5L7OA

X-ray structure of triatoma virus empty capsid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
230
Chain Sequence
DEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein
total genus 46
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08762 CRPV_capsid CRPV capsid protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oA00
2HWE3 1QJX2 4QPGC 1IHMA 1RUJ1 1RUC1 2R042 2GSYA 4GH4A 1A6CA 1PIV2 1RUI1 1RB8G 4CDQA 1WCDJ 1B35A 1RUF3 4RFT0 1MQTA 4RQPA 4CDQC 5C9AA 1AR72 1RHI3 1R091 1PIV3 2BFUL 4N43C 5L7OA 5D8AC 2XBO2 5CFCB 1K5MB 4IV3B 1HRV2 4AEDA 1Z7S1 1ND2B 1HXS3 1B35B 1C8M1 5C8CB 2XBO1 3TN93 1VBD2 5FMOS 1RUI3 3JB8A 4RS5A 4RS5B 2HWE2 1QQP1 2HWD1 2PLV1 1VBD3 4GMP3 4EJRA 1NCRB 5JZGC 1EV11 4IV1C 5BNPC 1COV3 4CEWC 2RS13 3JBG2 4JGYC 1RUC2 5ABJA 5BNNC 2WLPA 2WS91 4Q4W3 3JB4C 2RS12 1FPN3 2BUKA 5DDJ1 2X5IB 1OHFA 3ZFEB 1VBA3 1RHI2 5L7OB 3VDDB 3VBRC 2XBO3 1ND2C 2WFF2 1AR61 4AEDC 1NA1A 3VBSC 4WM8A 5A33B 5BNNB 2RS51 1RUH3 1ND2A 1NY71 5CFDC 1AR71 5BNPB 3TN92 3VBUC 1PO22 4GB31 1RUI2 2ZTNA 1R1A2 1MEC3 1F8VA 1VBC1 1AYM2 4JGZB 2R061 1D4M2 4PDWA 1RUJ3 1CJDA 4YVSC 1AR91 4RR3A 1BEV2 1RUC3 4GH4B 1AR63 4JGZC 1RMU1 1NA1C 2R071 1H8TB 1VBA1 1NOVA 1R082 2FZ1A 1MEC1 4CDUC 1VAKA 3VBUB 2R043 3J8F2 2R062 4GB33 2TBVA 2MEV2 2WFF3 1COV1 2RS32 1POV1 3JD72 2RR13 1AYN2 1RUG1 2WWSA 4FSJA 1RUE2 3VBRB 4IV1A 4YVSA 3JD73 4CDXB 1NY72 3ZFEC 1RUE3 4RHV2 1MEC2 4QPIA 1AL22 4LLFA 1HRI3 1HX6A 1VBE2 1BMV1 4RHV3 4BCUA 2X5IC 4QPGB 3ZFFA 1ASJ1 1AR92 1FMD2 3DPRA 1POV3 4SBVA 3S6PA 3M8LA 1NCQC 4WM8C 3CJIC 1R083 2HWF1 1NG0A 1VRH3 4FTEA 1AR93 2VQ0A 1PVC1 1BBT2 1ND3C 4GB32 2R063 1QJU2 2Y26A 2WZR3 2MEV3 4RQPC 1B35C 3TN91 1H8TC 1ZBE2 1QJZA 2HWC3 1AR81 1V9U2 1FMD1 1BBT3 4GH4C 1FPN2 1POV0 4FTSA 4N53C 1VBA2 1C8NA 5K0UA 1GFF2 1ZBE3 4JGYA 1F2NA 2HWC2 4CEWA 1OPOA 3VBHA 5K0UC 1OOPB 3LOBA 4N53B 4AEDB 1AUYA 5A32B 1R093 3ZFGB 3VBOA 5BNOC 1AR83 1AL23 1RUH2 4N43B 1X36A 4WM7A 1RVF2 3VDDA 1ND3B 1AL0G 5BNOA 5BNOB 4NWVA 1VBB2 1AYN1 1RUG2 3JD71 1TME2 1COV2 3DPRB 1EV12 3NAPC 4CDWA 1FOD2 1QJY2 4CDXC 1EAH1 3J8F1 1VRH2 4PDWC 2QQPA 1OOPA 2HWE1 2BBVA 4Y5Z0 4N53A 4Q4W2 5D8AA 1RUJ2 5L7OC 4N43A 2WZR2 4Q4X3 1BEV3 1HRI1 2RM23 3VBOB 5C9AC 4Q4X1 1H8TA 1MQTC 4YVWB 1RMU2 1PO12 1ND3A 2RS11 2RM22 1EAH3 4CEWB 5CFDA 2WS92 1HRV1 2HWB3 1RMU3 3CJIA 3CJIB 4CEYB 5C4WB 2GH8A 3DPRC 3NAPB 1EAH2 3VBFB 3NAPA 5AC92 2BPA2 1R092 2RR11 3ZFFC 2X5IA 1TME1 4YVWA 1QQP2 1R1A3 2ZAHA 1VBB1 5ACA2 4WM7C 5AC93 1PIV1 1VBB3 5C9AB 2R041 3VBOC 1RUF1 1D4M3 5ACA3 1PO11 2ZZQA 5CFCA 1M06G 4IV3C 3VBFC 1K5MC 1NCRA 5C4WC 1Z7S2 5D8AB 5CFDB 3HAGA 3VBHC 5C4WA 1RHI1 4Q4X2 1FMD3 2WZR1 1E57A 5J98B 5J96B 1PVC3 1PO13 3FBMA 5ACA1 3JBG1 1VRH1 1FOD1 1QJY1 2RR12 2HWB2 1DDLA 5AC91 1RVF1 1QJU3 2BFUS 2HWD2 1VB4A 2RMU3 4Q4V2 4WM8B 5A33A 1NA1B 1RUH1 1QJX1 4RR3C 1VBD1 4GMP1 1QQP3 1HRV3 3VBHB 1RUD1 2RMU2 4Q4V3 1TMF3 1ZBA1 1C8M2 1HXS2 5C8CA 2HWC1 1VBE1 5LK7B 5FMOL 1PGW1 1HRI2 1VBE3 4QPIC 1AL21 1FPN1 1TMF2 1W39A 1C8M3 4Q4W1 5ABJC 1AR82 1V9U1 3ZFEA 1QJX3 4WM7B 1Z7S3 4QPGA 4Y4YA 1OOPC 5K0UB 3ZFFB 1ZBE1 1RUG3 2XPJA 3VBFA 3VBSB 1QJU1 5CFCC 4CEYC 3JBG3 1EV13 5FOJB 1PVC2 1FOD3 1QJY3 1V9U3 1PGL2 1VB2A 4CDUA 4QPIB 4RR3B 1ASJ2 4Q4Y1 4CEYA 1NCQB 1BMV2 4JGZA 4FTBA 4YVSB 1ASJ3 4IV1B 5JZGA 1RUD2 2RMU1 5JZGB 1NCRC 1K5MA 4IV3A 1PGL1 4RS5C 4CDQB 1RVF3 1BBT1 2FZ2A 1RUE1 1R1A1 4CDUB 1CD3G 1HQNA 1TME3 2HWF2 3VBUA 2RS53 5C8CC 2MEV1 2R073 1NCQA 4CDXA 4Q4Y3 4CDWC 1X33A 1R081 2HWF3 2RS52 3IDEA 3VBSA 3ZFGA 3VBRA 5DDJ3 1VBC3 2IZWA 5ABJB 4RHV1 1D4M1 5A32A 1ZBA2 1BEV1 1AYM1 5DDJ2 2WS93 1RUF2 1VBC2 5GKAC 3J8F3 4RQPB 5BNNA 1AR73 4JGYB 2RS33 4GMP0 1ZBA3 4PDWB 2PLV3 1PO21 1RUD3 1SMVA 4Q4V1 5BNPA 3ZXAC 1AYN3 1PO23 2RS31 4NWWA 2HWD3 2HWB1 4CDWB 2PLV2 1AYM3 3VDDC 1TMF1 2DF7A 2WFF1 1PGW2 2RM21 3ZFGC 2R072 1AR62 4YVWC 1MQTB 1HXS1 4Q4Y2 4Z92B
chains in the Genus database with same CATH superfamily
3AP6A 2EIDA 3CJXA 4AXOA 3MI8A 1CIYA 1FXZA 1LU1A 4XHXA 5IVCA 1QJX2 4M3CE 2QQIA 1IHMA 1RUJ1 1V6LA 2A71A 2WL1A 3AKRA 4HN0A 4P5HA 2I45A 2R042 2WZPP 2GSYA 1ZNPA 5BUVA 3TNPB 2BV4A 4V2VA 4BE3A 1IKQA 1SACA 2B8MA 4CCNA 4LMFA 3E5XA 3JQXA 3WX5A 4P9WA 5HV4A 2Q8OA 3VKLA 1G7YA 3PJQA 1RUF3 1W04A 1WA4A 4A3XA 4E4DX 1GSLA 2NMNA 5FOBB 2DWRA 1RHI3 1YRZA 4J1XA 5IVFA 2BFUL 1YQ8A 2JIJA 1XQNA 1T6GC 4DXTA 5CISA 3LPGA 4FFFA 3WEZA 5D8AC 5IK4A 2DCZA 3KD4A 1OLMA 3EJKA 3OGRA 3MUY1 5HXVA 2XBO2 3POIA 3N9OA 1LECA 1TZOA 4AEDA 4IE4A 1KS5A 4UYBA 2VUAA 4EN6B 1ZZ8A 1HXS3 1ENQA 1J84A 3DL3A 2W08A 2V73A 2VY0A 1LR5A 1NXD1 1V70A 4QWNA 2BEOA 3KMHA 5IFPA 4ASMB 4P9JA 5EJ1B 5L73A 3O1OA 2EXHA 5EP9A 5J09A 1RUI3 3JB8A 4UI9L 3VHNA 1LAJA 2C6SA 2WN3A 4YARA 4XFBA 3LQCA 3ABZA 3H3UA 2B42B 5GZFA 2PLV1 5K4LA 4XC9A 1W8OA 2B9UA 3H1MA 4NO4A 1RJ8A 5SV5A 4IV1C 3BPZA 4SLIA 5E89A 2PFWA 4I0WB 3O1MA 4CEWC 2RS13 3TB0A 3HT2A 4C0HA 1CN1A 4XAEA 3GJBA 5JCTA 4H55A 3GZAA 3PU3A 4NAOA 4YFWA 2IXLA 2E33A 4Q4W3 1UQXA 3LDKA 4BOWA 2V4AA 2X5IB 1CAWA 3ECQA 1UIKA 3LAGA 2XVGA 1H2KA 3ZXKA 1X8MA 3SLIA 2Q1ZB 4YPJA 3VBRC 1UL9A 2DFCA 1ND2C 3EHKA 2RDRA 2W1UA 3IAPA 2GN3A 4ZPIA 4GJYA 4BISA 4WM8A 5A33B 2JDNA 4F83A 2CSGA 2Y34A 4RA0A 4AQ2A 1XJAA 2XLGA 4NHXA 4YFZA 3AJZA 1AR71 3G6JB 4YW2A 2VZRA 1MS5A 5BNPB 4HBNA 5FMBA 2DCJA 2E32A 3VBUC 5GZGA 1RUI2 3WF4A 2VE1A 4FQ4A 1R1A2 1ULPA 3T1MA 1CR7A 1WKYA 2AZ5A 3AYDA 2W68A 2WYFA 4CPBA 1J83A 3TNQA 1KRIA 2ZMNA 3E5UA 3TEZA 4C90A 3RZJA 4QHZA 5EPAA 1D4M2 1AF9A 1RUJ3 4P02B 4HK8A 1CJDA 2VNOA 4MYEA 5FP9A 4ORFA 4RR3A 4WZFA 4KU8A 2AYHA 4OI0A 1AR63 3FFZA 4BHPA 2VD7A 4A7YA 3AL5A 2R071 4LA2A 1D4VB 2I2SA 3HNBM 1W2UA 1CAVA 2BGCA 3KCCA 3MW4A 3OBZA 3KGZA 3RMXA 2GNDA 5C3RA 3AFGA 4LBLA 1EP0A 2Y38A 1VAKA 4B4QA 2PXJA 4IERA 2R30A 2LUWA 3HEIA 5LASA 2R043 5FPXA 3NV2A 3POJA 1V0AA 2CAVA 3ETPA 1CPNA 3K2OA 3NV1A 3R4UA 1OFNA 4Y1VA 4CVUA 2RS32 2BBAA 3A22A 1UOGA 4LITA 1RUG1 2A6WA 2JG8B 1UOBA 4BWOA 3FHAA 3IDAA 4LKDA 3I54A 4IV1A 4ES9A 1W28A 1PNGA 3PVBB 1DYOA 3DKQA 1RXGA 2VZTA 3N7JA 4TN7A 2VM9A 4DS0A 5KHKA 3TEWA 3EBRA 4HLTA 5TSWA 1A8MA 5A7NA 1WMEA 2UWBA 4ARXA 2E9QA 3ZSLA 1A34A 2UU8A 5F1RA 4AVBA 4LOSA 3GGLA 4MHRA 4R9BA 1BMV1 2X5IC 2VVEA 3ZMOA 1ASJ1 1EYBA 2ORXA 2OXBA 3OPZA 1U5IA 2VMDA 1AR92 1GZTA 3V0BA 3ACGA 1JW6A 1POV3 2ZHLA 3S6PA 1KFUL 4OUSA 3ZVXA 1K3IA 1NCQC 1GBGA 3DYOA 3MPPG 5LW9A 4A7ZA 1UYPA 5T52A 4F8AA 3O1TA 1R083 1CQ9A 5DAWA 5JI9A 2Q1MA 2W87A 1AR93 2VQ0A 3VUOA 1DQ4A 2XVLA 4QAWA 1BBT2 1JYXA 1ND3C 1UO9A 4OI4A 3MFAA 5JUVA 4YW1A 5BY5A 1GP6A 2VVDA 4I01A 1IKPA 1BHGA 2VOTA 4L11A 3R4DB 5IVBA 3TN91 5KC5A 4QXCA 3M7AA 5AFEA 4X6RB 2FMYA 1BBT3 4XQDA 5CG9A 3MIFA 2PHUA 1QJEA 3PVNA 1JUIA 2WYSA 3D6EA 2EALA 1UF2C 5EFUA 1GFF2 5K0UA 3U78A 4K8RB 3WF2A 1QXJA 1OPOA 1XNCA 1N3PA 4QX7A 4Z2AA 5K0UC 1TQ5A 3EB7A 1HB3A 1W2TA 1WW5A 4CXYA 3I4IA 2JWPA 4NIHA 4L0PA 5A32B 1GZCA 4YM0A 4LBOA 3VBOA 2JG9B 4PIZA 5FY7A 1RUH2 3VZOA 3RZMA 4H2AA 4AFBA 4K1YA 1XE7A 2CHHA 2E53A 3RI8A 1UZZA 2R7EB 3OUIA 4FOYA 3KV4A 2YB7A 3S57A 3ST7A 4NWVA 4XTMA 4FAHA 4W6WA 1W9TA 4FPCA 3MDPA 3I49A 1WWYA 4OYUA 3T3YA 2C9KA 4BMEA 2QQWA 3MLKA 1GZ9A 4PDWC 3THCA 4IE0A 2A6YA 5CVRA 4N53A 3B9IA 4PCRA 1RINA 5F2SA 1BEV3 4YG0A 4JRAA 3ACIA 5FO9B 4GZ9A 4XFAA 1CAVB 3E6BA 1MQTC 2HJIA 2D3PA 3IDBB 4R8HA 1RMU2 3NRUA 1OD3A 4YW3A 5EJ3A 3T2OA 2VG9A 1PO12 1MZ5A 3OSDA 1UYZA 3RYKA 3WLUA 4AFAA 3E6DA 1EAH3 4DQAA 2WS92 1HRV1 1D7PM 1RMU3 4XBNA 3CJIA 4AVTA 3GBWA 2XUEA 3T2QA 1DGWX 1ZYBA 4IEOA 5C4WB 2TNFA 3MHZA 1EAH2 3I3EA 3NAPB 3VBFB 1UCXA 1O3RA 2RR11 4A41A 3ZFFC 1XPWA 4MGIE 4M01A 2EIGA 1YFWA 4X8PA 4ISRA 1FYUA 5I8TA 4WM7C 3LFMA 5JPMB 2O0OA 4FPKA 3PTRB 5LBBA 1JU4A 1RXFA 3URFA 3WP4A 4D8MA 1RUF1 1Y43B 3A0KA 2ZZQA 2IFRA 1AZDA 2WT0A 5CFCA 3PMEA 4XMAA 1M06G 1SLCA 2WO3A 5CIRA 2YU1A 1NCRA 2DYCA 2WINB 3KV9A 4DINB 1CGPA 4HKLA 4EYUA 1NQJA 5D8AB 1MS8A 3ZYFA 1E5HA 1HB4A 2N7GA 3VBHC 1YFYA 5ERLA 4ATFA 4RL7A 2R1BA 4OHXA 3MO4A 3RYPA 5HBAA 1NAEA 1XSQA 4IEUA 2B45X 4A2UA 5LATA 3POFA 2WZR1 1PGSA 1W0PA 4AOCA 1BVVA 4JC1A 1W3VA 4AGGA 1GYKA 4UWDA 1PO13 2DU0A 4XF3A 3GZEA 3TAYA 3T2TA 2C0ZA 3D3AA 5ACA1 5HV0A 1LHWA 2WNUC 2PHLA 1QJY1 5JSOA 3O0WA 2D44A 2JG9C 1QXPA 2YU2A 2HWB2 4PT6A 5KBFA 1JYNA 2WWJA 2HWD2 1UMIA 1SBDA 2W3JA 1RUH1 5IJRA 2WO1A 4O65A 3TEYA 5LA0A 1Q43A 3VD9A 2BW8A 3J7NA 5JXGA 5FCCA 1RUD1 4IL7A 4Q4V3 1UIJA 4D6RA 1Z78A 2ZGQA 1JYIA 1ZBA1 1HXS2 2C9AA 2FHRA 4Y5TA 4PF5A 2CGOA 3QCWA 4MG2A 1LTEA 2GP5A 1W39A 5GM0A 4Q4W1 3B00A 3B5LB 4BQ5A 1ULCA 1QJX3 4AVCA 2PAEA 4LE4A 4Q29A 4QGLA 3K48A 1JOBA 3HPNA 4JAAA 4FBFA 5HCBA 1YUDA 5JVVA 3ENRA 1LU2A 4LR4A 5T54A 1ZBE1 4Q27A 1IG3A 2WNVB 1ULGA 1RUG3 2XLFA 3DEMA 1CONA 1DU3D 2PHWA 4FPFA 3SISA 4BJ0A 4JDOA 4WVMA 5C8WA 2HYXA 3MW3A 5FYYA 4CEYC 2VZVA 2RJ2A 1PVC2 3BVCA 1JHJA 1YO8A 1OQEA 5FY5A 4BQ4A 3OYWB 4CCJA 2VNGA 4XHBA 1V9U3 2XWBB 3ZOIA 2DCTA 4QXHA 5FYMA 1KEXA 2D6KA 5CAZA 4CDUA 1MR5A 2GC0A 3AZYA 4ZONA 3S30A 5FP7A 1UAIA 2CU5A 1ODMA 1O3QA 5IAXA 2R0FA 3P1IA 2HEYF 3LB9A 5F8PA 5EYYA 2ZHKA 4AGRA 4QGMA 2GN7A 4JTNA 1M4WA 3RFRA 1ASJ3 1N47A 2B7YA 1RUD2 5DPNA 4YSFA 3I2OA 3OBRA 4XXPA 4LEJA 1K5MA 2D3RA 4IV3A 1D2QA 2WBKA 4BLIA 5IVJA 3WG4A 1C4RA 4TYSA 3BTAA 1RVF3 2JB8A 4I2OA 3ZIXA 5LRSA 2P37A 3NMBA 4NJ4A 1X9PA 4CUBA 2FZ2A 4QHOA 1R1A1 3PUSA 2BZDA 2BNNA 4ZXEA 1NLRA 3ITQA 4AHXA 2WIIB 5C8CC 3LDRA 3C7FA 4YM2A 2OZ6A 3NWKA 4HANA 3I2GA 2BRTA 1ENXA 1YIFA 2Y6KA 4M0NA 2R0HA 4B7KA 1NCQA 2D98A 2JENA 1ZM1A 3IN9A 4LKEA 4CDXA 3TOJA 1JZ5A 1KDKA 2D5HA 3HVDA 1LOBA 1I6XA 5LRRA 3VBSA 4CCCA 4W8JA 3POGA 2BQPA 3FX3A 5JSPA 2UY8A 3NKGA 4FOVA 4COUA 4QKFA 3F2ZA 5DDJ3 1EPWA 1OLQA 5F6KA 4E27A 2VUDA 2B46X 2QQNA 2Y0IA 3JUUA 5A3NA 5HXMA 3ME2A 2RJLA 3ZN6A 3WQ1A 5FRAA 1MZEA 1W03A 2X10A 3OGSA 3Q8AA 4MSVA 4MXWB 4ZU4A 4UOJA 1V6NA 4QQLA 5FZDA 5FQ0A 4Y1ZA 3INAA 3RDIA 1RUF2 4BXSV 2P17A 1GNYA 5FMDA 5GKAC 5J7MA 3VN4A 5KXBA 1W6MB 4S2GA 4Q5OA 1ZRRA 4RQPB 1DQ2A 4JKMA 3I3BA 5FBJA 4JGYB 4PDWB 3SCGA 1DLLA 2OZJA 2PLV3 2GNMA 1UMHA 2W94A 1RUD3 3PDQA 2LROA 4MXVA 4Q4V1 3N7MA 5FPBA 1KGYA 3N9NA 4L8QA 3P5BA 3POBA 2A73B 3LA3A 5HCHA 5DG2A 3WVJA 2FDGA 4ZY9A 1WLCA 2PLV2 4D6SA 3O7OA 1W6PB 3MLLA 3UJOA 4BYYA 1C1LA 2VZPA 4P9YA 2WSUA 2D5FA 2JE8A 2GC3A 2VBDA 2X29A 1TMF1 2VMEA 4XZPA 4QX3A 5FMCA 1YYNA 3OGVA 5DAVA 5FR3A 1OI6A 3ZN6B 2DVDA 3N9MA 4MO3M 1GOGA 5J3UA 3ZXDA 3DF0A 4Z92B 2NN8A 1V6MA 4LBQA 2ZKNA 1J59A 1YNAA 3J7MA 5F9TA 3M3QA 3WDXA 4QPGC 1OA2A 5CADA 4LKSA 4AVAA 3SCHA 5IT6A 3ZYPA 4GH4A 2OQ7A 5EJZB 4PI2A 3WHUA 2QCSB 1O8PA 4KI5M 3VDCA 1A6CA 3IBMA 1PIV2 5GLZA 3AK0A 1YQ2A 1DQ1A 1POQA 4M0HA 4UFJA 5IAVA 1OMIA 3HNYM 4LO8A 4IDZA 2HBTA 4D69A 5L9RA 2OIIA 3LOIA 1R091 2RJKA 2QQJA 5FLJA 1UX6A 3ZSKA 4N43C 2NLRA 1OPMA 4IEYA 4KNCA 5JDBA 5L7OA 1JMUB 3T08A 1C5HA 4UFKA 4EV0A 3W5MA 3WDYA 2X09A 5CFCB 3V65A 1YQ5A 4IV3B 2G19A 3L2HA 1BK1A 3ON7A 4XPVA 4AQ6A 3PVOA 1S4CA 1UU5A 2PAMA 2PHTA 2J1UA 2VUCA 3AP4A 3IMMA 4XJZA 4YGCA 3T30A 3I2DA 4IEXA 4IE7A 2F4PA 2VCBA 4P9IA 4QXKA 4COZA 2WQZC 2J1VA 4AEMA 4WV8A 1BKZA 1YFXA 3WP3A 1W0OA 5FMOS 3K75B 3AYEA 4GKYA 5FZ9A 2FDFA 5CEHA 1J58A 1UU4A 1WMFA 2Y64A 2ZBJA 4LBQB 1UZYA 3U14A 1LESA 3GHMA 1WA6X 3VGIA 1QQP1 1W8HA 3LEIA 2HWD1 4AQSA 4DRVA 3NJVA 2DURA 3LA7A 2ZGLA 3C7HA 3HN3A 4LXLA 1NCRB 4EJRA 3IM0A 4IETA 2EIEA 3KCYA 1H6XA 2AEZA 2YHJA 1COV3 4QKDA 1YXWA 3JBG2 1S2EA 3NNLA 4D0QA 4Q0PA 4C1XA 5JOYA 4N8MA 4WVZA 2XKPA 3ZMNA 4ZU5A 4R9CA 2RS12 2OYZA 1G9AA 3ZYGA 2BUKA 3OGJA 5DDJ1 5JI7A 5KWRA 2H6BA 1TG7A 2VTXJ 1J3QA 5GZDA 5L7OB 5B4XA 1H30A 1GQHA 2NMOA 4PBPA 4NRMA 5FFOC 1AXKA 4OI2A 4LHSA 4Y20A 1YI9A 4TLFA 2GH2A 2MNGA 4AEDC 2A3YA 3VL8A 4BZ4A 1LGBA 3FN9A 1RC6A 4LQRA 4FPLA 1RUH3 5FKCA 3AVSA 4NRPA 5A7SA 4QHBA 3TYJA 5C3QA 4NPRA 5CFDC 2ZA9A 4C8DA 4EN9B 4R4XA 2J1RA 3WW3A 1LHVA 2WJSA 2ZX4A 1IS3A 3GHNA 2XJTA 1IG0A 2O8OA 1YFUA 3BI3A 4GB31 2ZTNA 1LEDA 1LOAA 2IXHA 3DYMA 5HPOA 1V6OA 2DVFA 1C57A 2XL9A 2K9ZA 1OH3A 4QPWA 1MEC3 4CU6A 1AYM2 5DQ0A 1FV3A 2DTWA 4JGZB 1MS3A 4Z8BA 2VVFA 4KH9A 3HR9A 1W2NA 1GP4A 1BEV2 3AM2A 3LGRA 1WMXA 2EXJA 3BYWA 5LB6A 4JGZC 1RMU1 1QMJA 1NA1C 4Q2FA 4AG4A 1SPPA 4IEQA 4FI9A 1H8TB 1YWKA 3E97A 3HJRA 3JZVA 1NOVA 2RDSA 1R082 2Y8KA 3NW4A 1J1TA 3USUA 2RDNA 2EA7A 2ZHNA 1CAXA 3KF3A 4N90A 4P5YA 1R1ZA 4H3WA 5HCAA 2P4EA 3OF1A 2WFF3 2CWMA 4OCTA 4FO9A 2LTNA 1J3RA 1GLHA 2WUHA 3ACFA 3JD72 3M2MA 5E88A 1AYN2 4E8CA 5FZCA 2BU9A 5IW0A 2XVKA 1HKDA 2WWSA 3I2JA 4Q1PA 3U37A 3AX4A 4W50A 2XJRA 1BQPA 5JMCA 1SLLA 3D0SA 3ZKYA 3JD73 4CDXB 3N7KA 1XBFA 1K5JA 2PHFA 3LDBA 5JXJA 2VUJA 3MLJA 5FYSA 3ZFEC 4DXRA 1UXZA 3AKPA 1TE1B 3KV5A 2Y6LA 1QKQA 3MIGA 2YGMA 3O0VA 3H7JA 2JKBA 4H14A 4JQTA 1MEC2 1W6QA 4QPIA 5FZ4A 4AF9A 1UY4A 4OUMA 4GJZA 4XDQA 4AE2A 4EN8B 2JKXA 2K2SA 2Q8EA 1Y9MA 3NV3A 1HRI3 1O91A 2PHDA 2XONA 4HONA 3ACHA 4QPGB 1IQDC 1UX7A 4A45A 2DVGA 3ROUA 1ST8A 2A6VA 3WW1A 1WW6A 3DPRA 5I0TA 2QQOA 3ATGA 4FPJA 4OQ9A 1HJFA 2PA7A 2XJPA 3NNGA 1PVXA 5DAXA 5FYTA 3I3DA 4LJHA 2BVVA 1Q3EA 1W9SA 4Y24A 1QY4A 1GOHA 3MF9A 1SQ4A 1XYNA 1CESA 1PVC1 1GNZA 4Z82A 3BKZA 2HLEA 1GWMA 3W9AA 2WO2A 1KXGA 3B3QE 2DBIA 3M1HA 4RQPC 1JBCA 4YLZA 4KWUA 1YI7A 3AMHA 2DBNA 4AVVA 1YCIA 4BQYA 1ZBE2 5F5IA 2V4VA 1ZRCA 3IZOA 1AR81 3Q8CA 5J37A 2BOIA 5FYBA 1GZWA 2ZGNA 3VHRA 3MIDA 4MADA 2D7FA 3CIHA 4FTSA 1W6NB 4Z2WA 2PMWB 5AFBA 1JZ6A 2QVSB 1XE0A 1F2NA 1PMIA 2QQMA 1S2KA 5EQUA 1LNSA 2VW1A 4HSLA 2ES3A 4XJ9A 3BALA 4ZS3A 1XXNA 1OURA 2GP3A 3ZPYA 3WDVA 1US2A 4AEDB 5F5AA 1W05A 4O9GA 5BNOC 4GALA 1W6PA 3SNMA 3KQRA 4PHZA 1J1LA 4XEZA 4HSJA 2Z4FA 4LORA 3O1UA 1XNDA 1NZIA 1RVF2 3VDDA 1W8WA 3V0AB 3U10A 4LUKA 1AL0G 1E5IA 5BNOA 5BNOB 1RUG2 2ETEA 2F17A 4KWKA 4JRLA 4Y22A 1NXMA 1QNYA 2WRAA 3NAPC 3NJYA 4AW7A 4QDSA 3A7QA 5KHHA 1LOEA 5A80A 4CDXC 2XQXA 4UF0A 3U4SA 1CAUB 2QQPA 2HWE1 1MZFA 1HW5A 4KGQA 2VU9A 3BTYA 3N4MA 4NRQA 2JDHA 3EYPA 5L7OC 4N43A 1NX9A 2Q1FA 4XUQA 4QD2A 2MHFA 3M3OA 3KSCA 5FLHA 1LEMA 4KBBA 3OEAA 3VBOB 1C28A 3LD8A 2BNOA 2IWGB 1DYPA 1JI6A 2AREA 3HBZA 5F2WA 2Q4SA 4B8EA 4NUBA 2XHNA 1JH5A 3GYDA 2PQSA 1JZ8A 5KHIA 1UY3A 3OTFA 4QXBA 1P8JA 2RS11 4XCBA 5DN2A 5IK5A 5CFDA 4RSUA 4GWMA 1AXYA 4ZZ8A 2HWB3 2NQYA 3ZN4A 3CZJA 4ITCA 2CYFA 4NMIA 4AVSA 3S7IA 4L9BA 5FZ8A 4CEYB 2XDVA 2GH8A 2JX9A 3DPRC 4MV2A 1UWWA 3RWNA 1R092 1UZ0A 2EF6A 3CQOA 1JYTA 4KGGA 2C24A 5HI0A 4ZKTB 3NKTA 1QGLA 5FZAA 4J6GA 3FUOA 3AMMA 3PLQA 5H9RA 1J3PA 4Q0VA 5GLTA 1PIV1 2YUEA 3S7EA 1LOCA 1N1SA 2QDNA 1OA3A 3VZNA 1UNBA 2ADEA 5IWFA 5FXVA 5FWEA 1UKGA 4MH0E 1PMHX 2JE9A 3A21A 4AFMA 3H3LA 4XJWA 3OPTA 4JTOA 3H0OA 5CFDB 2QDRA 4ARYA 4IW3A 1UN1A 5C4WA 2UYAA 1Y9QA 5T5LA 4DUWA 4WVVA 3RYRA 5C33A 4DXZA 3KHCA 2D40A 4Q0UA 3WF0A 4UW5A 3FL7A 1WZXA 2D6OX 1URXA 4GKXA 3ZR5A 1E57A 3AYCA 4FPGA 3C2UA 1DLCA 4P9XA 5IK7A 1PVC3 2ARBA 3DUIA 4L2NA 2CNAA 2W52A 4EZHA 1VRH1 2ARXA 4WVWA 2Q5TA 5FXXA 1H2MA 1GR3A 1L7LA 2RR12 4FOQA 1DDLA 5AC91 1QJU3 2BFUS 2VQUA 3PUHA 3RMYA 1AX2A 1VB4A 4XUNA 3I2FA 5I0UA 3BPSA 3LEKA 1ACCA 4FVVA 1NA1B 5FK8A 2NM1A 2WZ8A 1I5ZA 1S0EA 4P9LA 1MPXA 1FNZA 2G4IA 1DQ6A 5G05L 3WDUA 3C7OA 4G9SB 5FO8B 2ZGPA 2ZXQA 3ES4A 4FAGA 4CCEA 3MIBA 1Q8VA 5C8CA 2CDOA 5C6CA 2HEWF 2HWC1 1FAYA 1VMHA 4PQQA 4R52A 1PGW1 5FZ3A 1VBE3 3O0XA 1FATA 1F31A 1WLDA 2HKXA 3BOPA 3H3ZA 4FXGB 1YJKA 4BM8A 5KHGA 1JZ2A 1OKOA 2WWUA 2FDHA 3W58A 1AR82 3WF1A 2QUOA 5ANQA 3ZKUA 3FLPA 1Z7S3 4QPGA 4K7JA 5K0UB 4FP2A 4L99A 4XJUA 1OLME 1O5LA 3I3QA 2WFPA 3ZFFB 3F95A 1PX4A 5JXIA 2D6NA 3RSJA 4X8NA 1XU2A 4W6XA 3JXSA 3HT1A 3VBSB 4E2GA 1QJU1 3RJRA 5CFCC 5KR7A 2J1EA 2BGPA 3JBG3 5FXWA 3T0DA 4W4ZA 5FOJB 2RE9A 1KQRA 1JYCA 1XNTA 4AR2A 3UKVA 4Y5SA 5CNAA 2OPWA 1N1YA 1REDA 1SFNA 3ZSEA 4COWA 4LK7A 4I09A 1W0NA 1VB2A 4RGGA 2ZGKA 2H0VA 2DU1A 3APBA 3N9LA 5FIXA 4AI9A 4EWEA 2FDKA 1W6QB 4QPIB 2JD4A 2QNKA 1YHFA 1XB9A 2CGNA 3WUDA 4Q4Y1 4CEYA 1SHWB 1NCQB 2JICA 2AC1A 4LO4B 5T5JA 5FZHA 3HN1A 1OF4A 2Y6HA 2W92A 4FCAA 1TEIA 3OOXA 4CSWA 5FWJA 3RPQA 1DQ0A 3HBKA 1RJ7A 3ZSJA 3N7LA 2TUNA 4XOGA 3VL9A 2VMCA 1ULEA 4XJ8A 5EYXA 3ILFA 4PBOA 2YFUA 2OS2A 1OA4A 4CDQB 2QZ2A 2XKOA 3USUB 4ZS2A 1IS4A 2ZEXA 2CL2A 3NJXA 1ULDA 1N3OA 4O61A 1RUE1 2E26A 5A3WA 3UETA 2ET1A 4CDUB 1YQ6A 1TME3 5E16A 4XF9A 2HWF2 3R4SA 5F5CA 3DXTA 1MS0A 2E7TA 4QQPA 5FREA 4XF4A 5JIUA 2QQUA 4CP9B 4XUOA 3K4DA 2R073 1NKGA 5FP4A 4WZCA 5T5PA 2Q30A 4BQ1A 2BOJA 1X33A 2HWF3 3M70A 1NE6A 1US3A 3U11A 2WT2A 2QBXA 1X82A 4AHZA 4CCMA 1IOAA 3WP6A 3CKHA 5A1AA 1GNHA 1CZTA 2WA3A 1CAXB 5F3EA 3LSDA 2IC1A 5ANNA 1VBC3 4CP0A 2WSVA 2IUWA 2WNUA 1C5IA 5ABJB 4RHV1 3OB8A 5JOXA 1WLTA 4BH9A 2K0GA 4R9DA 5DDJ2 2GNBA 2FCVA 2R49A 5BNNA 5I93A 1AR73 2YXSA 1XYPA 3H50A 5J1XA 1VMJA 3VD4A 2RS33 2GC1A 1NQDA 2YPDA 2PAKA 4KG0A 5BNPA 3ZXAC 1PO23 5FY0A 4FT8A 2VULA 2RS31 4HPKA 4NWWA 5APAA 3WQ7A 4CDWB 2XH6A 1FNYA 1CZVA 1XC6A 1GV9A 4IE6A 1FV2A 1SLAA 5FZLA 1KITA 1VLNA 1AYM3 2P34A 4PLNA 2X53S 2OQ6A 3AC0A 3GF6A 3WR0A 3O1SA 1T6BX 1WD4A 2DF7A 2P3IA 2JD9A 2OX0A 4AHWA 4MXWA 5FQ0B 2VCMA 3ZFGC 2LS6A 4AAXA 1ZZCA 2R072 1REFA 5FPLA 4ONUA 4XE9A 4FXKB 1D2SA 4NIIA 1CX4A 5FK7A 5IVVA 1Y9GA 5A3LA 2WR9A 5LBCA 3P6BA 4XXAA 1E5SA 4YZ3A 4X6QB 1RL3A 1RUC1 1S0DA 1A78A 3NV4A 2E7AA 1QOSA 3I97A 3K4ZA 4IGOA 3LF7A 4Q26A 3O1RA 3P3NA 5CZKA 1RUI1 4CDQA 3EO6A 1B35A 3CLPA 4OFGA 4OMDA 1MQTA 1NUKA 4J25A 3H1WA 3K77A 3WHTA 3ZXLA 2YBPA 2DUOA 4CDQC 4QB1A 3JU9A 1AR72 1G6NA 1YQCA 4P9GA 3D8CA 1PIV3 2GMEA 5F3IA 4BXFA 1H1IA 4U36A 3JQWA 1AXZA 1C1FA 4UFMA 3ZXJA 2A7AA 1DYKA 3K4AA 4YW7A 1NE4A 3RVHA 4HL0A 1HRV2 1GU3A 5JOWA 1G9DA 2ARCA 2ORZA 2JJ6A 1Z7S1 3UL2A 4CCKA 4Y33A 3SH3A 2Z69A 4RN5A 4DPNA 1B35B 3IT8A 4EE2A 4QX8A 5A3MA 1AJKA 4E4ZA 5C8CB 1K45A 5JWPA 1PM4A 5KXEA 4QKNA 2DUQA 5C71A 4A7KA 5FY8A 3TN93 2ZABA 4ZXKA 1VBD2 4LBQD 2CWSA 2EAAA 3HIFA 1JU3A 2UWCA 4AI1A 1D0GA 2L9LA 4C91A 1AVBA 2XB6C 3RZLA 2GNTA 4CE8A 2A5ZA 1S0GA 5LEKA 4URAA 4BQWA 3E5QA 3R0RA 3MGUA 2P6CA 2BNMA 2QKDA 2VQTA 5CU1A 1ODNA 1DFQA 1STMA 2NZ9A 3LEMA 4A44A 1O7FA 1LOGA 3SH5A 1OUXA 3BIEA 3C7GA 3UYJA 5BNPC 3I59B 5CB7A 3LCPA 4HZFA 1BLZA 1ZRDA 5ABJA 1H1AA 5BNNC 1SBFA 4LBNA 2FD8A 2WLPA 2WS91 3CF6E 4CA9A 3OUJA 4AEKA 1CWPA 5LA1A 1QHDA 3JB4C 4S2HA 1ENSA 1OHFA 2EIBA 4LUMA 3FLRA 4Q0QA 4E9KA 5FO7B 4Y3OA 1VAVA 4XJAA 5G04L 3VDDB 1ULOA 1V6IA 2VXJA 3VDAA 4LHNA 3N36A 3U1XA 3MZHA 5LY2A 1SFYA 2WFF2 3T4HB 4M4PA 1AR61 3KGLA 4GA9A 4N9IA 2ILMA 5A6ZA 5BNNB 2XHKA 1DHKB 4XDOA 3SEPA 4RGAA 4GIQA 1ND2A 2R16A 4WVMB 3AZVA 3KS7A 4B7EA 4D7SA 1YJLA 4AK3A 2YG0A 3LE0A 3TN92 4AFCA 4KMQA 3ZXFA 5JOZA 3HWJA 1Z0HA 1PO22 2GAUA 4M00A 3AKTA 1ZREA 1HQLA 4XW3A 3DKWA 3NNMA 1KD7A 5A3PA 3GBGA 1G9BA 3FWEA 2JDPA 2Q0AA 1F8VA 1VBC1 3ZYHA 4AI2A 5FDBA 4PIXA 2JDYA 2R061 2ZGTA 4LHKA 4QB2A 4YZ2A 4PDWA 4YM1A 1CPMA 1AR91 1UYXA 2VTFA 3WNPA 3AB0A 2A6ZA 3AVRA 2E31A 1RUOA 3OPWA 4YRDA 3PJYA 3Q8BA 2B39A 2A6XA 1B09A 3OBTA 3LA2A 5LEJA 1VBA1 1VRBA 1DP0A 2XJQA 2FZ1A 4B4PA 2JG9A 3H7YA 2VAUA 3PTYA 3OD0A 3RWKX 2J22A 4XETA 2B9VA 3VBUB 4D6QA 1Y4WA 4AI3A 2WQ8A 3J8F2 1S0BA 2TBVA 3DECA 2DTYA 3KT1A 5FZ7A 4QKBA 1U5ZA 1MS1A 3WUCA 1COV1 1HLCA 4NPLA 1LHUA 5C7GA 4NIAA 1POV1 3AZXA 2RR13 5FZIA 1RIRA 4XFFA 4NIGA 1DZRA 4FFGA 4JDNA 1V00A 5FUPA 5GZEA 1GQGA 2WO7A 5A3TA 3T09A 2W5FA 1RUE2 1ZRFA 1I1EA 1SLBA 3VBRB 2ID4A 4YW6A 3WDWA 1APNA 1O6UA 2E51A 2W47A 4BQ3A 5EZWA 5FAXA 4UW6A 1QJFA 2QZ3A 1NY72 1GANA 3IB3A 1GWKA 2P5BA 3I2HA 3FBYA 4BLJA 4RHV2 3LPFA 4PLOA 4IUGA 1LENA 4LT5A 4KWJA 2ZACA 2IXJA 4LLFA 1LKNA 1VBE2 4RHV3 3ZFFA 4NN0A 3HQUA 1FMD2 1RGSA 4JQRA 5LA9A 5T55A 4EN0A 5L9VA 1ZRIA 1MS9A 1SLIA 2P3JA 1JN2P 3M8LA 4IESA 3OEBA 4JZRA 3I7DA 1F5JA 4WM8C 4Z1VA 4EN7B 3CJIC 1JS9A 1NLQA 2VJXA 4YGDA 2A1XA 2HWF1 4RYDA 1DGWA 4TLGA 2B5HA 2KR2A 3QLQA 5L9BA 2VOKA 3WCSA 4GULA 1W9FA 3IWZA 2YBKA 2CGPA 4XTPA 1QJU2 4MLOA 4B4RA 3N9PA 2Y6FA 4EWAA 1B35C 1X9TA 5L36A 1KS4A 1WGPA 3J7LA 3V0AA 1ULFA 2HWC3 2XMLA 1V9U2 4BQXA 4UT5A 3WG1A 2SBAA 2ZS6B 3N9QA 5LA2A 3LFIA 3FZ3A 3WINE 1POV0 1MACA 1ZZ6A 4N53C 4XCAA 5FUNA 3VZKA 4CP9A 1VBA2 1C8NA 1EY2A 2OA2A 5CA6A 1ZBE3 3ASIA 3C7EA 3MV11 4CEWA 3UK9A 3ZN5A 2JEMA 4XABA 3L9JT 3POWA 1ZZ7A 3NQHA 2ZKLA 3ZYJB 1RITA 1WW4A 5DZGA 1SCSA 1BZWA 1R093 2XJSA 2ERFA 4XFIA 3EXUA 5IUQA 1AR83 5JR7B 5DUWA 2OW4A 5E8AA 2BERA 5FZ6A 4IEPA 3QH6A 1T2XA 2R6QA 2VECA 1X36A 2VZUA 1Q5OA 3NSTA 4YG6A 2F6BA 5H9SA 4TXWA 3WQ0A 4DO0A 1QOTA 1YIPA 1QOOA 4DZGA 2DCKA 1GWLA 4XUPA 1OH4A 2ZGRA 4BQ2A 4EQVA 3H8XA 3U0ZA 1AYN1 1KJLA 3JD71 2UYBA 2C26A 2D6MA 2WZEA 2Q8CA 3DPRB 1UW8A 2VZOA 2ZX1A 3BCWA 3POSA 4IGQA 1FOD2 1EAH1 4K1ZA 1VRH2 4Q1RA 2FBEA 2JDZA 1OOPA 4IEZA 2PHRA 1IZ3A 2BTVC 4LULA 4MVTA 4Y5Z0 4CRQA 2VL4A 5I0SA 2BBVA 5D8AA 3IPVB 5F7UA 3D0JA 2B4KA 1HRI1 2ZAAA 4W65A 4I30A 4E2SA 4Q4X1 2Y6JA 4CU9A 3VKMA 1H9WA 4K8FA 4LE3A 4YVWB 4N7UA 1HQWA 2KD7A 1Q8PA 1REEA 2WLQA 5D21A 5FYIA 1ND3A 2P3YA 4UBGA 3ZSMA 4CEWB 5DMYA 5KHJA 2VC9A 4HG6B 4QDRA 1LJ7A 4Y22B 3SHRA 5L19A 1EPZA 2OUJA 4KBZA 4U2AA 3CJIB 1CIWA 1AHSA 1W9YA 2NPIA 1D0HA 1L7RA 1QNWA 2CTVA 3ILRA 2QJVA 3TRSB 1LHOA 2DDUA 2WQ4A 5EXOA 4DXSA 3WCRA 3NAPA 1HV0A 5AC92 2BPA2 3B9CA 4GAZA 2PELA 4FPYA 4W6YA 1NYWA 5H9PA 1VP6A 2X5IA 3ETQA 4M3CA 3R6SA 4DB5A 4YVWA 1LULA 2VPVA 1R1A3 4MZUA 2KXLA 1LHNA 1W2AX 1SFPA 1W90A 4A4AA 3KV6A 1S0IA 2EVXA 4Y1YA 4LO7A 5AC93 3K46A 2ATFA 4Z07A 1TNFA 2DVBA 3L2YA 4YZ4A 1OXCA 2I74A 1UY0A 2R041 5AVAA 5BYNA 1MZ6A 2FQPA 1PO11 3GJAA 1DBNA 5FZGA 3E6CC 1OVSA 4CXXA 4YZ5A 4J1WA 1WW7A 5KXCA 3SXWA 1QH7A 3VV1A 4DEQA 1Z7S2 1UY2A 4FQZA 4Y1UA 3VDBA 1RHI1 5C3OA 2O1QA 2NP0A 2A75A 5EIYB 2UURA 2V5DA 1DCSA 2EICA 4YYOA 4DEVA 5F3CA 1FMD3 3AMQA 2QE3A 2J1TA 3X29B 4UAPA 5J96B 2CAUA 4Y4RA 1MVQA 3FBMA 4I3PA 3JBG1 3UT0A 4AL9A 3LEGA 4XIKA 4NROA 4PI0A 3ZIWA 5FPVA 4AI0A 5B2GB 4FFHA 5FYCA 5FZMA 5JR2A 1FT9A 4I0BA 1CX1A 3NNJA 2W46A 1RYYA 2VW0A 4K40A 4QX1A 4COVA 3D4KA 1GUIA 2RMU3 2D3SA 2WNVC 5F5QA 4LTAA 2VOVA 3EQEA 1QJX1 1LRHA 1NLSA 2VOXA 2ZGSA 4M3CB 4CP2A 4RR3C 4ZZ5A 1A3KA 3WNNA 4LKFA 1KJRA 1HRV3 2PQQA 1H4GA 3GNEA 5F37A 4UFLA 1TMF3 4S2DA 4QQHA 4ATEA 3WV6A 1C8M2 2ARAA 3WW4A 1UMZA 1VBE1 5LK7B 2W9XA 4JV4A 5BV6A 2ZGMA 2YZ4A 1VAMA 4QPIC 3SKJE 3V56A 4ISQA 2YGLA 3WDTA 5GALA 5CYYA 2QQKA 5ABJC 1V9U1 3FHIB 3ZFEA 4JHZA 5FLIA 3S5AA 5FY4A 4C0BA 5LZ6A 2BP6A 1OOPC 1CVNA 3GZTB 2P1BA 4TWTA 5FJKA 1U0AA 4YW5A 4TZDA 3H8RA 5CKQA 1YC61 3VBFA 2UWAA 5J48A 1XSRA 2ZHMA 4HN1A 3VKFC 4BIOA 4A3ZA 5I0RA 2GU9A 2ZX2A 4URTA 4Q0SA 1FOD3 2BVBA 2IVJA 5F3GA 4XUTA 3ZLIA 2YC4A 1Q8QA 1TNRA 1HV1A 1PGL2 4OHYA 1N1VA 4XMIA 2G9GA 2LALA 1Q8OA 1S0CA 3MICA 5K9YA 2XJVA 3FC0A 4OHWA 1O4TA 1SCRA 1IQAA 3KT7A 3H8OA 4OVEA 4BU2A 5A1LA 2XR4A 1ZZBA 4JGZA 4KG8A 1Q56A 4BA6A 5IVEA 2P3KA 2YDEA 1XNAA 3ZYIB 4MGZE 3I59A 4YVSB 4CUAA 4IV1B 1RUNA 1H2LA 1W8FA 2GZWA 3PL0A 4Y26A 4CCDA 2JG8C 5IHRA 2AACA 3VKOA 3CHXA 1DG6A 2D43A 2J1AA 3J7HA 1OFSA 2JDKA 5JSRA 2VBBA 2YV8A 1IPJA 2YMZA 1S0FA 3FMGA 1GMMA 3KT4A 1CD3G 5DXDA 4XIOA 3KQ4B 3A0NA 4NOTA 4XDPA 2RS53 1W8ZA 3BU7A 3KF5A 4AYUA 1ZX5A 1W6NA 3UNPA 3BTZA 2JXAA 2G9ZA 4KQ7A 3RJ2X 4PF1A 4ZU7A 4O9EA 1DGRN 2VZ1A 2W1QA 4CDWC 4B1LA 4OMCA 5EWSA 5DZEA 3IDEA 4XBQA 4CZSA 3RZZA 5KXDA 5FPAA 2PYTA 3ZFGA 4GWJA 3VD7A 3AL6A 2XWJB 3FLTA 4META 5FPZA 4UXAA 4MGKE 5A7PA 1D4M1 2VMFA 2V5YA 4LO6B 4YW4A 5A32A 1TVGA 3OUHA 1WMDA 2VH9A 2XGXA 3KHBA 1BEV1 1XYOA 3B7MA 2PTMA 2WS93 1VBC2 2FMDA 5DG1A 3W21A 4HVQA 3WF3A 3J8F3 5FBZA 3WW2A 4BPZA 2IXCA 3GXUA 5FY1A 4QPYA 4HXCA 4GMP0 2EXKA 1ZZ9A 1PO21 2WAOA 5FYHA 1SMVA 1AYN3 4Y20B 1CAUA 4IEVA 1U5YA 4PLMA 5K7PA 4XFGA 1A8DA 1W3XA 1K42A 2KM2A 4XF0A 4JKLA 4D7YA 2A3XA 5SV8A 2IXIA 4IE5A 3RZKA 3NJZA 3B93A 2VNRA 4HVRA 5JAXA 4XFCA 3VDDC 2VOWA 3VZLA 1FI2A 1G9FA 2WFF1 5C70A 3WNKA 3KLSA 1PGW2 1WCUA 3AP7A 2HEVF 1C3HA 1LOFC 3AMNA 3KCXA 1SLTA 5E1RA 1IS5A 4HMZA 2BDRA 4DNYA 2W1WA 1X50A 3GM8A 5T3NA 1OT5A 1GP5A 1I3HA 2Z79A 3VKNA 5J36A 1HN1A 3CL1A 4BDVB 2HWE3 3RQ0A 4OHZA 1PX3A 5F6LB 3VHOA 5I0DA 1DQ5A 1DF0A 2KA3A 3LIGA 3QH7A 1U5XA 2VZSA 1JYVA 4LK6A 5BXXA 4XZUG 3HD8B 3ACLA 1PK6C 1IPKA 2JDAA 4NPMA 1F4HA 2YROA 4B3NA 1UD1A 1RB8G 1F9KA 1WCDJ 1IPSA 4QX2A 1ALYA 4RFT0 5A7QA 4RQPA 3TWIA 3A4UA 5C9AA 4BK5A 1UOJA 1PK6B 3BOWA 4HK9A 4OZOA 1VIWB 3FHQA 1VPHA 2D97A 3M3CA 4JDMA 5EHDA 5A6YA 3O1VA 2ZGOA 1BVP1 2BWCA 3RZGA 3CU7A 4D3WA 1XOYA 3MF6A 5DUVA 2JE7A 1BJQA 2ZCWA 1K5MB 5FYZA 3AMPA 4GWNA 1XNBA 3UGGA 4EROA 2IXKA 3UESA 1ND2B 1W8UA 1QDOA 2W2IA 1KFXL 3SQOA 1WUVA 3B94A 5FZ0A 1C8M1 3ZYRA 2H6CA 3HQRA 2HH9A 1GQPA 1BXHA 2XBO1 3WT3A 3MIEA 1H9PA 2WKKA 5C5UA 2YPJA 2W39A 2G1MA 3CBNA 3RI9A 3NO8A 1W8TA 4QU2A 3MYXA 4RS5A 4RS5B 4E8DA 3H1YA 2HWE2 3PHMA 3NL1A 1QDCA 3ZXEA 3ZM8A 1VBD3 4GMP3 3SITA 3MUZ1 4LLOA 5IVYA 3I2IA 3MIHA 4JCKA 1EV11 4N9HA 5JZGC 2OT7A 2CV6A 4KL1A 1SZBA 3OCPA 4XQ4A 4EZ4A 4JGYC 4CYDA 5K8SA 5LBEA 4OQ8A 1RUC2 2JB4A 3EMRA 4MUVA 4DUVA 4EWDA 1IS6A 1I9RA 1OUSA 3BN6A 3WNOA 4XAAA 2Z42A 3MFCA 1PNFA 1UZWA 5GLWA 4E4SA 1FPN3 1DGRA 1ZA7A 3HNMA 3SEEA 4NHKA 1SEFA 3GBFA 5LY1A 3ZFEB 2JECA 1VBA3 1RHI2 4OUEA 3PU8A 5FP8A 5FYVA 5EV7A 5B4NA 4E4HA 4UFHA 1ENRA 5GLUA 4I3GA 1LCLA 3I8TA 3O1PA 1F4AA 2XBO3 5IATA 5HCFA 1NA1A 2ZJCA 3VBSC 4DOUA 4FPEA 1WLWA 3AP5A 1JZ3A 2W91A 2RS51 2VMIA 4CTEA 4DRRA 3Q8EA 4LOTA 5FY9A 1NY71 3U07A 5A1FA 3KWVA 4NHMA 3H9AA 2AEYA 4LBMA 1W8NA 3T1LA 2VNVA 3GZUC 3ZYBA 1UPIA 2WNUB 3M3EA 5DUUA 2ZGUA 1JUHA 3PIJA 1OF3A 3UGFA 4LA3A 1MS4A 4XFHA 3OGGA 1VJ2A 2IVIB 2C1FA 3ELNA 5DAQA 4I02A 1SBEA 1DZTA 4IQPA 1VR3A 2DV9A 3AXEA 4P14A 4HKWA 3SMHA 3G7DA 5A3OA 3PUIA 5E6HA 3VBRA 3HMYA 2RHPA 4YVSC 1L3JA 5IYYA 3O12A 5FZBA 3VB9A 1LGCA 1RUC3 2UY9A 2VCCA 5FYUA 4GH4B 1O5UA 2QQVA 4M4RA 4NE9A 3KVBA 2ZMKA 1SPPB 1I5PA 4XILA 4RGKA 5CKMA 2HYKA 3WNXA 5JLVA 1HB1A 3WY6A 4CU7A 3U75A 3B01A 5T50A 1MEC1 4OLLA 4RFRB 3VHPA 3W59A 2XUMA 1JOPA 3PNAA 4HFSA 4CDUC 4D7TA 3BU0A 4GXLA 5I91A 2I07B 4ASKA 2R062 1HIXA 4GB33 4QM8A 4QX0A 2MEV2 3AKQA 2Y33A 4QB6A 3LSEA 4AHYA 3VZJA 3DN7A 1GKBA 3P3PA 1AJOA 1W6OB 4QU1A 1OBNA 4HOOA 3C8XA 1NZCA 2RG4A 4DIQA 1GOFA 3IMNA 2X05A 3VZMA 5DUXA 2IFWA 3B02A 4FSJA 1UYYA 4JVAA 3UKTA 4YVSA 4AI8A 3AP9A 5JIAA 4MHUA 2J7MA 1QU0A 1GICA 2LM3A 4BK4A 2Y0OA 5GLVA 5KC6A 3WSOA 1Q8SA 5LCWL 1RUE3 1RTVA 3OYWA 4FFIA 4LPLA 1H0BA 4LIUA 4Y1XA 1SG3A 3FFQA 3WQBA 1EUUA 1WBFA 2JDMA 2XOMA 3KZ4C 1AL22 1W6MA 5FZFA 3N3HA 4NIDA 4WBBA 4QM9A 3WG3A 1XE8A 3PURA 2OKXA 5LWBA 5GZCA 3WD5A 1HX6A 4ET7A 4BCUA 3CZUA 1LODA 4FP3A 3ZDSA 4CCOA 1UPSA 3BGAA 1GZWB 4SBVA 3M4FA 1OSGA 1R64A 2ADDA 4FPHA 4XF1A 4F7ZA 2VQAA 3RRDA 1NG0A 1VRH3 4FTEA 4QMAA 5FZOB 2R1DA 3O14A 2O8QA 2YFZA 4DMIA 1BCXA 2XJUA 4P08A 1H6YA 3DV8A 3E1F1 1HJGA 1IGOA 2R063 2Y26A 2WZR3 2MEV3 3LIHA 4GB32 5LBFA 5C3PA 5JMOA 1OQDA 1OC1A 2WT1A 1H8TC 1XNKA 3HQXA 4XACA 1QJZA 4CP1A 2A3WA 2VTXA 4K20A 1LB2A 1FMD1 2GDFA 2RDQA 4LIVA 1W99A 4B29A 2HBUA 1FPN2 2Y60A 4GH4C 2P2KA 4QDQA 1JOJA 1OKQA 2DVAA 1WCQA 2PN5A 4UW4A 3VLBB 4YNIA 1O3SA 2QFEA 3N35A 4JGYA 1HDKA 2HWC2 4COYA 2VGDA 2NYYA 3VBHA 3B69A 2SLIA 5A7WA 4G3YC 1OOPB 3LWCA 3LOBA 1WCKA 2OUHA 3VD3A 4N53B 1G9CA 3KVAA 3AFKA 3RNSA 3RZHA 3UGHA 1AUYA 3CNAA 3ZFGB 4P00B 3RGBA 1AL23 1BYHA 3I3MA 5FZEA 3OBAA 1W9WA 4N43B 4UFIA 3WNLA 4HVOA 4WM7A 1QEXA 1ND3B 1F35A 4H7MA 3WG2A 4YM3A 1S55A 1VBB2 1F15A 1U12A 4ES8A 4LHLA 1TME2 3I2KA 3MPBA 3WOGA 3WXPA 4CUCA 4KU7A 5A6QA 1COV2 2AH2A 1EV12 3VD5A 2F4LA 4CDWA 4QQOA 1QJY2 1ZA4A 1DGLA 1OVPA 1N3QA 2WDBA 3J8F1 4IGPA 2LW8A 4K3UA 5FZOA 3THPA 2DCYA 4Q8LA 4D94A 4G4FA 1S2BA 2GMPA 4Q4W2 1H8VA 1RUJ2 1VALA 4V2WA 2CY6A 2WZR2 3CEWA 4Q4X3 4CU8A 1OD5A 2RM23 2VZQA 1AX0A 3NNFA 5C9AC 1H4HA 1H8TA 2BGOA 2YYOA 4R9AA 1X7NA 2ZX0A 5D2AA 5LK5A 3T4VA 2AGSA 3IAQA 2OVUA 3THDA 4OULA 1DZQA 3WP5A 1BK0A 1PHMA 2RM22 2X8KA 3DYPA 5FZKA 5FTTC 5FV3A 3OG2A 4BMBA 4LO5B 4ZHNA 5DABA 4H7LA 3ES1A 2DUPA 1ZVFA 4XVHA 5T5OA 1E5RA 3FUQA 4MX3A 3ZPOA 2VZ3A 3SC7X 4AZZA 2JIGA 3LZZA 4O7XA 4INDA 4UBHA 3RG0A 1W06A 1QXRA 4YGEA 1TME1 4QX5A 3IPVA 1QQP2 2Q8DA 2ZAHA 1VMFA 1VBB1 5ACA2 3KM5A 1O4ZA 5A7OA 4FPOB 2BYVE 4PIYA 4AAPA 2ZMLA 2ZEYA 1VBB3 1H2NA 4L97A 3SKVA 3CMGA 5C9AB 3S0MA 4TSVA 2VCAA 3ZX7A 3VBOC 1D4M3 2FDJA 3IIAA 2VXRA 3J9SA 5ACA3 2J42A 2VO5A 1UXXX 3M3IA 4IV3C 3UV9A 3VBFC 1K5MC 3POEA 4AFDA 5H9QA 4FOWA 5CBLA 5C4WC 1LGNA 1JZ7A 2XPJA 5FP3A 2A70A 4YWAA 4MOAA 4JKKA 4DUXA 4R4ZA 3HAGA 2V72A 4N7IA 2XXZA 1NT0A 5JXHA 1Y7BA 2QTWB 3CDZB 4Q4X2 4E2QA 2AR6A 3Q8FA 3PUAA 3ALQA 1OQ1A 2PHXA 1SDDB 3H42B 4JHTA 3PMSA 5IK8A 1DIWA 5J98B 4BIFA 2W0XA 3PUQA 4B1MA 1FOD1 2WABA 4LBKA 2D93A 4V1PA 3K51A 4DFSA 1PZ9A 4IEWA 3POYA 2D6LX 2Y6GA 1RVF1 1WD3A 4GWIA 5A7WB 1G8WA 1V6KA 2XL7A 3D82A 2WA4A 4Q4V2 5FPUA 1HB2A 4WM8B 5A33A 2ZEZA 3MW2A 3H8UA 1EUTA 3J4UH 2Z2SB 2WNVA 3QOPA 4YZ1A 1CZSA 1UZVA 3PVEA 5I8YA 1Y3TA 1JYWA 1VBD1 3OJBA 4GMP1 3THTA 2XQRA 1QQP3 4QT6A 4XURA 3V64A 2MPFA 1O4YA 3VBHB 2RMU2 3ZDVA 3WNMA 3DCQA 3OD4A 4CXWA 3AJYA 4F3JA 3KB5A 1QH6A 2ZEWA 3TBDA 3D5OA 4M3CF 4NR1A 5I8SA 5FMOL 4IXLA 2AENA 1HRI2 1K12A 1AL21 2RVAA 1FPN1 1TMF2 5M0TA 2G9FA 1C8M3 4CUGA 1CAWB 2YC0A 3IKWA 1YEWA 4XBLA 4WM7B 2OPKA 1V6JA 2K46A 2JG8A 3FE5A 3GCWA 4Y4YA 5F39A 3RS6A 4NVPA 4PQ9A 2QQLA 3CO2A 3NVCA 4TTGA 1UU6A 1YLLA 1O3TA 4MGYE 4ASLA 4I0AA 2FDIA 2RV9A 5A3UA 3LKJA 5C3SA 4QGNA 1L7QA 3MV01 4UF0B 5AVPA 1EV13 1LOFA 5FZ1A 5ISLA 5C5TA 1QJY3 4K21A 3ZXGA 4CCLA 2GALA 5FUIA 4YGBA 1O59A 1S0JA 2TEPA 3DGTA 1QIQA 3GDBA 3IIIA 5BPXA 5JPNB 3WZ1A 5CKNA 1UY1A 2AUYA 4RR3B 3W20A 1ASJ2 3C3VA 4OI1A 3ZO0B 4DY3A 3U4XA 4HETA 5A6XA 4AWDA 1UKRA 2D6PA 2FCTA 3MBWA 5BNQA 1BMV2 2C4XA 3AYAA 4S2FA 2CDPA 1X8EA 3FJSA 1PMJX 4YG3A 4FTBA 3OY8A 5JZGA 2RMU1 3OY8B 2EXIA 4OZXA 4XQWA 5JZGB 1NCRC 1S1AA 2YBSA 4K9SA 2O14A 4HKOA 4QQ2A 2GMMA 2VMGA 4A6OA 3A23A 1PGL1 2P6HA 4RS5C 3QD6A 4NAMA 4AEJA 2H0BA 3ZR6A 4DY5A 2BJSA 2EAKA 1WBLA 3DXUA 1BBT1 5FJHA 1ONAA 2E6VA 4MGTA 1QF3A 1JXNA 3ILNA 1HQNA 2ZX3A 2VMHA 2WNEA 3VBUA 4RD7A 2MEV1 2R32A 3BB6A 3SH4A 4AGVA 3TEXA 2VBPA 2W1SA 4NHLA 2YC2A 3BTXA 5CG8A 3AKSA 5DZFA 2FCUA 1PM7A 4KWLA 4GQ7A 1VE0A 4Q4Y3 4A6SA 2XLAA 3IDCB 5DAPA 1R081 2RS52 4JX0A 3GCXA 2VW2A 3SCFA 1CJPA 3AXDA 1JTZX 3BODA 4LBJA 4UW3A 2WN2A 5D1IA 4Q8KA 2C5DA 3HOBA 4L92A 4PJYA 3Q9OA 2JDUA 2Z5WA 3AZZA 1F5FA 2IZWA 3AZWA 2WAAA 3T0BA 2ZOEB 5IFTA 1FX5A 2E7QA 4C1WA 3W5NA 2DFBA 1JHNA 3PIGA 3T0AA 4BB3A 1G86A 2LRPA 3GALA 1ZBA2 1W6OA 3K3NA 5FXZA 4A42A 3ORJA 3JCIA 3O5SA 4GD4A 1AYM1 1PZ7A 4NHYA 2GC2A 3J26N 1PK6A 2J1SA 3V0BB 1OLRA 2V09A 1XU1A 4OHVA 3R05A 5F32A 2W95A 1SDWA 1ZBA3 4XYXA 1N1TA 1HN0A 1WCSA 1O8SA 5FKBA 3UJQA 3K3OA 1JZ4A 2VR4A 1XRUA 1PZ8A 4HPKB 1QWRA 2HWD3 2HWB1 5A70A 3BIWE 3QACA 3MEPA 3QBQA 4CPBD 2BWAA 2ZZJA 4LNVA 4K6BA 4AQTA 1JODA 1AX1A 1W2OA 2E63A 2ENRA 2WNOA 2XG3A 2YY1A 3T2PA 4MGSA 1UOFA 4HT1T 1KDMA 1MVEA 3S5QA 2RM21 1H1MA 3BUCA 3UKNA 2WC2A 1AR62 4MGQA 4YVWC 3USSA 1MQTB 1HXS1 2ZPXA 4Q4Y2 2ET7A 5GJ6A
chains in the Genus database with same CATH topology
3AP6A 3CJXA 4AXOA 3MI8A 1FXZA 1LU1A 4XHXA 1QJX2 4M3CE 2WL1A 1IHMA 1RUJ1 1V6LA 2A71A 3AKRA 4HN0A 4P5HA 2WZPP 2I45A 2R042 2GSYA 1ZNPA 5BUVA 3TNPB 4BE3A 1IKQA 1SACA 2B8MA 3E5XA 3JQXA 3WX5A 4P9WA 2Q8OA 3VKLA 1G7YA 3PJQA 1RUF3 1WA4A 4A3XA 4E4DX 1GSLA 2NMNA 5FOBB 2DWRA 1RHI3 1YRZA 4J1XA 2BFUL 1XQNA 1T6GC 5IK4A 5D8AC 2DCZA 3KD4A 3EJKA 5HXVA 2XBO2 1LECA 4AEDA 1KS5A 2VUAA 4EN6B 1ZZ8A 1HXS3 1ENQA 3DL3A 2W08A 2V73A 2VY0A 1LR5A 1NXD1 1V70A 2BEOA 3KMHA 4ASMB 4P9JA 5L73A 2EXHA 5J09A 1RUI3 3JB8A 3VHNA 4YARA 4XFBA 3H3UA 2B42B 5GZFA 2PLV1 2B9UA 3H1MA 4NO4A 1RJ8A 5SV5A 4IV1C 3BPZA 4SLIA 5E89A 2PFWA 4I0WB 4CEWC 2RS13 3TB0A 3HT2A 4C0HA 1CN1A 5JCTA 4H55A 3GZAA 4YFWA 2IXLA 4Q4W3 4BOWA 2X5IB 1CAWA 3ECQA 1UIKA 3LAGA 2XVGA 1H2KA 3ZXKA 1X8MA 3SLIA 2Q1ZB 3VBRC 1UL9A 2DFCA 1ND2C 3EHKA 2GN3A 4WM8A 5A33B 4F83A 4RA0A 4AQ2A 2XLGA 4YFZA 3AJZA 1AR71 3G6JB 4YW2A 5BNPB 1MS5A 4HBNA 2DCJA 3VBUC 5GZGA 1RUI2 4FQ4A 1R1A2 3T1MA 1CR7A 2AZ5A 3AYDA 2W68A 3TNQA 1KRIA 2ZMNA 3E5UA 4C90A 1D4M2 1AF9A 1RUJ3 4HK8A 1CJDA 2VNOA 4MYEA 4ORFA 4RR3A 4WZFA 4KU8A 2AYHA 4OI0A 1AR63 3FFZA 4BHPA 4A7YA 2R071 4LA2A 1D4VB 2I2SA 1W2UA 1CAVA 2BGCA 3KCCA 3MW4A 3KGZA 3RMXA 2GNDA 3AFGA 4LBLA 1EP0A 2Y38A 1VAKA 4B4QA 4IERA 2R30A 2LUWA 5FPXA 2R043 3NV2A 2CAVA 3R4UA 1CPNA 3NV1A 4Y1VA 1OFNA 2RS32 1RUG1 2A6WA 2JG8B 4BWOA 3I54A 4IV1A 4ES9A 1PNGA 3PVBB 3N7JA 4DS0A 5KHKA 3EBRA 4HLTA 5TSWA 1A8MA 1WMEA 2UWBA 2E9QA 3ZSLA 2UU8A 5F1RA 4AVBA 4R9BA 1BMV1 2X5IC 2VVEA 3ZMOA 1ASJ1 1EYBA 3OPZA 1U5IA 1AR92 3V0BA 1JW6A 1POV3 2ZHLA 3S6PA 1KFUL 4OUSA 3ZVXA 1NCQC 1GBGA 3MPPG 4A7ZA 5T52A 4F8AA 1R083 1CQ9A 5JI9A 2Q1MA 1AR93 2VQ0A 3VUOA 1DQ4A 2XVLA 1BBT2 1ND3C 4OI4A 3MFAA 4YW1A 5BY5A 2VVDA 4I01A 1IKPA 4L11A 3R4DB 3TN91 5KC5A 5AFEA 3M7AA 4X6RB 2FMYA 1BBT3 4XQDA 5CG9A 3MIFA 2PHUA 3PVNA 1JUIA 3D6EA 2EALA 1UF2C 5EFUA 1GFF2 5K0UA 1QXJA 1OPOA 1XNCA 1N3PA 5K0UC 1TQ5A 1WW5A 3I4IA 5A32B 1GZCA 4YM0A 4LBOA 3VBOA 2JG9B 4PIZA 3VZOA 1RUH2 4AFBA 4K1YA 1XE7A 2E53A 3RI8A 1UZZA 4FOYA 3ST7A 4NWVA 4XTMA 4FAHA 4W6WA 4FPCA 3MDPA 4BMEA 3MLKA 1GZ9A 4PDWC 5CVRA 2A6YA 4N53A 3B9IA 4PCRA 1RINA 1BEV3 4YG0A 4JRAA 5FO9B 4XFAA 1CAVB 3E6BA 1MQTC 2HJIA 2D3PA 3IDBB 4R8HA 1RMU2 4YW3A 5EJ3A 2VG9A 1PO12 1MZ5A 3RYKA 3WLUA 4AFAA 3E6DA 1EAH3 4DQAA 2WS92 1HRV1 1RMU3 4XBNA 3CJIA 4AVTA 3GBWA 1DGWX 1ZYBA 4IEOA 5C4WB 2TNFA 3NAPB 1EAH2 3VBFB 1O3RA 1UCXA 2RR11 3ZFFC 4MGIE 4M01A 2EIGA 1YFWA 4X8PA 4ISRA 1FYUA 5I8TA 4WM7C 5JPMB 2O0OA 4FPKA 3URFA 3WP4A 1RUF1 3A0KA 1Y43B 2ZZQA 2IFRA 1AZDA 2WT0A 5CFCA 3PMEA 4XMAA 1M06G 1SLCA 5CIRA 1NCRA 2DYCA 2WINB 4DINB 1CGPA 4HKLA 1NQJA 5D8AB 1MS8A 2N7GA 3VBHC 1YFYA 4ATFA 4RL7A 2R1BA 4OHXA 3RYPA 5HBAA 4A2UA 4IEUA 2B45X 2WZR1 1PGSA 1W0PA 1BVVA 4JC1A 4AGGA 1GYKA 1PO13 2DU0A 4XF3A 3TAYA 5ACA1 3T2TA 2C0ZA 1LHWA 2WNUC 2PHLA 1QJY1 5JSOA 3O0WA 2D44A 2JG9C 1QXPA 2HWB2 5KBFA 2HWD2 1SBDA 1RUH1 1Q43A 2BW8A 5FCCA 1RUD1 4IL7A 4Q4V3 1UIJA 1JYIA 1Z78A 2ZGQA 1ZBA1 1HXS2 2C9AA 2FHRA 4PF5A 2CGOA 3QCWA 1LTEA 1W39A 5GM0A 4Q4W1 3B00A 3B5LB 1ULCA 1QJX3 4AVCA 2PAEA 4LE4A 4Q29A 4QGLA 3K48A 4JAAA 4FBFA 5HCBA 1YUDA 5JVVA 3ENRA 1LU2A 4LR4A 5T54A 1ZBE1 4Q27A 2WNVB 1ULGA 1RUG3 2XLFA 4FPFA 1CONA 1DU3D 2PHWA 3SISA 4JDOA 4WVMA 5C8WA 3MW3A 4CEYC 1PVC2 1YO8A 1OQEA 3OYWB 2VNGA 4XHBA 1V9U3 2XWBB 2DCTA 2D6KA 5CAZA 4CDUA 1MR5A 2GC0A 3AZYA 3S30A 1UAIA 1O3QA 2R0FA 2HEYF 3LB9A 5EYYA 2ZHKA 4AGRA 4QGMA 2GN7A 4JTNA 1M4WA 1ASJ3 1N47A 2B7YA 1RUD2 4YSFA 3OBRA 4XXPA 4LEJA 1K5MA 2D3RA 4IV3A 1D2QA 4BLIA 3WG4A 1C4RA 4TYSA 3BTAA 1RVF3 4I2OA 3ZIXA 5LRSA 2P37A 2FZ2A 1R1A1 4AHXA 2BNNA 1NLRA 2WIIB 5C8CC 4YM2A 2OZ6A 3NWKA 4HANA 1ENXA 1YIFA 4M0NA 4B7KA 2R0HA 1NCQA 2D98A 2JENA 1ZM1A 3IN9A 4CDXA 3TOJA 1KDKA 2D5HA 1LOBA 1I6XA 5LRRA 3VBSA 2BQPA 3FX3A 5JSPA 2UY8A 3NKGA 4FOVA 4COUA 5DDJ3 1EPWA 1OLQA 5F6KA 4E27A 2B46X 2Y0IA 3JUUA 3ME2A 2RJLA 3ZN6A 3WQ1A 5FRAA 1MZEA 4MSVA 4MXWB 4ZU4A 5FQ0A 1V6NA 4QQLA 4Y1ZA 3INAA 3RDIA 1RUF2 2P17A 5J7MA 5GKAC 3VN4A 5KXBA 1W6MB 4S2GA 4RQPB 1ZRRA 1DQ2A 4JGYB 4PDWB 3SCGA 1DLLA 2OZJA 2PLV3 2GNMA 1RUD3 4Q4V1 4MXVA 3N7MA 4L8QA 2A73B 3LA3A 5DG2A 3WVJA 1WLCA 2PLV2 3O7OA 1W6PB 3MLLA 3UJOA 4BYYA 1C1LA 4P9YA 2WSUA 2D5FA 2GC3A 2X29A 1TMF1 4XZPA 1YYNA 1OI6A 3ZN6B 2DVDA 5J3UA 3ZXDA 3DF0A 4Z92B 2NN8A 1V6MA 4LBQA 2ZKNA 1J59A 1YNAA 5F9TA 3M3QA 3WDXA 4QPGC 1OA2A 5CADA 5IT6A 4AVAA 3SCHA 3ZYPA 4GH4A 3WHUA 2QCSB 1A6CA 3IBMA 1PIV2 5GLZA 3AK0A 1DQ1A 4M0HA 1OMIA 4LO8A 4D69A 2OIIA 3LOIA 1R091 2RJKA 5FLJA 3ZSKA 1UX6A 5JDBA 4N43C 2NLRA 1OPMA 4IEYA 4KNCA 5L7OA 4EV0A 1C5HA 3WDYA 5CFCB 3V65A 4IV3B 3L2HA 1BK1A 4XPVA 4AQ6A 3PVOA 2PAMA 1UU5A 2PHTA 4XJZA 3AP4A 4YGCA 3I2DA 4IEXA 2F4PA 4COZA 4P9IA 4QXKA 2WQZC 4AEMA 4WV8A 1BKZA 1YFXA 3WP3A 1W0OA 5FMOS 3AYEA 4GKYA 1J58A 1UU4A 1WMFA 2ZBJA 4LBQB 1UZYA 1LESA 3GHMA 3VGIA 1QQP1 4DRVA 4AQSA 2HWD1 2DURA 3LA7A 2ZGLA 4EJRA 1NCRB 3IM0A 4IETA 3KCYA 2YHJA 1COV3 1YXWA 3JBG2 4Q0PA 4C1XA 5JOYA 4WVZA 2XKPA 3ZMNA 4ZU5A 4R9CA 2RS12 2OYZA 1G9AA 3ZYGA 2BUKA 3OGJA 5DDJ1 5JI7A 5KWRA 2H6BA 1J3QA 5GZDA 5L7OB 1H30A 1GQHA 2NMOA 4PBPA 5FFOC 1AXKA 4OI2A 4Y20A 1YI9A 4TLFA 2GH2A 2MNGA 4AEDC 2A3YA 3VL8A 4BZ4A 1LGBA 1RC6A 4FPLA 1RUH3 4QHBA 3TYJA 4NPRA 5CFDC 2ZA9A 4EN9B 4R4XA 3WW3A 1LHVA 2WJSA 2ZX4A 1IS3A 3GHNA 2XJTA 2O8OA 1YFUA 4GB31 2ZTNA 1LEDA 1LOAA 2IXHA 1V6OA 2DVFA 1C57A 2XL9A 2K9ZA 1MEC3 1AYM2 1FV3A 2DTWA 4JGZB 1MS3A 4Z8BA 2VVFA 4KH9A 3HR9A 1BEV2 3AM2A 3LGRA 2EXJA 4JGZC 1RMU1 1QMJA 1NA1C 4Q2FA 4AG4A 4IEQA 1H8TB 1YWKA 3E97A 3JZVA 1NOVA 1R082 3NW4A 1J1TA 3USUA 2EA7A 2ZHNA 1CAXA 4N90A 1R1ZA 4H3WA 5HCAA 3OF1A 2WFF3 2CWMA 4FO9A 2LTNA 1J3RA 1GLHA 3JD72 3M2MA 5E88A 1AYN2 2XVKA 1HKDA 2WWSA 4Q1PA 3AX4A 5JMCA 2XJRA 1BQPA 1SLLA 3D0SA 3JD73 4CDXB 3N7KA 2PHFA 2VUJA 3MLJA 3ZFEC 3AKPA 1TE1B 1QKQA 3MIGA 2YGMA 3O0VA 3H7JA 2JKBA 4H14A 4AF9A 1MEC2 1W6QA 4QPIA 4OUMA 4XDQA 4AE2A 4EN8B 2K2SA 3NV3A 1HRI3 1O91A 2PHDA 4QPGB 2DVGA 3ROUA 2A6VA 3WW1A 1WW6A 3DPRA 5I0TA 3ATGA 4FPJA 2PA7A 2XJPA 1PVXA 2BVVA 1Q3EA 4Y24A 1QY4A 3MF9A 1SQ4A 1XYNA 1CESA 1PVC1 1GNZA 4Z82A 3W9AA 1KXGA 3B3QE 4RQPC 3M1HA 1JBCA 4YLZA 1YI7A 3AMHA 4AVVA 1YCIA 1ZBE2 1ZRCA 1AR81 5J37A 1GZWA 2ZGNA 3VHRA 3MIDA 2D7FA 4FTSA 1W6NB 4Z2WA 5AFBA 2QVSB 1F2NA 1PMIA 1S2KA 2VW1A 4HSLA 2ES3A 4XJ9A 3BALA 1XXNA 3ZPYA 3WDVA 4AEDB 4O9GA 5BNOC 4GALA 1W6PA 3SNMA 3KQRA 1J1LA 4XEZA 4HSJA 1XNDA 1RVF2 3VDDA 3V0AB 3U10A 4LUKA 1AL0G 5BNOA 5BNOB 1RUG2 2ETEA 4KWKA 4JRLA 4Y22A 1NXMA 1QNYA 3NAPC 4AW7A 5KHHA 1LOEA 4CDXC 1CAUB 2QQPA 2HWE1 1MZFA 1HW5A 4KGQA 2VU9A 3N4MA 5L7OC 4N43A 4QD2A 2MHFA 3M3OA 3KSCA 5FLHA 1LEMA 4KBBA 3VBOB 1C28A 2BNOA 2IWGB 1DYPA 2AREA 3HBZA 4B8EA 2Q4SA 1JH5A 3GYDA 5KHIA 3OTFA 2RS11 5IK5A 5CFDA 4RSUA 4GWMA 1AXYA 2HWB3 2NQYA 3ZN4A 4ITCA 2CYFA 4AVSA 3S7IA 4L9BA 4CEYB 2GH8A 2JX9A 3DPRC 4MV2A 3RWNA 1R092 2EF6A 4KGGA 5HI0A 4ZKTB 3NKTA 1QGLA 4J6GA 3FUOA 3AMMA 3PLQA 5H9RA 1J3PA 4Q0VA 5GLTA 1PIV1 2YUEA 3S7EA 1LOCA 1N1SA 2QDNA 1OA3A 3VZNA 1UKGA 4MH0E 2JE9A 4AFMA 4XJWA 4JTOA 3H0OA 5CFDB 2QDRA 1UN1A 5C4WA 2UYAA 1Y9QA 5T5LA 5C33A 4WVVA 3RYRA 4DXZA 2D40A 4Q0UA 4UW5A 2D6OX 1URXA 4GKXA 1E57A 3AYCA 4FPGA 3C2UA 4P9XA 5IK7A 1PVC3 2ARBA 3DUIA 4L2NA 2CNAA 2W52A 1VRH1 2ARXA 4WVWA 2Q5TA 1H2MA 1GR3A 2RR12 4FOQA 1DDLA 5AC91 1QJU3 2BFUS 3RMYA 1AX2A 1VB4A 5I0UA 4FVVA 1NA1B 2NM1A 1I5ZA 1S0EA 4P9LA 1FNZA 2G4IA 1DQ6A 3WDUA 4G9SB 5FO8B 2ZGPA 3ES4A 4FAGA 3MIBA 1Q8VA 5C8CA 5C6CA 2HEWF 2HWC1 1FAYA 4R52A 1PGW1 1VBE3 3O0XA 1FATA 1F31A 1WLDA 2HKXA 3BOPA 3H3ZA 4FXGB 1YJKA 4BM8A 5KHGA 3W58A 1AR82 2QUOA 3FLPA 1Z7S3 4QPGA 4K7JA 5K0UB 4FP2A 4L99A 4XJUA 1O5LA 2WFPA 3ZFFB 2D6NA 3RSJA 4X8NA 1XU2A 4W6XA 3VBSB 3HT1A 4E2GA 2XPJA 1QJU1 3RJRA 5CFCC 3JBG3 5FOJB 2RE9A 1KQRA 1JYCA 3UKVA 5CNAA 1N1YA 1REDA 1SFNA 3ZSEA 4COWA 4I09A 1VB2A 4RGGA 2ZGKA 2H0VA 2DU1A 3APBA 4EWEA 1W6QB 4QPIB 2JD4A 2QNKA 1YHFA 2CGNA 3WUDA 4Q4Y1 4CEYA 1NCQB 2JICA 4LO4B 5T5JA 3HN1A 4FCAA 1TEIA 3RPQA 1DQ0A 1RJ7A 3ZSJA 3N7LA 2TUNA 4XOGA 3VL9A 1ULEA 4XJ8A 5EYXA 3ILFA 4PBOA 1OA4A 4CDQB 2QZ2A 2XKOA 3USUB 1IS4A 2CL2A 1ULDA 1N3OA 1RUE1 4CDUB 2ET1A 1TME3 5E16A 4XF9A 2HWF2 3R4SA 1MS0A 2E7TA 4QQPA 5FREA 4XF4A 5JIUA 2R073 5T5PA 4WZCA 2Q30A 4BQ1A 1X33A 2HWF3 3M70A 1NE6A 3U11A 2WT2A 4AHZA 1X82A 1IOAA 3WP6A 1GNHA 2WA3A 1CAXB 3LSDA 2IC1A 1VBC3 4CP0A 2WSVA 2WNUA 1C5IA 5ABJB 4RHV1 5JOXA 1WLTA 4BH9A 2K0GA 4R9DA 5DDJ2 2GNBA 2R49A 5BNNA 5I93A 1AR73 2YXSA 1XYPA 3H50A 2RS33 2GC1A 1NQDA 2PAKA 4KG0A 5BNPA 3ZXAC 1PO23 4FT8A 2VULA 2RS31 4HPKA 4NWWA 3WQ7A 4CDWB 2XH6A 1FNYA 1GV9A 1FV2A 1SLAA 1KITA 1VLNA 1AYM3 2P34A 4PLNA 2X53S 3GF6A 3WR0A 1WD4A 2DF7A 2P3IA 4AHWA 4MXWA 5FQ0B 3ZFGC 1ZZCA 2R072 1REFA 4ONUA 4XE9A 4FXKB 1D2SA 1CX4A 5A3LA 4XXAA 4YZ3A 4X6QB 1RL3A 1RUC1 1S0DA 1A78A 3NV4A 2E7AA 1QOSA 4Q26A 3P3NA 1RUI1 4CDQA 3EO6A 1B35A 3CLPA 4OFGA 1MQTA 3WHTA 3H1WA 4CDQC 3ZXLA 2DUOA 3JU9A 1AR72 1G6NA 4P9GA 3D8CA 1PIV3 2GMEA 1H1IA 4U36A 3JQWA 1AXZA 1C1FA 3ZXJA 2A7AA 1DYKA 1NE4A 4HL0A 1HRV2 5JOWA 1G9DA 2JJ6A 1Z7S1 3UL2A 3SH3A 2Z69A 4DPNA 1B35B 3IT8A 5JWPA 1AJKA 4E4ZA 5C8CB 5KXEA 2DUQA 4A7KA 3TN93 2ZABA 4ZXKA 1VBD2 4LBQD 2CWSA 2EAAA 3HIFA 4AI1A 2UWCA 1D0GA 4C91A 1AVBA 2XB6C 2GNTA 2A5ZA 1S0GA 5LEKA 3E5QA 3R0RA 3MGUA 2BNMA 2QKDA 5CU1A 1DFQA 2NZ9A 1O7FA 1LOGA 3SH5A 5BNPC 3I59B 5CB7A 3LCPA 4HZFA 1ZRDA 5ABJA 1H1AA 5BNNC 1SBFA 4LBNA 2WLPA 2WS91 3CF6E 4AEKA 1QHDA 3JB4C 4S2HA 1ENSA 1OHFA 4LUMA 4Q0QA 3FLRA 4E9KA 5FO7B 1VAVA 4XJAA 3VDDB 1V6IA 4LHNA 3N36A 1SFYA 2WFF2 1AR61 3KGLA 4GA9A 4N9IA 2ILMA 5BNNB 2XHKA 1DHKB 4RGAA 4GIQA 1ND2A 2R16A 4WVMB 3AZVA 3KS7A 4B7EA 4D7SA 1YJLA 4AK3A 3TN92 4AFCA 3ZXFA 5JOZA 3HWJA 1Z0HA 1PO22 2GAUA 4M00A 3AKTA 1ZREA 1HQLA 4XW3A 3DKWA 1KD7A 3GBGA 1G9BA 3FWEA 2Q0AA 1F8VA 1VBC1 4AI2A 5FDBA 4PIXA 2ZGTA 2R061 4LHKA 4YZ2A 4PDWA 4YM1A 1CPMA 1AR91 3AB0A 2A6ZA 1RUOA 4YRDA 3PJYA 2B39A 2A6XA 1B09A 3OBTA 3LA2A 5LEJA 1VBA1 2XJQA 2FZ1A 4B4PA 2JG9A 3H7YA 3PTYA 3OD0A 3VBUB 4XETA 4AI3A 3J8F2 1S0BA 2TBVA 3KT1A 2DTYA 1U5ZA 1MS1A 3WUCA 1COV1 1HLCA 1LHUA 1POV1 3AZXA 2RR13 1RIRA 4XFFA 1DZRA 4JDNA 1V00A 5GZEA 1GQGA 1RUE2 1ZRFA 1I1EA 1SLBA 3VBRB 3WDWA 1APNA 2E51A 5EZWA 5FAXA 4UW6A 2QZ3A 1NY72 1GANA 3FBYA 4BLJA 4RHV2 4PLOA 1LENA 4LT5A 4KWJA 2ZACA 2IXJA 4LLFA 1LKNA 1VBE2 4RHV3 3ZFFA 4NN0A 1FMD2 1RGSA 4JQRA 5T55A 4EN0A 1MS9A 1SLIA 2P3JA 1JN2P 3M8LA 4IESA 4Z1VA 3I7DA 1F5JA 4WM8C 4EN7B 3CJIC 4YGDA 2HWF1 1DGWA 2B5HA 3QLQA 3WCSA 2VOKA 4GULA 3IWZA 2CGPA 4XTPA 1QJU2 4MLOA 4B4RA 4EWAA 1B35C 5L36A 1KS4A 1WGPA 3V0AA 1ULFA 2HWC3 1V9U2 3WG1A 2SBAA 2ZS6B 3FZ3A