5L7OA

X-ray structure of triatoma virus empty capsid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
230
Chain Sequence
DEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein
total genus 46
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08762 CRPV_capsid CRPV capsid protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oA00
1ND2A 1VAKA 5L7OA 1RVF1 1C8M2 1FMD1 2RM23 4Q4W3 1AR92 3JB8A 3JB4C 5FMOL 1ZBE2 4QPGC 2RMU3 5C4WC 1ASJ3 1ZBA3 1R092 3ZFGB 1RUC3 1R1A3 1FPN3 1EAH2 2R063 3IDEA 3FBMA 1FOD3 3VBFA 4Q4Y1 1EAH1 1TME3 1Z7S2 1VRH1 1AYM2 5AC93 1QJY1 2GSYA 3ZFEC 1RUH2 1H8TB 4RR3C 4QPGA 1VBA2 1PVC2 1BBT3 4JGZC 4GMP3 5JZGC 1QQP3 5AC91 1COV3 1RUJ3 2HWC2 1VBD2 3ZFFB 5AC92 2PLV1 1NG0A 1CD3G 2WS93 1QJU3 4YVWB 3NAPB 3S6PA 1AR63 1FMD2 3CJIB 5ACA2 1H8TC 1RMU3 1PO12 5ACA1 3TN93 1D4M2 1RUI1 4YVWC 4CDQC 2RM22 4Q4W2 1RUI2 1IHMA 1PIV2 1QJU2 2ZZQA 4RQPA 1EAH3 1FOD1 5BNOC 1PIV1 2ZAHA 4Q4Y2 1ZBA2 4JGYB 4CDUA 1VRH2 1X36A 4GH4C 5A33B 2TBVA 1ZBA1 4WM8C 5A32B 3VBFC 1VBC2 1BMV1 1BEV1 1VB2A 5BNOB 3CJIA 3VBUA 3HAGA 4CDWC 2PLV2 4IV3C 5BNPA 4CEYA 2RS32 1AR83 1HRI2 1MEC2 4RS5B 1M06G 1K5MB 5C9AB 1PGL1 2Y26A 1POV1 2RMU2 2WS91 1AR62 5CFDA 4Q4V2 3DPRA 1OOPC 5J98B 2PLV3 1AYN1 4PDWC 5K0UA 1NA1B 1VBE2 4QPIA 3VBSC 1BBT1 1RUG3 4CDXB 5J96B 5BNOA 4GH4A 4IV1B 2HWD3 1RUI3 4Q4V3 3ZFEA 1OOPB 1RMU1 3VBOA 3VDDA 2MEV1 1VRH3 2HWB3 1C8NA 4CEWA 3VBRC 4RS5A 2R061 4IV1C 1R1A1 5BNNC 2HWE1 2DF7A 2R062 1RUF3 1QJZA 1RUC2 2MEV3 4Y4YA 5C4WB 1RUJ1 1R093 2XPJA 1COV1 1MQTB 1NA1A 5BNPC 3VBOC 2WFF3 1QJY3 2WWSA 2BPA2 4JGZA 2BUKA 1AYN3 1TMF1 4Q4Y3 1EV11 5D8AC 1TMF2 1F8VA 4QPIC 1QQP2 1AL0G 4PDWB 1BBT2 1HRV2 1QJX2 1AR71 1ASJ2 3VBSA 4FTEA 4N53C 5C4WA 5CFCC 1X33A 1FMD3 2ZTNA 1NOVA 1B35A 1R1A2 5DDJ3 4IV3A 4RFT0 2RS51 3ZFFA 3JBG1 1V9U1 2R073 1NCQB 1ZBE1 1VBA3 3JBG2 3NAPA 5C9AC 5L7OC 1C8M3 2RS11 5CFCA 4NWWA 3VBHC 4GB31 3J8F3 1Z7S1 1POV0 4GB32 1ND3B 1FPN2 2HWF3 5C8CC 1RUH1 4CDQB 3VBHA 1RHI1 1HRV1 1HRV3 4RHV2 1PVC1 5K0UB 5GKAC 2BFUL 3LOBA 1RUD1 4RHV1 2RR11 1VBD1 4YVWA 4GH4B 3JD72 4JGYC 1RUD2 2R043 1RVF2 3JD71 1ND2C 1RUG1 5DDJ2 5CFDC 3ZFFC 3VBOB 2R041 4CEYB 1B35C 2R072 5JZGB 1MQTC 2QQPA 4AEDB 4RHV3 1AR91 4WM8B 1VBB1 1K5MA 1TME1 4CDUB 1VBB2 1AYM1 4CDWA 5CFDB 1PGW1 5FMOS 1D4M3 4WM7C 2FZ1A 1PO13 1GFF2 2BFUS 1W39A 2WZR3 4JGZB 4LLFA 5ABJA 1BEV2 2HWC1 3ZFEB 3DPRC 2XBO1 4N43C 1F2NA 1SMVA 1VBE3 4AEDA 4Q4X1 2RS53 1NCRA 4GMP0 1MEC1 4Q4X2 2HWB2 2X5IB 5L7OB 1B35B 5ACA3 1AR82 1HRI3 4N53A 3VDDC 1TME2 4IV3B 1R091 1FOD2 1PO11 1D4M1 4IV1A 1PO21 3VBRA 1AL21 1ND3C 4N43B 5LK7B 1NCQA 1AL22 1QJU1 4YVSA 3ZFGA 1PGW2 3VDDB 4CDUC 2X5IC 1VBC1 1BMV2 1QJY2 1AR93 1NY72 1PVC3 4PDWA 5K0UC 3NAPC 1NY71 4WM7A 1ND2B 1AL23 2XBO2 1RUE1 3JD73 1Z7S3 2RS31 2RS33 1RUE2 1HRI1 1E57A 2RR13 1NCRC 5BNNB 4RR3B 4FSJA 1VB4A 4AEDC 4N43A 4CEYC 1R082 4YVSB 2HWF2 2HWB1 5C8CB 1PGL2 4Q4X3 2RMU1 1AR81 1VBE1 2HWF1 2RM21 4Q4W1 4Q4V1 1PO22 2HWC3 1RVF3 3ZFGC 5JZGA 3VBSB 5FOJB 4QPGB 4RQPB 1RB8G 1BEV3 1ND3A 1HXS2 4FTBA 3M8LA 3TN92 1NCQC 1OHFA 2FZ2A 4CDQA 1RMU2 4YVSC 1V9U3 1HXS1 1MEC3 4RQPC 2VQ0A 1RUF2 1PIV3 4Y5Z0 2RS52 1HQNA 1VBB3 5ABJB 2XBO3 3VBUB 5CFCB 1RUJ2 2WFF1 1COV2 5BNPB 1AR73 2WFF2 1R081 2WZR1 2WS92 1AR61 4SBVA 3VBUC 4Z92B 2WZR2 4WM8A 4JGYA 5ABJC 5A33A 3VBHB 1AYN2 2HWE3 1AYM3 4NWVA 5A32A 4CDWB 1AR72 1QQP1 4N53B 1RUH3 5D8AA 3TN91 1QJX3 1QJX1 1AUYA 2MEV2 1WCDJ 1K5MC 3ZXAC 1OOPA 1CJDA 4GB33 1RUE3 1RUF1 2HWE2 1C8M1 2RS13 1V9U2 4CEWB 5C9AA 1RUC1 1VBD3 1RUD3 2R042 4BCUA 2R071 1VBC3 3JBG3 3DPRB 1POV3 2HWD2 4GMP1 1RHI3 1R083 4CEWC 4FTSA 4RS5C 2HWD1 4QPIB 3CJIC 2X5IA 2RS12 4CDXA 1PO23 5D8AB 2IZWA 2GH8A 5BNNA 4RR3A 3J8F1 2WLPA 1EV12 1HX6A 3VBRB 3J8F2 5C8CA 1FPN1 1VBA1 2BBVA 1ZBE3 1HXS3 1OPOA 3VBFB 1RHI2 2RR12 1ASJ1 1A6CA 1DDLA 1NCRB 4EJRA 1EV13 4CDXC 1TMF3 1NA1C 1RUG2 1H8TA 4WM7B 5DDJ1 1MQTA
chains in the Genus database with same CATH superfamily
1SEFA 3NNLA 1ST8A 4YW6A 1XNTA 3POIA 5FY1A 3T2TA 5L7OA 1RVF1 2EIEA 4AVAA 1C8M2 2QDRA 2FCTA 3WLUA 1FMD1 4DUWA 1AR92 3IWZA 3AKSA 4L9BA 3I3EA 3Q8EA 3I49A 2VZSA 4QPGC 5KBFA 1IKQA 4XMAA 1GKBA 2H0BA 2GMPA 1O4YA 5FLHA 2DFBA 1R1A3 2N7GA 2R063 2VM9A 4XF1A 2VNRA 4CU6A 2W0XA 4Q4Y1 1SACA 4D94A 1Z7S2 1VRH1 1AYM2 1ZZ6A 1H9PA 4XJWA 4Q27A 1URXA 3Q8AA 5AC93 3HBKA 4XJZA 1XJAA 1W8ZA 5C8WA 3G6JB 4LO6B 4I09A 3AJYA 1V6NA 4XZUG 4RR3C 3SQOA 2CU5A 3WUCA 1PVC2 1VJ2A 4GMP3 1QQP3 5AC91 2Y0IA 3KQ4B 5A3TA 2DCJA 4EN0A 3LPGA 5FZ3A 4K7JA 2JKBA 3LZZA 4COVA 4YFZA 2DTYA 1H8TA 2RHPA 1QJU3 4RD7A 1J83A 1UYXA 3NAPB 3P6BA 1XNKA 4X8PA 2WIIB 4I2OA 3LEIA 5ACA2 1N3PA 4GIQA 3RI8A 2B9VA 2E9QA 3I2GA 2J7MA 4W6YA 5DUVA 5DZEA 1D4M2 3LE0A 4PHZA 4CDQC 4LEJA 4IGOA 2DWRA 1JYVA 2RM22 3FHAA 4Q4W2 4QDQA 3M3QA 4A3ZA 4R8HA 4AQ2A 2ZZQA 1E5SA 1EAH3 5LK5A 3RDIA 3JCIA 3JQXA 1PIV1 1ZBA2 4JGYB 4CDUA 1ACCA 4CUGA 1VAMA 1Y9MA 4K20A 2BW8A 1WCKA 2C9KA 1CESA 1ZBA1 4JKLA 5FP7A 1X8MA 4XILA 4H7LA 5A7NA 4FVVA 1VBC2 5J36A 1BMV1 3S5QA 4YZ2A 1F4HA 1UY4A 1VPHA 1OLQA 2EIBA 5BNOB 4QKFA 1QNYA 3HBZA 2ENRA 4FOQA 4DQAA 3GJAA 3P3PA 2LM3A 1JU3A 5BUVA 1V00A 3ACHA 1Q8PA 3ZIWA 5BNPA 4QD2A 2Q1FA 5DAWA 1HB1A 1W9WA 4UOJA 1DZQA 1HRI2 3NL1A 4RS5B 2ZEWA 4L8QA 3MV11 2RMU2 4K8FA 5FV3A 4IEOA 3Q8FA 2D3PA 2RJ2A 1Y3TA 4XUNA 3T3YA 2WUHA 2G1MA 2JE7A 4UFJA 1VMHA 1QWRA 1C28A 1WCQA 3AK0A 3MIHA 5J98B 4DEVA 1F4AA 3O7OA 4PDWC 2ORZA 3BODA 4BOWA 1ZNPA 2VOKA 5T5OA 1ZZ9A 1G8WA 4L97A 4CDXB 3E97A 4GH4A 1QXJA 5EQUA 2AR6A 4XBNA 2FDHA 4IV1B 3N7MA 1RUI3 2PQSA 5JI9A 2YU1A 3ZFEA 4MXVA 1JYXA 1D7PM 5E6HA 4XF9A 4DOUA 5FZIA 2YU2A 4XFBA 4Y33A 5E88A 4XYXA 4P08A 2IXIA 2MEV1 2XVGA 4UW5A 2H6CA 2HWB3 4LBLA 4Y5SA 5FPLA 2G9GA 4H14A 2V09A 4ZONA 2WT0A 1RINA 2QQMA 3B93A 3DN7A 3WNOA 2PTMA 1H1AA 1W9FA 1DBNA 2R062 1RUF3 4XJ8A 1YUDA 3GYDA 4Y20A 1CWPA 2MEV3 1QXPA 4FQZA 3KZ4C 1WGPA 5DAPA 3A0KA 4IE7A 4XZPA 1VMJA 1O3RA 2PHRA 4QX5A 5T5PA 2WNUA 3NKGA 4IGQA 3ZVXA 3QACA 1OLMA 2OKXA 1Q8QA 2HEYF 1ENXA 5HXMA 4QPYA 5BYNA 2JG9A 4SLIA 3IMMA 5GLUA 2LW8A 1QJY3 3BU7A 2BPA2 4BWOA 4OZXA 4JGZA 2YHJA 2BUKA 4FO9A 3VL8A 1L7RA 4K8RB 5K7PA 2XJRA 5C7GA 2P4EA 1CAWA 1WLTA 3CDZB 4D6QA 5I91A 1AL0G 1BBT2 1OH4A 2EXKA 1ENQA 1DQ6A 1MZ6A 1JBCA 2UWCA 3THDA 2VD7A 2XVLA 4FPEA 1ZRDA 2VZQA 1IS5A 1AR71 1YQ8A 3ES1A 1Q5OA 3DXUA 3ORJA 2J1TA 1CAVA 3ACIA 3NV2A 2XJPA 4NPRA 3IIIA 4AI3A 1SLBA 5E16A 4LK6A 1X33A 3M3OA 5KHKA 1O5LA 4L99A 1NLQA 1WW5A 1SFNA 3VHNA 4E8CA 1GYKA 1UWWA 3E6DA 1LOGA 3V0AA 1W2OA 2VTXA 3JBG1 5FY9A 1A8MA 1PZ8A 2PMWB 4QKBA 5FZ0A 2R073 3F95A 4DUVA 2WAAA 4GQ7A 1ZBE1 1OA3A 1W0PA 3C7HA 2VMEA 3CO2A 5C9AC 4MXWA 2RS11 2ETEA 3PUAA 4BQWA 1Z78A 3WCSA 3AL5A 1O4TA 1A8DA 1ULFA 2ZHKA 2TEPA 1ZYBA 2GDFA 3IMNA 2FHRA 3EMRA 2QQKA 2VC9A 4WVVA 5FJKA 1Z7S1 3MICA 1POV0 4JTOA 2BNOA 2ZS6B 1ND3B 4BDVB 2VVDA 4BMBA 4XOGA 4AFDA 3H8RA 4O9EA 4C1XA 1YFUA 2XJVA 4QQPA 4BE3A 1RHI1 4LR4A 5CKNA 3ASIA 4PLNA 1K42A 2DCKA 1QOOA 2QBXA 2VCAA 1DF0A 1OMIA 3O1TA 4K1YA 1PVC1 3KCCA 3BCWA 2BFUL 4AWDA 3LOBA 1ULPA 1RUD1 3LAGA 3FL7A 5L73A 2RR11 1DQ0A 4GH4B 4IEUA 2DUQA 3JD72 1RUD2 2R043 4NR1A 2OZJA 1RVF2 3ILRA 3RQ0A 1KXGA 1BVVA 1H0BA 2YBPA 3J7MA 4V1PA 3KHBA 4PQ9A 3HN3A 1U12A 1F35A 3BN6A 3N9NA 2VTXJ 5LASA 1IQDC 5IUQA 2FMYA 3WP3A 4E2SA 1JZ5A 5H9QA 5HCFA 5JZGB 2GH2A 4AEDB 1YYNA 2CSGA 2D98A 3ILFA 4RHV3 3VKLA 5LBFA 1BK1A 2GMMA 4LBNA 2D44A 4QXHA 4UBHA 5E8AA 2D6MA 2CWMA 3THTA 4R9DA 2VH9A 4CDUB 3SEPA 1J84A 1O6UA 2OXBA 2SBAA 3MF6A 3LFMA 4XMIA 4BQXA 4F7ZA 3PJYA 5IFPA 2QCSB 1Y9GA 4FFGA 1VALA 1PX3A 5DXDA 4B1LA 2WAOA 2VAUA 1YIFA 2JEMA 5FMOS 4YM3A 5JPMB 4QQOA 4E4SA 2WZEA 3CQOA 4XDOA 4JGZB 2WQ8A 2BQPA 2EF6A 2R6QA 2RDQA 5ABJA 3M3EA 3HWJA 3UL2A 4Q0UA 2HWC1 4KWJA 2A6ZA 1GR3A 3HPNA 2XBO1 5FUIA 2WNOA 1IPKA 2IXJA 2A5ZA 5LB6A 5B4XA 5LA1A 2AYHA 4R4ZA 4CP2A 4BXSV 3U4XA 1MS9A 2EICA 2RS53 1DYPA 1NCRA 2GC3A 2LRPA 3POYA 3USUB 3C7FA 1KRIA 3D0JA 2CDOA 3UGHA 2BRTA 4LLOA 3LA3A 5FYTA 5HBAA 5HI0A 1GQPA 1GANA 2W94A 3AKTA 3WHTA 2W08A 3J4UH 4Z2WA 3G7DA 5A3OA 3D8CA 5FUNA 4E2GA 1NLSA 1XXNA 5KC6A 1DGRA 1R091 3HIFA 3B00A 3ZDVA 4COWA 4IV1A 3K4DA 3FLTA 1ND3C 4N43B 4Y22B 4DIQA 1QJU1 3R4DB 4AEKA 2Q8DA 4QB1A 2XGXA 2LALA 2YGMA 3PURA 4I0WB 2NP0A 2X5IC 5CA6A 1VBC1 1GNHA 2P2KA 3ECQA 4RA0A 3ZLIA 1QJY2 1AR93 1N3OA 4PDWA 1ALYA 5LCWL 2MHFA 2RG4A 1PNGA 1NY71 3AP9A 4DY5A 4YM0A 4XUTA 1RUE1 1J3PA 2DURA 4CUBA 5FMCA 3JD73 4CCCA 2ARCA 3GZEA 3NNJA 4HG6B 1ENRA 2GNTA 2RS33 2YYOA 3MV01 4Y1XA 3OY8A 5KHHA 3ZSKA 4B29A 4MO3M 4W65A 4XETA 4YGEA 3T1MA 5FZHA 3CZUA 1XNBA 2RR13 2JX9A 3MO4A 3GHMA 4QAWA 4FSJA 3H3ZA 2E31A 1DGLA 1Q8SA 4JHTA 3W5MA 2BGOA 1SBDA 1QIQA 5DUWA 3FHQA 4YVSB 5KWRA 4IE6A 1H8VA 1UY3A 4Q4X3 1UY2A 2P5BA 4A6OA 1UMIA 2O0OA 1VBE1 2HWF1 4IERA 1LGNA 3WG1A 5FREA 2C9AA 4QHZA 4QDSA 2WT1A 3I54A 4XUPA 3WNKA 2HWC3 1RVF3 4NHKA 5JZGA 3MEPA 4QX8A 5C3OA 3T08A 1ULEA 1FXZA 3K3NA 5F5QA 2Q1ZB 2DBNA 4GAZA 3POWA 1KGYA 4NIGA 5F3CA 3CJXA 2HH9A 3A7QA 1UN1A 4HONA 4LE3A 4AE2A 3CBNA 4HMZA 2DDUA 4WVWA 4AI1A 3NRUA 5GZFA 4GA9A 4CDQA 2Z69A 4LORA 1HXS1 4LBJA 2VU9A 1MEC3 2NM1A 3GBGA 4LUMA 3MBWA 1BQPA 3RVHA 1FV3A 3T0BA 5A3PA 3IB3A 5FY5A 3WHUA 2R30A 3GDBA 2BEOA 3MIDA 4GD4A 2QZ3A 3T4HB 5ABJB 3VHOA 1J3QA 3FBYA 1ZZBA 3POSA 3RRDA 2B9UA 3B9IA 1UPIA 4P9GA 4TWTA 2X05A 1MZ5A 5GLZA 4XF3A 3WQ7A 1OFNA 2P3KA 4XC9A 1COV2 1W2TA 4ASKA 4P9YA 4LULA 1A78A 4OVEA 3I3QA 4AI0A 4CP9A 3E5QA 3IPVA 1JS9A 1V6LA 1R081 2WFF2 2WZR1 1XPWA 5FLIA 1IS3A 4FFFA 4XBLA 5J3UA 5GZDA 1KFUL 1OQEA 1U5XA 2SLIA 4OI4A 4IETA 5DMYA 1NZIA 4WM8A 4YW7A 3S7EA 5JVVA 3FWEA 3ZM8A 5CADA 2Q30A 2VNGA 1MZFA 2HBUA 3FUOA 1DYOA 1PK6C 4HSJA 4BQ4A 2BOIA 5A32A 4O7XA 4FOWA 5JDBA 4LO5B 4HKOA 1AR72 1CAXA 1RL3A 1GV9A 4IDZA 5EZWA 3WEZA 4IEQA 2X09A 1AXZA 5EJ1B 4W8JA 3WP5A 1W6PA 1QJX3 1EPWA 4MGYE 3OGRA 5EWSA 1AUYA 2MEV2 1WCDJ 1NE4A 4KQ7A 4XIOA 5CG9A 4HKWA 3OGGA 4BXFA 1OOPA 1CJDA 2W52A 3PLQA 1ONAA 2ZPXA 4BB3A 4LXLA 4LPLA 2CL2A 4NIAA 1TE1B 2XB6C 2AUYA 2HWE2 2VOVA 1W90A 2CAVA 2RS13 3HT2A 1V9U2 4BA6A 2B8MA 4AQSA 5C9AA 1Y9QA 2HEVF 3BOPA 2DCTA 1TQ5A 3LDBA 4G4FA 4DINB 4BCUA 1S0EA 2GP3A 1OUSA 2R071 4YLZA 1WKYA 1W9TA 1XOYA 3NSTA 1POV3 3A0NA 4JHZA 2HWD2 4O65A 4ZS3A 4EE2A 4LHNA 2XDVA 4B4QA 4FTSA 4RS5C 2Y6JA 3CJIC 4XCAA 2YG0A 1CX1A 1SCRA 2DV9A 3M3IA 2O1QA 3PNAA 5LBBA 4BYYA 3NVCA 1HJFA 3J8F1 5JAXA 3TEZA 2EVXA 3HOBA 4ISRA 4EV0A 1DHKB 4EQVA 1CZTA 1HX6A 1UW8A 3AZWA 3ILNA 3SCGA 2P6HA 2WO1A 1JZ6A 1LOEA 3EHKA 5FXVA 5IWFA 1VMFA 1XE8A 4AFBA 3I97A 5EYXA 2P37A 2A3WA 3WNMA 1RHI2 2Z5WA 3OUIA 3TYJA 1V6OA 1WA4A 1NCRB 3QCWA 3WQBA 2CNAA 1NKGA 3B94A 1OQ1A 4EZ4A 3O1SA 4UF0A 2OW4A 1DQ2A 4OQ9A 4COYA 2IWGB 3PUHA 1Y43B 3P5BA 4J1WA 4ZPIA 3BYWA 5GZGA 1OF4A 3GALA 2W9XA 4K1ZA 2WO7A 2ZX2A 4KWUA 4FT8A 4ARYA 4XFAA 3RYKA 2HKXA 3B5LB 2OT7A 2W47A 3TNPB 1FT9A 1OXCA 2ZGSA 2GNDA 3ZXKA 1AVBA 3C2UA 2ZX1A 5M0TA 4QT6A 1WD3A 2JJ6A 1S0JA 1UZWA 2JDKA 1MS8A 3FJSA 3JB4C 3OBAA 3FHIB 1ZBE2 5F5IA 5FMOL 5FTTC 1VIWB 2RMU3 3WQ1A 4YYOA 2PHLA 1ASJ3 1ZBA3 5EXOA 4Q1RA 5L9BA 1MVQA 2GMEA 2JDYA 4OUSA 3VDCA 2ADEA 4AXOA 4M3CA 3ZYHA 1RUOA 1RIRA 4UFIA 1ZRFA 1EAH2 4DB5A 2JDNA 2YZ4A 5FP9A 2JDUA 3VBFA 4HL0A 1TME3 1WLCA 4YFWA 5FBJA 3RMXA 4PF1A 3LFIA 1UOJA 1H2KA 1X82A 5JXJA 3B02A 3NMBA 4Q0VA 3O0WA 3ZFEC 1D4VB 4XDPA 3F2ZA 4OMCA 3H1WA 3E5XA 5KHGA 2AH2A 1VBA2 3R4UA 3ZXFA 4FAHA 3AP5A 1BBT3 1SPPA 2JDHA 5J09A 3OJBA 3WNXA 5LEJA 1ENSA 5F6LB 1COV3 3D6EA 4AYUA 4CUAA 1RUJ3 1W0OA 1LECA 4LTAA 1BMV2 1YC61 3JQWA 4DXTA 3PVBB 5JOWA 1NG0A 1CD3G 2WS93 1UZVA 1LENA 1XSRA 4Z07A 1S0IA 2R0FA 5FBZA 4I3PA 4DUXA 1FMD2 1S4CA 3AMPA 3K48A 1IS4A 1UU6A 3CJIB 3E6BA 3R05A 5F7UA 1Z0HA 3CL1A 3ETPA 1RMU3 3U78A 5FR3A 2W95A 3IIAA 1H1MA 3AX4A 3HD8B 1PO12 4XXAA 2GC0A 4E4ZA 3B7MA 1G6NA 4P9IA 3BPZA 3OGSA 4M0HA 2UWAA 2WA3A 3LQCA 4OHVA 4R52A 4AVCA 1RUI2 1YJKA 1Y7BA 3H9AA 2K2SA 4COUA 3NKTA 1KS4A 5TSWA 3KCYA 3WV6A 4CU7A 3ZMNA 3I2HA 2TBVA 2E26A 4AEMA 1O59A 2XQXA 3H3UA 4JAAA 5LBEA 3URFA 1S0DA 4LMFA 2EIGA 2WKKA 3PTYA 1MR5A 1JOPA 1NE6A 4Q0QA 1JMUB 3AP7A 1VB2A 1J1LA 1GP5A 4N7UA 4H55A 4A3XA 5FIXA 5JWPA 2ARBA 2A6XA 3GBWA 3NV3A 3WSOA 5B4NA 4PIYA 3VBUA 4MOAA 4YZ3A 5T3NA 1D2SA 1U5YA 1WW4A 1CPMA 2JG9C 3AC0A 4CEYA 4CP9B 4FP3A 2VOXA 3VKNA 1AF9A 5JLVA 1QGLA 2LS6A 3DKQA 3CNAA 1JUIA 5FY7A 1H6YA 5FPXA 5EYYA 1M06G 1K5MB 4AEJA 1PGL1 4LE4A 4OI2A 3AMHA 3ZIXA 5HCHA 2WS91 3ME2A 4YSFA 1W2UA 3OYWA 2BVBA 4BMEA 1ZRRA 2Y60A 4FAGA 5BY5A 1Y4WA 3BTAA 4MLOA 4NN0A 1NA1B 1VBE2 2QQIA 3PU8A 4QPIA 5F5CA 4BQ2A 1BBT1 2PHWA 1M4WA 5SV5A 3POFA 1QH6A 1UIKA 1S0CA 2BERA 3I3DA 2ZX0A 2XUEA 3ZPYA 3HN1A 4Q4V3 4YRDA 4A6SA 2J42A 1OOPB 3MLJA 2OUJA 3NNGA 2WQZC 5FYHA 3H1MA 4MHRA 3SISA 3VDDA 4P9XA 5IK5A 3ZYFA 2YBKA 2QZ2A 4A42A 3ZOIA 2BVVA 4UFMA 5JIUA 3VBRC 3UESA 5JCTA 2R061 4NHLA 5IVYA 5F6KA 1R1A1 3HJRA 2HWE1 3I2KA 1LOBA 4OHZA 4ZKTB 3OG2A 1O8PA 5FQ0A 2YC0A 2FDJA 2FQPA 4JKKA 1RUJ1 4ZU4A 2UU8A 3ACGA 4ZY9A 1COV1 2VXJA 3I4IA 5C4WB 5IVJA 1U0AA 2G9FA 4UFKA 4B7EA 2UY8A 4ES8A 2OX0A 4DZGA 2DTWA 5BNPC 5C6CA 2V4VA 5A3WA 3W59A 2PHXA 2WR9A 2A3YA 4M4RA 1D0HA 1Q43A 2XHKA 1AYN3 3RGBA 2OIIA 3PU3A 1L7QA 3I3BA 4HPKA 1K5JA 2K0GA 5FP4A 1G9AA 4FPJA 2C1FA 1MVEA 3LA7A 4K9SA 3AYCA 3AKRA 1QQP2 2KD7A 4IE0A 2WO2A 3MIEA 4META 4KNCA 4S2FA 5FUPA 5FOBB 1ULDA 2VUDA 3D0SA 2O14A 3WDWA 1WW7A 2HYXA 3EJKA 5E1RA 1HRV2 4KG0A 4MVTA 4NAMA 2I45A 4LBQD 2VMGA 3UKVA 4FTEA 4FPGA 1CVNA 1PNFA 1UL9A 2Y38A 4QKDA 1G9CA 2Q8CA 4BHPA 1NAEA 5DUXA 2GN7A 4LO4B 1KFXL 2JG8A 1TNRA 3C7EA 5FYCA 1O7FA 2VOTA 2ZTNA 3KF3A 1MS3A 3MDPA 4Z2AA 5C5TA 5FO8B 4EN7B 3RZJA 4D0QA 1B35A 1R1A2 1GZWB 3KD4A 1QDCA 3AXEA 4IV3A 4WVMB 1GMMA 3EXUA 3N9PA 4BM8A 4P14A 4CRQA 4YW3A 1SBFA 4QDRA 4YNIA 3WNLA 3ZN4A 4E9KA 3NNFA 2LROA 3GZUC 2PN5A 4BQ5A 5L9VA 3OGVA 4B7KA 3MW4A 5AFBA 1WUVA 2P3IA 3NAPA 3WDXA 4HZFA 1O3QA 2IVJA 2Z4FA 1XNDA 2RDNA 4PQQA 5CKQA 5CFCA 1HKDA 2A73B 1EPZA 3O0XA 3T09A 3WT3A 4A4AA 1W3VA 3VBHC 4RFRB 3GF6A 5FZ6A 3J8F3 4PLOA 3FX3A 1JOJA 2VCMA 4GB32 4NRMA 4AHWA 2FDKA 3POGA 1WCSA 1FPN2 1XNCA 2HWF3 1XYPA 5FYZA 5C70A 2DVDA 3MGUA 2Q4SA 4Q0PA 1ZZCA 5C8CC 3VBHA 4XTMA 4XQWA 5F32A 4N9HA 5K0UB 1STMA 5GKAC 3ZXDA 3DXTA 4C0HA 3ZN5A 2AZ5A 3IM0A 4FPKA 3PTRB 4YARA 5CEHA 4AOCA 2DCYA 2BDRA 3W58A 1LGCA 1YJLA 2R0HA 3UJOA 3VZMA 4LBQB 1W99A 3CMGA 1UO9A 1S55A 4NOTA 3JD71 3M3CA 4C1WA 3LSDA 3CKHA 1RUG1 2BTVC 4Y5TA 3GCXA 5FZ1A 5FZAA 3ZFFC 4CSWA 2ET1A 1DZTA 3DUIA 4ONUA 5FY4A 1UYPA 5FXWA 3ZYPA 2YY1A 2DU1A 1OURA 3HNYM 4Y1ZA 1MQTC 5CVRA 1FAYA 2VVFA 1XBFA 1AR91 3AZXA 4YW4A 3ABZA 5HV0A 3VD5A 1GBGA 3I3MA 5FQ0B 2W46A 2J1VA 2JD9A 4CDWA 2PHDA 4NIIA 4GJZA 3ST7A 3OB8A 3VGIA 5C3QA 1PGW1 1PM4A 2BV4A 4UT5A 1PO13 4KU8A 1OPMA 3KV5A 1SLCA 1GFF2 5A80A 3EO6A 2BFUS 3PJQA 4AI9A 2WZR3 1YCIA 1GNZA 2XLFA 1RJ7A 4IEWA 1J1TA 2C0ZA 4LT5A 3L2HA 1JHJA 4IUGA 1W8TA 4M3CE 5GM0A 1VAVA 1BEV2 5FZ4A 1LU2A 2E7TA 3ZFEB 5FZ7A 5IAVA 1QH7A 1Q8OA 1SFPA 3PHMA 1AX2A 4QU1A 1LODA 5A7SA 3E6CC 1SMVA 1VBE3 3ZSMA 1J3RA 1YI9A 1W6NA 4NHXA 1JH5A 1CZSA 1W9SA 4Q4X1 5FYMA 4CTEA 4D6RA 2ZKLA 3K75B 1MEC1 3LDKA 5FK8A 3VZJA 3INAA 4Z82A 4Q0SA 2UURA 2B4KA 1GWKA 1QEXA 4A2UA 4BQYA 2HWB2 4AFAA 1W6QA 2JDZA 2VY0A 3B3QE 1B35B 5ACA3 1AR82 1GZWA 2YBSA 4N53A 3VDDC 5IK7A 5FO9B 2AREA 5LA2A 3QH6A 4IV3B 3FFZA 4WVMA 4AW7A 3BKZA 1FOD2 4E27A 3LOIA 3VBRA 4BH9A 4B4RA 3HR9A 2QFEA 4BIOA 2ZX3A 1WBLA 2DUOA 3WF2A 1FNYA 2BZDA 2GNBA 4ATEA 5A3UA 5KHJA 1OC1A 1S1AA 1PGW2 3BGAA 3VDDB 3BTZA 1DQ4A 1N1YA 2JICA 4COZA 1LHVA 1XNAA 3JZVA 2X29A 3V0BA 1LOAA 3HT1A 4TXWA 5FZ9A 2ZX4A 3H8UA 1PZ7A 3NAPC 4YGDA 1IQAA 3WX5A 2PYTA 2ZHMA 4QX7A 3POBA 2WNVB 3WNPA 4PI2A 2ZEXA 4E2QA 5B2GB 2E6VA 3SLIA 1ND2B 1KJLA 1GNYA 2XBO2 3D82A 2RDRA 3GGLA 3M2MA 5BV6A 1V70A 3OUJA 4S2DA 4MZUA 3ZR5A 3S5AA 3GXUA 2GU9A 2RS31 3ZR6A 4LHKA 3VL9A 3DYMA 3FLPA 3R6SA 1WW6A 4XURA 1NCRC 4RR3B 3RWNA 4IL7A 4CPBD 3O12A 1VB4A 1C1LA 2P6CA 3FUQA 1SDDB 3NJZA 1HV1A 2OPWA 3I2JA 4HPKB 4CEYC 1CAUB 1PMIA 1ZRIA 5LY1A 4XFCA 2DVGA 3N9LA 3QLQA 4H2AA 2IXLA 4AQTA 2ZGKA 2WL1A 4FP2A 2B7YA 2UYAA 3WDUA 3BIWE 4Q4V1 5A7QA 4P5HA 5A7WB 3QBQA 4EN9B 1OKQA 2ZKNA 2R1BA 3O0VA 2WINB 5BPXA 1JYTA 2W1QA 4IEXA 5FOJB 4MX3A 4IEPA 4QPGB 3IN9A 5JXHA 5ERLA 4RQPB 2JG8B 1LGBA 3MFCA 5FYUA 2WWUA 4Y1UA 1ND3A 5F3GA 4C90A 1W0NA 3NO8A 3GBFA 2Y6KA 5IK8A 4J25A 2GALA 3T2PA 1PMJX 1NCQC 2Q0AA 3D4KA 4F8AA 3RPQA 5I8SA 3PUQA 1V9U3 1BZWA 4RQPC 2RVAA 1RUF2 2OA2A 1PIV3 4CE8A 1PK6B 4QXKA 2JXAA 5D1IA 5LA0A 4GWMA 4NIHA 4Z1VA 3KMHA 1TZOA 2QUOA 3KLSA 5CFCB 2DCZA 4XF4A 3LKJA 4XVHA 1I3HA 1JTZX 1AR73 4QQLA 3VBUB 2HBTA 2VCBA 4PIZA 1HW5A 1UU5A 4XFHA 3J7LA 1W6NB 2EXHA 4HOOA 3VBUC 3WW3A 4ET7A 4Z92B 1HB4A 2WZR2 3LA2A 5A70A 5ABJC 5A33A 1LHOA 1UPSA 3VBHB 2W87A 5T52A 1K12A 4NWVA 4H7MA 1S2KA 2QKDA 1SCSA 1W2NA 4QPWA 4MH0E 1N47A 2A6WA 2QQNA 5FAXA 4N53B 5FZMA 1RUH3 5D8AA 4XFGA 2FD8A 1N3QA 1A34A 1CZVA 3AKPA 2GC1A 2RDSA 4HXCA 1OVSA 2VW0A 3LPFA 3MIFA 3ZXAC 1C3HA 4R9CA 2KM2A 2VUAA 3P3NA 1RUF1 4O9GA 1OA2A 2VOWA 3S57A 3FMGA 1C8M1 4CEWB 2PHFA 3OOXA 4HK9A 5FZKA 5FZOB 4HVRA 2XONA 1JU4A 1HN1A 2E53A 5J37A 3UYJA 2WNVA 1X9PA 2IVIB 1E5RA 2PAMA 3JBG3 3O14A 3DPRB 3K4AA 2NMOA 1NUKA 4CVUA 1W28A 3POJA 3SKVA 2VE1A 4XHXA 2Q1MA 2YXSA 2BU9A 2YDEA 3AZYA 3KV4A 3MPPG 5FKBA 3USSA 5C3SA 4LA3A 1KQRA 2RS12 2YV8A 1POQA 1PO23 3IBMA 1UX6A 3KT7A 5FPBA 2GH8A 3PDQA 5AFEA 3D5OA 4RR3A 2AEZA 4XABA 2PFWA 4QKNA 2BP6A 2WQ4A 5A6ZA 4NRQA 2XWJB 1UY1A 1YQ2A 5FZGA 3W20A 1QU0A 2PELA 2W1SA 1S0FA 1IG0A 3ACFA 3N3HA 2W1WA 2D6NA 2HLEA 2NZ9A 1UAIA 1IPSA 2BBVA 1ZBE3 3RJ2X 3TEXA 5BNQA 2IFRA 4I01A 3WG3A 4WBBA 1X9TA 4INDA 3RZMA 5HCBA 2VMCA 4OI1A 2ES3A 3A4UA 4FBFA 1XB9A 1W6OB 3AP6A 1DLCA 3T2QA 2K46A 1SFYA 1MQTA 3KB5A 4FPCA 3RZHA 2VXRA 1UOGA 3OY8B 1QNWA 3SNMA 2RM23 4Q4W3 3JB8A 4HK8A 2XKOA 2C6SA 1O5UA 1WMEA 1XYOA 3AP4A 5C4WC 3HNBM 1RTVA 2RJKA 3WCRA 2ZZJA 1R092 5I0RA 1F9KA 3GZAA 3HQRA 3SC7X 1SLAA 1YFXA 4MGZE 2EALA 1MS5A 4TLFA 2CGOA 5FYYA 3FBMA 4V2VA 2CDPA 3RWKX 1EAH1 3T2OA 2XLGA 2EAKA 4D8MA 4BJ0A 3U10A 5AVAA 1LHUA 2YUEA 2JIGA 3RZKA 3ZKYA 5I93A 1X50A 1YHFA 1BK0A 4DO0A 5GJ6A 2A7AA 2BWCA 3VBSA 1RUH2 1H8TB 3P1IA 4ORFA 3ZXEA 4XPVA 5EJ3A 3ZYGA 2W92A 5FZDA 4JGZC 3DECA 2OZ6A 1XC6A 5FJHA 2PHTA 1UYYA 2HWC2 1W8NA 3K3OA 4ZU5A 4KH9A 3ZFFB 5AC92 2PLV1 1DGRN 3O5SA 4M00A 3W5NA 1W05A 2BNNA 5FK7A 4CZSA 5JXIA 1LTEA 3DEMA 2GN3A 3H3LA 4HSLA 5CU1A 2HYKA 4YVWB 3TBDA 5FYVA 3VZOA 5IFTA 5L19A 1MPXA 5GLTA 5FMBA 5GALA 4JC1A 3B01A 1QXRA 5DZFA 2NPIA 2JE8A 4GKXA 1H8TC 3AVRA 1EP0A 4LBOA 4BQ3A 1L3JA 4XAEA 5ACA1 3WW2A 4ARXA 4LHSA 3WR0A 4YVWC 1D0GA 1HN0A 4QWNA 3UETA 4ZU7A 3OGJA 4Y26A 4DRVA 3AZVA 5LA9A 3IPVB 1PIV2 4RQPA 1JXNA 3GHNA 3TRSB 2V5DA 3KV9A 1KJRA 4N90A 1YEWA 4Q4Y2 3BPSA 1X36A 4GH4C 5F1RA 2ZMNA 2CYFA 4AR2A 2A6VA 5JPNB 5H9PA 4AFCA 4C8DA 5IK4A 3MIBA 4ATFA 5A32B 2FDGA 4YG6A 2ORXA 3ROUA 3VBFC 1J58A 3HEIA 1GP4A 2WLQA 1PK6A 4Y3OA 5ANQA 2E7AA 3KSCA 2J1RA 4ITCA 5IATA 4GKYA 3HAGA 1L7LA 2WA4A 4JZRA 5LWBA 4UBGA 1GICA 2PLV2 3O1VA 1UZ0A 3PMEA 3T1LA 4J1XA 5JOYA 2RV9A 1CQ9A 4JQTA 3Q8CA 4FXGB 2QQLA 3CIHA 3FLRA 4LUKA 4NVPA 3WW4A 1MEC2 2VW2A 2CAUA 3C8XA 1MACA 2WBKA 5C9AB 2WC2A 1VP6A 1W3XA 2Y26A 3AYDA 4LA2A 2CY6A 5A1LA 2VUCA 4I0BA 3KGZA 2F4PA 4Y20B 5CFDA 3OD4A 2CGPA 1YXWA 4DXZA 2WNUB 4FXKB 4CCMA 5KR7A 1ZA7A 4MHUA 3H42B 2A1XA 4OI0A 1AJOA 5J96B 1RUG3 4MUVA 4AVTA 4JQRA 5BNOA 4XE9A 4IE4A 3WDYA 1AHSA 2HWD3 4AHZA 4QX2A 5T5JA 4J6GA 2I2SA 2NYYA 2VZOA 3JUUA 3QH7A 4MV2A 4U2AA 1RMU1 1AZDA 2H0VA 2ID4A 2VGDA 3VBOA 5DAVA 3WG4A 5JXGA 1VRH3 2EA7A 2Y6FA 1C8NA 3HNMA 4CEWA 1DGWA 3LEGA 4RS5A 1NYWA 5I0TA 4EWAA 3IAQA 2UWBA 1OLME 3PVEA 1OI6A 5BNNC 2EXIA 3AYEA 1XU2A 4Q2FA 3LF7A 4XUOA 2A71A 4TSVA 3X29B 3ZX7A 1BKZA 5A3NA 1T6BX 5F39A 3M7AA 5I8YA 1LR5A 1R093 2B46X 2XPJA 4TZDA 4PCRA 4QQHA 4NE9A 2JENA 1F5JA 4YM2A 3RMYA 2ZJCA 2ADDA 3N36A 4ISQA 1O3TA 3VBOC 2E32A 2XL7A 1PGSA 2QNKA 3NWKA 2VBDA 5F2WA 1MS4A 2XH6A 3V0AB 2XHNA 2KR2A 4AGVA 3E5UA 4Q4Y3 1EV11 2PXJA 4TTGA 5FP3A 4D69A 2BBAA 4RYDA 1NZCA 1JYNA 4LBKA 2E33A 1I5ZA 3LEMA 4XJ9A 1CPNA 3ZYRA 5JSOA 3H8XA 1WMXA 3N9OA 4DRRA 1UKGA 1QJX2 5DAQA 2ZEZA 2FCVA 1LULA 1ASJ2 2KA3A 1W6OA 1US2A 4JDNA 5D21A 4N53C 2Q8OA 3S7IA 1SDWA 4NHMA 5JSPA 4UFHA 3QOPA 5A6XA 5CFCC 1G86A 5F8PA 4CXYA 5A1AA 5EPAA 3H50A 2XVKA 1Q8VA 3RZLA 5HXVA 1GUIA 3ZMOA 3H7YA 4OLLA 3HMYA 5LY2A 2JG9B 4EWEA 5JIAA 4IESA 4RFT0 2VZPA 3TNQA 1OFSA 2PAKA 4XACA 5I0DA 3ZSLA 2EIDA 1PMHX 1C5IA 1JHNA 1NCQB 3ZKUA 2A3XA 4L92A 3JBG2 4W6WA 3OCPA 2BYVE 1DGWX 4XUQA 3TAYA 5L7OC 1ZVFA 4NWWA 4DFSA 2JDMA 3V56A 3O1UA 1EY2A 1GOGA 2QE3A 1XQNA 3NJXA 2Q8EA 3A23A 1SLLA 5EHDA 4GB31 2P3YA 4OMDA 1GOFA 1V6KA 2J1AA 2GC2A 2MNGA 4B8EA 4L2NA 3KVBA 5HCAA 5CZKA 3A22A 4AI2A 4H3WA 4R4XA 1GP6A 3AKQA 3AJZA 4E4DX 5IW0A 4KWLA 1VLNA 1HRV1 4RHV2 1XU1A 2LTNA 5F9TA 2J1UA 3OEAA 4RHV1 3PIJA 1N1VA 2WSVA 4YVWA 4K40A 2OYZA 1QF3A 5C71A 1JYCA 1BXHA 4JGYC 4AF9A 3T0AA 5F2SA 5FWEA 1IZ3A 4LK7A 4S2GA 4MXWB 4DS0A 1ND2C 4PLMA 5FZLA 1RXFA 5DDJ2 5CFDC 3VBOB 3DYOA 2LUWA 2R041 4QGMA 3U14A 4CEYB 4YG3A 1C57A 4NPMA 1S2EA 2K9ZA 5IHRA 3AMMA 4QHBA 4LIUA 3T4VA 1VBB1 1K5MA 2CGNA 3OBZA 2JB4A 4LOSA 4NPLA 4P5YA 3WD5A 1MS0A 1VBB2 3M4FA 2DFCA 3KVAA 4EN6B 1ODMA 1AYM1 5J48A 4PT6A 4RN5A 5DQ0A 2X8KA 3OYWB 4QM8A 3WF4A 1UU4A 2QQWA 2Q5TA 4EYUA 2A6YA 1D4M3 2D6OX 2RE9A 3DL3A 3MHZA 5FLJA 2XXZA 1GSLA 4I0AA 4CA9A 2XUMA 5F5AA 3RFRA 1AXKA 4AAPA 2YPDA 4AK3A 5APAA 1QOSA 2QTWB 3BU0A 4XXPA 1UOBA 4Y22A 1D2QA 3PMSA 3KV6A 4Y1VA 4YZ4A 4CCJA 5LW9A 1LRHA 3DPRC 1IGOA 3VD3A 2WNUC 3BALA 3IDAA 1NXD1 4AEDA 4F83A 2VZRA 3UNPA 4QX1A 1UMZA 2ZGNA 2YMZA 1APNA 2QQJA 4AGGA 4P00B 4NHYA 5FKCA 2G4IA 2R16A 1G9BA 4AL9A 5I8TA 3RYRA 4CPBA 4KGGA 3DYPA 1QKQA 2XR4A 3ATGA 4MSVA 1K45A 1JI6A 2X5IB 2A75A 1OSGA 1SHWB 1RJ8A 2R49A 2P1BA 1HRI3 5DAXA 4IE5A 2JECA 3W9AA 5K9YA 1ZM1A 1CX4A 3ZDSA 1D4M1 1G7YA 1AL21 5FMDA 1FATA 1HDKA 3H8OA 1G9FA 5LK7B 2VO5A 4WV8A 1NCQA 2FDIA 1IOAA 4IEVA 4YVSA 3ZFGA 2VVEA 3H0OA 4CP1A 1OD3A 2WN3A 3R4SA 4FFIA 3UJQA 4FPOB 4KG8A 5C3PA 1NY72 4QMAA 4ZHNA 1UD1A 2WSUA 4IGPA 3ZYJB 1LHWA 1PVXA 4XIKA 3N9QA 5D2AA 5FZBA 3USUA 3TEYA 1ZZ8A 4WM7A 4BLIA 3OSDA 2GAUA 3BUCA 1AL23 1DYKA 5LBCA 3KS7A 5DABA 1SBEA 1NQDA 1V6MA 5T5LA 5FPAA 1W8FA 1LESA 3MF9A 1O3SA 3HVDA 2WRAA 3LDRA 4BPZA 3SXWA 4W50A 2VPVA 2P17A 3ZSEA 1UYZA 2V73A 3O1PA 1WLWA 1VR3A 2W68A 3C7OA 3PVNA 4FFHA 4HANA 4N43A 5C8CB 2RMU1 3OPWA 3MIGA 1AR81 2XKPA 3AVSA 4CXXA 3I2DA 1XE7A 2HJIA 1JZ8A 2RM21 3GJBA 3ENRA 4Q4W1 4UXAA 1PO22 2QQVA 3WP6A 1YI7A 1ZZ7A 3NJVA 1RITA 3ZFGC 5CYYA 2XJQA 3VBSB 3T0DA 2I74A 3POEA 5K0UA 3THPA 2ZGRA 4W4ZA 1QMJA 1BEV3 3FE5A 2G19A 2ET7A 1QHDA 3FN9A 3LSEA 5EP9A 3TN92 1OHFA 2FZ2A 2IXKA 1RMU2 2B5HA 3NQHA 5H9SA 2W91A 2ZXQA 3L2YA 1H9WA 1CAXB 2VQ0A 2ZGMA 3DKWA 3LIHA 1GU3A 3MLLA 4Y5Z0 1PZ9A 1LJ7A 1CN1A 4XEZA 5JUVA 4C0BA 2RS52 1CONA 5F37A 2AENA 1UOFA 2Z79A 5EFUA 2WYSA 2ZAAA 2XBO3 2YPJA 4LO7A 1SLTA 5IVFA 3NV1A 1SZBA 4C91A 1JZ3A 2WZ8A 3GNEA 5JI7A 1N1SA 4HETA 1RUJ2 3ACLA 4I02A 1GZTA 2W1UA 3I59A 1NX9A 3JXSA 5LZ6A 2QVSB 4A7KA 3GZTB 3BVCA 4OUEA 5IVCA 2WS92 2I07B 4G3YC 2A70A 3U1XA 2W2IA 4KGQA 4JGYA 3PIGA 2ZGPA 4LITA 1LEDA 1LCLA 3B69A 4AVVA 2HWE3 4NO4A 1LOCA 5DUUA 2VJXA 5DN2A 1LAJA 1HV0A 2AGSA 4CDWB 4AVBA 3SH4A 5A3LA 4JCKA 3U0ZA 2OQ7A 1QQP1 2X10A 2MPFA 5DG1A 1SQ4A 2W39A 2DBIA 1LEMA 3EB7A 1H6XA 5FCCA 3RJRA 3OBTA 1DG6A 1JN2P 4CP0A 2VZUA 5C33A 3J26N 2D5FA 2ZBJA 4GB33 1ODNA 3ETQA 3I8TA 4MGQA 1UZYA 3IZOA 2VBPA 1FNZA 3KF5A 5I0UA 3SHRA 4BK4A 4LOTA 2QDNA 1RUD3 2R042 3N7KA 4R9BA 4ZZ8A 4UF0B 3D3AA 2TNFA 4B4PA 1W8UA 2VZ1A 1NT0A 3LGRA 3N4MA 1RHI3 1R083 4CEWC 1CJPA 4HN0A 4NUBA 3TB0A 2ERFA 3GM8A 3O1RA 4CDXA 4NIDA 1W6QB 1QJFA 3O1MA 2IXCA 2IZWA 1ZA4A 3AB0A 5IAXA 1U5IA 2WLPA 2BGCA 3WW1A 1E5HA 1SG3A 4UW4A 4WZCA 3VBRB 5KC5A 4MYEA 3SKJE 5C8CA 4QB6A 4M3CB 5FZEA 4FPFA 2WT2A 4URAA 5CG8A 1F31A 5LRRA 3LD8A 1WA6X 1YRZA 3R0RA 4EN8B 2YGLA 3LCPA 2GZWA 3VBFB 1S0BA 1ASJ1 4X8NA 4PI0A 3KWVA 5A7PA 3SMHA 1TMF3 1NA1C 1AX0A 1CIWA 2CWSA 1RUG2 3RNSA 4YPJA 3K2OA 3M1HA 1YFWA 4BZ4A 1ND2A 2D5HA 1VAKA 4FQ4A 4XFFA 5FPUA 1SPPB 1ZRCA 3VKOA 1YWKA 3M70A 1TNFA 2YFUA 1F15A 3C7GA 2FMDA 2WN2A 5BXXA 3OEBA 2XWBB 4R9AA 4HKLA 1W8WA 2VULA 4XQDA 4JV4A 1O91A 4AI8A 3I2FA 1LOFC 4HFSA 4OYUA 1CAWB 2ZEYA 3ZFGB 1E5IA 5FYSA 2L9LA 2F17A 1RUC3 3AM2A 4XFIA 1FPN3 1W06A 1DQ5A 3IDEA 1R1ZA 1DZRA 5G05L 2ZMKA 4Y1YA 1FOD3 4X6QB 1HQLA 1A3KA 2NMNA 5E89A 2WZPP 2ZGLA 5ANNA 1WLDA 2C4XA 1W9YA 5IJRA 1QJY1 2GSYA 4ASMB 5HV4A 4XHBA 2J1EA 4E4HA 3BOWA 4QPGA 4MG2A 3I2OA 3W21A 3CU7A 3VHPA 5JZGC 4TYSA 3RYPA 4M0NA 2D97A 3KGLA 3RG0A 1VBD2 4NJ4A 2WFPA 2ZGOA 2PAEA 5A3MA 3AYAA 1I9RA 1OA4A 4QGLA 4D3WA 1BYHA 3WF1A 4HLTA 5FFOC 2XQRA 1V6JA 2CTVA 2JDPA 4OUMA 1XE0A 3KCXA 3HQUA 3S6PA 1AR63 1RUNA 1B09A 5AVPA 2XMLA 5FXXA 1O8SA 4XJAA 1OLRA 1WZXA 4P9WA 4QXBA 4S2HA 5DZGA 2Y34A 2ARAA 2R7EB 1IPJA 1UZZA 3AFKA 1OT5A 1RC6A 2Y33A 3TN93 1RUI1 1GZCA 5KXDA 3SITA 5CAZA 4CCKA 4KBZA 4P02B 4TLGA 1UQXA 3ZYIB 4JRAA 1IHMA 1QJU2 3UGFA 1LKNA 5FRAA 1FOD1 3TOJA 3VDBA 1NLRA 5IVBA 4OHXA 5BNOC 2ZAHA 1H30A 5J1XA 4PBOA 1VRH2 5A33B 1ZX5A 3S0MA 1BCXA 1ULCA 4Q8KA 2VNOA 1FYUA 1R64A 2JIJA 4WM8C 1GZ9A 1JZ2A 2QJVA 4NAOA 3MI8A 2QQOA 2FCUA 3NV4A 4XQ4A 4GWJA 5C3RA 4Q29A 4IQPA 1BEV1 4LHLA 3U07A 2V72A 3DF0A 3WVJA 3J9SA 4L11A 5A6YA 1UNBA 4DXRA 3CJIA 2OS2A 2YC2A 1DCSA 2C24A 4CDWC 3PUIA 4UW3A 3MUZ1 4IV3C 4V2WA 2OVUA 2UY9A 3I59B 3ES4A 4RGGA 1UY0A 2RS32 4ZXKA 3VLBB 2YB7A 1AJKA 1AR83 4Q5OA 2NQYA 2UYBA 2B45X 4LKFA 4OFGA 3N7JA 1OH3A 2BNMA 5KXEA 3FFQA 5FZOA 1POV1 3SH5A 5FWJA 4I3GA 1CR7A 4HT1T 4AGRA 4N7IA 1AR62 4LIVA 4Q4V2 1LB2A 1QY4A 1UCXA 1JUHA 2Y64A 3DPRA 4U36A 1OOPC 3VUOA 2DUPA 2PLV3 1OF3A 4YG0A 1OVPA 2D93A 1AYN1 2W5FA 3KT4A 4DNYA 5KXBA 1PM7A 1KDMA 3WUDA 2Y6GA 1YQ5A 2IXHA 1W2AX 3VBSC 4RL7A 2WYFA 2ATFA 4DPNA 3WP4A 3PVOA 5H9RA 2D7FA 4MGKE 5A7OA 2ZOEB 3UK9A 5JOZA 4TN7A 1TG7A 4K6BA 3MW3A 4CCLA 4QX3A 3TEWA 1MZEA 3C3VA 5I0SA 3ZPOA 4AG4A 1LOFA 2ARXA 3LB9A 3U11A 2ZA9A 4DY3A 2F6BA 4GWNA 4O61A 5CNAA 4D7TA 2OUHA 4RGKA 4IV1C 4N9IA 4BQ1A 3NJYA 2JB8A 5T55A 2DF7A 4IEYA 1C1FA 2WO3A 3EBRA 3OPTA 2ZACA 4JX0A 4LO8A 1QJZA 5IT6A 1RUC2 3WINE 2FDFA 1V6IA 1H2MA 4Y4YA 2D43A 5JMOA 3V64A 3DGTA 1MQTB 1T2XA 3AZZA 5A1FA 3FC0A 2BWAA 1NA1A 3K46A 3Q9OA 4HVOA 4Q26A 4HN1A 2WFF3 1UIJA 2C5DA 2WWSA 5K4LA 3UT0A 2JG8C 4PIXA 3VB9A 1OD5A 1YNAA 1FX5A 1GQGA 2H6BA 1TMF1 2XOMA 3FZ3A 3EYPA 1H2NA 3IDCB 4XF0A 3RS6A 2ZABA 1SLIA 5D8AC 4OULA 1TMF2 1F8VA 5SV8A 3THCA 4QPIC 2WDBA 3TWIA 4PDWB 3SCFA 1AXYA 1BJQA 3UKNA 1DIWA 1QDOA 4JDOA 4Z8BA 4YW5A 1GWMA 1DU3D 3CHXA 5EV7A 5FY8A 4OHYA 2VQAA 4FPYA 2B42B 3AXDA 4MGIE 5GZEA 4KU7A 5C4WA 1H4GA 2YFZA 4I30A 1I5PA 4IW3A 1FMD3 1KDKA 3EQEA 1J59A 2Z2SB 1S0GA 1S2BA 4KWKA 3WZ1A 1NOVA 1H4HA 5DDJ3 4CCOA 3V65A 1REEA 3BI3A 2RS51 4ES9A 3ZFFA 1Q56A 1JW6A 1N1TA 3MUY1 3DV8A 3RZGA 1QJEA 1F5FA 1V9U1 3ZN6A 2WNVC 1GOHA 2G9ZA 1W6MB 1VBA3 3VN4A 2XG3A 3VZLA 4A7YA 2VMIA 3MPBA 1IKPA 3VV1A 1C8M3 5CKMA 4YGCA 5FZFA 1UXXX 3OTFA 3RZZA 2VR4A 2JWPA 3MW2A 5DPNA 1EUTA 3CEWA 5FYIA 2ILMA 4QGNA 5GLWA 4BISA 4LKDA 1MS1A 1W03A 2VZTA 2VTFA 3E1F1 4FOVA 2C26A 4YM1A 5EIYB 4XTPA 1W04A 4EWDA 5EJZB 2AEYA 1RUH1 4CDQB 4QM9A 4MGSA 2Y0OA 2ZMLA 1HRV3 2KXLA 5C5UA 1X8EA 3S30A 4PBPA 3APBA 4L0PA 4IEZA 3K77A 3ZO0B 5JMCA 1BVP1 4NROA 4URTA 5DDJ1 1VBD1 2VUJA 2VZ3A 5FO7B 4ASLA 3WOGA 3AMNA 4OQ8A 2JD4A 2JE9A 2XJUA 3J7HA 5GZCA 5T50A 1RGSA 4QU2A 1B35C 1HB2A 3MFAA 2R072 3LIGA 4OCTA 3U37A 3WQ0A 4EROA 2QQPA 4WM8B 1LNSA 2WJSA 1TME1 3J7NA 4GULA 3AL6A 3B9CA 1DLLA 2P34A 3MYXA 5J7MA 2RJLA 3LEKA 1WBFA 3CF6E 4FPHA 2VBBA 5CFDB 3VD7A 3NNMA 2X53S 3RI9A 5FP8A 4LKSA 2V4AA 4X6RB 1HQWA 4PF5A 4WM7C 1I6XA 2FZ1A 1CIYA 3OD0A 2Y8KA 1W8HA 1W39A 1W6PB 2E7QA 4UFLA 4MGTA 4Q1PA 4F3JA 4LBQA 4LLFA 2D3SA 3BTYA 2VL4A 4DEQA 4CU9A 1V0AA 1YLLA 2BGPA 4A45A 2R32A 4ZS2A 3I2IA 2PHUA 4JKMA 3WXPA 2ZCWA 2DVBA 4N43C 1F2NA 2VCCA 1H2LA 2ZGUA 4UAPA 4JVAA 3A21A 1H1IA 2GP5A 1BLZA 2ZGTA 3IT8A 1HJGA 3BB6A 4GMP0 5FYBA 3T30A 2WABA 4Q4X2 4A41A 4GXLA 4OHWA 3UGGA 5IVVA 4IXLA 2OPKA 4LNVA 4WZFA 4M01A 5HPOA 5L7OB 5LEKA 5GLVA 2VQTA 1P8JA 4RSUA 4KMQA 4UW6A 1TME2 1UX7A 4AAXA 1U5ZA 2XJTA 1PO11 2O8OA 2EXJA 3ALQA 3OF1A 4QQ2A 1PO21 4UYBA 3SEEA 3MZHA 1WD4A 2XL9A 3VHRA 3OPZA 3PUSA 4GJYA 3VKMA 4BU2A 1REDA 5FZCA 4CYDA 1AL22 3ON7A 4FCAA 2J22A 5KXCA 1ZREA 2VW1A 4GZ9A 2D40A 4AHYA 4CDUC 2Z42A 1PVC3 1VE0A 5K0UC 4W6XA 1REFA 2JDAA 4YGBA 1NXMA 3NW4A 1X7NA 2D6PA 1WCUA 5LRSA 4AVSA 1UMHA 4D7SA 1OKOA 2NN8A 4LKEA 2CV6A 2PQQA 5FDBA 2VZVA 1Z7S3 5JSRA 2D6LX 3VD4A 2R1DA 3ZXLA 1OBNA 1RUE2 5LATA 4XAAA 1HRI1 4XW3A 4YWAA 3OUHA 4ZXEA 1E57A 4LBMA 3K51A 5BNNB 4CU8A 4Y4RA 4AHXA 1OQDA 4JTNA 5CIRA 4AEDC 1JOBA 3JU9A 5T54A 5IYYA 1DP0A 3KQRA 2BJSA 5FY0A 1R082 5A6QA 2HWF2 2HWB1 1YFYA 3H1YA 1PGL2 3BTXA 1YQCA 4P9LA 1JYWA 1IS6A 4A7ZA 1JZ4A 5ISLA 3UV9A 2EAAA 5F3EA 3MLKA 3WNNA 3V0BB 4D7YA 1C4RA 3VKFC 4LJHA 2BOJA 3VD9A 4HBNA 3PL0A 4RGAA 4CUCA 5L9RA 3GCWA 4WVZA 4G9SB 1WWYA 3BIEA 1AX1A 1KD7A 3WDVA 1UF2C 1IG3A 4NMIA 4GWIA 2CHHA 4Y24A 1YO8A 2NLRA 2TUNA 2VMDA 4PJYA 3WDTA 1RB8G 4YW1A 1CGPA 2OQ6A 1GWLA 1XYNA 2XLAA 4JRLA 1HXS2 1KEXA 1ULGA 3LWCA 3M8LA 4YZ5A 4FTBA 1TEIA 3IKWA 4KBBA 3RSJA 1I1EA 4YVSC 3IDBB 1US3A 3ZXGA 1YQ6A 5DG2A 3UKTA 5FZ8A 4ZZ5A 3IAPA 1HIXA 4MADA 1WMDA 4QX0A 1HB3A 1HLCA 4K21A 2W3JA 4BIFA 3ZN6B 4DMIA 1CAUA 1QOTA 1W6MA 2D3RA 2ZGQA 3ZXJA 4UI9L 1HQNA 1VBB3 3KM5A 4XDQA 3VZKA 4P9JA 4AFMA 2E63A 3CZJA 4XBQA 3U75A 1UXZA 4JDMA 1KS5A 2Y6LA 4M3CF 4LQRA 2WFF1 5K8SA 5A7WA 4CXWA 5BNPB 1DFQA 3WY6A 2GNMA 1DQ1A 4QHOA 3ZYBA 4UWDA 4B1MA 2J1SA 1AR61 4SBVA 1GLHA 1GQHA 1NQJA 5CISA 4N8MA 4CCEA 3O1OA 1TVGA 2IFWA 4XCBA 2VMHA 2ZHLA 1JYIA 1FV2A 2WWJA 1AYN2 4XJUA 5F3IA 2VQUA 1AYM3 4BLJA 4K3UA 2P3JA 4GALA 5G04L 1WMFA 4YZ1A 2AACA 2XJSA 4DXSA 4D6SA 1RXGA 4KI5M 3Q8BA 2YC4A 1T6GC 2VNVA 3TN91 4BK5A 1QJX1 3I7DA 3OBRA 5IVEA 4E8DA 5KHIA 1K5MC 3ZSJA 3WF0A 5FPVA 5JR2A 1LHNA 3AMQA 1ULOA 1YIPA 1RUE3 4AZZA 1K3IA 1PHMA 3SCHA 5CBLA 1G9DA 4OZOA 3WF3A 2VECA 1RUC1 1VBD3 3CLPA 1O4ZA 2B39A 4B3NA 1Q3EA 4NRPA 2Y6HA 1VBC3 3ITQA 2VG9A 3AFGA 3L9JT 3VDAA 2DVAA 2JKXA 5CB7A 2F4LA 2IUWA 1KITA 2HEWF 3KT1A 3DCQA 4GMP1 2IC1A 4Q8LA 4HVQA 3QD6A 2HWD1 4QPIB 3N9MA 1OUXA 4AQ6A 2X5IA 3HQXA 5FXZA 2QQUA 5D8AB 1UKRA 1PX4A 2VMFA 5BNNA 2DVFA 1W8OA 4FOYA 1EV12 4M4PA 4YW2A 2E51A 3U4SA 2PA7A 3N35A 3J8F2 2AC1A 2DU0A 2WNEA 3H7JA 4QXCA 4KL1A 1FI2A 2YROA 2O8QA 5JOXA 3SH3A 4A44A 2D6KA 1FPN1 3KHCA 2V5YA 1XRUA 4CCDA 1XSQA 2FBEA 1VBA1 4FPLA 1JODA 5JR7B 1HXS3 1OPOA 1C5HA 1RYYA 2RR12 5FPZA 1A6CA 1BHGA 3K4ZA 3WG2A 3N7LA 2DYCA 3ELNA 1DDLA 4EJRA 3VZNA 1EV13 1VRBA 1EYBA 1EUUA 4CDXC 4FI9A 4QB2A 1JZ7A 4EZHA 5L36A 1LU1A 4WM7B 1CAVB 2ZHNA 4CCNA
chains in the Genus database with same CATH topology
1SEFA 3T2TA 5L7OA 1RVF1 4AVAA 1C8M2 2QDRA 3WLUA 1FMD1 1AR92 3IWZA 3AKSA 4L9BA 4QPGC 5KBFA 1IKQA 4XMAA 1GKBA 2H0BA 2GMPA 1O4YA 5FLHA 2DFBA 1R1A3 2N7GA 2R063 4XF1A 2VNRA 4D94A 2W0XA 4Q4Y1 1SACA 1Z7S2 1VRH1 1AYM2 1ZZ6A 1H9PA 4XJWA 4Q27A 1URXA 5AC93 4XJZA 5C8WA 3G6JB 4LO6B 4I09A 3AJYA 1V6NA 4RR3C 3WUCA 1PVC2 1VJ2A 4GMP3 1QQP3 5AC91 2Y0IA 2DCJA 4EN0A 4K7JA 2JKBA 3LZZA 4COVA 4YFZA 2DTYA 2RHPA 1QJU3 4RD7A 3NAPB 1XNKA 4X8PA 2WIIB 4I2OA 5ACA2 1N3PA 4GIQA 3RI8A 2E9QA 4W6YA 5DUVA 5DZEA 1D4M2 4CDQC 4LEJA 2DWRA 2RM22 4Q4W2 4AQ2A 3M3QA 4R8HA 2ZZQA 1EAH3 5LK5A 3RDIA 3JCIA 3JQXA 1PIV1 1ZBA2 4JGYB 4CDUA 1VAMA 4K20A 2BW8A 1WCKA 1CESA 1ZBA1 1X8MA 4XILA 4H7LA 4FVVA 1VBC2 5J36A 1BMV1 4YZ2A 1OLQA 5BNOB 1QNYA 3HBZA 2ENRA 4FOQA 4DQAA 3P3PA 2LM3A 5BUVA 1V00A 1Q8PA 3ZIWA 5BNPA 4QD2A 1DZQA 1HRI2 3NL1A 4RS5B 4L8QA 2RMU2 4K8FA 4IEOA 2D3PA 1Y3TA 2JE7A 1QWRA 1C28A 3AK0A 3MIHA 5J98B 3O7OA 4PDWC 3BODA 4BOWA 1ZNPA 2VOKA 1ZZ9A 1G8WA 4L97A 4CDXB 3E97A 4GH4A 1QXJA 2AR6A 4XBNA 4IV1B 3N7MA 1RUI3 5JI9A 3ZFEA 4MXVA 4DOUA 4XF9A 4XFBA 5E88A 4XYXA 2IXIA 2MEV1 2XVGA 4UW5A 2H6CA 2HWB3 4LBLA 2G9GA 4H14A 2V09A 2WT0A 1RINA 3B93A 3DN7A 2PTMA 1H1AA 1DBNA 2R062 1RUF3 4XJ8A 1YUDA 3GYDA 4Y20A 2MEV3 1QXPA 4FQZA 3KZ4C 1WGPA 3A0KA 4XZPA 1O3RA 2PHRA 4QX5A 5T5PA 2WNUA 3NKGA 3ZVXA 3QACA 1Q8QA 2HEYF 1ENXA 4QPYA 5BYNA 2JG9A 4SLIA 5GLUA 1QJY3 3BU7A 2BPA2 4BWOA 4OZXA 4JGZA 2YHJA 2BUKA 4FO9A 3VL8A 5K7PA 2XJRA 1CAWA 1WLTA 5I91A 1AL0G 1BBT2 1ENQA 2EXKA 1DQ6A 1MZ6A 1JBCA 2UWCA 2XVLA 4FPEA 1ZRDA 1IS5A 1AR71 3ES1A 1Q5OA 1CAVA 3NV2A 2XJPA 4NPRA 4AI3A 1SLBA 5E16A 1X33A 3M3OA 5KHKA 1O5LA 4L99A 1WW5A 1SFNA 3VHNA 1GYKA 3E6DA 1LOGA 3V0AA 3JBG1 1A8MA 1PZ8A 2R073 4GQ7A 1ZBE1 1OA3A 1W0PA 3CO2A 5C9AC 4MXWA 2RS11 2ETEA 1Z78A 3WCSA 1O4TA 1A8DA 1ULFA 2ZHKA 2TEPA 1ZYBA 2GDFA 3IMNA 2FHRA 4WVVA 1Z7S1 3MICA 1POV0 4JTOA 2BNOA 2ZS6B 1ND3B 2VVDA 4BMBA 4XOGA 4AFDA 4O9EA 4C1XA 1YFUA 2XJVA 4QQPA 4BE3A 1RHI1 4LR4A 3ASIA 4PLNA 2DCKA 1QOOA 1DF0A 1OMIA 4K1YA 1PVC1 3KCCA 3BCWA 2BFUL 4AWDA 3LOBA 1RUD1 3LAGA 5L73A 2RR11 1DQ0A 4GH4B 4IEUA 2DUQA 3JD72 1RUD2 2R043 4NR1A 2OZJA 1RVF2 3ILRA 3RQ0A 1KXGA 1BVVA 1H0BA 4V1PA 4PQ9A 1U12A 5IUQA 2FMYA 3WP3A 4E2SA 5H9QA 5HCFA 5JZGB 2GH2A 4AEDB 1YYNA 3ILFA 2D98A 4RHV3 3VKLA 1BK1A 2GMMA 4LBNA 2D44A 4UBHA 5E8AA 2D6MA 2CWMA 3THTA 4R9DA 2VH9A 4CDUB 4XMIA 2SBAA 3MF6A 4F7ZA 3PJYA 2QCSB 1VALA 5DXDA 1YIFA 2JEMA 5FMOS 4YM3A 5JPMB 4QQOA 4E4SA 4JGZB 2BQPA 2EF6A 2R6QA 5ABJA 3M3EA 3HWJA 3UL2A 4Q0UA 2HWC1 4KWJA 2A6ZA 1GR3A 2XBO1 1IPKA 2IXJA 2A5ZA 2AYHA 4R4ZA 4CP2A 3U4XA 1MS9A 2RS53 1DYPA 1NCRA 2GC3A 3POYA 3USUB 1KRIA 3D0JA 4LLOA 3LA3A 5HBAA 5HI0A 1GANA 3AKTA 3WHTA 2W08A 3J4UH 4Z2WA 3G7DA 3D8CA 4E2GA 1NLSA 1XXNA 5KC6A 1DGRA 1R091 3HIFA 3B00A 4COWA 4IV1A 3FLTA 1ND3C 4N43B 4Y22B 1QJU1 3R4DB 4AEKA 2XGXA 2LALA 2YGMA 4I0WB 2NP0A 2X5IC 5CA6A 1VBC1 1GNHA 2P2KA 3ECQA 4RA0A 1BMV2 1QJY2 1AR93 1N3OA 4PDWA 1ALYA 3AP9A 2MHFA 1PNGA 1NY71 4DY5A 4YM0A 1RUE1 1J3PA 2DURA 3JD73 5T5OA 1ENRA 2GNTA 2RS33 2YYOA 4Y1XA 3ZSKA 3OY8A 5KHHA 4B29A 4W65A 4XETA 4YGEA 3T1MA 1XNBA 2RR13 2JX9A 3GHMA 4FSJA 3H3ZA 1DGLA 1Q8SA 1SBDA 5DUWA 4YVSB 5KWRA 1H8VA 4Q4X3 2O0OA 1VBE1 2HWF1 4IERA 1LGNA 3WG1A 5FREA 2C9AA 2WT1A 3I54A 2HWC3 1RVF3 4NHKA 5JZGA 3MEPA 1ULEA 1FXZA 5F5QA 2Q1ZB 3POWA 3CJXA 1UN1A 4LE3A 4AE2A 4HMZA 4WVWA 4AI1A 5GZFA 4CDQA 4GA9A 2Z69A 1HXS1 4LBJA 2VU9A 1MEC3 2NM1A 3GBGA 4LUMA 1BQPA 1FV3A 3WHUA 2R30A 2BEOA 3MIDA 2QZ3A 5ABJB 3VHOA 1J3QA 3FBYA 1ZZBA 3POSA 3RRDA 2B9UA 3B9IA 1UPIA 4P9GA 4TWTA 3VBUB 1MZ5A 5GLZA 4XF3A 3WQ7A 1OFNA 2P3KA 1COV2 4P9YA 4LULA 1A78A 4OVEA 4AI0A 3E5QA 3IPVA 1V6LA 2WFF2 1R081 2WZR1 5FLIA 1IS3A 4XBLA 5J3UA 5GZDA 1KFUL 1OQEA 1U5XA 2SLIA 4OI4A 4IETA 3S7EA 4WM8A 5JVVA 3FWEA 5CADA 2Q30A 2VNGA 1MZFA 4HSJA 3FUOA 1PK6C 1LU1A 5A32A 5JDBA 4FOWA 4LO5B 4HKOA 1AR72 1CAXA 1RL3A 1GV9A 5EZWA 4IEQA 1AXZA 3WP5A 1W6PA 1QJX3 1EPWA 4MGYE 5EWSA 1AUYA 2MEV2 1WCDJ 1NE4A 4KQ7A 4XIOA 5CG9A 4HKWA 3OGGA 1OOPA 1CJDA 2W52A 3PLQA 1ONAA 2ZPXA 2CL2A 1TE1B 2XB6C 2AUYA 2HWE2 2VOVA 2CAVA 2RS13 3HT2A 1V9U2 2B8MA 4AQSA 5C9AA 1Y9QA 2HEVF 3BOPA 2DCTA 1TQ5A 4G4FA 4DINB 4BCUA 1S0EA 4YLZA 2R071 3NSTA 1POV3 3A0NA 2HWD2 4LHNA 4B4QA 4FTSA 4RS5C 3CJIC 1SCRA 2DV9A 3M3IA 2O1QA 3PNAA 4BYYA 3NVCA 3J8F1 5JAXA 2EVXA 4ISRA 4EV0A 1DHKB 1HX6A 3ILNA 1UW8A 3AZWA 3SCGA 1LOEA 3EHKA 1XE8A 4AFBA 5EYXA 2P37A 2A3WA 1RHI2 2Z5WA 3TYJA 1V6OA 1WA4A 1NCRB 3QCWA 2CNAA 3B94A 1OQ1A 2OW4A 1DQ2A 4COYA 2IWGB 1Y43B 4J1WA 5GZGA 3GALA 4K1ZA 2ZX2A 4FT8A 4XFAA 3RYKA 2HKXA 3B5LB 3TNPB 1FT9A 2ZGSA 2GNDA 3ZXKA 1AVBA 3C2UA 2ZX1A 4QT6A 1WD3A 2JJ6A 1S0JA 3FJSA 1MS8A 3JB4C 5FTTC 5FMOL 3FHIB 1ZBE2 4DRVA 5C33A 1VIWB 2RMU3 3WQ1A 4YYOA 2PHLA 1ASJ3 1ZBA3 5EXOA 4Q1RA 1MVQA 2GMEA 4OUSA 4AXOA 1RUOA 4M3CA 1ZRFA 1RIRA 1EAH2 4DB5A 2YZ4A 3VBFA 4HL0A 1TME3 1WLCA 4YFWA 3RMXA 1H2KA 1X82A 3B02A 4Q0VA 3ZFEC 3O0WA 1D4VB 3H1WA 3E5XA 5KHGA 2AH2A 1VBA2 3R4UA 3ZXFA 4FAHA 3AP5A 1BBT3 5J09A 5LEJA 3OJBA 3WNXA 1ENSA 5F6LB 1COV3 3D6EA 4AYUA 1RUJ3 1W0OA 1LECA 4LTAA 3JQWA 5JOWA 3PVBB 1NG0A 1CD3G 2WS93 1LENA 4Z07A 1S0IA 2R0FA 5FBZA 4I3PA 1FMD2 3AMPA 3K48A 1IS4A 1UU6A 3CJIB 3E6BA 3R05A 1Z0HA 3CL1A 1RMU3 3IIAA 1H1MA 3AX4A 3HD8B 1PO12 4XXAA 2GC0A 4E4ZA 3B7MA 1G6NA 4P9IA 3BPZA 4M0HA 2UWAA 2WA3A 4OHVA 4R52A 4AVCA 1RUI2 1YJKA 1Y7BA 3H9AA 2K2SA 4COUA 3NKTA 1KS4A 5TSWA 3KCYA 3WV6A 3ZMNA 2TBVA 4AEMA 3H3UA 4JAAA 3URFA 1S0DA 2EIGA 2WKKA 3PTYA 1MR5A 1NE6A 4Q0QA 3AP7A 1VB2A 1J1LA 4A3XA 4N7UA 4H55A 5JWPA 2ARBA 2A6XA 3GBWA 3NV3A 4PIYA 3VBUA 4YZ3A 5T3NA 1D2SA 1U5YA 1WW4A 1CPMA 2JG9C 4CEYA 4FP3A 2VOXA 3VKNA 1AF9A 5JLVA 1QGLA 3CNAA 1JUIA 5FPXA 5EYYA 1M06G 1K5MB 4AEJA 1PGL1 4LE4A 4OI2A 3AMHA 3ZIXA 2WS91 3ME2A 4YSFA 1W2UA 3OYWA 2BVBA 4BMEA 1ZRRA 4FAGA 5BY5A 5K0UA 3BTAA 4MLOA 4NN0A 1NA1B 1VBE2 4QPIA 1BBT1 2PHWA 1M4WA 5SV5A 3ZPYA 1QH6A 1UIKA 1S0CA 2ZX0A 3HN1A 4Q4V3 4YRDA 1OOPB 3MLJA 2OUJA 2WQZC 3H1MA 3SISA 3VDDA 4P9XA 5IK5A 2QZ2A 2BVVA 5JIUA 3VBRC 5JCTA 2R061 4NHLA 5F6KA 1R1A1 2HWE1 1LOBA 4OHZA 4ZKTB 5FQ0A 2YC0A 2FQPA 4ZU4A 5C4WB 1RUJ1 1O3TA 2UU8A 1COV1 3I4IA 1U0AA 2G9FA 4B7EA 2UY8A 4ES8A 4DZGA 2DTWA 5BNPC 5C6CA 3W59A 2PHXA 2A3YA 1D0HA 1Q43A 2XHKA 1AYN3 2OIIA 4HPKA 2K0GA 1G9AA 4FPJA 2C1FA 1MVEA 3LA7A 4K9SA 3AYCA 3AKRA 1QQP2 3MIEA 4META 4KNCA 4S2FA 5FOBB 1ULDA 3D0SA 3WDWA 1WW7A 3EJKA 5E1RA 1HRV2 4KG0A 4MVTA 2I45A 4LBQD 2VMGA 3UKVA 4FTEA 4FPGA 1CVNA 1PNFA 1UL9A 2Y38A 1G9CA 4BHPA 5DUXA 2GN7A 4LO4B 1KFXL 2JG8A 1TNRA 2ZTNA 1O7FA 3MDPA 1MS3A 5FO8B 4EN7B 1B35A 1R1A2 1GZWB 3KD4A 1QDCA 3AXEA 4IV3A 4WVMB 3EXUA 4BM8A 4P14A 4CRQA 4YW3A 1SBFA 4YNIA 3ZN4A 4E9KA 3GZUC 2PN5A 4B7KA 3MW4A 5AFBA 1WUVA 2P3IA 3NAPA 3WDXA 4HZFA 1O3QA 1XNDA 5CFCA 1HKDA 2A73B 1EPZA 3O0XA 3WT3A 3VBHC 3GF6A 3J8F3 4PLOA 3FX3A 1JOJA 4GB32 4AHWA 1WCSA 1FPN2 1XNCA 2HWF3 1XYPA 2DVDA 3MGUA 2Q4SA 4Q0PA 1ZZCA 5C8CC 3VBHA 4XTMA 4XQWA 4N9HA 5K0UB 5GKAC 3ZXDA 4C0HA 3ZN5A 2AZ5A 3IM0A 4FPKA 4YARA 2DCYA 3W58A 1LGCA 1YJLA 2R0HA 3UJOA 3VZMA 4LBQB 1S55A 4NOTA 3JD71 3M3CA 4C1WA 3LSDA 1RUG1 2BTVC 3ZFFC 2ET1A 1DZTA 3DUIA 4ONUA 3ZYPA 2YY1A 2DU1A 4Y1ZA 1MQTC 5CVRA 1FAYA 2VVFA 1AR91 3AZXA 4YW4A 1GBGA 5FQ0B 4CDWA 2PHDA 3ST7A 3VGIA 1PGW1 1PO13 4KU8A 1OPMA 1SLCA 1GFF2 3EO6A 2BFUS 3PJQA 2WZR3 1YCIA 1GNZA 2XLFA 1RJ7A 4IEWA 1J1TA 2C0ZA 4LT5A 3L2HA 4M3CE 5GM0A 1VAVA 1BEV2 1LU2A 2E7TA 3ZFEB 1QH7A 1Q8OA 3PHMA 1AX2A 1LODA 3E6CC 1SMVA 1VBE3 3ZSMA 1J3RA 1YI9A 1W6NA 1JH5A 4CTEA 4Q4X1 2ZKLA 1MEC1 3VZJA 3INAA 4Z82A 4Q0SA 2UURA 4A2UA 2HWB2 4AFAA 1W6QA 2JDZA 2VY0A 3B3QE 1B35B 5ACA3 1AR82 1GZWA 4N53A 3VDDC 5IK7A 5FO9B 2AREA 3QH6A 4IV3B 3FFZA 4WVMA 4AW7A 1FOD2 4E27A 3LOIA 3VBRA 4BH9A 4B4RA 3HR9A 2QFEA 4BIOA 2ZX3A 1WBLA 2DUOA 1FNYA 2GNBA 4ATEA 5KHJA 1S1AA 1PGW2 3VDDB 1DQ4A 1N1YA 2JICA 4COZA 1LHVA 3JZVA 2X29A 3V0BA 1LOAA 3HT1A 2ZX4A 3H8UA 1PZ7A 3NAPC 4YGDA 1IQAA 3WX5A 2PYTA 2ZHMA 2WNVB 4E2QA 5B2GB 2E6VA 3SLIA 1ND2B 1KJLA 3D82A 2XBO2 3M2MA 5BV6A 1V70A 4S2DA 4MZUA 2GU9A 2RS31 4LHKA 3VL9A 3FLPA 3R6SA 1WW6A 1NCRC 4RR3B 3RWNA 4IL7A 3O12A 1VB4A 1C1LA 3FUQA 3NJZA 1HV1A 4HPKB 4CEYC 1CAUB 1PMIA 4XFCA 2DVGA 3QLQA 2IXLA 4AQTA 2ZGKA 2WL1A 4FP2A 2B7YA 2UYAA 3WDUA 3BIWE 4Q4V1 4P5HA 3QBQA 4EN9B 1OKQA 2ZKNA 2R1BA 3O0VA 2WINB 5BPXA 4IEXA 5FOJB 4MX3A 4IEPA 4QPGB 3IN9A 4RQPB 2JG8B 1LGBA 3MFCA 4Y1UA 1ND3A 4C90A 3NO8A 3GBFA 5IK8A 2GALA 1NCQC 2Q0AA 3D4KA 4F8AA 3RPQA 5I8SA 1V9U3 1BZWA 4RQPC 1RUF2 2OA2A 1PIV3 1PK6B 4QXKA 2JXAA 5D1IA 4GWMA 4Z1VA 3KMHA 2QUOA 3KLSA 5CFCB 2DCZA 4XF4A 3LKJA 1I3HA 1JTZX 1AR73 4QQLA 4PIZA 1HW5A 1UU5A 4XFHA 1W6NB 2EXHA 3VBUC 3WW3A 4Z92B 2WZR2 3LA2A 5ABJC 5A33A 1LHOA 1UPSA 3VBHB 5T52A 4NWVA 4H7MA 1S2KA 2QKDA 1SCSA 4MH0E 1N47A 2A6WA 5FAXA 4N53B 1RUH3 5D8AA 4XFGA 1N3QA 3AKPA 2GC1A 2VW0A 3ZXAC 3MIFA 1C3HA 4R9CA 2KM2A 2VUAA 3P3NA 1RUF1 4O9GA 1OA2A 2VOWA 3FMGA 1C8M1 4CEWB 2PHFA 4HK9A 4HVRA 2E53A 5J37A 2WNVA 2PAMA 3JBG3 3O14A 3DPRB 2NMOA 4XHXA 2Q1MA 2YXSA 2YDEA 3AZYA 3MPPG 3USSA 4LA3A 1KQRA 2RS12 2YV8A 1PO23 3IBMA 1UX6A 3KT7A 2GH8A 5AFEA 3D5OA 4RR3A 2PFWA 2WQ4A 2XWJB 1QU0A 2PELA 1S0FA 3N3HA 2D6NA 2NZ9A 1UAIA 2BBVA 1ZBE3 3RJ2X 5BNQA 2IFRA 4I01A 3WG3A 4WBBA 4INDA 5HCBA 4OI1A 2ES3A 3A4UA 4FBFA 1W6OB 3AP6A 1SFYA 1MQTA 3KB5A 4FPCA 2VXRA 3OY8B 1QNWA 3SNMA 2RM23 4Q4W3 3JB8A 4HK8A 2XKOA 1O5UA 1WMEA 1XYOA 3AP4A 5C4WC 1RTVA 2RJKA 3WCRA 2ZZJA 1R092 5I0RA 1F9KA 3GZAA 1SLAA 1YFXA 4MGZE 2EALA 1MS5A 4TLFA 2CGOA 3FBMA 1EAH1 2XLGA 2EAKA 3U10A 5AVAA 1LHUA 2YUEA 5I93A 1X50A 1YHFA 5GJ6A 2A7AA 2BWCA 1RUH2 1H8TB 4ORFA 3ZXEA 4XPVA 5EJ3A 3ZYGA 4JGZC 2OZ6A 2PHTA 2HWC2 4ZU5A 3ZFFB 4KH9A 5AC92 2PLV1 1DGRN 3O5SA 4M00A 2BNNA 4CZSA 1LTEA 2GN3A 4HSLA 5CU1A 2HYKA 4YVWB 3TBDA 3VZOA 5L19A 5GLTA 5GALA 4JC1A 3B01A 1QXRA 5DZFA 2NPIA 4GKXA 1H8TC 1EP0A 4LBOA 1L3JA 5ACA1 3WW2A 3WR0A 4YVWC 1D0GA 4ZU7A 3OGJA 4Y26A 3AZVA 3IPVB 1PIV2 4RQPA 1JXNA 3GHNA 3TRSB 1KJRA 4N90A 4Q4Y2 1X36A 4GH4C 5F1RA 2ZMNA 2CYFA 5JPNB 2A6VA 5H9PA 4AFCA 5IK4A 3MIBA 4ATFA 5A32B 4YG6A 3ROUA 3VBFC 1J58A 2WLQA 1PK6A 2E7AA 3KSCA 4ITCA 4GKYA 3HAGA 2WA4A 4UBGA 1GICA 2PLV2 3PMEA 3T1LA 5JOYA 4J1XA 1CQ9A 4FXGB 3FLRA 4LUKA 4NVPA 3WW4A 1MEC2 2VW2A 2CAUA 1MACA 5C9AB 2WC2A 1VP6A 2Y26A 3AYDA 4LA2A 2CY6A 4I0BA 3KGZA 2F4PA 4Y20B 5CFDA 3OD4A 2CGPA 1YXWA 4DXZA 2WNUB 4FXKB 4OI0A 1AJOA 5J96B 1RUG3 4MUVA 4AVTA 4JQRA 5BNOA 4XE9A 3WDYA 1AHSA 2HWD3 4AHZA 5T5JA 4J6GA 2I2SA 2NYYA 3QH7A 3JUUA 4MV2A 4U2AA 1RMU1 1AZDA 2H0VA 2VGDA 3VBOA 3WG4A 1VRH3 2EA7A 1C8NA 4CEWA 1DGWA 4RS5A 1NYWA 5I0TA 4EWAA 2UWBA