5EA 4FP8H 2BOCB 1ZSDA 4LKCB 2Y72A 5DMIL 4HIJA 3NZHL 2JJTA 2OQJB 3RZCD 5HDBE 3D48R 3HS0B 4GQ9H 4KKAD 1NCWL 3WFZA 3QYCA 5I30L 5LBSL 5JQ6L 4OLYH 4LHUG 4EUPB 1A6WH 1P4BL 3GSUB 1QSFD 1ES0B 2C1OA 12E8H 1TNNA 4R6UA 2UY6A 5I75C 5L8LB 4PD4K 1NFDB 3T2OA 3N1QC 1J0YA 5C6TL 1FFQA 3NIDE 1T2XA 2DQUL 3G9AB 3ISWA 4N5UA 1VPOL 2UUDH 3SDXA 4M6OH 2F8XC 2G60H 3NCJH 3O4OB 3UTTA 5IFHL 4OCRH 1X5HA 3IAGC 2DWDA 3B83A 4YGAB 3D85D 4I5BA 1J8HD 4HS8H 2BVOA 2ATKA 3HNSL 4X98B 3G04A 3FAWA 5AYUH 4LVEA 2IBBA 4P23D 5D6DC 5MENE 5C07D 1D7FA 5D1XA 4G80A 1IGCH 3RHWK 4YHIB 4JPIB 1YEDB 4NHCL 1P5VA 4ZO9A 2XZCH 4NIKB 5HHPB 5D6CB 4ZSOB 1E28A 3HRZA 2NTSP 4ONFL 1MI5E 4WDIB 5E4IA 3NCBB 3P9MB 5DDHA 2NY0D 1FZKA 2ZCKH 3BZ4B 4Z9KB 4F7EB 2EIEA 1S7QB 3SDAC 4KV5E 3SDXF 2DQHH 1KULA 4TQEH 1AC6A 4HS3B 4CW1A 5B39B 3BIAX 3O4LB 1IC5H 4P5TB 4PJ5E 3H9SB 2IPUK 3QNXA 3FO2B 3S97C 4Z7OF 1CD9B 5GZOC 3T8XA 4PUBL 3AAZB 2A6IA 4KPHL 2XY1A 1I8KB 5EUOE 4NN7B 2SEBB 5IG7A 1N8ZA 3X17A 1S9VA 3P4LA 4OZIA 1L0QA 1JZ5A 3ZKSD 1C5BL 3BRGC 4OT1H 5FOJA 1J7VR 1ZHNB 4N8PA 4UDUA 3QIBC 3HZVB 2CUIA 3D39B 2P5ED 5JHDD 1TZIA 3REVA 4QRPE 4H88L 3BXNA 5JXEC 3TWCH 3BP5B 1IAOB 1R3KB 3B43A 3LIZL 4NWTH 5F96L 3U30B 1A6VL 3KJ4C 2Y25A 5MEND 3DI3B 4KK5C 2HLAA 5LGHH 3JWDL 1NCBH 3CK0L 4OZFB 2W65A 1FCGA 3U0PB 3KPNA 3O0RH 4A2LA 3AS1A 1KB5A 3HAEH 1IC4H 5DK0B 1IKNC 5D71H 4OGZA 1MI5D 4V1DB 5LAXB 4LNRA 5L7XL 3IKCB 5F7KC 4ZUTB 4OZIF 4JREC 1MIEH 3BN9C 4HWBL 3M17A 4A2MA 1NCAL 1SMAA 2AJZA 3EJJX 3BEWB 1JK8A 1C08A 3CXHJ 5D9SB 4U3CA 4OCSH 4WJ5A 1UM4H 3GDBA 1G7IA 2X42A 2VLJB 4MJ6B 1KPVB 2ZOKB 3OWEA 4PJ5D 3ZKXB 5HTSA 3SKJH 4WU5B 3HI5H 2GJ6B 3NFNA 3VJ6B 5L2KA 4JVWA 3CVHA 2CGRL 2ENYA 2P49B 1KIUA 1PW3A 3P4OB 4PY7A 1TIUA 3OG6B 4P46D 1ZLSL 4EEEA 4TOYL 1R3IH 3OAYH 1X3DA 4HD9A 4IIQA 4ODVL 4JO4L 2I07A 5E94A 3AM8A 3UTOA 5J4MA 4JVUA 1A7QH 4GRWE 4QTIL 4UV7L 3BO8A 3L9RA 5EO9A 3H7BB 5C6WH 5EFIB 1T7XA 3MRDA 3O3DB 1HHGB 5EA0L 2EXWC 4Q9CA 2ZCHL 5FDWB 4GXVL 4BSWB 3G6AB 5ESAB 2X4OB 2HT3C 2IMNA 5F7LB 3W11C 4I2XA 4CVXB 1KTDB 4LPYA 1J8KA 1J5OL 3QULB 3ES6A 3QDJA 1TCRA 1LO5B 2DTSA 4UV4L 1QKZL 4IOFD 4YQXL 1JWUA 3L1OH 1KJ3L 1MCPL 1WWAX 4UQ3B 3FN0L 1EERB 3KXFA 4WV1C 3HCVB 4K8RH 4XMKL 2Z8VC 4LRNH 1JPTL 1MCIA 5K59F 4FZEH 3LY6A 4JFPB 4WGVB 4KKCC 3MOAH 4QNPE 5KS9B 3N06B 3NOIA 3UXFA 3QEUB 5C08B 1T5XA 4WNQB 3W2DH 5D1QC 4RMQA 3SE4C 4XBPB 3W81A 2D3VA 3TA3B 3DSFL 3FRUB 4KHTL 3MLYL 1EJ6A 2NZIA 3KS0J 3OBAA 3VD7A 2JTDA 2JB6B 1CQYA 2KZ1B 4F7CA 1S7XB 2VLLA 2WNGA 4M7KH 4YBQC 1F3JB 1RZFH 4GXUM 3E6FA 1AI1H 4PJGA 2Q8AL 4NCDA 5IHZB 3BP4B 3FOLA 5IM7B 1DQQB 4EUPG 4ZQKB 3OKOA 3PWNA 3BSZL 5DUBB 3NFPB 2FECL 3KYOB 5IVNA 1O0VA 4NO0D 3LEVH 5KSAD 1KJ2L 1FGNH 1PGRB 5J6GB 4U6XB 1MRFL 1OGAB 1YPZE 3BQUD 5TQ2L 5HYQB 4XNYL 1GGUA 2NXZC 3GBNL 1KYOK 3HR6A 1A14H 2GYSA 1SYVA 3SCMA 3B5GA 3C5ZD 1S9WB 4QRUA 3OB8A 1YY8B 3SQOL 5E5MB 4R2GC 1JUFA 4P0DA 5CP3H 3RWHA 2Y9RT 1LD9A 4PP1C 2AXJA 5GGTL 1PKQB 1I3GL 3QUKB 3HPJB 3FL7A 1WT5C 3KYKH 3QEQB 4PLKD 4XT1C 1LO3L 5E4EC 2KQNA 4U0RB 4PJGF 3S37H 2PF6A 3S3PA 1N5YH 2Z92B 1CZ8H 3O45B 4TPRL 2X40A 2BMKB 3RTQB 1HKLH 4R0LB 4F37K 3S3JA 1TVBB 4OSUH 4YHPA 1R3HB 5ALCL 5HGAB 3WFHB 1AR1D 3WIHL 2ZSWA 1A3RL 3MLSL 1CF8H 1UWXH 1ZT4B 1RAMA 1H8OA 2NZ9D 1A9BA 3LDBC 4YE4L 3U7YH 4NZRH 4JFED 1ZVHA 2VSDA 1BJ1H 1H9VA 3AU1A 4LCIL 5F3HB 5H35B 1VGEL 1KJVA 1Q9LB 2VDRL 4L1DA 2BY1A 2X4UB 5C3LD 3CC5B 2PXYC 1QP1A 5ITBH 2YBRB 5DHVA 1FLRL 3QHTC 2CDFB 4H26B 3IJYB 3GJEB 2ZUXA 4LHUA 3GSOA 5IT2L 1T0NA 3UTPE 2RHEA 1XZ0A 3O3UN 4P5TC 3RWGB 3DGGA 3RVXC 3MRGA 4Q0XL 3AREA 3G5ZA 1XGUB 3I6KB 5MEQB 1ZHBB 4P2RB 5D1ZB 1YEHH 2BNQB 2DQFA 3F7YB 1U8HB 2EH8L 2FWOB 4TUJB 4KKNA 5FO8A 2ZJSH 4HIXH 3O8XB 4MXQC 4I3SH 4K3HA 2DTML 5ESQA 3WNOA 4XI5C 3MLTB 4JEGB 3ZTNL 4JZJA 4P4KC 5I1JH 2NY6C 5ILTH 3CFEA 3O6KL 1CLOL 1DN0B 4HPOH 3PWPB 4XXDA 1T0MA 2X7LA 3LV3A 4UT7H 1C1EL 1MCWW 1S7UB 2A83A 3ZSSA 4EOWH 5EU7E 4F7MA 4E9LA 4LLMB 4OZFG 4HZAA 3U30C 1HHKB 4NC1C 2ORBH 1A6TA 3QJFA 4L4VB 2FD6L 4ZXBA 3T0EE 1KXTB 4R97C 5TGBA 4F8TA 4HUUA 2VR5A 3G5VB 3T04D 4LSDA 3MRKB 1HYSC 3VG9B 1DN2A 4NQSA 5CMAA 1FDLH 1JL8A 1YC7A 4AEFA 1TPXC 3P0GB 5FDYA 4MJ5A 3CFBA 3X12A 4D9QD 4DFHA 4I77H 4IRSB 3PHQB 4JFDA 5F70A 5IBLD 3U4BH 4HGMA 3MRIA 4LASH 4C83B 4ODTL 1RU9H 2F53E 1KIPA 3HPLA 1MAMH 1ORSB 5HHMB 3CSBA 2X6MA 1YYLL 2J4WL 3T3ME 5GGSA 1NMAL 4MWFB 5FYJE 3CCHA 3MV7E 3WS6A 5ANMA 4DZ8B 2AGJL 3MJ8B 4UILH 4WI3A 5C6PB 4Q9QH 5L9DL 2DF3A 4HV8A 3BWAA 3Q2CA 1QYGH 1LP9A 3TNMA 4PRIB 2Y36L 3BDXA 2DWEA 3JVGC 4LVOB 1B2WL 2H1PL 1OP5H 2CLRA 4OF6A 4D0DA 4XWOD 3TZVD 4D94A 3OJDA 1A9EB 4XP5L 4JCMA 1OF2A 2R8SH 3FQXA 1G7JB 1YEFL 4Q2ZB 3DBXA 3ZT5A 3RVWD 4PJDA 3QDMB 3L3JB 4XRCB 2P5WA 2Y07L 1MIMH 5TDNB 4Y4KD 1WLHA 3L5HA 4HCRA 4HF5H 5AWNL 2HJFB 4POUB 3CDGA 4XGZB 1IM9A 3ZO0A 4RX4D 5KSBB 3PWLB 1QLEH 4CJ0A 4L9DA 1Y6MR 3V5DB 3RVUC 2ZUWA 3B2VL 1QHPA 5F72S 3TIDB 2YN3A 4TVPE 5F7EL 3CX5K 4OF8A 5I1CH 3TBWB 5EORH 3T0ED 1YNKH 2NY1D 3QP3A 5FGBC 4QLRA 4Q58C 3SJVD 1DE4A 4OZ4B 4CADB 3ARDD 4YXLH 3RY6C 1KEMH 1K2DB 3ZDYF 3UDWC 3JV4A 3DMMD 3K4AA 2I25N 3M45A 2IAMB 2ADGB 4HUWA 1U6AH 3WO4B 5J9PA 4MXVF 1P84K 1RMFH 3FFDB 4XBEH 5CBAB 3ROOA 3WLBB 3VI4F 1BQHB 2NR6C 3MPCA 2YA2A 5HGGS 2F53D 1QFWH 4PJDF 2HVKB 4FQHA 3ZHDA 1LK3H 2FATH 4GBXC 1H0DB 2V7NB 3L3KB 3QRGL 1BX2B 2VAJA 5FYJD 4XNUL 3MV7D 4PRHA 3FT2B 5IB4B 5IBTL 1JP5A 1WBXA 1KCUL 5I1EL 1JHTB 3TT3H 1F11A 4X5XB 4HLJA 1XCQA 4H0HB 4BQCA 5CEZH 4Z0XB 3SGEI 4JRXE 2ZKHL 1QRKA 1VDGA 5ISZB 4U1JA 3Q6GL 2H9GB 1EPFA 4S1SH 1M05A 1RVFL 4KTEH 1MREL 1DQDH 3HZYB 5HDLA 3LKSB 3Q5TA 1U95A 1EXUB 1PVHA 3ELAT 4QCIB 1MHPL 4ZPTA 1F4YH 1A4JA 2H41A 2ARJB 1NCTA 1E4XL 5EU6A 2OTPA 1EGJL 4XP4L 3IXTA 1IGMH 1FYTE 4PIRF 1TETL 5EU3A 4PJHE 4HH9B 5KVDH 2E7BA 1K6QH 1JF1A 2HH0L 3T1FB 1A7BA 5GISL 4XMPL 4P4RA 1AP2B 4JR9L 1AC0A 2E27L 3PE9A 1HEZB 5J3HC 3BP6B 5CKGA 4TVPD 4BELD 1S9KC 5E2VH 3DRTB 4JCLA 2F74B 1ED3B 1IKFL 1JTPA 4ISVA 4J8RB 2AI0H 4UI2A 2CLVB 3VXOB 4A6YH 4GKSA 1U8KA 3HE7D 5I1HH 4LF3B 1S7WA 5FGCB 3EYOB 1T6WA 1KT2A 1WBYA 3K2UH 3BVNA 4HKBA 3I85A 1B0RA 3OKEA 5CD3B 4G7VL 4NN6C 1CDBA 4NNYB 3O2WL 5H8DA 1JBJA 1EO5A 2N7BA 4WW1B 2Q3ZA 3VWJC 1WBZA 4KWUA 2VOTA 4QKXB 4AIXA 2QADC 5DSCB 3QPXL 2BOCA 4L8DB 3PABA 1A1NB 2E6JA 2HLFC 4LEXH 2OX5A 4NYLA 4G6KL 5CJ8A 3UTSB 1ZK9A 5IQ7H 5IKCB 2CDGB 4RMRA 1DVFB 2W9DH 3HS0A 2HT2C 4DZBB 4DUVA 4GMSH 1EFQA 3L3GB 1KB9K 4KVCL 4EUPA 4JRXD 3WHXB 4P2OB 4D3CH 4WIQA 5JOEA 3GSUA 4M7LT 1ES0A 5JDSA 1R0AH 4PGEB 1MCRA 3KG5A 2VXTH 3RUGA 3L3HB 5B8CB 3OR6B 4N0UE 4F7PB 2HFGH 1JRHH 3HI6L 4PJ8A 3VXSA 1TJGL 4FFZL 4KKBC 2D03H 4D0CB 5HI5C 2XV6B 5I0DA 1BREA 4XWGH 1T7YA 2ATPB 4G6JL 5IJKC 1I1YB 1NLDL 1ORQB 2BNRE 2F54E 4HKJB 3T0BA 5FHBL 3NPSC 3LN5A 5DTFB 1J0IA 4CDHA 4H1LB 3BRFA 5D7LB 5KOVC 2MSPA 3CMGA 3PDOB 2MCPH 3TYFB 4AG4H 4YHIA 2OI9C 2FX8H 1FVDB 3LKRB 5IMOB 4AZ8A 2EE6A 3RGHA 2R29H 2EKJA 3S34H 5FXCH 1MEXH 5FUOL 2B0SH 4KVNH 4WDIA 4X6EA 5JXAL 2IJ0C 4Y19B 1IFHL 2VLKE 1UH3A 3K46A 1I7UB 5D7JC 4MB5A 3RUGF 1D6VH 2GSGA 1NUNB 2AEQL 1QPXA 3P9MA 1T83C 5AAWA 3MACH 5F7WC 4ZNEE 1Y18B 1RI8A 4I0PA 3KNBB 2C3WA 4LSSH 2LTQC 3JSSA 3NIFE 1S7QA 2DIBA 3MRFB 4RA0C 5DUML 4HS3A 2H2PC 4YDIL 3O4LA 4HMDA 5MEOA 5I6XB 5KJRH 4BH8A 5LG1A 2XQYK 1BFVH 1OLLA 2FBJL 5D2LE 3FO2A 1ZLUH 3SOBH 3UAJD 4KK8D 3GK8H 4L3EA 5BW7C 5IBUG 2O5ZL 2X9YA 4M1GH 2WW8A 3V2AR 4XVJH 1I85C 4OGXL 1I1AC 1XH3A 5F88A 2SEBA 3O2VL 3ARUA 1F4WH 5BZDB 1WAAE 2HWZL 4X6BB 2VMFA 2EDJA 1FNSL 5DEZA 4E0RA 4NJ9L 1ZHNA 5DWUL 1RIVH 5GGRY 3C2SA 5T3XD 5GRUL 1G9MH 3D39A 3VFGH 1MJ8L 4LVOC 3D2UD 4YDJB 4LSRH 4IOIB 1DBML 5HVHB 1IAOA 4NUGH 5IK3B 2F54D 1R3KA 3X11A 5DJYB 1FAIL 3QO1B 5T1LB 5HYSB 3IRZA 4JHAL 4ZFGH 2CKNA 3RY4A 3P0YH 2G75B 4OZFA 4L9LA 5JIIA 3T65B 3U0PA 5DJXB 4PB0H 2R69L 3U6RA 4EJ1C 3S36H 5TDOB 1OWRM 3P30H 4R9HA 1JI1A 5TE6L 2BXZA 2YD3A 2F5BH 1OAKH 4V1DA 2DQTL 5LAXA 5J11C 3QQ3A 3IKCA 3NACH 2F9BT 3ESUF 5JOFA 3BEWA 2PR4H 3RPIB 4FQXD 3U2SA 3VXMA 5DHYB 2IFGA 3W0WB 3QDGE 5D9SA 4MVBC 4LSQH 5A2JH 2FJHA 1V3MA 4HFUL 1BQHG 3MLUH 2XYCA 3MA9L 4DN3H 2W60B 2JB5H 2IAMC 2VLJA 5CP3A 1KPVA 3TBYA 3WO4C 1HSBA 4EBQH 1U8PB 1YNLH 4L4TA 4WU5A 2GJ6A 1CDGA 3VJ6A 3F7PC 4LARL 2ZUQB 3HN3A 3OKLA 3P4OA 4LGPB 1E6JH 1J88A 4Y4FD 4YBLB 4PR5A 2J7LA 2DL9A 3B8YA 3KPRA 4RWYH 3R8BB 5JW3L 3OB0H 4C4KT 1DL7L 1NAML 4LOUC 1T0PB 2WWKT 4MJIE 1UWEL 1CG9B 1MNUL 3H7BA 3P3YA 4DUXA 2P24B 5I17B 4LLVB 1UEYA 3O3DA 3GSNL 4JGUA 3ZDZE 4XP6L 3UBXB 5GGUB 3MLVL 5FDWA 1S9XB 5DJAB 3U0TB 3VXUD 4BSWA 2LVCA 1FIEA 2H8PB 1WITA 2X4OA 4I48A 1U3YA 4OFVA 5E00B 2AJ3B 1SY6H 1PZ5A 2EDTA 2QQQA 3QULA 1MLCB 1MWAH 5SWZB 4U2ZA 4WEBL 5I1GL 1AQKL 2W92A 2A77L 5DJ8B 3KLAB 2APWA 3MXVH 3GUTA 1XIWA 2CLZB 3HCVA 4RDQG 5GQBA 5IEKB 2PYFA 2R1WB 2P1YA 2BSED 3FN3A 4JFPA 3QXDB 4GXUN 2KDGA 5HI3C 5KW9H 4U2YA 4UIMB 3QEUA 1JYXA 5EZJA 2GITA 1P4IH 2ICWI 2E9IA 4XBPA 4DVBB 1EHLL 3TA3A 3JUYA 4QRRE 1O7VA 2DB8A 4ODHL 1SJEB 4FQ2L 2EC9U 4YHLL 2JB6A 4FFYL 4JM2F 4XCCH 1S7XA 4B7LA 1BD2D 3TIEB 3X3GL 3ARYA 4TNWF 5C09A 1W2KT 1F3JA 2GAZB 4IRJA 3AM8C 4NZJA 3THML 4WY7H 1GHFH 4E5XA 1DBKL 3KYOA 1L7IH 3RAJL 3UPRA 4HJJL 5E6ID 4FMFA 3CNKA 1KCSL 1UA6H 4U6XA 1OGAA 5HYQA 2RCSH 5CZVH 3MFFA 3O3BA 5DD1H 2R9HC 5EH1A 2LVEA 4KJPC 4LSPL 2PO6D 3J7HA 3MGTA 3ULUL 4UNUA 2FECI 1MCWM 3S88L 2Y06H 1CBVH 5GRYA 3TPUB 5E2UL 5E5MA 5HYJB 3ZKMD 2QSVA 5I76B 4OM1H 4HXAH 3MBED 1PKQA 3CZFB 4PJIB 3HPJA 3QEQA 4Z78B 1AO7B 3HTLX 3MROB 1QLFB 3EO1B 4LQ1A 4NJAL 5BVPL 2BMKA 3RTQA 3O9WD 4R0LA 3V6OC 1W72H 1RK1B 3CDCA 3ARVA 4PGDA 3WFHA 2YWYA 3NTCH 1YEEL 4BKLB 5F7DB 4NKDB 2FJFB 2DD8L 2I9TB 4QRRD 5T1DL 4PRNB 5FA4B 1EA9C 5H35A 3WIIH 2W0PA 3A67L 3RWJB 4I4WB 4HXBH 2X4UA 5HHOE 1V7MH 4NHUB 2YBRA 4YIQB 2XIDA 3IJYA 3QUZD 5E56A 2LABA 1RSFA 1S7RB 4JQVA 4WI5A 5I6XC 2BSRB 5SX5K 3RWGA 2E8YA 5IVZB 1QA9B 2FX9H 5E5UB 3VFWB 4M03A 4KZDH 3I6KA 4YWGL 3K1KC 3QI9D 5D1ZA 1GOFA 1IVLA 1QSFB 4WWID 5IUSA 3F7YA 4ZPVB 3UYOD 1U8HA 2Q86B 4TUJA 4M9OA 3SCMC 4TRPL 3CLEH 3SE8L 4G8GE 1HQ4B 4NSKA 1XMWA 1YECL 1MVFA 3LKNA 5HHVH 1INEL 2QKIB 3LS5H 1A47A 4HIIB 4LPVA 3TN0D 1FO0L 5DC0A 1FBIH 2FX7L 4M7LH 3C6SA 2GTZA 4JPWH 1UWGH 3TM6A 4JRWA 5HYSG 1JGVL 2XQBL 3DYOA 5D72H 2PETA 2X41A 4YPJA 2X44D 4LLMA 1G1CA 1K4CA 2EE2A 4JN2B 4M7JL 4FQJH 1DBBH 1AIFB 4DFIA 2OCFD 3MO1A 4L4VA 2DQEL 4S1DC 3JBG7 1RD6A 4KHXL 3G5VA 3MRKA 1ZAGA 1I9EA 3GSWA 2YEZA 2WINB 3BKCL 4U1MA 3ULUC 4FP8L 3WFBH 3QFJD 3SDCC 4IRSA 4Z7VB 4ZS6C 3GI8H 3U9UB 2F19L 3DECA 3HAEB 2EDDA 3O11A 2KQMA 2BSSB 5IW1A 1T2QH 1T03H 4OLYL 4DJMA 1A6WL 4Q9RH 4MWFA 4AM0A 4DZ8A 1WZMA 3DTXB 12E8L 3AREC 5E1AB 2YPLE 1OL0A 1G6RH 4HIHB 4ETQB 3W5NA 2Q7NA 3JV6B 1XGQA 3LVEA 2XI9A 1Q38A 4D8PB 2ZUQC 4A6YA 4KXZI 4WEMB 3VRJB 1MCEA 2Q6WB 2X4SB 1D5ZA 3A6BH 4G8GD 4WU7B 3NCJL 1A9EA 4C54A 4OCRL 1H8NA 1DSFH 4Q2ZA 4HS8L 1WWBX 1FNGB 3VGAB 1V3LA 1CTOA 1TVHA 3BDBA 1D5IH 3QDMA 4O4YH 4IDLA 4JAMB 2QSCH 4FFWC 5DJCB 2HJFA 4OKVB 5C0BA 1U8LB 4XGZA 2CMRH 2UY7A 3SGJC 3NAAH 2XFXA 5KSBA 1IGCL 1TQBB 3PWLA 1BOGB 2W0FA 2VABB 1EEUA 4PJCE 1MJJB 2XZCL 3V5DA 5BQ7B 4HC1H 5MENB 3ARGB 5C0AA 5EOQL 4PJBE 2CXGA 6FABH 4RWHA 3TBWA 3BN3B 1CFQB 4G42A 2MHAA 4R4NC 5KAQF 4WO4D 4MAYC 2ZCKL 3EFDL 4CN1A 1MHEA 3FB8A 1YNTA 3QUXD 4QT5A 4LVNC 2ADGA 4KJWD 1NUGA 2DQHL 4G8FB 4XPFH 4RA3A 3FFDA 3ARBA 3NZ8A 3WLBA 5D5MA 1IC5L 1BQHA 3MV01 2E3VA 2NY7L 1QSED 5F9OH 4Y8DC 5K9QG 1X5XA 1AJ7H 2HVKA 1QRNB 3X14A 2EDFA 3L3KA 2V7NA 5FM5O 3CSYA 4LLQB 5KSBF 3O6ML 1KV3A 5CIPH 4PJ5B 5IB4A 2C5DC 3EZJB 4NT6B 3PDDA 2NY3B 4UB0H 5JW4R 3JUZA 5TE7L 1YEIH 3FJTA 1P6AB 2FR4B 2ZPKH 3V79C 4K2UH 4JB9H 1NGYB 2HMIC 4OT1L 3WDHA 1Z0MA 3PQYA 4EI5C 4Z8FH 3F12A 4YHMH 2H9GA 4JLRA 1DFBH 1EH9A 3W9EB 1JHLH 4S0SD 5FOBA 5C0FB 4PD4J 1CU4L 2ZG2A 4YNYB 3FQNB 4OCXH 3UO1H 1G84A 1HK6A 3ILPB 3N1GC 5BRZA 4NWTL 4TNVF 2ARJA 4IBLT 5E8PB 4W4OC 4HUVA 2VRAA 5D5MF 3LEYH 2MWCA 1BZ9A 3V6FB 4ELMA 4QRPB 5LGHL 4HH9A 4X5LA 1NCBL 4Y1AD 4TSCH 2XN9A 2UVEA 4U6YB 3O0RL 3WUZA 1IC4L 3SGKC 3K8MA 1E4XI 5D71L 2WV3A 3DRTA 4Q6IA 4EVNB 1QO3A 1J18A 2XTJC 5D8JL 1C12B 5FF6B 1MIEL 4KQ4H 3VXOA 2CLVA 4P3WA 1YY9C 3NFSL 1XF2A 1WQVT 4ODBD 2X2YA 3EYOA 3I02B 2AS5M 1N4XH 4UQ2A 4W6WB 4PRBB 4OFDA 2C4FU 3GO1H 4GLRI 4OCSL 5IWLA 1ACZA 5CD3A 4NNYA 2COQA 2AK4E 3LB6D 2YPVH 4HKXB 2HN7B 4WW1A 3LZFH 5D96B 3NPZB 3TBTA 4XVUD 4YDLB 2JKXA 4N0YH 3SKJL 2VIRA 3RX7A 4XNQB 1CCZA 5DSCA 2YSSB 1JGLH 4ELMF 2DMBA 3Q48A 4KK9C 1TFHA 2PTTB 3UTSA 3ABZA 2CDGA 1DVFA 1AE6H 4NPYB 3TVMA 3RDTC 5E8EB 1A7QL 3WHXA 3P9LA 4P2OA 1OAQL 3EJZD 4DGIL 1BJ8A 4J7RA 1G7MB 5E8OB 15C8L 4RDQF 4GRLB 2VXVH 5ADPH 2YD8A 3L3HA 5B8CA 2GKIA 1X4ZA 1XGTA 2HFTA 4KRLB 1Y0LB 4LAQH 4PLJD 2XTLA 1JPGA 5DD6A 4ODUB 1FVEB 4J3WA 3MLXL 4PJ9D 5FCUH 2ED9A 1S3KH 2XKNA 2AKRB 4JFQA 1I1YA 3FO9A 1JZ4A 1ORQA 4I3RH 4RFNB 3ME0A 1J86A 5EO1A 3IDNB 4HKJA 3L1OL 2MKLC 1EVUA 1A6UH 3D9AH 3MV9A 5D7LA 4I1NB 8CGTA 1LNUB 3IDGB 3TYFA 3U7WH 1FVDA 4LRNL 3LS4H 2AQ3A 3LKRA 2ED8A 1AH1A 4FZEL 4OCNC 1F13A 4HK0B 4IHOB 5EU4A 5INDB 5CBEA 4Y19A 3W2DL 4WUUD 4AYFA 4HX1B 5F89A 2DM7A 3CFCH 5D93B 3S6CA 4FXLA 3BW9A 4YUEL 2MJWA 4HWEH 5C9JB 3D0VA 3MRFA 3QHZH 3BMWA 4M7KL 1QUNA 1RZFL 2AW2A 2ID5A 1AI1L 2CRZA 1IBGH 1YMMA 1H3XA 5M7QA 5JO5A 1P6FA 2M2DA 1HH9B 2VB5A 3WJLC 3ZE0E 1KF9B 3LEVL 4N5EC 1FGNL 4X0KB 2QSTA 4JVPA 3A6CH 1K85A 3GMNB 1MFNA 1UM6H 4PJ8C 2GUOB 3CJJA 5GRVL 5BZDA 2AABH 1OPGL 1A14L 1TQCC 4X6BA 2FSEB 1NGWA 1E6OH 5ICXB 1YPZB 4V2BA 2J6EL 2OMBA 3UZEA 1LEKA 3GM0A 5IMLB 5D7IE 3MLZH 4YDJA 2K9UA 4Y5VC 1LEGB 2X4QB 3ARWA 5DFTA 4GKZB 5IK3A 1X6NA 3QO1A 5IB5B 5HYSA 2IQ9H 4POZC 1XGRB 2I60H 3S37L 2R0ZH 3MRPA 2CDEB 1CZ8L 2G75A 1RUAL 3TCLB 1LE5B 1QVOB 3BT2H 1UH2A 2H2SC 5DJXA 2E9WA 3DVGA 5TDOA 1BQLH 2C7UB 5FECB 5DT1H 3TPKA 1FPTH 2ZWLT 1S7VB 1CF8L 1WGOA 1II4E 1UXSA 5EOTB 3U7YL 2ICCA 4I0PC 4NZRL 4YAQB 4XBGB 1SJHA 3QWOB 4LSUH 2X4TB 3E1F1 5DJ2A 4YBHA 4YZFF 2XA3A 3QIUD 1LEIB 2D7QA 5MERA 4FMKA 5ITBL 2W60A 4J1UB 1RHHA 4NBYB 1U8PA 1NL0H 3T3PF 2DLTA 5GSRB 1UJ3B 4W68A 4K8RC 1UCTA 2NXYC 3VXRE 1YEHL 4HWUA 1OTUC 2EZ0D 2VDPH 3DLQR 3A6OA 5GZNC 1A1OA 4NQCE 2ZJSL 1AD9B 3QG7L 4HIXL 4PBXA 4DTGH 1UYWH 1CG9A 3VI3E 1BVLB 5DS8B 3SDYL 4XX1E 4LLVA 5I17A 2V7HB 4XP1H 4Y2OA 4PRPE 5GGUA 1FRGH 5DJAA 3V5HB 3JTTB 3U0TA 4HPOL 1ONQA 4ORZC 2H8PA 5K33A 5ID0A 4UT7L 2VDLH 3GRWH 4LLWA 1NAKH 3VCLA 3KYNB 1D5XB 7FABH 4L9LC 5KSUB 3TESA 1MLCA 5CAYB 4KZEH 3OR7A 4ORGB 3ARFA 2ORBL 5SWZA 1MVUB 1UQSB 1A0QH 3QNZB 5DJ8A 3KLAA 1OCWH 3QUYA 1ZLWK 1C7SA 4J3TA 3GIVB 5I1DA 4K7PY 3WS3B 3ULVF 2R1WA 4WW2B 4HS6A 5TQ0L 4WHYH 3QXDA 4I77L 2CRMA 4YGVB 5F6IC 5IHBA 2J3SA 3E6HA 3T2PA 4AENB 4WI7A 3ARDB 3U4BL 4LASL 3S98A 3UZVB 3HC0A 1VFOA 2DI7A 2HYMA 3S96B 5EWIL 5AAMA 2PYEA 3QIBD 3T4AB 1L6XA 1ZVYA 5I74C 2F53B 4UILL 1JPFA 3PWVA 4KI5D 5JXED 1EEYB 1QYGL 4X83A 2GAZA 1PLGH 7CGTA 3BPOB 3MV7B 5E99H 4X7SL 1B3JA 2E7LA 3MMEB 2NX5E 4NGHH 4BSVB 5AG8A 2LAGB 5CWSB 4P3CH 2EYRB 1EUTA 2R8SL 2EECA 4Z5RA 1KLUB 4W81A 1IM9D 4OLWL 3EYQC 4Q9BA 4Y2DD 3N0PB 1NDGB 3DUUB 4HF5L 3F7RA 5HGDB 4JM2C 5LXGL 3I3DA 4AQ1B 4OV5B 5AZ2H 5I19L 2LQRA 1EV2E 4QXUL 3TPUA 5I76A 4JDVB 3C60A 3BZDA 1U3HB 4F58H 3UCRA 2R2CA 3DVNB 4PJIA 3X13B 1S7SB 3KLSA 1AO7A 4KK6C 1YNKL 4MX7B 1XIWC 1QLFA 2BDNH 4JGJA 3EO1A 3CGTA 4WI8A 1KXVC 1KEML 4X4ME 4MYWB 2AVGA 3FMGH 4Y16B 3HMXH 1U6AL 4MAUL 5B3JE 3K1DA 4JRYD 1MCBA 1RMFL 4XBEL 4BKLA 4NKDA 1QFWL 5HD8C 2I9TA 1LK3L 3GEWB 4DGVH 2FATL 1QNZH 3D6GA 3C9NB 1OP9A 1FN4B 4PRNA 2EDKA 2A0LD 4I8DA 2UWEA 2BC4B 1SVCP 2QQKH 4I4WA 1CL7H 1HXMA 4I0KA 3BWUC 1PJ9A 1W0VB 1W8NA 4HBCH 5CEZL 5FM4A 2C26A 2HT3D 4WFEE 1HOCB 2FIKB 5FM8A 4TULH 2VDMH 2NX5D 4S1SL 2I27N 5L0QC 1NBYA 1M7XA 5FGSA 1DQDL 2WBJC 1NANH 1QA9A 3VFWA 4LCWD 4PGBA 2NY4D 4R7NA 1FZOB 3FQWA 1QSFA 1QLRA 4WHYG 2A38A 3SE9H 2JJUA 2NY2C 3RWIB 3VD4A 1IGML 4HWZB 1RY7B 2QKIA 1RIUH 4HIIA 1K6QL 4XCYB 1HE7A 4JO2H 4U1IB 4XPTH 1SEBA 4KKCD 1BZ7A 2DLHA 1AHWB 2HJKB 1FYTB 4QHLB 4PJHB 2FLBT 5E2VL 1X44A 3N9GH 3VFNA 2UWEF 3D85A 4Z7UA 1J8HA 4ZSOE 1K8DA 5CIPA 2H3NB 1BF8A 2UUDK 3MRBB 1N0XH 1J0ZA 1CE1L 2AI0L 4JN2A 4A6YL 1T66D 5I1HL 4JO1L 3VFSB 1AIFA 3RNQB 5MHSE 1FE8H 3HMWH 1MJUH 4MXWH 4WHDA 3K2UL 4WHTB 3CX5J 2VL5A 1T2JA 3ARPA 4G6MH 1FFNA 1HWGB 3HG1E 3OQ3B 3TNNA 5DZNA 3TEUA 1FG9C 3MNWB 4J3VA 2WINA 3H9SE 1M71B 3V0AC 1RJYB 5JA9A 4LEXL 3U9UA 2OYPA 5I9QC 5IW6A 3QO0B 2BSSA 4PJAE 4GMSL 2XT1B 4FNLH 3MUY1 1KNOB 4K23H 4JQVC 1QFPA 2VISA 4XVTH 4Z7UF 4D3CL 4J2XA 3BIKB 3BH9A 3DTXA 1W0YT 4PGCB 3LOWA 5ERWB 3VU2A 2QR0B 4Z95H 5JPMB 4NQXA 4HIHA 2VXTL 4OI7A 3JV6A 3IDUA 2E9BA 5IFAH 4HJ0C 2HFGL 2WUCH 2WLZA 4GKOA 2Q6WA 2X4SA 2V9TA 1ZA6B 3GI9H 1WEJL 3RQ3A 3EDEA 2D03L 4N0UB 3TO4B 4ZUUA 5H37G 5BMFH 3CH1A 4NC1E 4XWGL 5A2LH 4LQFH 3LEXB 4LCCB 3GGWB 4H5SB 4GS7B 5GGRB 5C7XL 1HHJB 4JAMA 2ERJC 4BFIB 1IEHA 5DJCA 3PXJA 4JG1H 3HLAA 4HGWB 3D2UB 4YO0B 3WCYA 1JNHB 3R06B 4AG4L 2BNRB 2F54B 2VABA 4F7TA 1FL6B 1MJJA 3DYPA 2R29L 4RMUA 3S34L 5MENA 1MEXL 3L5WA 3PHSA 4PYHA 4OLZL 1BFOB 1CWVA 4ENEC 2UZXB 2AK1H 5HDBF 4CMHC 32C2B 5A3IC 4BZ1H 2PXYD 1CFQA 2OK0H 1FP5A 1D6VL 3P4NA 4PV9B 2BK8A 3D5OF 5E24E 3HG1D 1DQML 3DV4B 1KTLB 3O4LD 4HIEA 3MXWH 1MI5A 3EYFB 4P5TD 1E4JA 1HDMB 2VLKB 3V95A 4G8FA 3H9SD 3RVXD 2DQGH 4UTBH 5DJ0B 4YXHH 3L6FA 2D4DA 5KJRL 3NIDF 3VG0L 5CLTA 3TFKC 3OJVC 1V05A 4K3EH 4N9GB 5F1SA 4FQCH 1KLGB 4NM4L 4J4PA 4F2MB 5JLZB 2EEAA 4H25A 4M1GL 1KTRL 1BBJB 4XVJL 4XI5D 4PJ5A 3IJSA 4NT6A 3TJHD 3BUYB 1S78D 5D2LB 4OJFH 4OBSA 2FR4A 1RZKH 4J12A 1NGYA 1F4WL 1KB9J 3VFRA 4P46A 1EFXD 3S5LB 4M48L 1J10A 1CVRA 1Z5LB 3EJYD 5EUOA 5F97E 1T20B 2X10A 4WI2A 1J1PH 1B4JH 4DGYH 5ITFB 5C0FA 3IS0X 4J23A 4YNYA 4K9EH 1NCDH 1AQDB 1SQ2N 3ILPA 3OAYK 4PJFE 4TYUA 1S7TB 1EJOL 3OJMB 3BE1L 4GAYA 3HE6B 5F3BB 4QRPA 4ZFGL 1IGFH 3P0YL 3WN5B 4Z7WE 4KV5F 2EDEA 1U8IA 3IRPX 3H42H 1HZHL 2GJZA 2YC1B 1KC5H 2DYPB 3F6IA 4PB0L 3S36L 3P30L 3B9EA 3CFKB 3OKMB 1CXKA 2F5BL 1OAKL 1XR8B 4MA3A 4MD0A 1C12A 3NACL 2BVUA 1WCQA 4FFVD 4IRZH 4R7DB 2WWMD 3GNML 2XPGB 3V4VH 3OXRA 2PR4L 3TP4A 3LRGA 2VLJD 5EUOF 5F9JB 3FO0H 3INUH 3ARBC 2A74B 4LSQL 4PRBA 2GJ6D 3MCLH 2A6JB 1CLZH 4X7EC 3RP1A 4DN3L 2JB5L 4CNIB 1DUYA 3ULSB 4LBEB 1JPSH 3QDGB 5GS0D 5CILH 5H2BB 5T3XH 3MA7A 2A73A 2YSSA 4PLNC 3BP7B 3H2WA 4RMSA 2CKBB 4RGOL 5E8NB 2PTTA 1GH7A 3MV8E 4RWYL 1T1XA 4GKNB 1YA5A 3BKJL 2CK0L 4NPYA 4WFFD 4C59B 4WUKH 3KPMA 1UKSA 2EDQA 2YRPA 2X4RB 4G9FE 2IPTH 3MRHA 4RNRB 4YEFA 3LKOB 4RSVA 5EC1A 1CGXA 5JW4M 5E8OA 3E0GA 2ESVE 2OR8A 4GRLA 1LDPL 4TUKL 3G6DH 4X9GA 5CZXC 3BKMH 1NMBH 1NSNH 3OTTA 4H0GA 4MJIB 1S9YA 4EN3B 3BQUA 4MA8H 2OTWA 3FRPG 4OM0L 2EXYD 1ZS8B 4S2SB 1SY6L 4ODUA 1FVEA 4YK4B 4WHCA 2O5YH 4M1DH 2CO6B 5GRJH 2AKRA 1MWAL 3C5ZA 2ITCA 2AJYH 5E08L 3STZB 4XNXH 5GRVK 2BZDA 4MCZA 3MBEB 3MXVL 5DQJB 3GSVA 2ADIA 1CFVL 1GYAA 5C2BH 4GBXD 2NTFA 3QG6A 1RZIB 3I2CH 2VDQH 4UT9L 5C08D 5IJVB 1A2YA 3LSOA 4WWKB 1EZVY 3S8WA 2V6HA 5KW9L 1H3WM 2IGFL 4HK0A 4IHOA 5INDA 1NGQH 5F9WB 1P4IL 9CGTA 1HHHA 3RNKB 1XR9A 2R1XB 1CFNA 3FONB 1VKXA 3O6FB 4GRWF 4LRIC 1PSKH 1FVCB 3QCVH 3DURB 1LHZA 4XCCL 3SEPA 4NQVB 5A2KH 3GRWA 1AGFA 1UKTA 1Z9OA 1QR1A 4RISH 3RL1B 1WZ1H 2OXGA 2Y7QB 1VFBB 2ICWJ 1HILB 3EGSB 3FT4A 4WY7L 1GHFL 3CMOH 1UWXK 2VDOH 2G5BA 1OGAD 2B4CH 4P2RE 2Q8BL 1L7IL 5CZKA 5TE4H 5DZLA 4JE4B 1MH5B 4AK1A 5HBBA 3JWOH 4X0KA 4XMLH 1UA6L 1I7ZB 4M7ZC 4UINH 1U36A 5CZVL 3WNPA 3GMNA 1DCLA 5DD1L 5DI8B 3WV0A 1U93A 5J13B 2GUOA 2LE9A 4N1HB 2P7TB 2FSEA 2X70A 1OT2A 1IL1B 2W9LA 3V52H 5ICXA 1YPZA 4APQB 2Y06L 1PKOA 4OD3H 1CBVL 3PWPE 1INDH 4XAKE 4OCYH 1TXKA 3GMQB 4QWWC 3LCYA 2AV7B 4OM1L 1LEGA 3PWUB 3PGDB 3BZFA 3TN0B 2CRIA 1NC4D 4OLEA 1CD1B 1AD0B 3RTQD 2UZIH 5CS7A 4D2NA 4P59H 2GT9B 2QADD 5B3NA 4KDVA 4LFHG 4CVWA 3VXPA 4X7CC 1LE5A 5I1LB 5C0IA 1W72L 5DD3H 1CDUA 2CKBL 1X9QA 1U2CA 2C7UA 4GAGH 1EHAA 3RWDA 5DC4B 1WIPA 3V0VB 1NMCC 5EOTA 1YC8A 3VMPA 4HUNB 4JPVH 1ADQH 3P9WB 4YAQA 1IC1A 1URLA 3GBMH 3WFEH 5J1AA 1DBAH 2VQTA 5HHME 3RVVC 3QWOA 1YPZF 2O93L 3WIIL 3U4EB 1KFAH 3GMRA 5C86A 4HXBL 3VRIB 3WDIA 1V7ML 1LEIA 2FYYA 1B6UA 1HIMH 3SDXE 2D7TH 3UTTE 4PRIE 4P2RD 4O2CA 1F00I 5I1AB 3RI5K 3V0WL 5GSRA 2NPLX 2WUBL 4KY1H 2BNQD 2YUWA 5HHOB 4NO3B 4O2EB 1C16A 5DK3A 5CJ5A 2FX9L 1DLHB 3RKDC 1ACYL 1BLNB 3ZSTA 4KZDL 1KPUB 1LO4H 3D69B 4M93B 2FGZA 1X5LA 3MRMA 3O8XD 2F15A 1RK0B 4LCYA 5BXFB 4ONHA 2OZ4H 3S5LG 4HEME 1ETZB 1H3UA 1AD9A 5E9DE 2A9MH 2VZ3A 3RGVB 4KJYB 3LS5L 5C0CE 3PWPD 3DSNA 4XAKD 4M7LL 5ID1B 2APVA 4PY8I 1J12A 4G8GB 3TZVA 4JPWL 1EMTH 1A8JH 1UWGL 2JCCE 2B1AH 3JTTA 4NRZA 3V5HA 5FKPB 1KCRL 1T1ZB 1PDKA 3BI9X 1I7TB 1XGYH 4GW1B 5D72L 5ADOH 2QQNH 1XFPA 4Y4KA 5J06A 3SKOB 4FQJL 1DBBL 4C55A 2DLFH 4ORGA 1SBBA 2QLVB 5CSZB 2AJSH 1UQSA 3HE6C 5HY9A 3QA3B 1FFPB 3BGMB 4BQ9A 4MDJB 2HFFB 2H2PD 3QNZA 1T04B 5EZLB 4K3DH 5E5RB 1BGXH 1NUDA 4XC1H 5I8EB 4Z7NE 3RJQB 2BNUB 3WS3A 4WW2A 3T0EA 4G43B 2R2BA 3SJVA 5HHMD 4JZOB 4NQDB 5JIPA 4YGVA 4OZIE 3GI8L 4AENA 1I1AD 3J8F7 1P7KA 3ARDA 4FABH 2BY0A 2VLRE 4WVRA 2VQ1B 1IM3A 1MCSA 3QUXB 1KELH 3WLWC 3S96A 4AMKL 5J12C 2C3VA 3ZE2F 1T03L 2EEDA 4X8XA 1CGWA 1KCVH 4Q9RL 1X5IA 4PRID 4OF3A 3T4AA 4HDIA 1AGEB 1PZUB 2F53A 3CXDH 3RWEB 5ISZE 1R3JA 4S11A 1G6RL 4M61B 4PV8B 1UACH 1EEYA 2H32H 1H3PL 5IIEB 1KIRA 5ACMA 1G9EA 4P5MA 3MV7A 4FQPA 4G7YH 2YPLB 3MMEA 3A6BL 5EO0B 4BSVA 5CWSA 3AC0A 1K3ZA 5FUZL 3V7AE 5E9DD 2EYRA 3OAZK 4DKFH 3RWCB 3T08A 5IFJB 1EZVX 2QHRH 4L8BA 1KLUA 2IALB 3CUPB 4WW2F 3BJ91 2NYYC 3KHOA 1AGCB 4O4YL 2QSCL 4IDJL 1OVZA 1ZHLA 4U3XA 2EKSA 5HXMA 3WNKA 2DBLH 5KVMC 2V2TB 2CMRL 4WFGE 4RAHA 3NAAL 5IHUH 3T77B 4QRSB 4OV5A 2FEDC 3H9HA 3OKNB 5F1KC 4MS8C 4EDXB 4D0BB 5HVFB 4HC1L 4JDVA 4EN3C 1Z3GH 1T89C 4AT6B 1CICB 4GG8B 4F9LC 3U7AA 3DVNA 1JI2A 4NC0B 4UMGA 4YK4C 1S7SA 1FZJB 4K94L 4MX7A 4PJCB 2XOTA 4F15C 2IAMD 2ICES 4L8SB 3T3MF 2DS4A 4E42B 1N3NB 4PJBB 2Q3AA 1RQ5A 3C2AL 5JZ7C 1ND0B 2YD9A 5J8OA 4Y16A 1F2XK 3MJ9A 4X9BA 3EOAB 4ZFFB 2DQJH 5FYKU 3C6LC 4Q74A 4O5LL 3HE7A 3P0VL 5K59E 2VLRD 1NBVH 4NFBA 5F9OL 1MCNA 1AJ7L 3ZT6A 5B38G 5K9KB 5IVXE 3FQRA 2YD1A 3DJ9A 1FGVH 5F9WC 3IDYB 3TGXA 1FSKB 2XY2A 4U1GC 5CKAA 2BC4A 5MEPB 5ISZD 2OL3B 1YEIL 3QIWB 3IGAA 2B5IB 3CFJB 2ZPKL 3EFFB 1W0VA 4K2UL 4JB9L 1QFWI 3TCXA 3H0TB 4Z8FL 4IOSD 4YHML 4D9RE 2FZ3B 4FG6C 3DVFA 3B9KB 4Y5XB 4I0CC 4JRXA 1UG9A 4OCXL 2YPKB 4GOSA 2GEEA 4HJGB 2OTUA 4MQXD 4LU5H 3UJTH 1G7LB 3RWIA 4TN9A 3LEYL 1LQSR 4HWZA 3FRPA 1OY3B 2J8UA 4XCYA 5DEFB 3V6OE 3C60C 4I18B 4U1IA 2AQ1A 2VR4A 4DW2H 5I1KL 2HJKA 1AHWA 5HI3D 4PJHA 5EIIB 2VXSH 1S8DB 2X4NB 2CIKB 1H5BA 4FN0A 4YHKL 4U6HA 2H3NA 3SY0A 4KQ4L 3EZ8A 4JKKA 2O61B 3DO7B 3OX8B 3VFSA 3BPLC 1WZKA 4U7MA 1TTUA 2ZUSA 1L6ZA 3NMEA 1JTTA 1U92B 4PJGE 4ZAKB 4WHTA 2EIBA 3GO1L 4UOW0 2G2RB 1MFAH 3I3BA 3OMZA 2YPVL 2XZAH 3LPFA 2OSLB 4YHZL 1YQVL 3KPSE 5BVJB 4QRTB 1A02N 2Z91B 2AK4B 1WTGT 5FM5M 3OGCB 2J8UF 3IVKA 3QUMA 4S10A 1MAJA 2HTLC 2R9HD 1AE6L 1IAIH 3QO0A 4CMMB 2IPUG 4WCYL 4PJHF 2AEPH 1KB5H 4U7SA 1YUHB 3HA0A 3RZCC 4QGYA 2OXHA 4I13B 4LVHC 4KKAC 3WD5H 3G5YA 5IR1B 5ERWA 2ZCLH 5HPMB 4JQXA 2VXVL 5ADPL 1HSAB 5HHNA 1IEAA 2YUZA 3O2DH 1DDHB 4PJ7E 3WSQH 1C5DB 3UPCA 2OBGA 1ZLUK 1UB5B 4LAQL 5E2WH 3GHEH 5EZIH 2JJVA 4YH6A 2BVTA 1NGPH 4Y7MA 1NC2B 4N0UA 5FCUL 4M9PA 3HR5B 4F57H 2E8ZA 5IP4A 2IQAB 4ZFOB 3EO9H 1ZLVK 1HHIB 3E2HB 4LCCA 3GGWA 4OB5L 4I3RL 5D7LD 4KUCD 4ALAH 4JJHA 4HG4K 5GGRA 1NH6A 1JRHI 4LPUA 4BFIA 3D9AL 1H8SA 4HGWA 3QHFL 3D2UA 4YO0A 1JNHA 1FZMB 1DTUA 3MGOA 3R06A 5IESH 3VW3H 4P23C 3TBVB 2F54A 3LS4L 4Y5YB 3ULUE 1FL6A 2XACC 2AXFB 4Y19D 4PTTA 4CVUA 5DVMA 1BFOA 2YUXA 1JZ3A 4YHNA 3V8OA 3O6LH 3MTRA 2BOBA 1XF3B 1MJ7H 4LKXB 3C08H 2CJUH 3IKKA 1MRDL 2MPAH 3CFCL 4YFLI 4ZYKB 4Z77A 3DV4A 1JTOA 1KTLA 4JHBA 4DAGL 1D5BB 3EYFA 3QJHB 1YDPB 5ICYB 2NY0C 3L5XH 2VLKA 3QHZL 5M94B 3OL2A 5DJ0A 4ZNEA 4E41E 3QSKB 3S9DB 3QQ4B 4FQXA 4X7TB 5I75B 4N9GA 1FC2D 5JUEH 3L7FB 1KLGA 1CDCA 3FB5A 2IANE 4F2MA 4LLDB 4G5ZH 2P43B 1RIHH 1BBJA 3K4DA 3VDBA 2BRRL 1R24B 3A6CL 3BUYA 5D2LA 4U1KB 5DMGD 2X1OA 1OB1B 5BV7H 3PGCA 5BZWB 3GKZA 4CUCA 2AABL 3S5LA 1E6OL 4Z76B 1Z5LA 3B5TA 3HFMH 5ACZA 1E0OB 5GS1C 4MNQE 1JNNH 5T1LD 1U8MA 5IEHB 1MHHA 1WAAA 3MLZL 1RULH 1UZ8A 4S1DD 1EAPA 2PKDA 3C87A 3T0AA 1S7TA 5GIRB 4KMTL 2IQ9L 4JY6B 5D7IB 1MFCH 1REIA 2I60L 2UV3A 4XHQA 3VXUA 2R0ZL 1C8PA 3NIFF 1K4DB 3WN5A 4U0QB 1A6ZB 3BT2L 2AJUH 3AFLA 4K71C 1PY4A 2OJZL 5LGKA 5JNYB 1E27B 3VGDA 1BQLL 2FIRT 5DT1L 3HRPA 3OKMA 3V5KB 1XR8A 5D2LF 3SDAB 3W0WD 5J1SC 4G6AC 5DR5H 3WHE0 4AIZB 4R7DA 3VFMB 5DQ9A 5A2FA 3MJGX 4LSUL 5J0BA 1G7PB 5A2IH 1A21A 5F9JA 2RFXA 2VL4A 1MFBL 1N5AB 3BMVA 4NRXA 3KYMB 4PS4H 3MCKB 1DBJH 3ZDYE 1RJLB 1IAKA 4XNZC 5T1KB 1WAAF 2A6JA 2Z4QB 4CNIA 5I16B 4AEIL 4LBEA 4MXVE 4QRQB 3QDGA 1NL0L 3IFOB 4YX2H 4UOW1 1TNMA 1Q9OB 3AY4C 4K55A 3BP7A 1T7WA 3ULVD 1NEZB 4XCEB 4MD5A 1FCCA 1UC6A 4PGZA 4GKNA 3QIBB 1UM5H 4OD2B 3IDYC 3MQIA 3FB7B 3Q3GB 4P46C 3SHSA 4LIQH 4FFWD 2VDPL 4U1SB 4Z0BH 5J89A 5HGHB 5IROA 4DN4H 1JGDB 2RIKA 2WAHA 1U8JB 3QIWC 3EKCA 4DTGL 5I18H 4R90H 1UYWL 2B5IC 4FQ1H 4ODXA 5JPNB 3VXRB 1WFOA 4KQ3H 1UKQA 3KJ4B 4MNQD 1SYSA 4NQCB 2ZUVA 4GQPH 4XP1L 5I66A 2A1WH 1FRGL 2EIZB 1KGCD 4GUPB 4PG9B 5TDPA 4MJIA 1MLBB 2XTJE 4U1LB 4OZHB 2YR3A 3CLFH 3H6JA 2VDLL 4X9FA 2O5XH 5FEBA 3NA9H 2YD2A 3LKPB 4LLUB 1ZS8A 2YRZA 5JDJA 7FABL 4MAYD 1UXWB 4PRPB 4R8WH 2PO6A 1BIIB 1Z9MA 5JW5B 1PX3A 3MUGB 4KZEL 3DNKA 2HJLB 4JREB 3QCUH 5EBGA 3UJIH 1ZGLP 3VE0B 1A0QL 1YEGH 1EK3A 3D18A 5C8JA 3STZA 4I18C 2IWGA 2P8LA 3MBEA 2XZQH 3KPPB 5DQJA 1OCWL 3WNLA 4KUZH 3MRNA 1GOHA 4XPHL 1RZIA 3UROR 4KJQD 1NDMB 1ZOXA 5IJVA 1FL3A 1LO2H 4WWKA 2FL5B 3DRQB 3EYSL 1T3FA 2ZNXA 3RNKA 5FO9B 2R1XA 5KG9A 3O9WA 4NNXB 1L0YA 3O6FA 4G8IB 3IT8D 4U1HA 1E4WH 1QG3A 5B38A 3RPKA 5GSVB 2CH8A 5CHNA 4K7FB 5I1IL 3ZDZF 1OW0C 1DUZB 5IMKB 1IILE 1T5WB 4QRRA 5EULV 2VZOA 5EZOH 4GAJH 4UDTA 3RL1A 1PLGL 4LP5A 5ETUB 2Y7QA 3RWFB 3EGSA 1QR4A 1U8NB 5FYKL 4GG6E 3CDYA 1I8MA 4NO5A 5ACLA 1CLYH 4M8QB 4P3CL 2DDQH 3DHMA 5IV2B 4LSVH 1I7ZA 4C56B 1NLBL 2W38A 1PG7W 2M26A 3QUZA 2NW3B 4JM4H 1KENH 1R5WA 1EEQA 4B0MM 5DI8A 5KSAC 1GSMA 2GY7B 5HYJD 2MQ0A 2VITB 3BQUC 1RZJH 2P45B 2P7TA 1QFUH 5H94A 4Y88A 4M43H 5FKAB 4K7PH 1IL1A 2XTJD 5AZ2L 4APQA 2R15A 3QISA 1MFEH 1YY9D 2GK2A 4QXWA 3GMQA 2AV7A 1AO7D 2VZTA 5C92A 3C5ZC 3KPOB 1I9RH 3D0LB 4F58L 3PGDA 2W91A 4IEFB 5CGYC 1MQKH 3TN0A 4R3SB 4MQTB 3KLHD 1CD0A 2R2HB 4BK5A 3TLRA 2BDNL 2YHGA 3BUTA 2DKMA 1NCNA 2V2WB 4IMKC 4NKMB 1Z0NA 2GT9A 2H32A 4PLKC 4PRDB 1INQB 5D1QB 3FMGL 3HMXL 4KK9D 4Y5YC 4FZ8H 4UU9B 4QXGL 4Z7VE 5CSBA 4QYOB 5KANG 4DGVL 1NCWH 4HCRH 1FIGH 4C57C 2NZ9C 1VHPA 4LMQI 3RUGE 1MCQA 1O5DT 4KRNA 5DUPL 3VFTA 4TSBH 2V17H 4N8CH 1P4BH 2QQKL 3MREB 3WHE1 3VRIA 5CEXB 3VXSE 2N56A 1JZ2A 4HBCL 3QFJA 4MD4B 1TZHB 1J1OH 3QPQC 3BZEB 5LGJB 2NXZB 2E7CA 4TULL 2VDML 3IF1B 4O2EA 3RHWF 5GGQL 1KPUA 1MAKA 2BVPB 1X5GA 4NP4L 3ARQA 3V6ZA 1RK0A 1ZEAL 4R2GB 3IB4A 3VXNA 1VA9A 2MQ3A 3VMOA 1HYRC 5KVGH 2CR6A 1LDSA 1QEWA 2X1WL 3B6SA 4R26H 1TCMA 5ID1A 4XPTL 5E4EB 4H20H 1Q9KB 4G8GA 2HG5B 4ZD3H 3R0MA 4NHCH 5FKPA 1P1ZB 1ZMYA 3N9GL 3BESR 1I7TA 1D6EB 2R23A 5D2NC 3B2UD 1N0XL 4RAVB 4RQQB 5EBLA 3D25B 3QWRD 3M8OH 3SKOA 1E4KC 5K9QI 3LDBB 3HMWL 1MJUL 5CSZA 2H6PB 3VFVB 1FFPA 1RV6X 3BGMA 4CVZB 3OHXB 4FXKB 1TTFA 5I8EA 1BECA 3NCEB 4AIOA 4JG0H 4ZUSB 2BNUA 3HZMA 3OKKA 2XWBA 4NKIH 2PXYB 2VERN 3PL6C 4Y4HC 1QRNE 3KPQB 3FQTB 4WO4A 4NRYB 3HG1B 3KPLA 4JHZA 2VQ1A 3QUXA 4L1HA 4KPHH 5IB3B 4UAOC 1D9KC 1TDQA 2ICWB 1XF4B 4NZUL 1OLZA 5IBLC 4FNLL 2X09A 1P5UA 4XVTL 1WFNA 3MZGB 4OUUB 1QSEA 2ZSVB 4Z95L 4PJAB 3IJHB 4ZUWB 5CJQH 4MNHA 3HI1B 5IFAL 2WUCL 4YC2C 1I4FB 1P9MA 2H26B 4M3JA 3BAEH 4P4KB 2NY6B 3GI9L 3LIZH 1J0JA 1GZPB 3E8UH 3RWCA 5IFJA 2G9HB 1EX0A 1MUJA 5BMFL 5TH2A 1EFXB 3WNNA 3TZVC 3JWDH 2IALA 3CUPA 4ODWA 1IGYB 3FZUC 1T1YB 5LQBH 5DRNA 5I8OL 4JG1L 3QR2A 4XX1G 3RVWC 2V2TA 3AMKA 5B4MC 2Z31C 1UVQB 3ARGD 3T77A 4QRSA 4EQ2A 4Y4KC 3EAKA 3VFPA 2VDKL 4M5ZL 4R97B 3VXME 4EDXA 1KJ2B 2BSTB 1GXEA 4EUPH 4JANB 4AT6A 1NPUA 4HWBH 3ZLQC 5EOCH 1CXFA 3L5IA 1TPXB 5I71C 4P3DB 1CK0L 4Y1AA 2AK1L 1P2CB 4ODSH 2EDBA 1FZJA 3MRLB 2OK0L 4PJCA 3UTQA 5L2JB 4L8SA 2QSQA 4E42A 1N3NA 4MDIA 4PJBA 3LD8B 3O2DA 2NY1C 3MXWL 3AXLA 3LQMA 3KPRE 1G0DA 3EOAA 1QRND 2B2XH 2YN5A 2DQGL 4UTBL 4PJXE 2NXYD 3LMJH 1JGUL 2IPKB 3DMMC 1JF5A 4J4PD 4XAWL 2L7UA 3UJJL 1ZT7B 1ZLSH 2I9LB 3O41A 4K3EL 5GZND 3GSXB 2NY3D 4FQCL 5ENWB 2C1PA 1A4KB 4Y89A 2EH7L 3FO1A 5DLML 1F3DH 2VUOA 5MEPA 1BFSA 1OTSD 2OL3A 4OJFL 2WBKA 1P7QB 3CFJA 1JYNA 1RZKL 3EFFA 1I8LC 3MLPA 5DF0A 2ADJB 4X4XA 2UYLB 2F5AH 3H0TA 5EA0H 2ZCHH 1UB6B 3OF6D 2VN4A 4XNMB 2FZ3A 4U6VL 4PG2C 4PJCF 1B4JL 3B9KA 4Y5XA 3ZYIA 1KBGH 3VXTB 4K9EL 2MMXA 1HH6A 1NCDL 1J5OH 1JN6B 4QRPD 2CIIB 1S5HB 5SWQB 5FA3A 5FV2A 4HJGA 2X89D 4QOKE 2HFEA 3SPVA 2DRUA 4CU8A 3G08B 3EDDA 3VXQB 4YQXH 1KJ3H 2DM4A 5ECJE 1NGXB 3FOMA 4PJFB 5DEGA 3BYYA 3H42L 4OI9A 1KC5L 4CN6A 3U46B 1I1FA 4X9HA 5JOPE 1CFTA 1O7SA 5EIIA 1S8DA 2X4NA 4PJ9A 2CIKA 5F1NB 1S5IL 4Z7WB 5L88L 2ZUYA 3SKNB 3S35X 1MF2H 2E5EA 5CEYA 4IRZL 3V4VL 1IAIM 1N0LA 4KH2A 1U91A 3DO7A 2O61A 3OX8A 4M00A 2VSCA 2JJSC 3VH8G 3MLYH 4MCYB 2HT4C 3FO0L 3S7GA 3LN4B 4GBXB 1U92A 1XCTA 2VNCA 4ZAKA 2GFBA 4JKPL 3MCLL 4KDTC 1J11A 4JN1H 2OSLA 3BFOA 3ZDXE 2LFGA 2HRPL 1JPSL 4LNVA 1KG0B 3H9ZA 2VDNH 4KGLA 5T3XL 1AGBA 4WUUA 4QRTA 4WI6A 1QSZA 2AK4A 4JY4A 5C3TA 4R4FL 3OGCA 4ESKA 1IC7H 3EOBA 4TUOB 4X7DC 4OZFH 2XQYG 3HUJA 3OXSB 4MLIA 4PLOB 3BRDA 1MRFH 4X9IA 3PNWA 2IPTL 4GRLD 4LDEB 4HUMB 2DLIA 4UZGA 1YUHA 4HEPG 3GBNH 3MV8B 4B5EA 5IR1A 2FDBP 2DL2A 5GJSH 4Q97A 3CFDB 5HPMA 4N68A 4G9FB 1P4LB 5FO7B 1HSAA 3FCTA 4F37F 1F6AA 4D9LH 1NMBL 1EBAA 1NSNL 4CL7A 1C5DA 4MA8L 5E03A 2IH1B 1UB5A 3MRQB 2ESVB 3RIFK 1BEYL 4P2YA 1A6AB 2I26N 4NQTA 1BVKB 3MRJB 5A1AA 4DKAA 2EYTA 1OAYH 1QBAA 2O5YL 1J9CT 4OAWB 5GRJL 4ZFOA 1HHIA 3ZHKA 2MKWA 1Z9LA 2AJYL 1U9KA 4TPRH 3P4MB 5KOMC 3R1GH 4UBDC 1X6LA 1QQDB 1U8OB 4XNXL 4IMLB 1JV5B 5ALCH 5KTEH 5DA4A 5GS0H 5HD8D 4MA1B 3HUJF 5HDOA 5C2BL 5CSGA 4NDMB 3I2CL 4NN6B 1NC4B 1RZKC 1X4XA 5I73C 2VDQL 4YE4H 1YQ2A 3O3AB 3VWJB 5CJXA 1IZJA 3QEHB 4ETYA 2QADB 3AROA 1NGQL 5CINH 1JVKA 5CLWA 4UT6H 5CJBA 4CU7A 2VDRH 3I6GA 1PSKL 4G8EB 4K9EC 4ELKB 5A40E 4ZYKA 2R39A 2VN7A 2ZOLA 2YOCA 3QCVL 3ARTA 4KI1A 1YDPA 5ICYA 2NLJA 3DETC 4PJEE 5B39G 4MGXA 2A6KB 3WJJC 1EVTC 3NH7H 3WFDH 4YFDB 4Q0XH 3CMOL 2VDOL 2GTWB 4G9DA 1HN1A 2NY2D 5INCA 4JFYA 3L7FA 3ET9F 5TE4L 3QIUA 4KMQA 4XZUB 3JWOL 4KK8C 1R24A 4UINL 3VGGA 4U1KA 5IB1A 3TBSB 1A7PH 5E1HB 1GGBH 4NBZB 1OB1A 4NUJB 5BZWA 3ZTNH 3VD3A 3V52L 3JXAA 3MYJB 3O81A 4OD3L 3RA7H 1INDL 5CEZE 4OCYL 3NPSB 5D6DA 4S1RH 5DVKA 1V7NH 1XAUA 4DOHE 5IEHA 1VENA 3Q5YA 1H15A 4JKWA 2OI9B 4JHWH 2V5YA 3V6BR 1T80A 4F8QA 5GIRA 2R4SH 5ICZB 4JY6A 3L3OB 5D7IA 1DANT 3VWKC 4HZLB 1A5FH 5D7JB 1J87A 5DD5H 3GJFB 3D3VB 1A6ZA 3BH8A 5DD3L 1OSPH 3IDIA 5JNYA 2AQ2A 5DK2A 4G3YL 2LTQB 2Z93B 4GAGL 4KTDH 3WXWH 3SDAA 3NABH 4X80H 3QFDA 1QD0A 4HSQA 1WCBB 1ADQL 4JPVL 4AIZA 3GBML 1JIBA 3RVTC 3WFEL 3ZE0F 1DBAL 2OM5A 1F4XH 2VYRE 4ZTOH 1N5AA 2ADFH 1KFAL 3KYMA 4XTRC 4UUJB 3KR3L 3LD8C 1G9NH 4FQXC 2P47B 1I3RB 3RZWA 1HIML 1OTTD 5I16A 2D7TL 1DJSA 1I1AB 4PRAB 3IFOA 3DWTA 4JJ5A 4KY1L 1B2WH 1R3LB 1CIDA 5D7IF 5DQDH 3UTPD 3KYAA 4URTB 3SDDC 3SDXB 1LO4L 5DMKA 3W82A 3UTTB 1Q1JH 4XP5H 3QIBA 4OD2A 2DWDB 5DJ6A 5C0BE 1VB9A 4ZFZB 2R4RH 1YEFH 1RUKL 3FB7A 3DXAE 3Q3GA 4Y4FC 2OZ4L 2BVOB 2ATKB 3N85H 1BJ1J 1JGDA 1PQZA 3G04B 5JXEA 1U8JA 1NGZA 2A9ML 2DMCA 5C0AE 5CEZD 5D1XB 3L7EA 5DZOA 5T3ZH 2PW2B 3SGDH 3S37X 5E9DB 2EIZA 1EMTL 3I75A 2B1AL 4PG9A 1PAMA 3S4SB 5A3ID 5C0CB 1MLBA 1F42A 2WM0A 1XGYL 1E28B 3HRZB 5ADOL 4J3OC 2QQNL 1WF5A 3LKPA 4BUGA 4Y2DA 5FV1L 1IKNA 2JCCB 1BIIA 5AUMB 5F44A 5JW5A 3RFZC 2DLFL 3F7QA 3MUGA 2HJLA 4PY8J 5J11B 2B4CC 2Z9TA 4HPYH 5D5ME 1FZKB 2AJSL 3TYGH 3PV6B 2DIAA 5KSVB 5LCVH 3JWOC 1KJMA 3TFKD 1BGXL 3C09C 4R4BB 4XC1L 1LP9F 3EOTH 4KROC 3D87B 2J5LC 3SO3C 4MNGE 3CPLA 1NDMA 4KI5F 3QNXB 3LAFA 2YKLH 3T8XB 1WIOA 1ZA3A 4FABL 3SBWC 5FO9A 1KELL 2VKWA 5IBTH 2XZZA 3WNMA 4NNXA 1AXIB 1KCUH 5I1EH 4JRYA 5IG7B 4G8IA 1CT8A 2LAAA 4OZIB 5GSVA 3VI3F 4NZDA 5TJWK 2VLRB 4K7FA 3CXDL 4ERSH 2F8VA 3Q6GH 1G7QA 5SV4A 1X7QA 1UACL 2PUQT 4UDUB 5BRZE 1XGPA 3RWFA 5ETUA 4ELME 1U8NA 3DIFB 3DXAD 1RZ8B 4H0IA 3JTSB 2WP3O 2XN9E 4U33A 3MNVA 2D31B 1F8TL 5K9JH 2Q76A 5IV2A 4ZDHB 3DX9B 4EXPX 3P77A 2HLAB 3F7VA 4HGKC 5E6IC 2NW3A 1DLFH 2NX5A 2W65B 2DI9A 4YJZL 2WBWB 2DBLL 2E27H 3KPNB 5EPMB 4LCWA 5FKAA 5IHUL 1U3HD 2BX5A 4B7IA 2PO6C 3WXVL 1BHGA 5B21A 2IG2H 3VGEA 1IKFH 1CXHA 4WV1A 1M7DB 2BHZA 3D0LA 2AJZB 4M6MH 2KKQA 3EUUA 3OPZL 1JK8B 4RGMC 2R2HA 5BO1H 3IFLH 4Y16D 3TJEH 1W0WA 4G7VH 2V2WA 3GIZL 4X4YB 5HGBA 1F90L 1G7IB 4JGMA 5D1QA 3SE4A 1AXSB 3VH8A 4MA1C 3NFNB 2DQJL 3CVHB 5DRXB 4PY7B 1NBVL 4CU6A 4G6KH 4LGSB 4QF1B 4QYOA 4FRWA 4IIQB 3CX2A 2I07B 5E94B 4RGNC 1ROWA 1VFAB 3TC9A 4QY8B 2GIYA 1LWRA 2L4OA 3RU8H 1FLTX 3BO8B 1CFSB 3MREA 4LKCA 2OQJA 4HK3N 5EO9B 5IVXB 5CZXD 5IB2B 3I6LE 3BJLA 3MRDB 4O58H 3BZEA 1Q8MA 4HWBA 4IJ3C 4RAUB 3HI6H 4AEEA 3BIBX 2DLEA 1JMXA 3R0NA 1CR9H 4N90E 1CL7I 1NFDA 5BS0E 3MR9B 1TCRB 4LU5L 3UJTL 3V4UL 5KVEH 4NZTH 4ZMAT 3QI9C 5L6YH 1FYTD 2FHCA 1WT5A 2ZNWA 1NANI 4MMZC 5B3JF 4Z7QE 1YJDH 4X98A 1Q9KA 2HG5A 5BV7B 3KWWB 1AXTH 3QNYB 1D6EA 3T2QA 1NAMB 3MGAA 4JPIA 1YEDA 5JXAH 1T5XB 4RQQA 3L3DB 3D25A 2AEQH 1MCHA 5HHPA 3GSNB 5D6CA 4ZSOA 2D2OA 2H6PA 3VFVA 4RFOL 1QFHA 4YLQT 1A3LH 1YMME 2VLLB 4FXKA 1BQUA 3C8HA 1NFDF 2YMXH 2XZAL 4P2QE 1N6QL 2FO4B 4PJGB <