5L7OA

X-ray structure of triatoma virus empty capsid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
230
Chain Sequence
b'DEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08762 CRPV_capsid CRPV capsid protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oA00
1R093 1COV2 1PGW2 3J8F3 5AC93 1R083 1QQP3 1RUH1 1ZBA3 5ACA2 5CFDA 1K5MB 1RVF2 1POV1 2ZZQA 4YVSC 5BNPB 4GB31 1QJU2 4IV1C 1AL21 1AYN3 3JD73 1IHMA 2BFUL 1TME3 4CDXA 4CDQC 4Q4V1 1BBT3 1RUG2 1RUE3 1ASJ2 5A32A 4JGZA 1RMU1 2WWSA 1ZBE2 4PDWC 1RUC1 3TN93 1PO11 4Q4X3 4YVSB 1AR73 1NCQA 1W39A 1AR83 4CEYC 1FMD2 1NA1A 4QPIA 3VBUC 5D8AB 2HWB2 4QPGC 2HWC3 3VBHC 3LOBA 4GH4A 4CDQB 1QJZA 2RMU1 1C8M3 2WFF1 4CEWA 4WM7C 5BNNC 1MEC2 4PDWB 5ACA1 4YVWC 1VBA3 1AYM2 4RFT0 2RS53 1EV12 1PO22 2BPA2 2PLV1 5C4WA 1MQTC 1V9U3 4CEYB 3JBG3 2ZAHA 1QJU1 1HXS2 2R063 2RS31 1H8TA 1VRH2 3VBUB 2X5IC 4RHV2 3VBHB 4RQPC 2HWD1 3JB8A 1HX6A 2WZR3 4RS5A 1PGL2 4GMP0 4GMP3 1RHI3 5A33B 1RUH2 5DDJ1 1ASJ1 4WM7B 3ZFFA 5BNNB 3VBSA 4YVWB 1ZBE1 3VBFA 4CDUC 2MEV3 1HRV3 4GB32 1MQTB 2Y26A 3CJIC 1AL22 1FMD1 1CD3G 1EAH1 1R1A3 2XPJA 1VBC2 2X5IB 1OOPA 4RQPB 1HRI1 1X36A 2WS92 1PIV3 1QJY3 1VBE3 2R043 5J98B 1VB2A 3NAPC 5CFCA 4CDWB 1D4M1 4WM8C 1NY72 2HWE3 1TMF2 4N43A 2GH8A 3DPRC 4IV3B 3CJIB 4JGYB 2RS13 1FPN1 5K0UA 1RUJ3 3VBOC 4FTEA 1F8VA 2R073 3JB4C 4RHV1 4RR3C 2RMU2 1FOD1 2WFF2 1POV0 5L7OC 1POV3 3NAPB 1ND3A 1NCQC 4N53C 5J96B 1NG0A 1RUF1 3ZFGC 1AR62 1VBD3 1VBB3 1RUI3 2PLV2 3DPRB 5JZGA 2RS32 5FMOL 2RR11 4AEDA 4Q4V3 3VBOB 1QJX3 2WLPA 1NCRC 4FSJA 1VBC1 2HWC2 2HWD2 2HWF2 4RR3B 4CEWC 4FTSA 1RMU3 5C8CA 2WS91 1PVC3 1RUC3 4Q4Y3 3VBRC 1PO13 5L7OB 2RM21 2XBO1 5DDJ2 1R091 5ABJC 3S6PA 3HAGA 3J8F1 1QQP1 1NY71 1AL0G 1K5MA 1TMF1 3VDDC 1Z7S2 4IV1B 5BNPA 2BBVA 1EAH2 1RUD3 5FOJB 1NCRB 1AYN1 1HRI2 1OHFA 1BEV2 1COV3 3ZFEC 5ACA3 1BBT1 1D4M2 1RVF3 5ABJB 1RUE1 1CJDA 3TN91 1QJU3 1AR61 3VDDB 4Q4X1 1E57A 2FZ1A 1AR71 4YVSA 1FPN2 2ZTNA 1AR92 4Q4W2 4QPGB 1F2NA 2DF7A 5D8AA 1FOD2 1RUG3 2HWC1 2HWF1 1ASJ3 3ZFEB 1ND2C 4CDQA 4NWVA 1ZBE3 1C8M1 3ZXAC 5FMOS 1RUF2 4PDWA 4LLFA 1C8NA 1FMD3 1VBA1 2IZWA 2RS51 2RR12 5BNOC 5C9AC 1V9U1 1Z7S1 2HWB3 4CEYA 3JBG1 4NWWA 1B35C 2R061 3VBUA 3VBHA 1BEV1 2RM22 2XBO2 1WCDJ 1MEC3 5CFDC 1R092 2TBVA 3J8F2 5AC92 1RHI1 1AYM3 1QQP2 1R082 1ZBA2 5A33A 4WM7A 1EV13 1PO23 5BNNA 4CDUB 4YVWA 4AEDC 1HXS3 2MEV1 1VRH3 5BNOB 1MQTA 4RHV3 1BMV1 1AYN2 1B35B 4CDXC 1R1A1 1AR91 3JD72 2X5IA 4Q4W1 5LK7B 2QQPA 1TME2 1OPOA 4JGZC 4RQPA 1RUH3 1BBT2 4SBVA 1PIV1 5CFDB 1QJY1 1RUE2 3FBMA 1RUJ1 2FZ2A 1SMVA 4WM8B 3TN92 4CDWA 5BNPC 4GB33 4Q4X2 2HWE1 1AR72 2BUKA 1AL23 1AR82 1NA1C 4QPIC 1VBC3 4IV3A 3CJIA 4JGYA 4GH4C 2RS11 4Y5Z0 2WS93 2R071 5A32B 1AUYA 4JGZB 1C8M2 1NCQB 1TMF3 3NAPA 4N53B 3ZFGB 5C4WC 5AC91 1R081 4WM8A 1ZBA1 1VBA2 1H8TC 1VBD1 1NA1B 1VBB1 2RS52 1RUI1 4QPIB 1GFF2 1V9U2 3DPRA 3JBG2 5D8AC 2R062 4GH4B 4RS5C 1HQNA 1A6CA 2RMU3 2WFF3 3VBOA 1QJX1 3JD71 4CEWB 2WZR2 3ZFFC 4RR3A 1RB8G 1TME1 3VBSC 3VBRB 4Q4Y1 1PVC1 3VBFC 1RHI2 1AR63 5L7OA 2PLV3 4N53A 5C4WB 3ZFGA 2RS33 2MEV2 1H8TB 1HRV2 1AR81 2GSYA 1OOPC 1BMV2 4IV1A 2HWD3 4RS5B 1R1A2 2HWF3 1RUD1 1NCRA 5DDJ3 5CFCC 3ZFFB 4Y4YA 1PIV2 1QJY2 3VBSB 1COV1 1PGW1 1VBE2 3VBFB 2R042 4N43C 3VBRA 2VQ0A 1RVF1 5ABJA 1M06G 4FTBA 2HWE2 1Z7S3 1EAH3 5K0UC 3VDDA 1OOPB 2RS12 1HRI3 1DDLA 1RUJ2 1BEV3 2R072 4QPGA 5CFCB 1ND3C 5GKAC 1RUG1 1D4M3 1ND2B 2WZR1 4CDWC 3ZFEA 4N43B 4GMP1 5JZGC 4Z92B 2BFUS 1X33A 1VBD2 1VBB2 4IV3C 4JGYC 1RUI2 5K0UB 1FPN3 1HRV1 1NOVA 1AR93 4BCUA 5C9AB 4Q4W3 4EJRA 2HWB1 1FOD3 4Q4V2 1QJX2 5C8CC 3IDEA 1ND3B 1RMU2 1RUF3 4Q4Y2 1PVC2 1RUC2 1PO12 1ND2A 1MEC1 1K5MC 1VBE1 2R041 5JZGB 1AYM1 1EV11 1PO21 2RR13 4AEDB 4CDUA 1HXS1 1VRH1 5BNOA 5C9AA 1RUD2 4CDXB 1VAKA 5C8CB 1B35A 3M8LA 1VB4A 1PGL1 2RM23 2XBO3
chains in the Genus database with same CATH superfamily
3LPFA 2YXSA 2ZGLA 5IATA 4OLLA 3OCPA 1GMMA 5FZ4A 1R083 4KMQA 3RYPA 1MS9A 3A21A 2Z2SB 1E5HA 3WF3A 5HXVA 3A0NA 3HN1A 3C8XA 5I8SA 4CU9A 5BNPB 5FY5A 2QZ2A 2VZPA 4XIOA 4MO3M 4BLJA 2DTYA 4QDRA 1PNGA 2A7AA 3WF4A 3ZYFA 5FP3A 2P3IA 1WCUA 3HT1A 2EIGA 2CGPA 1MPXA 1JBCA 3KSCA 1D0GA 4OVEA 2D6MA 3RWKX 4KQ7A 2BFUL 4ISQA 3LOIA 1W05A 4XFFA 1EPZA 4HVOA 2QKDA 2QQNA 3P1IA 1J3QA 1RUE3 3UL2A 1H1AA 3BGAA 4LHNA 4FBFA 4RGGA 4JGZA 5BYNA 5CG8A 3WEZA 1IPSA 1RMU1 2AEZA 4LO8A 4PDWC 3POJA 3U14A 4M0HA 5CKMA 1PO11 3R05A 3H0OA 3MEPA 2W92A 4P08A 4Y22A 3KD4A 5A7NA 4OUEA 1W2TA 1JYIA 3RS6A 3WNMA 5C71A 1FMD2 3RMYA 1KJLA 3WG4A 2WIIB 4A41A 4AHZA 1I5PA 4QWNA 4E4HA 1NA1A 1GZWB 4CUGA 3ZSKA 5D8AB 2HWB2 3O0XA 1GWLA 4JDOA 3I2KA 4GH4A 3FL7A 1XSQA 2XJTA 3J26N 4XABA 5IVJA 2AYHA 1XNTA 2VUJA 2RMU1 2VJXA 4YNIA 4CA9A 5FAXA 2PTMA 5K4LA 4A45A 1MS1A 2VMGA 4URAA 1OF4A 1O4YA 4MGYE 1AX0A 3AMMA 3OBRA 2WA3A 2J1RA 5IWFA 4UFKA 2QQMA 5I91A 5ACA1 4GXLA 1LOCA 1VAVA 4MGSA 2H6BA 5J48A 2RS53 3BU7A 1EV12 1HQLA 2IXLA 1S0BA 2JDZA 4MGQA 2D7FA 5C4WA 1MQTC 2CTVA 3J9SA 4K9SA 4FPKA 3UNPA 1FV3A 3QH6A 5A6QA 1D2SA 1QJU1 1X8MA 2RS31 1PHMA 2WNVB 4YWAA 5F8PA 2A6YA 1VRH2 4YPJA 4NVPA 4JHTA 4IEZA 3KVAA 4RHV2 3T4VA 4WVZA 2HWD1 2E63A 1W2UA 3JB8A 5FP7A 4NIGA 3O12A 1AX2A 5JMCA 5FPAA 4TLGA 4AI9A 4COWA 2WO7A 1N1YA 1K12A 1XB9A 1D4VB 1RUH2 2D6KA 3P6BA 2A3XA 3ZSMA 3ZFFA 5LCWL 1JW6A 1LECA 2F17A 4R8HA 3VBFA 3AMHA 4AFCA 2MEV3 2VNRA 3ILFA 5E16A 2XLAA 3AZWA 2BEOA 4GB32 5IAVA 3T1MA 1HN0A 2Y26A 2W95A 4KWUA 1UCXA 3AL6A 2GN3A 1NE6A 1YIFA 2UY8A 4D6RA 1CD3G 1W2NA 4MYEA 2PHXA 2WA4A 3I54A 2X5IB 2W1WA 4XBQA 4AGGA 3VKOA 1OOPA 4M0NA 4RQPB 3GNEA 3NVCA 1HRI1 1QJY3 2WABA 2E32A 4ASMB 1UZWA 3WDXA 4LKFA 4YW7A 3LB9A 1G86A 3HT2A 5CFCA 5JI7A 2FDIA 4WM8C 1UQXA 1ULGA 5DG1A 2YC2A 2ZJCA 3OPWA 4LT5A 1IGOA 2ZGMA 3LAGA 3C7EA 1XYOA 3KCXA 3KV5A 4LBQA 3ZXEA 5CADA 4MOAA 2VMIA 3CZJA 3C7FA 3I3EA 3CJIB 1V6LA 2XQRA 4AHWA 5K0UA 4R9BA 1RUJ3 2EIEA 3ZIXA 4JDNA 1FNZA 2BU9A 3WXPA 4B7KA 3RYRA 2XKPA 3ETQA 4AVAA 4AL9A 4EN0A 2YZ4A 4OHXA 3U11A 3T09A 4LJHA 5J37A 4AI1A 2R30A 4GA9A 1POV3 4CUCA 1J58A 4LBNA 1DU3D 1NCQC 5ISLA 1ZRDA 4KBZA 2FDHA 5FZIA 5C5TA 1V6JA 1AR62 1N3QA 1XOYA 2X29A 1SZBA 1ZZ6A 1PNFA 4ORFA 1UMIA 3O1SA 3DPRB 5BUVA 1CWPA 3WQBA 1CR7A 2K46A 2Q4SA 3PHMA 4OHVA 4CPBD 5FYIA 5FMOL 1O91A 2RR11 2Z69A 5FUIA 4AEDA 4X8PA 5FY1A 1I3HA 5AFBA 5K9YA 2K2SA 4AF9A 4E2GA 2FDGA 5FP9A 4F8AA 2ETEA 2HWC2 4QM8A 4GWIA 4EE2A 2CL2A 2HWF2 4E9KA 1QJEA 2A5ZA 1UNBA 3LIGA 4P9LA 5JR2A 2YROA 3MICA 4ARYA 3VZMA 3ZOIA 2WJSA 1AHSA 5FZFA 3VBRC 3VHPA 2XBO1 3VDBA 1R091 5EZWA 1RC6A 3FBYA 2JKBA 3QH7A 3SKJE 4BQ4A 3A23A 3L2YA 3HAGA 2NLRA 3J8F1 3ZX7A 3LDBA 4COUA 1MS4A 2A75A 2G9ZA 4QKBA 2P34A 1NY71 1RUOA 4EV0A 4QDQA 4N8MA 3E6DA 2Y6LA 4I2OA 4IE4A 3ZXKA 2RJKA 5BNPA 1PK6B 2VOTA 4LBLA 2C5DA 4K1YA 3H8RA 5LBBA 2YBPA 3IBMA 2YFZA 3TAYA 1U5ZA 1C3HA 3KVBA 2WNUC 3ECQA 4LOTA 1SBDA 1BEV2 1V6IA 2YPJA 1LODA 1TNFA 1WLWA 2IFRA 5DXDA 4HBNA 1BBT1 5JXGA 2P4EA 2J1EA 1D4M2 4P14A 2Y64A 4LIUA 3ES4A 1L7LA 1W0PA 4Q0SA 4J25A 4L8QA 1KDKA 2W68A 2ZKLA 3IZOA 1NLSA 1H1MA 2ZEWA 2E51A 4QQOA 2W08A 2OT7A 2G1MA 4LR4A 2W47A 3W59A 2VL4A 1AR71 1GUIA 1DQ5A 3CKHA 3PUSA 3FC0A 1YQ8A 4CRQA 2O1QA 5FYBA 1NQDA 2RDSA 1W9YA 3RDIA 3OEBA 2JXAA 4B4QA 3WNXA 2ZTNA 1U5YA 1R64A 2IUWA 1JU3A 3LF7A 4KU7A 4Q4W2 1GZWA 2VNGA 1KFXL 2DF7A 5D8AA 1YUDA 4EZHA 3H7YA 4HKWA 5LEJA 5T3NA 1W28A 3MI8A 3POFA 1LGCA 2OUJA 3ZFEB 5A80A 4LULA 2DYCA 1ZBE3 1C8M1 3OGJA 2DUPA 4AAPA 5IFTA 4M3CF 3FJSA 1RUF2 3NJZA 2Y6HA 4OYUA 3DXUA 5A70A 4D7TA 1LKNA 3P3NA 1QU0A 1XBFA 4NHKA 2WINB 3WDTA 2Y60A 3CQOA 3FHQA 4HZFA 3B3QE 5HV0A 1F5JA 4Y20B 1QXPA 4BOWA 3BOPA 3E5UA 2WNVA 4AQSA 2WN3A 3OSDA 4UBGA 3MF9A 1W03A 2JIJA 3BODA 1QWRA 3RVHA 2NYYA 4XXAA 1S1AA 3PVEA 4OUMA 4QQLA 2VCBA 4EWAA 4LKSA 4BQYA 2CGOA 3EXUA 3NSTA 4K20A 4XQ4A 3DKWA 3LEMA 1V6KA 4ATFA 3I2OA 4C1WA 1ZBA2 4RGAA 1DIWA 2CAVA 4NPMA 3KS7A 4LHLA 2ZMLA 3RYKA 2WUHA 4Y1VA 5LRRA 3HQUA 4LK7A 4HMZA 4UFMA 5FXXA 1JZ2A 1U5XA 4RSUA 1QH7A 1AR91 1OA2A 4EROA 2X5IA 1NQJA 5LK7B 3TYJA 1YFXA 1ZRIA 3LIHA 4JGZC 1W6MB 1W06A 3FLTA 4RQPA 1C5IA 5FO7B 5B4NA 3I2HA 4DRVA 5CFDB 3WP4A 1Q8OA 1F5FA 2J1AA 3FBMA 2D98A 3J7MA 5IK5A 1DGRN 2DCZA 3VV1A 5F3IA 3U07A 1SMVA 4WM8B 3WZ1A 3TN92 3Q9OA 1G9FA 3DKQA 3GCWA 4Y1UA 4LUMA 4BE3A 4Q4X2 1F4HA 3WHUA 3HJRA 2W94A 4QQPA 3SISA 3ZR5A 5FZOB 4B4RA 3TEZA 2BUKA 1NA1C 3QBQA 1QKQA 3USSA 3E6BA 1BK1A 1VMFA 1VBC3 5FZBA 2LTNA 3MIBA 3CJIA 2DFBA 5T54A 1GOHA 4GH4C 2RS11 2MPFA 2P3KA 3FLPA 4Y5Z0 4CCDA 3T1LA 2WS93 4QGMA 3EB7A 1RYYA 5FZMA 3WSOA 1GQGA 3EHKA 2R071 5A32B 2FDJA 1IPJA 3LA3A 4ZONA 2QQUA 3U1XA 5KXCA 4LPLA 2WZEA 3HIFA 3IDBB 1MR5A 3UV9A 1NCQB 1TMF3 5FMCA 2WN2A 5C4WC 1LHVA 1R081 2AREA 2B46X 4DS0A 2C0ZA 4QMAA 1VBB1 3NNJA 3JQXA 1DP0A 4A6SA 1V9U2 1WW4A 3DPRA 4MVTA 4NRPA 1UXXX 2UWBA 3HNYM 3MIEA 2VR4A 4H3WA 4XUPA 3ZXGA 2R062 2JDPA 4IL7A 4IW3A 1HQNA 2RMU3 2BNNA 5FO8B 1QJX1 4PCRA 3F2ZA 3O0VA 3VZOA 1GNYA 5CKQA 5LRSA 2R1DA 1LTEA 4I0AA 2WZR2 5FPVA 1UZYA 3ZFFC 4R4XA 2XJQA 3VBRB 3KGLA 3I97A 4Q4Y1 1PVC1 2MNGA 2WNEA 4HANA 1RHI2 3VBFC 1E5RA 4N53A 3H3UA 2GP5A 2VMDA 3BTYA 1ZZCA 4LUKA 4AVCA 1XNAA 2RS33 2I45A 2W46A 1H8TB 4UW6A 4CVUA 3KZ4C 1WKYA 1SDWA 5F2WA 5F7UA 2GSYA 1POQA 3HMYA 5FYCA 3WP5A 1OOPC 2B39A 2O14A 1BMV2 2VM9A 1SEFA 2HWD3 4LQRA 2BDRA 1PK6A 3ST7A 4TTGA 4AHYA 1G9AA 4IEXA 5DUVA 4QX5A 1S0FA 1ZZ8A 5GALA 4HXCA 5EXOA 3HOBA 4KH9A 3LA7A 1P8JA 5CFCC 3LD8A 4QB2A 1J59A 1PIV2 1T2XA 3MZHA 4K7JA 2ORXA 4N7IA 1VBE2 4LO5B 4YM0A 4D7YA 4FPHA 3U78A 5F3EA 4M00A 1GWMA 1OUSA 1CZSA 1NLQA 3OGGA 2ZX2A 3ZMOA 3GM8A 2Z4FA 5J09A 3GZTB 3BTXA 3MGUA 2JD9A 5AFEA 3PNAA 5K0UC 2WYFA 4NPLA 1AVBA 2JDYA 1W0OA 2YBSA 2DV9A 1W3XA 5EYXA 3PUIA 1HRI3 1WCQA 5CISA 4W8JA 1A3KA 3GHNA 2ZZJA 4MGZE 4PHZA 3D3AA 4EN6B 2C1FA 2Q8DA 3TB0A 2OYZA 3WF2A 2VNVA 4N9HA 4XVHA 3VD9A 4O65A 3ZFEA 1IQAA 3ELNA 3DL3A 3PVBB 4BU2A 4NHLA 4DINB 2BFUS 1UOFA 3NWKA 5D21A 1VBD2 4LBQD 3MIGA 4ZU7A 3TEXA 3D82A 5SV5A 4Z2WA 3KF5A 1UY0A 3AL5A 1NOVA 2ZOEB 2UU8A 5A3TA 1S2BA 1FX5A 2DU0A 2ZX1A 4K8FA 1W2AX 4TSVA 2GALA 3AVSA 2HWB1 1YLLA 4Y20A 4Q4V2 3OGRA 1WMFA 3MW2A 4FP2A 5JIUA 3LDRA 3HD8B 3SNMA 3THCA 1CIWA 2V09A 2HJIA 1QJFA 1UU5A 3ORJA 2B5HA 3SEEA 1MVQA 3POYA 2CAUA 5T5PA 3T30A 5FO9B 2P1BA 2OW4A 5F5QA 3FZ3A 2PAMA 5JZGB 3CJXA 3JXSA 4LIVA 4QQ2A 4XXPA 4I02A 1Q5OA 4QB1A 1EV11 2QE3A 2RR13 5IK7A 5ANQA 4KWKA 5LWBA 3ES1A 4AQTA 3TEYA 1NUKA 4C0BA 2HEYF 1VRH1 1YRZA 1BKZA 2YU2A 4L97A 5FZDA 5C3OA 1RUD2 1YEWA 3VDAA 1QHDA 3D5OA 2VXJA 3M8LA 4E4SA 1UF2C 1RUJ1 1S2EA 5JSPA 2RE9A 2XBO3 3NNLA 1R093 3I59B 4CCEA 1DZRA 2VG9A 3RJRA 2QTWB 4I01A 1NZIA 2FCVA 3M7AA 5C5UA 3J8F3 5AC93 4DXRA 2JIGA 1RUH1 3GALA 1Y43B 1ZNPA 4XUOA 1K5MB 5CFDA 2DCYA 4DEQA 2D93A 1POV1 2ZZQA 5LK5A 3SHRA 4F3JA 1Q43A 3UESA 1K5JA 3MDPA 1FAYA 3D4KA 2JICA 4XFAA 2VNOA 1YQCA 4GB31 2QDRA 1UYXA 3A0KA 4AFAA 1CJPA 3FMGA 4E4ZA 5FZOA 2WYSA 1H6YA 4ITCA 2VVEA 3FHAA 3MIDA 4LBMA 4UOJA 5DAVA 3O1OA 1IHMA 2O8QA 4JDMA 2UURA 4M4PA 1TZOA 2B9VA 4JKLA 4TWTA 4QHZA 3MUZ1 2ZS6B 1BBT3 5JDBA 1ASJ2 5A32A 1C4RA 2GMEA 2VGDA 5F1RA 4XAEA 1GP6A 1XYNA 2ARXA 2WWSA 3D8CA 3DUIA 3M3EA 4YW1A 3RRDA 3PU8A 3IIIA 1BXHA 1UX7A 4FFGA 2UWAA 4YVSB 1AR73 1NCQA 2R32A 5HCBA 4CE8A 2H0VA 4S2GA 2PHWA 2H6CA 4BMEA 3KWVA 2RDNA 3AKTA 5DPNA 1D7PM 3ZYJB 1O6UA 2VZ1A 4B4PA 5FV3A 1WLTA 4XBNA 2YV8A 5A7SA 4FPYA 1O5UA 2Z42A 2JDAA 4HT1T 4LMFA 5FK8A 2PYTA 2FMDA 4MGIE 4CDQB 1AXYA 1QJZA 1C8M3 1OQ1A 1GZ9A 1G7YA 5T5LA 1PZ8A 2OZ6A 3BTZA 5A3UA 1LOBA 4PLOA 4XURA 4DB5A 2PHTA 1ZZ9A 4QX2A 1AYM2 1LEDA 1OURA 4RFT0 1I6XA 3INAA 3PUAA 4CP2A 4COZA 3DN7A 1PO22 1GLHA 3QACA 2W2IA 4PBOA 3IN9A 3HNBM 2ZAHA 1LOEA 1HXS2 1DBNA 4JAAA 1H8TA 1QGLA 5GZEA 3ZN6B 1DFQA 3VBUB 3URFA 4AVTA 2D97A 2X5IC 2AEYA 3VBHB 1Q8QA 2ZHNA 1N3PA 1GANA 3LDKA 3G6JB 4Q8LA 4RQPC 1UZ0A 1HX6A 3D0SA 5FQ0B 2Y38A 4GMP0 1W04A 1OLMA 1H30A 4DOUA 3K3NA 1LGBA 4UI9L 3IAQA 1GOFA 1CAUB 2VTXA 1QXRA 4G3YC 4XFIA 4DUXA 5DZGA 4YW3A 1ZBE1 1H2LA 4KU8A 4CDUC 3UGFA 3H7JA 4M3CA 5IVFA 3SEPA 4IEPA 4OUSA 2FBEA 3WCRA 1YIPA 3BVCA 3K4AA 1XSRA 3CJIC 5FRAA 1XYPA 2R0FA 3NNFA 4WZCA 5FXVA 1AL22 2E26A 2Q1ZB 4LO4B 2XPJA 3LKJA 5FP4A 2GZWA 3UKTA 5JSRA 1KXGA 3PL0A 4YLZA 4UT5A 1WA4A 4P00B 3SXWA 3TNQA 5FJHA 2XR4A 1UD1A 3VUOA 4LO6B 2W1SA 1JU4A 2HEWF 3R4UA 4S2FA 2GNMA 4C8DA 4AAXA 2R043 3HBZA 3MFAA 2G9FA 3ZYRA 2YMZA 1GNHA 1GBGA 1LHWA 4NE9A 5T5OA 1D4M1 2VMHA 1O8PA 4IE7A 3I49A 2LALA 4YYOA 3SITA 3M1HA 5GZGA 5F3CA 2V5YA 3HVDA 3MHZA 3B94A 3DPRC 2VOVA 4IEOA 3OBTA 1Y7BA 2FQPA 4FPOB 4XCBA 1PVXA 3MLLA 2RS13 4D6QA 5F9TA 1G8WA 4MV2A 4NO4A 1HJFA 5A7OA 1ENSA 3POBA 1ZZBA 2R073 2GNDA 4BQ1A 1A34A 4BXFA 3AXDA 3HWJA 3W21A 4XF9A 2WFF2 3OPTA 4XPVA 5A3WA 5JCTA 2R7EB 2YUEA 2A3YA 2J7MA 4XJAA 4XC9A 3VN4A 4XETA 3NAPB 2JECA 2JG8C 4CUAA 5FPZA 2JE7A 4MHRA 4N53C 4XMAA 1HIXA 2EAKA 4AWDA 5J96B 2RJ2A 1RUF1 5CBLA 1IZ3A 4AVVA 4XOGA 1WA6X 1REEA 3S30A 4AFBA 1UMZA 2EAAA 1QDCA 3WNNA 1VBB3 1S0CA 2B8MA 5C7GA 1G6NA 3UKNA 2PLV2 3N7KA 3WUCA 5JZGA 5IFPA 1CESA 4NHYA 5FZ0A 3FUOA 1PK6C 2NPIA 1SHWB 3V0AB 3ZPOA 1OT5A 4V2VA 4CTEA 5I0TA 1OVPA 3MPBA 3VZKA 1QJX3 2JG9A 1Z0HA 1VBC1 4LKDA 5FMDA 3CU7A 1BZWA 1YNAA 4RR3B 1JZ4A 2ZX3A 4CEWC 1NLRA 2BWAA 2QJVA 5JAXA 4UFLA 4FVVA 4XDOA 2WS91 1PVC3 1RUC3 4Q4Y3 4AFMA 1AXZA 3CL1A 3NNGA 5L7OB 5DDJ2 2DVBA 5EJ3A 1VAMA 3I59A 5JUVA 4YW6A 4P9YA 3J4UH 4XJZA 3TNPB 3I3BA 4G4FA 1JZ6A 4XFHA 3NMBA 1ZA4A 1PZ7A 1WLDA 1K5MA 1TMF1 4N9IA 3VD3A 2Y8KA 4XDQA 2JEMA 1Z7S2 1RITA 5L9RA 2NMNA 1AXKA 1JZ7A 2E9QA 1XNKA 3GBGA 2XMLA 3VZLA 1S0DA 5FY8A 3WY6A 5FOJB 2I07B 4CP1A 3SC7X 2B4KA 3K75B 3WW1A 1J83A 4HVRA 3UGGA 4ZZ5A 1U0AA 2PN5A 4QHOA 3ZFEC 2CWMA 4JCKA 2QZ3A 3AYAA 5ABJB 5HBAA 1N1SA 3OBZA 5H9SA 2VBDA 5CNAA 2IXKA 3U4XA 2Q1FA 5IK8A 5I0UA 5FR3A 2VQUA 3TN91 3A7QA 2UYAA 4Q2FA 2Q8OA 4Q4X1 3ACLA 4IE5A 2FZ1A 1O5LA 4YVSA 3PIGA 3WNPA 1AF9A 1OLRA 4ATEA 4NAOA 5G05L 4AW7A 1UL9A 2ARBA 3PU3A 3S57A 4QKDA 1F2NA 3OD4A 2J1UA 4H7MA 1KD7A 4OULA 2DUQA 1BK0A 4KGGA 5FPBA 3O0WA 3UJQA 2GP3A 3OY8B 2UWCA 4CDQA 1LB2A 2D5FA 1EUTA 4V1PA 1SLIA 1F31A 2AENA 3OUIA 4QAWA 1OH3A 1GZTA 3THTA 4DPNA 3POIA 5FBZA 3TBDA 2EXIA 1LOAA 1PGSA 1CZVA 3OPZA 2CHHA 3Q8FA 1C8NA 1FMD3 3NV3A 1TQ5A 3O1RA 1ST8A 2K9ZA 2OPKA 2VQTA 4I0BA 1U5IA 2Y33A 1GQPA 3V56A 2IXIA 1V9U1 2HWB3 3POSA 4CU6A 4Z8BA 5JLVA 3U4SA 4A6OA 2R061 2GNBA 3I2JA 5FCCA 3IB3A 3ZN6A 4A7ZA 3VBUA 1X50A 4XAAA 2HBUA 1G9CA 1KRIA 2VZTA 2JE8A 3VBHA 1CAVB 1D0HA 2PHRA 3CF6E 2YC4A 1O4ZA 1RGSA 2RM22 5FQ0A 4GJZA 4GWJA 1W8FA 4XILA 5CFDC 2DUOA 3N7LA 2VUAA 3NL1A 5DAXA 5FJKA 3O1PA 2NQYA 1RHI1 3BIEA 1QQP2 1UZVA 4JHZA 4QGNA 1CAUA 1EV13 5F5CA 1DQ4A 4QPWA 4CDUB 4MGKE 4DY5A 2DCKA 2WT0A 3EYPA 3AXEA 3GZEA 1VRH3 5BY5A 1CVNA 1NXMA 5BNOB 3V64A 5L9VA 4Y1YA 4RHV3 1WMXA 3AKSA 4OZXA 4OHZA 1QIQA 4Q1PA 3W58A 1BMV1 1AYN2 1B35B 1W6NB 3IDAA 3JD72 3FUQA 2QQLA 2DBIA 4OQ8A 4Y1ZA 1TME2 3HBKA 2R6QA 1RUH3 4KL1A 4ASLA 3KB5A 2D6NA 1PIV1 4GD4A 4IE6A 2W39A 4PI0A 2VD7A 4DY3A 1V70A 4GAZA 5FYMA 4GWMA 4AEMA 1YO8A 2AUYA 2YHJA 1REDA 4MLOA 5E89A 2EICA 5FZ9A 1XJAA 4GB33 4EN9B 1MZ5A 2ZA9A 5J3UA 3MV11 5FY0A 1AR82 1ZA7A 1MVEA 2ARAA 4FOYA 1JI6A 5J1XA 1OFNA 3B9CA 4LITA 2VMFA 3H3LA 1DG6A 4JQTA 4O9GA 4QXHA 5JI9A 2GC2A 3BU0A 4PIXA 4I3PA 4DMIA 1VR3A 2XL9A 3OD0A 2JDUA 2F4PA 4JRLA 2QBXA 2CGNA 4IGQA 4QM9A 3DV8A 2NM1A 4HKLA 1YWKA 3MIFA 1HW5A 5J36A 1A8MA 1X82A 2JG8B 4EYUA 3UKVA 4IQPA 4N53B 3NAPA 2VCCA 1NX9A 3NV2A 1ZREA 2MHFA 5AC91 2FDFA 1VBA2 3C3VA 4CU8A 2QQVA 1H8TC 1VBD1 5IVBA 3AYDA 4LHKA 3FN9A 3MFCA 2DDUA 2VCMA 3I4IA 3JBG2 3ILNA 4NROA 3WNOA 4BPZA 3V0AA 2WFPA 1LOGA 3DYPA 1PMHX 1H0BA 2L9LA 2D6LX 1IKPA 2YPDA 3NV4A 4CEWB 3FE5A 4RR3A 5E88A 2G4IA 3K48A 5CEHA 1DYOA 1RB8G 1UPIA 5FP8A 5FOBB 5IT6A 1H2KA 4IDZA 1YFYA 2PHLA 5HI0A 1US3A 1AR63 1UIJA 2ZX0A 5L7OA 5GLWA 1FXZA 2BVBA 2WAAA 2QFEA 4FPGA 4QX8A 4Y1XA 4J6GA 3WDVA 4ZS2A 4XZUG 5K8SA 3ZFGA 2ZGRA 4CCOA 2W9XA 1HRV2 2LS6A 4NIDA 4XMIA 3AP6A 1H6XA 1YC61 3LE0A 3R0RA 2AZ5A 3PJQA 1R1A2 2HWF3 1XNCA 1ULEA 1S4CA 2WQ4A 3DCQA 5SV8A 4DRRA 2WT2A 1RUD1 4C90A 3EO6A 3VL9A 3U75A 3TEWA 3ZVXA 4CCNA 2DVFA 2XH6A 1MS3A 1IOAA 5FZ1A 5FXWA 1LESA 2AC1A 1FNYA 2VQ0A 2WLQA 3CBNA 1DF0A 1UO9A 3PVOA 3GCXA 4QT6A 2Y6JA 3OBAA 5ABJA 3T3YA 4RD7A 2Q8EA 4XYXA 5DQ0A 2OX0A 3ZN4A 2HWE2 3IPVB 1W8HA 1LGNA 1UW8A 4JC1A 4CSWA 1L3JA 5FKBA 1OA3A 2EXKA 2OKXA 3ZSJA 4ASKA 5JVVA 3VHRA 3AMQA 3BUCA 1EY2A 1X8EA 1DDLA 4CXYA 1BEV3 4QX3A 4DNYA 4TZDA 3IIAA 1GR3A 1Q8PA 4XFGA 1ONAA 1JYWA 1MS8A 3POGA 2HEVF 4KG8A 2EXJA 2P5BA 1HB1A 5FZ8A 1OD3A 5LA9A 4COYA 1D4M3 3E1F1 3RNSA 1DHKB 2Q30A 4CDWC 1US2A 4Y26A 3WOGA 1AJOA 3OY8A 5DUXA 2KA3A 1G9BA 5BPXA 1XQNA 3AP4A 1W6PB 3AYEA 5A3OA 1EPWA 3I3QA 5JZGC 4ZHNA 4K8RB 3T0AA 1W8TA 1SPPB 1APNA 2C9AA 3O14A 4IV3C 1RUI2 3JCIA 4IERA 5EJZB 5CU1A 4XTMA 3QD6A 1J1LA 3H1MA 4BDVB 4JZRA 2VZVA 2JG9C 1WMEA 1R1ZA 3M3IA 3OOXA 5DUUA 5EWSA 4NOTA 5JPNB 4Q4W3 4EJRA 3SCGA 4GIQA 1VALA 4K21A 3LEGA 4CU7A 1YQ5A 3H1YA 4WZFA 5LBEA 3ON7A 4JTNA 4AQ6A 3IDEA 3IWZA 3NO8A 3IT8A 3BALA 3JZVA 1ND3B 4AI0A 1RMU2 1RUF3 3O5SA 1CAVA 3AZXA 4META 5A3PA 3BTAA 5GZCA 1PO12 1ND2A 4UW3A 1K5MC 4OZOA 2R041 3NW4A 3PUQA 4OI1A 2KM2A 2P3JA 2VOXA 1AYM1 3I8TA 5JOYA 1F35A 3NKGA 5FREA 1C57A 1PO21 3EJKA 3MW3A 4CDUA 2HKXA 1Y9QA 2J22A 4KWJA 2JDKA 4NRMA 4MUVA 5H9RA 3H50A 1HXS1 2ZHLA 4IEYA 5FKCA 4BA6A 4IXLA 2VVFA 1SLLA 5BNOA 1W9TA 1JH5A 5HXMA 5C9AA 4PJYA 1FI2A 1OXCA 3AFGA 2EXHA 2RHPA 4OQ9A 4GKXA 5C8CB 4I30A 5LEKA 1O3RA 1B35A 4BISA 1HN1A 5FZCA 4W65A 1W6NA 2ZAAA 4KI5M 2BW8A 5KR7A 1CPMA 1COV2 1XU1A 5KHIA 3BPZA 4K1ZA 3Q8BA 2XVGA 1ZBA3 5FZAA 5ACA2 2OIIA 1RVF2 1DQ2A 4MXVA 4QPYA 3CEWA 5KHJA 1A8DA 4YVSC 3WT3A 4BIOA 2FD8A 2IVIB 2BP6A 1QJU2 2IXHA 2KXLA 2P17A 2VZOA 4IV1C 4QD2A 3RJ2X 3T2OA 1S55A 3H8UA 5JXJA 1AL21 4XFCA 4YARA 5F37A 1ENQA 1EYBA 3WDUA 3NJXA 2GNTA 1OBNA 3H9AA 3U0ZA 1KS4A 1ACCA 1DLCA 4CDQC 5JOXA 2OXBA 1WCKA 1RUG2 2G9GA 3AYCA 3GF6A 4ZXEA 3J7HA 1DZQA 3LSEA 2RDRA 4HK9A 1BLZA 2W91A 1E5IA 3TN93 5FYVA 1RUC1 3ITQA 4Q4X3 3NQHA 2JG8A 2FCUA 1WBLA 3WG1A 1OFSA 1W39A 2Y6KA 3MBWA 5C8WA 1VMHA 3P3PA 3IMNA 3OF1A 5KXDA 3R4DB 4LEJA 3HQXA 1E5SA 1LHUA 2WZ8A 4HN1A 1DGWA 3PIJA 3VBUC 5F5AA 4QPGC 1CAXB 5T50A 5T52A 3VBHC 3LOBA 5FYTA 2ES3A 1HLCA 4XHXA 5JR7B 2CSGA 4XDPA 5HPOA 4CCCA 2HBTA 2WFF1 2XHNA 2XJVA 2NP0A 5I8TA 3B93A 4AGVA 4CEWA 3BOWA 3USUB 4ES9A 3LA2A 1H4HA 1KGYA 1MEC2 4LO7A 2WO3A 5L73A 4M3CB 4NN0A 1WMDA 1HB3A 5I93A 4DFSA 4BK5A 2JDMA 3AFKA 3AP9A 5F3GA 2WO1A 3DEMA 1GP4A 2PLV1 4H14A 2IFWA 5K7PA 1V9U3 1VMJA 1WW6A 2XVKA 3ACIA 4CEYB 1V6NA 5F32A 2R063 4BM8A 1V6MA 1OI6A 1Y9GA 4LBJA 1OA4A 2UY9A 4V2WA 5JWPA 1W8ZA 2EIBA 4B1LA 3LQCA 1AZDA 2W3JA 1W3VA 2WZR3 3D6EA 1PGL2 3N36A 1GV9A 1LOFA 4GMP3 3WQ1A 4B3NA 1W9SA 4CYDA 1RHI3 4RN5A 5A33B 5DDJ1 4WM7B 3OTFA 5BNNB 2XJSA 1DLLA 1A78A 3I7DA 3M3QA 4HSJA 4YVWB 4QHBA 4FT8A 3VHNA 4P9GA 5B4XA 3AMPA 5A7WA 1S0EA 2GMPA 2QQIA 1YQ6A 4AYUA 4R52A 3AP5A 1W8UA 1O59A 2D40A 3AJZA 1JN2P 1LJ7A 3IPVA 1FMD1 1F9KA 1UY3A 1VLNA 2XG3A 2ZGSA 3MYXA 5GZFA 5IVCA 1LAJA 1RL3A 4A42A 4GZ9A 4B7EA 4XUQA 1QNWA 1GOGA 1LNSA 5C70A 5FMBA 1OD5A 4LBKA 3WW3A 2VTXJ 1PIV3 3AVRA 4Q29A 3RQ0A 2YDEA 1VBE3 2PFWA 5J98B 1VB2A 3NAPC 4HL0A 5LY1A 2A6XA 3UJOA 2RG4A 4CDWB 4BB3A 2WSUA 4R4ZA 3KV9A 3LFIA 1YXWA 1SDDB 1NY72 2WQZC 3AZYA 4L11A 5FYUA 5GLVA 3WP6A 1VJ2A 1KQRA 3AM2A 4A7YA 2DVGA 1W6PA 1UMHA 4P9XA 4XTPA 4IV3B 2C9KA 1F4AA 1SPPA 1O7FA 5IUQA 3GZAA 1RUNA 4DXSA 1OSGA 1LRHA 1OPMA 2JG9B 4YZ4A 2VAUA 2OZJA 3SH3A 2SLIA 4E8DA 5HCHA 3PUHA 1XPWA 4JX0A 4CCKA 1W99A 4AEKA 4RHV1 4RR3C 1PMJX 2EALA 5EPAA 5IK4A 4BQWA 5LASA 5JOZA 4YM3A 5T5JA 3AK0A 5L7OC 1ND3A 3H42B 3N9LA 4AOCA 2V4VA 2LM3A 4FPJA 4MADA 3GJAA 4PF1A 3RFRA 3ZFGC 5EIYB 1XRUA 1C1LA 1VBD3 1S2KA 1YQ2A 1OKQA 2VUCA 2XKOA 2XOMA 4A7KA 2VZQA 4NIHA 3IAPA 1OVSA 5CIRA 4WBBA 1QMJA 3KT1A 3M3CA 3ACGA 3BPSA 1SFNA 1ZRCA 2ZGNA 4Q4V3 3VBOB 4BIFA 3KT4A 3LZZA 2WKKA 1C28A 3ZDVA 3ZR6A 4FTSA 2K0GA 5C8CA 4TLFA 2VH9A 2RM21 3S5AA 5ABJC 3C2UA 3Q8CA 5EP9A 3S6PA 3M4FA 1QQP1 1JXNA 3MIHA 3QLQA 2VC9A 4KBBA 3ZKYA 4XZPA 2IVJA 3RZJA 1OH4A 1ZM1A 2Y0IA 1V00A 4IV1B 3T0DA 1ULDA 2BBVA 1EAH2 3Q8AA 1H2NA 2WSVA 2QQKA 1RUD3 2VY0A 4DZGA 4PQ9A 1NCRB 1AYN1 5EQUA 3ZO0B 5E1RA 1LEMA 4OMCA 4QU2A 2O0OA 5I0RA 3I3MA 2W1QA 1OHFA 3LGRA 2BVVA 5D1IA 2QNKA 5FZEA 4BMBA 4H2AA 1NAEA 3MV01 4D69A 4FFFA 5FLHA 2VE1A 2X05A 2XQXA 1YJKA 1OLQA 1MS5A 4HLTA 2ZABA 4UFIA 3ZXLA 4PI2A 2YGLA 5FYZA 3E6CC 3VD4A 4LA2A 1AR61 4PT6A 3VDDB 3WDWA 1E57A 2JJ6A 4IEVA 3K4ZA 4QGLA 3HN3A 2D3RA 1JYCA 1FPN2 4AFDA 1AR92 5F6LB 2IXCA 1WLCA 4QPGB 4IEQA 4J1WA 5A6ZA 4Z82A 1HB2A 1FOD2 1QDOA 1JUIA 2HWC1 1CAXA 4YW5A 5T55A 2HWF1 1ASJ3 3H8XA 4NRQA 5F5IA 1Q8VA 3G7DA 1ND2C 5IAXA 4IGPA 3SCFA 1BQPA 4NWVA 3SCHA 3ZXAC 1JYTA 2DCTA 2VXRA 5FMOS 3VD5A 1IS4A 2I2SA 4YSFA 4P02B 3NJYA 4EWDA 3USUA 2B45X 4ZS3A 5B2GB 4LLFA 2VO5A 2BRTA 3CNAA 3THDA 1VBA1 2IZWA 2LRPA 2V4AA 1DZTA 4YM2A 2A71A 1N1TA 5BNOC 4AE2A 1QF3A 5C9AC 1CONA 4CEYA 1OLME 3JBG1 3T2QA 1TE1B 1B35C 4NIIA 3RZKA 3KCYA 1CZTA 1PX3A 2Y0OA 2WL1A 4UBHA 1WW5A 1GNZA 2WDBA 2ZGQA 3KHCA 2CY6A 2YB7A 4CZSA 1BEV1 2W5FA 1BJQA 1WCDJ 1YFUA 4AGRA 4D7SA 3I2FA 5IVEA 3RZHA 5F6KA 2IC1A 2D6OX 1KFUL 3WG3A 2PAEA 4W4ZA 4KNCA 2WAOA 1MZEA 5CVRA 3GYDA 5EYYA 1AYM3 1EUUA 1R082 4Y24A 5A33A 4D94A 3RZGA 4M4RA 4WM7A 2XXZA 2A6WA 1PO23 5BNNA 4FQZA 2ZEXA 1WBFA 2QCSB 4AG4A 3WF1A 3KF3A 3NJVA 4YVWA 2DURA 3JUUA 3WVJA 1HXS3 3PJYA 4XHBA 1ZRFA 5EFUA 2ATFA 3RGBA 2C6SA 2Y34A 1UOJA 3RI8A 3ZYBA 1O8SA 1JZ8A 2JKXA 4A4AA 2PXJA 4UFJA 1CGPA 3N35A 1VP6A 4ET7A 3N9MA 3ZLIA 4XF0A 5C3QA 1R1A1 1GU3A 1HV1A 2YU1A 1YCIA 2VQAA 3N9QA 3RZZA 4Q4W1 4YGBA 1OUXA 4JKMA 1K45A 1WD4A 2TEPA 1OPOA 4BQXA 3V0BB 5DAPA 4NIAA 2JDHA 4Z2AA 4LA3A 3ZMNA 3ZYPA 3IM0A 1RUE2 4CCMA 2DWRA 2FZ2A 4QB6A 3PDQA 4CDWA 2GH2A 3O7OA 1N47A 2JX9A 5H9PA 2ZCWA 5I0DA 4COVA 1UYPA 2HWE1 3FHIB 1GICA 1AL23 3SH5A 1RXFA 4JQRA 4YRDA 4NUBA 3S5QA 5C33A 1XU2A 4IV3A 2BTVC 3FWEA 5IHRA 4K6BA 3U37A 3GDBA 4X6QB 3TRSB 4P5YA 2CYFA 2XHKA 4Y33A 4M01A 1AUYA 1JOJA 3TWIA 3WR0A 2WQ8A 4Y5TA 4ES8A 1JOBA 4W50A 5CAZA 2ZGOA 4IE0A 3WQ7A 1W9WA 3ZFGB 4OI2A 4CP9B 1ZBA1 3AKQA 4YFZA 3K2OA 3I2IA 3HR9A 3KM5A 2EVXA 2RS52 1RUI1 4QPIB 4HFSA 2XJPA 3I2GA 4LHSA 3WCSA 5FWJA 1GFF2 4LKEA 5FZGA 2KR2A 5C3PA 1QH6A 2B7YA 2GU9A 4FI9A 5FY9A 2DVAA 3SKVA 2X53S 2WFF3 3A4UA 4OHYA 3VBOA 1LOFC 3IMMA 4E2SA 4XIKA 3N9NA 3T08A 4Q0VA 2ZEYA 5FZ7A 2HLEA 1RXGA 2YC0A 3THPA 1I9RA 4BYYA 3ROUA 4UF0B 2QUOA 4AI2A 2WO2A 4BZ4A 3C7HA 1IG3A 3EBRA 3ILRA 3ZN5A 1YJLA 2PLV3 1X9PA 5LBFA 4UFHA 1UY1A 5FYSA 2DTWA 2PHDA 2MEV2 5EV7A 2XJRA 4QDSA 3IKWA 1GSLA 1UYYA 3ME2A 4GULA 3RMXA 3LCPA 5KC6A 2VTFA 2FCTA 5JSOA 4IV1A 3DECA 3LEKA 4RS5B 4U36A 3O1UA 2YY1A 2R16A 1UPSA 2FHRA 4A3XA 4C0HA 4XQWA 2BOJA 1NCRA 4H55A 1Q8SA 3LWCA 1MS0A 3VDCA 1KEXA 2XUEA 5DDJ3 3ABZA 3B5LB 3FLRA 3OEAA 4JKKA 4Y4YA 1W6OB 1QJY2 2ZX4A 3VBSB 1COV1 1JODA 2BYVE 1GYKA 2BNMA 3HPNA 4WVMB 5JXHA 1RVF1 4TYSA 4DO0A 2XL7A 4FTBA 1O4TA 3JU9A 4XF4A 3VGIA 1LU1A 1WZXA 1Z7S3 2PELA 2XGXA 3R6SA 1JYNA 1SQ4A 3E97A 2Z5WA 4KGQA 3VDDA 4QX7A 3BI3A 1RJ8A 1NXD1 2ZPXA 3F95A 3KCCA 1H1IA 1HV0A 2LROA 1W90A 5FWEA 1RUJ2 5A7PA 3UETA 3W5NA 5BNQA 4F7ZA 2VMEA 4QPGA 4GWNA 1ND3C 5GKAC 1RUG1 1OF3A 3MPPG 1PM7A 1ND2B 2WZR1 1EP0A 3U10A 4LE3A 2BJSA 5CG9A 1DYPA 3ZYGA 4N43B 2ID4A 3PVNA 5DAWA 2QQOA 4GMP1 4EZ4A 2X10A 4AI8A 2P6CA 3ACHA 2XVLA 2CDOA 1CAWB 3L9JT 2YGMA 1ULCA 2YG0A 4FAHA 4MGTA 5IYYA 2BBAA 1DQ1A 2OA2A 4JGYC 2VZSA 2GN7A 4L2NA 5DAQA 2GAUA 2NZ9A 3ATGA 4YM1A 2WZPP 1DQ6A 3WDYA 2KD7A 5DMYA 3GXUA 1VPHA 2J1VA 3OGSA 5C9AB 1BVP1 4MXWB 2I74A 4MZUA 4HPKB 5C8CC 3CO2A 2PMWB 1UAIA 4L92A 1QXJA 4WV8A 4AZZA 2ZHKA 1W2OA 1Y9MA 3GBFA 4LLOA 2NMOA 2J42A 1WW7A 4CP0A 1MEC1 1H8VA 1VBE1 2Q0AA 2VOWA 3BN6A 3CHXA 5FZ6A 4YW4A 3K4DA 1ENXA 3NV1A 3K77A 2O8OA 2P6HA 2ARCA 2OVUA 4FXKB 2JB4A 5LY2A 3B7MA 5JOWA 4O61A 1T6GC 4XF1A 2BQPA 1GP5A 4Q26A 1CIYA 5FK7A 4BQ2A 1JHJA 1PX4A 2VW1A 4XEZA 5I8YA 2PAKA 1G9DA 1VRBA 4BLIA 2X8KA 3LPGA 1VB4A 2OQ6A 3KGZA 3VZJA 2RM23 4FOVA 3RZLA 1PGL1 4UW4A 3AKRA 5A3MA 3WLUA 5IW0A 3DYOA 3FFQA 1OQDA 1PGW2 1O3TA 3V0BA 1SFPA 1QQP3 4Y3OA 5JXIA 2OQ7A 3OUHA 3RWNA 4D6SA 4L0PA 1H2MA 5A6YA 5DZFA 1U12A 4EN7B 4MH0E 1LULA 1WD3A 2CDPA 5ANNA 2ERFA 1AJKA 1ZYBA 3AX4A 4HOOA 4FO9A 1SLAA 4KG0A 2H0BA 2W52A 3QCWA 4PLNA 5D2AA 1AYN3 5APAA 1ULOA 5DZEA 3JD73 3BIWE 3VD7A 4IEWA 1DGLA 1TME3 4R9DA 4CDXA 4CXXA 4Q4V1 4UYBA 3ZSLA 5FZ3A 2VBBA 3BB6A 4Q0QA 1ZBE2 2B9UA 4E27A 2JENA 1ZZ7A 1O3QA 3MLJA 4AVBA 1TG7A 2W87A 3J7NA 2VW2A 2VMCA 1AR83 1QEXA 2W0XA 2ILMA 3SH4A 4CP9A 4LOSA 4CEYC 5KXBA 3N3HA 4UWDA 2HYXA 4WVVA 2R1BA 5FLIA 2J1SA 4QPIA 3ACFA 2JE9A 2HWC3 4HN0A 4BHPA 2P2KA 4UAPA 1DGWX 1XE8A 3N9PA 4AR2A 1J1TA 4EQVA 4Z07A 2CV6A 4ZU5A 4WM7C 3E5XA 4WVWA 5BNNC 4PDWB 3ZKUA 1IS5A 4UF0A 4DEVA 1REFA 4YVWC 5A7WB 1VBA3 5C3RA 4LORA 5DN2A 4ZY9A 2JWPA 5J7MA 1HKDA 2BPA2 4N7UA 4B8EA 4LE4A 4IESA 5LW9A 2XLGA 3MW4A 3JBG3 1C1FA 2A6ZA 2R0HA 4YW2A 1KITA 5GLUA 3M70A 4NHMA 2RV9A 4F83A 1X9TA 4YZ2A 3B01A 4PQQA 5ERLA 2VOKA 3HQRA 2VU9A 2YFUA 3ALQA 5GZDA 2EF6A 5LA0A 5H9QA 5AVPA 4S2DA 1UIKA 2V5DA 4Q5OA 4RS5A 3NRUA 2VECA 3I3DA 4I0WB 3AZVA 1QOSA 1FT9A 2C24A 2FMYA 5FDBA 1ASJ1 2D5HA 4G9SB 5KWRA 3R4SA 1W6OA 4XUTA 4Q0UA 3VBSA 1DCSA 1RTVA 3CMGA 4A3ZA 5A1FA 1X7NA 2C4XA 4WVMA 3ASIA 5KHGA 1HRV3 1S0GA 3K3OA 5FBJA 1STMA 3GBWA 4XJUA 4AHXA 1CN1A 5GJ6A 1MQTB 2E7AA 1HB4A 4FPEA 1XE0A 1J3RA 5FZKA 3WV6A 3OYWB 1QOOA 5F2SA 1EAH1 1R1A3 1BHGA 1W0NA 5FPXA 1VBC2 3AKPA 4HKOA 1JUHA 3VL8A 5FPLA 1YFWA 4W6WA 4L99A 4OMDA 5LBCA 1ULFA 1X36A 2HH9A 2WS92 3LSDA 4P9IA 5EHDA 3O1TA 3BCWA 4FPLA 2LUWA 2V73A 2JDNA 4AVSA 1JYVA 2A73B 3EQEA 2Z79A 3JQWA 4FP3A 5CZKA 4MSVA 2HWE3 1TMF2 1DYKA 4N43A 4FXGB 1FV2A 2GH8A 5DUWA 2ZKNA 2BV4A 5F39A 4QQHA 1LCLA 2OPWA 2PHFA 3FFZA 4YZ3A 1CAWA 4PLMA 1SBFA 4JGYB 2E31A 3EMRA 3W9AA 3WD5A 2PHUA 5GM0A 3GGLA 3S7IA 4KWLA 1JYXA 5AVAA 4Z1VA 2ZMKA 2VUDA 1FPN1 3VBOC 4FTEA 2QQJA 3APBA 1F8VA 5E6HA 3OGVA 3JB4C 1VIWB 4DUWA 2ZEZA 4IGOA 4MXWA 1OKOA 1XNBA 1FOD1 2RMU2 4HPKA 1POV0 3VHOA 1NYWA 3NNMA 4MX3A 5CB7A 2DVDA 2YBKA 4UXAA 4URTA 4PIYA 1I5ZA 2ZGPA 1YHFA 2PA7A 1M4WA 4Q8KA 4FFHA 3ZM8A 3LEIA 1NG0A 3RZMA 4AEJA 2VVDA 4BK4A 3M3OA 1HDKA 4RGKA 1RUI3 5FFOC 2IXJA 3X29B 1IKQA 2LW8A 3H3ZA 2J1TA 3ZSEA 4NHXA 1LHOA 2Q5TA 2RS32 5FY7A 5HCAA 3AJYA 4E2QA 2WLPA 2WR9A 1NZCA 1NCRC 1LENA 4NJ4A 4AK3A 4FSJA 2HWD2 1L7RA 4DQAA 3GHMA 2E6VA 3ZYHA 4MG2A 5E8AA 1RMU3 1FATA 1UOGA 4OI4A 1PO13 4NAMA 4NR1A 4QX0A 5L36A 5FYHA 3IDCB 3PMSA 4IETA 2WNOA 5L19A 3WP3A 1JZ5A 1AL0G 3VKLA 4RA0A 1IPKA 4P5HA 4O9EA 3MUY1 4XQDA 4FQ4A 2A70A 3VDDC 1DQ0A 2WRAA 4GALA 2NN8A 3CDZB 4YGEA 4YGCA 3ZYIB 2XWBB 3UT0A 3WW4A 3WUDA 4ONUA 1Y3TA 1ZRRA 2ADDA 4XACA 1S0IA 4Y5SA 3KMHA 1QOTA 3ZIWA 1JHNA 1HRI2 4PIZA 4BJ0A 2ZACA 3AP7A 4BXSV 1COV3 2RJLA 2Q8CA 2VULA 2XB6C 2N7GA 3RG0A 4E8CA 4YZ1A 5A3LA 5ACA3 5KHKA 5IVYA 4ZPIA 4Y4RA 1RVF3 1H9WA 1RUE1 2GDFA 4HK8A 1IG0A 1OC1A 1WUVA 1DGRA 3GZUC 5BV6A 5KBFA 1CJDA 2D44A 2DFCA 2ZMNA 3OB8A 5JPMB 1QJU3 1HQWA 4XCAA 5LB6A 4ZKTB 1O3SA 1SG3A 4S2HA 2VBPA 3AZZA 5IJRA 3T0BA 1BYHA 1TEIA 1JS9A 2QQWA 3WNLA 2F6BA 2E33A 3QOPA 4P9WA 4FCAA 3ZXFA 5EJ1B 2A6VA 2BGPA 3N9OA 2BNOA 2D43A 2UYBA 3O1VA 4I3GA 2WNUB 4P9JA 1RUG3 3N4MA 1BCXA 1XE7A 1SCSA 2BERA 1ODNA 2DU1A 3RSJA 3O1MA 4XFBA 3VLBB 2CU5A 2B42B 5FPUA 4HSLA 2WC2A 4PBPA 4YG3A 1ENRA 3J7LA 3HNMA 5FIXA 2ZGKA 2XONA 1K3IA 1W8OA 4PDWA 1KDMA 2GC1A 1UWWA 4ZU4A 1JMUB 4IEUA 4XBLA 4DXZA 3N7JA 3PMEA 1TVGA 2RS51 3T2TA 2RR12 2V72A 1KJRA 1Z7S1 2IWGB 4JVAA 5IVVA 1YI9A 4NWWA 1QNYA 4PF5A 4XF3A 4AQ2A 1ALYA 4C91A 4UW5A 2AR6A 4BQ3A 1F15A 3SQOA 1SFYA 1IS6A 4IUGA 2DCJA 2XLFA 3ETPA 2XUMA 5FYYA 2Y6GA 3FX3A 3MLKA 4JRAA 3UGHA 2F4LA 3D0JA 3VKFC 3ZXDA 2XBO2 5CA6A 5HV4A 4FAGA 1MEC3 4A44A 1R092 2ZBJA 4LBOA 4CCJA 1SCRA 5FTTC 1YI7A 2TBVA 1NE4A 1CQ9A 2R49A 1PM4A 3J8F2 5AC92 2QVSB 3M2MA 4GJYA 2GMMA 1PMIA 5GLTA 1NKGA 1XC6A 4QX1A 4CXWA 3C7GA 1W6QB 4AEDC 4D0QA 2MEV1 1RJ7A 2BGCA 2BGOA 2GC0A 4XJWA 3CIHA 4LTAA 4N90A 2AH2A 3SLIA 2E7TA 1MQTA 2XDVA 2P3YA 3ENRA 3P5BA 4RL7A 1MZFA 1XXNA 4AXOA 4HVQA 5A6XA 2JD4A 3S0MA 1H9PA 2PQSA 3OYWA 4CDXC 3WX5A 3DGTA 3KT7A 4FFIA 3AC0A 1MZ6A 2P37A 4K40A 4QXKA 2QQPA 3L2HA 2ET1A 2D3SA 3K51A 1RIRA 3ZDSA 1BBT2 4SBVA 4R9AA 4B1MA 4XJ9A 1QJY1 1Q3EA 2YYOA 4Q27A 3CLPA 2HYKA 1WGPA 4QU1A 1GQHA 2VCAA 4I09A 4X6RB 1ODMA 5BNPC 2ENRA 4ZXKA 4CUBA 2WWUA 2CWSA 1H4GA 1AR72 4MHUA 4LK6A 4HONA 4TN7A 4XJ8A 3NKTA 4QPIC 4D3WA 2E7QA 1UXZA 2OS2A 4ARXA 1WWYA 4OCTA 5LZ6A 4OI0A 4DXTA 1FYUA 1T6BX 3LFMA 4JGYA 1KS5A 5G04L 3I2DA 3OG2A 4RYDA 1VE0A 4LNVA 4HETA 2BWCA 4C1XA 2ADEA 5DABA 1JTZX 3OUJA 1J3PA 4JGZB 2ZHMA 4DIQA 3BKZA 3A22A 1C8M2 1JOPA 1W6MA 1W8WA 2GC3A 4BWOA 3H1WA 4Y22B 5KHHA 4E4DX 1IS3A 3RPQA 5C6CA 1NT0A 4NPRA 5I0SA 4WM8A 5DG2A 2JB8A 1SLCA 1TNRA 3DF0A 3KQ4B 3KLSA 3H8OA 1UKGA 5FLJA 5BXXA 4CPBA 1NA1B 3VB9A 5FUNA 1UKRA 3KQRA 4W6YA 3T4HB 1OMIA 2ORZA 1B09A 2VZUA 4LXLA 4QKNA 5D8AC 4GH4B 1UU6A 2Y6FA 4RS5C 5C3SA 1A6CA 1ZVFA 3DYMA 5JMOA 4XW3A 3WINE 4FPCA 1IQDC 2BOIA 3JD71 1YYNA 1Y4WA 4SLIA 3VZNA 4A2UA 1PZ9A 4EN8B 1TME1 3KV4A 1SLTA 3VBSC 3POEA 5JIAA 1UYZA 4L9BA 4B29A 4BQ5A 3W5MA 4X8NA 4XUNA 5LA2A 3S7EA 5A3NA 3AMNA 1JZ3A 2EIDA 3OJBA 5C4WB 2RDQA 1V6OA 1QY4A 2VZ3A 3UK9A 1LHNA 4ISRA 5GLZA 4CCLA 5L9BA 3TOJA 2WNVC 5A1AA 4O7XA 1AR81 4QKFA 3VKNA 1S0JA 3AB0A 2E53A 1Q56A 2XJUA 4HG6B 2X09A 2VW0A 2EA7A 4Q0PA 5KC5A 1GWKA 4YG6A 5FXZA 3KHBA 3ZPYA 3PLQA 3PTYA 4R9CA 1XNDA 3ZFFB 3W20A 5FZLA 1BVVA 1SACA 3HEIA 3KV6A 1PGW1 3B69A 4J1XA 2R042 1UOBA 2W1UA 4N43C 3VBFB 3VBRA 3WF0A 2CNAA 2PQQA 4FOQA 5FUPA 1M06G 5LA1A 2XWJB 4QXBA 2VPVA 5HCFA 3Q8EA 1W9FA 3VKMA 1GZCA 5TSWA 1EAH3 1WCSA 2TUNA 4TXWA 3RI9A 1I1EA 3UYJA 1ZX5A 3B02A 1OOPB 4RFRB 1Z78A 2RS12 3PTRB 3WQ0A 5KXEA 3B9IA 2ZXQA 4JV4A 2WT1A 4OHWA 4H7LA 2AACA 2R072 3B00A 3CZUA 1GKBA 2VZRA 5CFCB 2D3PA 1C5HA 2AGSA 2WNUA 4YGDA 2ET7A 4FOWA 4M3CE 5CKNA 3K46A 2C26A 4LBQB 3GJBA 4NMIA 4BH9A 1LU2A 4U2AA 4XE9A 2SBAA 2QDNA 2G19A 4Z92B 4K3UA 3V65A 1HJGA 2OUHA 1X33A 1VBB2 1L7QA 2WBKA 1W8NA 5K0UB 1FPN3 3C7OA 1HRV1 2Q1MA 3WNKA 4YZ5A 2FDKA 1AR93 2ZGTA 4BCUA 1RINA 4YG0A 4YFWA 1CX4A 3PURA 5LATA 3SMHA 2D6PA 2WWJA 1FOD3 3POWA 2DBNA 1D2QA 1QJX2 3DXTA 4W6XA 4D8MA 4AI3A 1K42A 1UN1A 1SBEA 1LR5A 4EWEA 4INDA 5M0TA 2BZDA 4Q4Y2 1PVC2 1RUC2 3WG2A 3WHTA 3ZXJA 1N3OA 5FY4A 4QXCA 1MACA 4GQ7A 5A7QA 1OQEA 2A1XA 1SLBA 2A3WA 3MO4A 1UY2A 4GKYA 4FPFA 2ZGUA 3MF6A 1J84A 4OFGA 4AEDB 1W6QA 1N1VA 3N7MA 4JTOA 3E5QA 5CYYA 1AX1A 1V0AA 1URXA 1UZZA 1CX1A 1UU4A 4Q1RA 1UX6A 4CDXB 4ZZ8A 1ULPA 1VAKA 2RVAA 5A1LA 3BYWA 4DUVA 3WW2A 1CPNA 1UY4A 2TNFA 3T2PA 5FZHA
chains in the Genus database with same CATH topology
2YXSA 2ZGLA 4OLLA 3OCPA 1R083 3RYPA 1MS9A 2Z2SB 5HXVA 3A0NA 3HN1A 5I8SA 5BNPB 2QZ2A 4XIOA 4BLJA 2DTYA 1PNGA 2A7AA 2P3IA 3HT1A 2EIGA 2CGPA 1JBCA 3KSCA 1D0GA 4OVEA 2D6MA 4KQ7A 2BFUL 4ISQA 3LOIA 4XFFA 1EPZA 4HVOA 2QKDA 3UL2A 1J3QA 1RUE3 1H1AA 4LHNA 4FBFA 4RGGA 4JGZA 5BYNA 5CG8A 1RMU1 4LO8A 4PDWC 4M0HA 1PO11 3R05A 3H0OA 3MEPA 4Y22A 3KD4A 1JYIA 3RS6A 1FMD2 3RMYA 1KJLA 3WG4A 2WIIB 4AHZA 1NA1A 1GZWB 3ZSKA 5D8AB 2HWB2 3O0XA 4JDOA 4GH4A 3J26N 2XJTA 2AYHA 2VUJA 2RMU1 4YNIA 5FAXA 2PTMA 1MS1A 2VMGA 1O4YA 4MGYE 1AX0A 3AMMA 3OBRA 2WA3A 5I91A 5ACA1 4GXLA 1LOCA 1VAVA 2H6BA 5J48A 2RS53 3BU7A 1EV12 1HQLA 2IXLA 1S0BA 2JDZA 2D7FA 5C4WA 1MQTC 2CTVA 3J9SA 4K9SA 4FPKA 1FV3A 3QH6A 1D2SA 1QJU1 1X8MA 2WNVB 1PHMA 2RS31 2A6YA 1VRH2 4NVPA 4IEZA 4RHV2 4WVZA 2HWD1 2E63A 1W2UA 3JB8A 3O12A 1AX2A 5JMCA 4COWA 1N1YA 1D4VB 1RUH2 2D6KA 2A3XA 3ZSMA 3ZFFA 1JW6A 1LECA 4R8HA 3VBFA 3AMHA 4AFCA 2MEV3 2VNRA 3ILFA 5E16A 2XLAA 3AZWA 2BEOA 4GB32 3T1MA 2Y26A 1UCXA 1NE6A 2GN3A 1YIFA 2UY8A 1CD3G 4MYEA 2PHXA 2WA4A 3I54A 2X5IB 4XBQA 4AGGA 3VKOA 1OOPA 4M0NA 4RQPB 3GNEA 3NVCA 1HRI1 1QJY3 4ASMB 3WDXA 3LB9A 1G86A 3HT2A 5CFCA 5JI7A 4WM8C 1ULGA 5DG1A 2ZJCA 4LT5A 1IGOA 2ZGMA 3LAGA 3ZXEA 1XYOA 3KCXA 4LBQA 2VMIA 3CJIB 1V6LA 4AHWA 5K0UA 4R9BA 1RUJ3 3ZIXA 4JDNA 1FNZA 3WXPA 4B7KA 3RYRA 2XKPA 3ETQA 4AVAA 4EN0A 2YZ4A 4OHXA 3U11A 4AI1A 2R30A 4GA9A 1POV3 1J58A 4LBNA 1DU3D 1NCQC 1ZRDA 1V6JA 1AR62 1N3QA 2X29A 1ZZ6A 4ORFA 1PNFA 3DPRB 5BUVA 1CR7A 2Q4SA 3PHMA 4OHVA 5FMOL 1O91A 2RR11 2Z69A 4AEDA 4X8PA 5K9YA 1I3HA 5AFBA 2K2SA 4AF9A 4E2GA 4F8AA 2ETEA 2HWC2 4QM8A 2CL2A 2HWF2 4E9KA 2A5ZA 4P9LA 2YROA 3MICA 3VZMA 2WJSA 1AHSA 3VBRC 3VHPA 2XBO1 1R091 5EZWA 1RC6A 3FBYA 2JKBA 3QH7A 3L2YA 3HAGA 2NLRA 3J8F1 3ZX7A 4COUA 1MS4A 2A75A 2P34A 1NY71 1RUOA 4EV0A 3E6DA 4I2OA 3ZXKA 2RJKA 5BNPA 1PK6B 4LBLA 2C5DA 4K1YA 3IBMA 3TAYA 1U5ZA 1C3HA 2WNUC 3ECQA 1SBDA 1BEV2 1V6IA 2YPJA 1LODA 1TNFA 1WLWA 2IFRA 5DXDA 4HBNA 1BBT1 1D4M2 4P14A 3ES4A 1W0PA 4Q0SA 4L8QA 1KDKA 2W68A 2ZKLA 1NLSA 1H1MA 2E51A 4QQOA 2W08A 4LR4A 3W59A 1AR71 1DQ5A 4CRQA 3FC0A 2O1QA 1NQDA 3RDIA 2JXAA 4B4QA 3WNXA 2ZTNA 1U5YA 4KU7A 4Q4W2 1GZWA 2VNGA 1KFXL 2DF7A 5D8AA 1YUDA 3H7YA 4HKWA 5LEJA 5T3NA 3MI8A 1LGCA 2OUJA 3ZFEB 4LULA 2DYCA 1ZBE3 1C8M1 3OGJA 2DUPA 4M3CF 3FJSA 1RUF2 3NJZA 4D7TA 1LKNA 3P3NA 1QU0A 4NHKA 2WINB 3WDTA 4HZFA 3B3QE 1F5JA 4Y20B 1QXPA 4BOWA 3BOPA 3E5UA 2WNVA 4AQSA 4UBGA 3MF9A 3BODA 1QWRA 4EWAA 2NYYA 4XXAA 1S1AA 3PVEA 4OUMA 4QQLA 2CGOA 3EXUA 3NSTA 4K20A 4XQ4A 3DKWA 1V6KA 4ATFA 4C1WA 1ZBA2 4RGAA 1DIWA 2CAVA 3KS7A 4LHLA 2ZMLA 3RYKA 4Y1VA 5LRRA 4HMZA 1U5XA 4RSUA 1QH7A 1AR91 1OA2A 4EROA 2X5IA 1NQJA 5LK7B 3TYJA 1YFXA 4JGZC 4RQPA 1W6MB 3FLTA 5FO7B 1C5IA 4DRVA 5CFDB 3WP4A 1Q8OA 1F5FA 3FBMA 2D98A 5IK5A 1DGRN 2DCZA 3VV1A 3U07A 1SMVA 4WM8B 3WZ1A 3TN92 3Q9OA 1G9FA 4Y1UA 4LUMA 4BE3A 4Q4X2 3WHUA 4QQPA 3SISA 4B4RA 2BUKA 1NA1C 3QBQA 1QKQA 3USSA 3E6BA 1BK1A 1VBC3 2LTNA 3MIBA 3CJIA 2DFBA 5T54A 4GH4C 2RS11 2MPFA 2P3KA 3FLPA 4Y5Z0 3T1LA 2WS93 4QGMA 1GQGA 3EHKA 2R071 5A32B 1IPJA 3LA3A 5KXCA 3HIFA 3IDBB 1MR5A 3UV9A 1NCQB 1TMF3 5C4WC 1LHVA 1R081 2AREA 2B46X 4DS0A 2C0ZA 4QMAA 1VBB1 3JQXA 1V9U2 1WW4A 3DPRA 4MVTA 3MIEA 2UWBA 4H3WA 3ZXGA 2R062 4IL7A 1HQNA 2RMU3 2BNNA 5FO8B 1QJX1 4PCRA 3O0VA 3VZOA 5LRSA 2R1DA 1LTEA 4I0AA 2WZR2 1UZYA 3ZFFC 4R4XA 2XJQA 3VBRB 3KGLA 4Q4Y1 1PVC1 2MNGA 2WNEA 4HANA 1RHI2 3VBFC 4N53A 3H3UA 1ZZCA 4LUKA 4AVCA 4UW6A 2RS33 2I45A 1H8TB 3KZ4C 1SDWA 2GSYA 3HMYA 3WP5A 1OOPC 2B39A 1BMV2 1SEFA 2HWD3 3ST7A 1PK6A 4AHYA 1G9AA 4IEXA 5DUVA 4QX5A 1S0FA 1ZZ8A 5GALA 5EXOA 4KH9A 3LA7A 5CFCC 1J59A 1PIV2 3MZHA 4K7JA 4N7IA 1VBE2 4LO5B 4YM0A 4D7YA 4FPHA 4M00A 3OGGA 2ZX2A 3ZMOA 5J09A 3GZTB 3MGUA 5AFEA 3PNAA 5K0UC 1AVBA 1W0OA 2DV9A 5EYXA 1HRI3 1A3KA 3GHNA 2ZZJA 4MGZE 4EN6B 2C1FA 3TB0A 2OYZA 4N9HA 3ZFEA 1IQAA 3ELNA 3DL3A 3PVBB 4NHLA 4DINB 2BFUS 3NWKA 1VBD2 4LBQD 3MIGA 4ZU7A 3D82A 5SV5A 4Z2WA 1NOVA 2ZOEB 2UU8A 1S2BA 1FX5A 2DU0A 2ZX1A 4K8FA 4TSVA 2GALA 2HWB1 1YLLA 4Y20A 4Q4V2 1WMFA 3MW2A 4FP2A 5JIUA 3HD8B 3SNMA 1CIWA 2V09A 2HJIA 1UU5A 2B5HA 1MVQA 3POYA 2CAUA 5T5PA 5FO9B 2OW4A 5F5QA 3FZ3A 2PAMA 5JZGB 3CJXA 4QQ2A 4XXPA 4I02A 1Q5OA 5IK7A 1EV11 2QE3A 2RR13 4KWKA 3ES1A 4AQTA 4C0BA 2HEYF 1VRH1 1BKZA 1YRZA 4L97A 1RUD2 1QHDA 3D5OA 3M8LA 4E4SA 1UF2C 1RUJ1 5JSPA 2RE9A 2XBO3 1R093 3I59B 1DZRA 2VG9A 3RJRA 4I01A 3M7AA 3J8F3 5AC93 1RUH1 3GALA 1Y43B 1ZNPA 5CFDA 1K5MB 2DCYA 2D93A 1POV1 2ZZQA 5LK5A 3SHRA 4F3JA 1Q43A 3MDPA 1FAYA 3D4KA 2JICA 4XFAA 2VNOA 4GB31 2QDRA 4AFAA 3A0KA 1CJPA 3FMGA 4E4ZA 4ITCA 2VVEA 3MIDA 4LBMA 1IHMA 2O8QA 4JDMA 2UURA 4TWTA 2ZS6B 1BBT3 5JDBA 1ASJ2 5A32A 1C4RA 2GMEA 2VGDA 5F1RA 1XYNA 2ARXA 2WWSA 3D8CA 3DUIA 3M3EA 4YW1A 3RRDA 1BXHA 2UWAA 4YVSB 1AR73 1NCQA 2R32A 5HCBA 2H0VA 4S2GA 2PHWA 2H6CA 4BMEA 3AKTA 3ZYJB 4B4PA 1WLTA 4XBNA 2YV8A 4FPYA 1O5UA 2Z42A 4HT1T 2PYTA 2FMDA 4MGIE 4CDQB 1AXYA 1QJZA 1C8M3 1OQ1A 1GZ9A 1G7YA 5T5LA 1PZ8A 2OZ6A 1LOBA 4PLOA 4DB5A 2PHTA 1ZZ9A 1AYM2 1LEDA 4RFT0 1I6XA 3INAA 4CP2A 4COZA 3DN7A 1PO22 1GLHA 3QACA 4PBOA 3IN9A 2ZAHA 1LOEA 1HXS2 1DBNA 4JAAA 1H8TA 1QGLA 5GZEA 3ZN6B 1DFQA 3VBUB 3URFA 4AVTA 2D97A 2X5IC 3VBHB 1Q8QA 2ZHNA 1N3PA 1GANA 4Q8LA 3G6JB 4RQPC 1HX6A 3D0SA 5FQ0B 2Y38A 4GMP0 1H30A 4DOUA 1LGBA 1CAUB 1QXRA 4G3YC 4XFIA 5DZGA 4YW3A 1ZBE1 1H2LA 4KU8A 4CDUC 3H7JA 4M3CA 4IEPA 4OUSA 2FBEA 3WCRA 1YIPA 3CJIC 5FRAA 1XYPA 2R0FA 4WZCA 1AL22 2Q1ZB 4LO4B 2XPJA 3LKJA 2GZWA 3UKTA 5JSRA 1KXGA 4YLZA 1WA4A 3TNQA 3SXWA 1UD1A 3VUOA 4LO6B 2HEWF 3R4UA 4S2FA 2GNMA 2R043 3HBZA 3MFAA 2G9FA 3ZYRA 2YMZA 1GNHA 1GBGA 1LHWA 5T5OA 1D4M1 2VMHA 2LALA 4YYOA 3SITA 3M1HA 5GZGA 2V5YA 3B94A 3DPRC 2VOVA 4IEOA 3OBTA 1Y7BA 2FQPA 4FPOB 1PVXA 3MLLA 2RS13 5F9TA 1G8WA 4MV2A 4NO4A 1ENSA 1ZZBA 2R073 2GNDA 4BQ1A 3AXDA 3HWJA 4XF9A 2WFF2 4XPVA 5JCTA 2YUEA 2A3YA 4XJAA 3VN4A 4XETA 3NAPB 2JECA 2JG8C 5FPZA 2JE7A 4N53C 4XMAA 1HIXA 2EAKA 4AWDA 5J96B 1RUF1 5CBLA 1IZ3A 4AVVA 4XOGA 3S30A 1REEA 4AFBA 1UMZA 2EAAA 1QDCA 1VBB3 1S0CA 2B8MA 1G6NA 3UKNA 2PLV2 3N7KA 3WUCA 5JZGA 1CESA 3FUOA 1PK6C 2NPIA 3V0AB 4CTEA 5I0TA 3MPBA 3VZKA 1QJX3 2JG9A 1Z0HA 1VBC1 3CU7A 1BZWA 1YNAA 4RR3B 2ZX3A 4CEWC 1NLRA 2BWAA 2QJVA 5JAXA 4FVVA 2WS91 1PVC3 1RUC3 4Q4Y3 4AFMA 1AXZA 3CL1A 5L7OB 5DDJ2 2DVBA 5EJ3A 1VAMA 3I59A 4P9YA 3J4UH 4XJZA 3TNPB 4G4FA 4XFHA 1ZA4A 1PZ7A 1WLDA 1K5MA 1TMF1 4N9IA 4XDQA 2JEMA 1Z7S2 1RITA 2NMNA 1AXKA 2E9QA 1XNKA 3GBGA 3WY6A 3VZLA 1S0DA 5FOJB 2I07B 4CP1A 3WW1A 4HVRA 1U0AA 2PN5A 3ZFEC 2CWMA 4JCKA 2QZ3A 3AYAA 5ABJB 5HBAA 1N1SA 5H9SA 5CNAA 3U4XA 2IXKA 5IK8A 5I0UA 3TN91 4Q2FA 2UYAA 2Q8OA 4Q4X1 3ACLA 2FZ1A 1O5LA 4YVSA 1AF9A 1OLRA 4ATEA 4AW7A 1UL9A 2ARBA 1F2NA 3OD4A 4H7MA 4OULA 1KD7A 2DUQA 4KGGA 3UJQA 3O0WA 3OY8B 2UWCA 4CDQA 1LB2A 2D5FA 4V1PA 1SLIA 1F31A 2AENA 4DPNA 3THTA 5FBZA 3TBDA 2EXIA 1LOAA 1PGSA 3OPZA 1C8NA 1FMD3 3NV3A 1TQ5A 2K9ZA 2OPKA 4I0BA 1U5IA 3V56A 2IXIA 1V9U1 2HWB3 3POSA 5JLVA 4Z8BA 2R061 2GNBA 5FCCA 3ZN6A 4A7ZA 3VBUA 1X50A 1G9CA 1KRIA 3VBHA 1CAVB 1D0HA 2PHRA 3CF6E 1O4ZA 1RGSA 2RM22 5FQ0A 4XILA 5CFDC 2DUOA 3N7LA 2VUAA 3NL1A 2NQYA 1RHI1 1QQP2 4QGNA 1CAUA 1EV13 1DQ4A 4CDUB 4MGKE 4DY5A 2DCKA 2WT0A 3AXEA 1VRH3 5BY5A 1CVNA 1NXMA 5BNOB 3V64A 4Y1YA 4RHV3 3AKSA 4OZXA 4OHZA 4Q1PA 3W58A 1BMV1 1AYN2 1B35B 1W6NB 3JD72 3FUQA 4Y1ZA 1TME2 2R6QA 1RUH3 4KL1A 4ASLA 3KB5A 2D6NA 1PIV1 2W39A 4DY3A 1V70A 4GWMA 4AEMA 1YO8A 2AUYA 2YHJA 1REDA 4MLOA 5E89A 4GB33 4EN9B 1MZ5A 2ZA9A 5J3UA 1AR82 4FOYA 1MVEA 1OFNA 3B9CA 5JI9A 1DG6A 4O9GA 2GC2A 4PIXA 4I3PA 4DMIA 1VR3A 2XL9A 3OD0A 2F4PA 4JRLA 2CGNA 4QM9A 3DV8A 2NM1A 4HKLA 1YWKA 3MIFA 1HW5A 5J36A 1A8MA 1X82A 2JG8B 3UKVA 4IQPA 4N53B 3NAPA 1ZREA 3NV2A 2MHFA 5AC91 1VBA2 3C3VA 1H8TC 1VBD1 3AYDA 4LHKA 3MFCA 3I4IA 3JBG2 3ILNA 4BPZA 3V0AA 2WFPA 1LOGA 1H0BA 2D6LX 1IKPA 3NV4A 4CEWB 3FE5A 4RR3A 5E88A 2G4IA 3K48A 1RB8G 1UPIA 5FOBB 5IT6A 1H2KA 1YFYA 2PHLA 5HI0A 1AR63 1UIJA 2ZX0A 5L7OA 5GLWA 1FXZA 2BVBA 2QFEA 4FPGA 4Y1XA 3WDVA 4J6GA 5K8SA 3ZFGA 2ZGRA 1HRV2 4XMIA 3AP6A 3R0RA 2AZ5A 3PJQA 1R1A2 2HWF3 1XNCA 1ULEA 2WQ4A 4DRRA 5SV8A 2WT2A 1RUD1 4C90A 3EO6A 3VL9A 3ZVXA 2DVFA 2XH6A 1MS3A 1IOAA 1LESA 1FNYA 2VQ0A 2WLQA 1DF0A 3PVOA 4QT6A 5ABJA 4RD7A 4XYXA 3ZN4A 2HWE2 3IPVB 1LGNA 1UW8A 4JC1A 1L3JA 1OA3A 2EXKA 3ZSJA 5JVVA 3VHRA 3AMQA 1EY2A 1X8EA 1DDLA 1BEV3 4DNYA 4TZDA 3IIAA 1GR3A 1Q8PA 4XFGA 1ONAA 1MS8A 2HEVF 4KG8A 2EXJA 4COYA 1D4M3 3RNSA 1DHKB 2Q30A 4CDWC 3WOGA 4Y26A 1AJOA 3OY8A 5DUXA 2KA3A 1G9BA 5BPXA 1XQNA 3AP4A 1W6PB 3AYEA 1EPWA 5JZGC 1APNA 2C9AA 3O14A 4IV3C 1RUI2 3JCIA 4IERA 5CU1A 4XTMA 3QD6A 1J1LA 3H1MA 2JG9C 1WMEA 1R1ZA 3M3IA 5DUUA 5EWSA 4NOTA 5JPNB 4Q4W3 4EJRA 3SCGA 4GIQA 1VALA 4K21A 3H1YA 4WZFA 4JTNA 4AQ6A 3IDEA 3IWZA 3NO8A 3IT8A 3BALA 3JZVA 1ND3B 4AI0A 1RMU2 1RUF3 3O5SA 1CAVA 3AZXA 4META 3BTAA 5GZCA 1PO12 1ND2A 4UW3A 1K5MC 2R041 3NW4A 4OI1A 2KM2A 2P3JA 2VOXA 1AYM1 3I8TA 5JOYA 3NKGA 5FREA 1C57A 1PO21 3EJKA 3MW3A 4CDUA 2HKXA 1Y9QA 4KWJA 5H9RA 4MUVA 3H50A 1HXS1 2ZHLA 4IEYA 4BA6A 4IXLA 2VVFA 1SLLA 5BNOA 1JH5A 5C9AA 4PJYA 1FI2A 3AFGA 2EXHA 2RHPA 5C8CB 4GKXA 5LEKA 4I30A 1O3RA 1B35A 4W65A 1W6NA 2ZAAA 2BW8A 1CPMA 1COV2 1XU1A 5KHIA 3BPZA 4K1ZA 2XVGA 1ZBA3 5ACA2 2OIIA 1RVF2 1DQ2A 4MXVA 4QPYA 3CEWA 5KHJA 1A8DA 4YVSC 3WT3A 4BIOA 4IV1C 1QJU2 2IXHA 2KXLA 2P17A 4QD2A 3RJ2X 1S55A 3H8UA 1AL21 4XFCA 4YARA 1ENQA 1EYBA 3WDUA 2GNTA 3H9AA 3U0ZA 1KS4A 4CDQC 5JOXA 1WCKA 1RUG2 2G9GA 3AYCA 3GF6A 1DZQA 3LSEA 4HK9A 3TN93 1RUC1 4Q4X3 2JG8A 1WBLA 3WG1A 1OFSA 1W39A 5C8WA 3P3PA 3IMNA 3OF1A 5KXDA 3R4DB 4LEJA 3HQXA 1LHUA 4HN1A 1DGWA 3VBUC 4QPGC 1CAXB 5T50A 5T52A 3VBHC 3LOBA 2ES3A 1HLCA 4XHXA 5JR7B 2WFF1 2XJVA 2NP0A 5I8TA 3B93A 4AGVA 4CEWA 3BOWA 3USUB 4ES9A 3LA2A 1H4HA 4LO7A 1MEC2 5L73A 4M3CB 4NN0A 1WMDA 5I93A 4DFSA 3AP9A 3AFKA 5K7PA 2PLV1 4H14A 2IFWA 1V9U3 1WW6A 2XVKA 4CEYB 1V6NA 2R063 4BM8A 1V6MA 1OI6A 4LBJA 1OA4A 2UY9A 5JWPA 1AZDA 2WZR3 3D6EA 1PGL2 3N36A 1GV9A 1LOFA 4GMP3 3WQ1A 4B3NA 4CYDA 1RHI3 5A33B 5DDJ1 4WM7B 3OTFA 5BNNB 2XJSA 1DLLA 1A78A 3I7DA 3M3QA 4HSJA 4YVWB 4QHBA 4FT8A 3VHNA 4P9GA 3AMPA 1S0EA 2GMPA 4AYUA 4R52A 3AP5A 2D40A 3AJZA 1JN2P 1LJ7A 3IPVA 1FMD1 1F9KA 1VLNA 2XG3A 2ZGSA 3MYXA 5GZFA 1RL3A 4B7EA 1QNWA 1OD5A 4LBKA 3WW3A 1PIV3 4Q29A 3RQ0A 2YDEA 1VBE3 2PFWA 5J98B 1VB2A 3NAPC 4HL0A 2A6XA 3UJOA 4CDWB 2WSUA 4R4ZA 1YXWA 2WQZC 1NY72 3AZYA 4L11A 5GLVA 3WP6A 1VJ2A 1KQRA 3AM2A 4A7YA 2DVGA 1W6PA 4P9XA 4XTPA 4IV3B 5IUQA 1O7FA 3GZAA 1RUNA 1OSGA 1LRHA 1OPMA 2JG9B 4YZ4A 3SH3A 2OZJA 2SLIA 4AEKA 4RHV1