5L7OA

X-ray structure of triatoma virus empty capsid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
230
structure length
230
Chain Sequence
DEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 46
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08762 CRPV_capsid CRPV capsid protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oA00
5DDJ3 4QPIA 1K5MB 1VBA2 5K0UB 2X5IB 4N53C 4CEYB 2HWC1 2QQPA 1H8TA 4AEDA 2RS31 1GFF2 3VBSC 5C8CA 1VBD3 4GB31 1PO22 1FPN2 1POV3 1NOVA 1VBB3 3VBFB 5BNOC 4CDWC 1PO12 4JGZC 5D8AC 2BPA2 5J98B 1R092 1AR61 4IV1A 2IZWA 2RMU2 4CEWB 1PGW1 4FTSA 1OOPC 1PIV1 5ACA3 3CJIC 5FMOS 2PLV3 1X33A 1R1A3 1RUD1 1RUE2 4N43B 1RUI2 1PVC1 4Q4Y1 1RUC3 3VBRB 1NY72 1ND3C 1ASJ2 1POV0 2ZZQA 1RUF3 1COV2 1D4M3 1H8TB 2R043 1AR81 4QPGB 4WM8C 4AEDB 5BNNC 3VBOB 3HAGA 1RUG2 1QJU1 4Q4V3 5CFCB 4CDQA 1RB8G 3NAPC 3ZFEA 4Z92B 4WM7C 1HXS3 1FMD1 1AL21 3TN92 1VB2A 3JBG3 1VBE3 1QJX2 1FOD3 1NCQC 1V9U1 1BBT2 2WFF1 4IV1B 4NWVA 5C9AC 1TME2 4Q4X1 1AR63 3JD72 1VBD2 1EAH1 1PIV3 3ZFFC 1ND2A 1QQP2 1E57A 5C4WA 2X5IC 4GMP0 1HX6A 1BEV1 1RMU2 2HWB1 1TMF1 4RR3C 1MQTA 1VRH1 1AYM3 1RVF1 1Z7S1 4GH4C 4RQPA 1R093 4CDQB 2RMU3 1K5MA 5FMOL 5K0UA 3ZFEB 1RUJ2 4CEYA 1C8NA 2HWE1 1VBC1 1R1A2 2RS53 2ZTNA 4CEWC 1R081 1RUI3 1RUH1 1ZBA2 3ZFGA 1AR73 5AC93 2VQ0A 1RUF2 2BFUL 1ASJ3 1HRV1 4CDUA 2FZ2A 3VBFA 4YVWA 4RHV1 1V9U3 1C8M3 4N43C 1B35C 1NCRC 1IHMA 3VBRC 1ZBE1 2HWC2 4JGYA 4QPIC 5C4WB 1H8TC 4AEDC 4QPGC 1QJY3 1AL0G 5C8CC 3JBG2 3VBOC 1MQTB 3TN93 5CFCC 1WCDJ 1BBT3 1OPOA 2MEV1 1AYN1 1TME3 1AR62 4QPGA 1PGW2 1PIV2 3JD73 3VBOA 5L7OB 4IV1C 4PDWA 1HQNA 1QQP3 3ZFGB 1RUD2 5CFCA 4CDUB 1PVC2 4YVWB 4Q4Y2 1RMU3 1AYM2 2WZR1 3J8F1 1RHI1 1PGL2 4JGYB 1BMV1 1MEC3 4GMP1 1CJDA 1QJU2 1RUJ3 4RFT0 2RS52 1VAKA 2TBVA 1AL22 4CDQC 1AR72 5AC92 3ZFEC 1AR91 1NG0A 1ZBA3 4LLFA 3ZXAC 2RM23 4YVSA 1V9U2 2WFF2 1C8M2 2BFUS 1VBA1 5A32A 5JZGB 2BBVA 3IDEA 4Q4X2 3VDDA 2HWC3 1A6CA 4PDWB 2RS33 1PO21 1FPN1 1CD3G 1QJY2 1EAH2 2RR11 4CDXA 4GB33 2WS91 5ABJA 1ND2C 1PO11 3M8LA 2HWB2 5C4WC 3JB4C 1TMF2 2HWD1 1Z7S2 3VBHA 1VB4A 1MQTC 1EV11 2HWF1 4RQPC 1NA1A 1M06G 5CFDA 2HWE2 1RUE1 1VBC2 1K5MC 5K0UC 2R061 4CEYC 1RUD3 4YVSB 1RUH2 1PVC3 4Q4Y3 5A32B 1HRV2 3VDDB 1MEC2 3ZFGC 1AR83 4CDUC 2GSYA 1W39A 4Y4YA 3VBFC 4YVWC 1RUG1 4FTBA 2WLPA 2RS11 4CDXB 1HRI1 1QJU3 5ABJB 4JGYC 5BNPA 5L7OA 1FMD3 1QJX1 1AL23 1F2NA 2RM22 1OOPB 5DDJ1 3VBHB 2Y26A 2WFF3 4Q4W1 2MEV2 1NA1B 5CFDB 1VBD1 2RS32 4Q4X3 1ND3B 1POV1 1VBB1 4GB32 1EAH3 5BNNB 4PDWC 1BEV3 2HWB3 1TMF3 2WZR2 1RHI2 1VRH3 1RVF3 1Z7S3 2XBO1 5ACA1 3DPRA 5JZGA 4RS5A 2PLV1 2GH8A 5BNPB 1R1A1 2DF7A 4EJRA 2HWE3 5A33B 1RUC1 1VBC3 4IV3A 1RUF1 1D4M1 1AR92 1R083 3LOBA 1RUH3 2R041 4SBVA 1HRV3 3ZFFB 1AR82 4RHV3 4YVSC 4Q4V1 3S6PA 4Q4W3 4RR3B 1ZBE3 2R071 4Y5Z0 1HXS1 3VBUA 3FBMA 3VDDC 3JBG1 4GH4B 1VBE1 1AUYA 2RR12 1FMD2 5FOJB 1FOD1 2WS92 4N53A 4CDXC 5ABJC 1OHFA 2HWD2 3VBSA 3DPRB 5GKAC 4RS5B 2MEV3 1EV12 1AYN3 2HWF2 2XBO3 3VBHC 4IV3B 5BNOA 2WWSA 4CDWA 2R062 1NA1C 1B35B 1NCRB 4JGZA 5D8AA 5CFDC 1AYM1 1BEV2 4QPIB 1PGL1 1VRH2 1SMVA 1RVF2 1OOPA 1R091 2WZR3 3J8F3 3CJIA 1RHI3 2RMU1 5C8CB 4NWWA 5J96B 3VBUB 4FTEA 4GMP3 2RS51 2RS12 2BUKA 1HRI2 2R073 1ND3A 1RUI1 4N53B 1AR71 1QJZA 5AC91 1NY71 1ASJ1 4WM8A 1R082 5BNNA 5BNPC 3VBSB 5L7OC 1COV1 1AR93 1C8M1 5DDJ2 4RHV2 2XPJA 4Q4W2 1VBA3 3NAPA 4WM7A 1ZBE2 5BNOB 4CDWB 1QJY1 4JGZB 5D8AB 1PO23 3TN91 1FPN3 1NCQA 1VBB2 2RR13 1F8VA 2WS93 5A33A 5C9AA 1BBT1 3CJIB 1PO13 1TME1 2HWD3 1AYN2 3ZFFA 2XBO2 3JD71 5ACA2 2X5IA 1EV13 2HWF3 2PLV2 1QQP1 3DPRC 4RR3A 5JZGC 4WM8B 4RS5C 1RUE3 1RUC2 1RMU1 2R063 2ZAHA 4GH4A 1D4M2 4IV3C 2R042 1MEC1 3NAPB 1COV3 3J8F2 4FSJA 4WM7B 1BMV2 4Q4V2 1RUJ1 1ND2B 1RUG3 1NCQB 4CEWA 5LK7B 2R072 1HXS2 2RS13 3JB8A 1HRI3 1VBE2 4BCUA 5C9AB 1ZBA1 2RM21 1FOD2 3VBUC 4N43A 1B35A 1NCRA 1QJX3 1X36A 4RQPB 1DDLA 2FZ1A 3VBRA
chains in the Genus database with same CATH superfamily
4B29A 1KDMA 2W1UA 2R1DA 5FZ8A 3WG3A 4CP9A 3DF0A 3PMEA 3QH6A 4LO4B 1W8UA 2OT7A 2VCMA 4N53C 3USUA 3HBZA 4PI0A 5FY7A 3ZPYA 2XJTA 3ETPA 5EHDA 2XVGA 5C6CA 2ZMKA 3D5OA 2WABA 3ETQA 3UKVA 1NYWA 2GNMA 1ULOA 5T5JA 5LASA 3PUHA 4XCAA 5HXVA 3THPA 2QQLA 2ZX2A 4CDWC 5BYNA 1ZA7A 4DOUA 2QBXA 2AR6A 2UYAA 2ZX1A 3BODA 4JGZC 3KVAA 1A8DA 1I5PA 3H1MA 5D8AC 3UL2A 3ZR5A 4BMEA 5J98B 5C3OA 5JI9A 2X09A 4I3PA 3WDUA 1MS5A 2WNUB 4IV1A 2RMU2 4PLMA 4FTSA 1OOPC 1IKQA 5ACA3 3OGGA 2Y60A 1RC6A 3HWJA 5FV3A 5C7GA 1JZ8A 2D3RA 1H0BA 3VD5A 4ZKTB 1F35A 3RPQA 1ZM1A 2MNGA 2CWSA 1PVC1 2VVFA 2WINB 1AHSA 2WO1A 4Q4Y1 5FZ6A 1NY72 1S0EA 3GZAA 1ASJ2 3T2OA 4P5YA 4Y4RA 3UKTA 4BISA 3EB7A 5FZDA 1XSQA 4QM8A 4D69A 1H8TB 2R043 3CIHA 1PNFA 3I59A 4WM8C 1O3RA 4I0AA 3P1IA 4GJZA 2BW8A 3WQBA 4A6SA 4LO7A 3AL5A 4QU1A 1L3JA 1QJU1 3FLTA 4A41A 2DUPA 4A42A 2WSUA 2PHLA 3M3OA 1M4WA 1RB8G 2OKXA 4RA0A 4P5HA 5I0DA 4WM7C 2FMDA 2VD7A 2FDJA 2V5YA 4O9GA 4S2DA 1VB2A 2YFUA 3B01A 3W5NA 1JYWA 1UO9A 3OTFA 2JICA 2YPJA 5E8AA 3OYWA 4IE7A 4UFLA 1BBT2 5FLIA 2WYFA 1U0AA 4WZCA 2BWCA 4NIDA 4V1PA 4AQSA 3HNBM 1WCUA 4EN6B 4OHXA 2VCBA 5C9AC 1YC61 3PUSA 3AYCA 5LW9A 3WNMA 4QXBA 5GJ6A 1UMHA 2LW8A 4BYYA 4D3WA 4DEQA 4UW3A 2YXSA 2XH6A 3JD72 3PLQA 1N1VA 2YPDA 5FYIA 4OMDA 4FT8A 1E57A 1ENSA 5DUVA 1UY3A 4FFIA 3ROUA 5A6QA 3SHRA 3BI3A 4GMP0 3VL9A 1H6XA 1NUKA 1TMF1 2GNBA 4CZSA 1HN1A 1WUVA 4MGYE 5IHRA 1MZFA 1AYM3 1UU6A 2K46A 5LY1A 1UOGA 4Q0SA 3AFGA 1LEDA 3ZYGA 2JG9A 1LENA 1R093 3T30A 3ZR6A 5EV7A 1R64A 2BEOA 4CDQB 1K5MA 2JDYA 3U37A 4CEYA 5FZHA 1C8NA 2HWE1 4UYBA 2E9QA 1ODMA 2FHRA 1R1A2 2VOTA 3K48A 3PU3A 3AKSA 3VKOA 3MW3A 4RSUA 3IWZA 4LO8A 4CEWC 1R081 2X53S 1RUI3 1RUH1 2ARBA 2JKBA 5C3RA 1W9TA 3ZFGA 2XUEA 2RJLA 4LK6A 4H7LA 2FZ2A 3GDBA 2CV6A 3J26N 3VBFA 4RHV1 3FUOA 5FAXA 4FPJA 4N43C 1B35C 3WW4A 1XNTA 2KXLA 5APAA 1ZBE1 4BJ0A 4TYSA 4QPIC 5C4WB 1FAYA 2AC1A 4CUGA 5LBEA 2JKXA 4CPBD 4QPGC 4RGAA 2WO3A 3M3CA 5DUWA 5J36A 1AL0G 3D4KA 2YU2A 3IIIA 2XQRA 1SCRA 1MQTB 3GM8A 1S4CA 2FDHA 2JD4A 2HYKA 2DVDA 1UY1A 4XXAA 5CFCC 1WCDJ 2HLEA 1OPOA 2YDEA 4BHPA 1QY4A 3NMBA 1MS0A 1ONAA 2Q1ZB 1GP5A 1C57A 2EXIA 3DXTA 3QOPA 4QPGA 3SH3A 1JW6A 5EPAA 3CL1A 2J1SA 3LFIA 3LWCA 3ZOIA 1IS6A 2G1MA 1ZREA 2WN2A 4E4DX 1CGPA 1AXKA 3POBA 1VR3A 5CFCA 1OA2A 4FPGA 1J3PA 1XQNA 1PVC2 5FYYA 3AZWA 1FXZA 4LBKA 2BBAA 3A0KA 1JHNA 1QIQA 2VBPA 4NVPA 4Q4Y2 4FAHA 3CF6E 2DCJA 2WZR1 3ZX7A 5C8WA 5IVVA 2LTNA 3GJBA 5B2GB 2P3JA 2A6VA 3IMNA 1IPSA 5FCCA 4YFZA 4A7YA 1HB1A 2VVDA 4NAMA 3TEXA 5IK5A 2EA7A 3PVEA 4MHUA 1EP0A 1QJU2 3GZEA 2JG8C 5JUVA 1OD5A 1VAKA 1F5FA 1W6MA 1S0CA 3RGBA 4EZ4A 2D5HA 3H3ZA 3U10A 3T2TA 3ZFEC 3HOBA 3OD0A 1Q8PA 1MS9A 4IE4A 4WBBA 4BMBA 1ZA4A 2RM23 5EJ3A 1HJGA 2VU9A 1V6NA 1T6GC 1UKGA 3TWIA 3KLSA 1YEWA 3N7KA 4FPOB 1UN1A 3M2MA 4XF1A 4KI5M 5ERLA 4NRQA 4S2HA 4OZXA 2RS33 2KR2A 3SITA 1PO21 3HMYA 5IW0A 3ILNA 1QDOA 5F7UA 1RXFA 2EIGA 1YQ2A 4YW7A 5FZAA 3PJYA 4CDXA 4R8HA 4P14A 5A7NA 4MG2A 3HQRA 1ZZ8A 4LA2A 3AVRA 3O14A 2XJRA 1PO11 1PMIA 3JB4C 1TMF2 4MX3A 5F6LB 5IVYA 2HWD1 1JI6A 2WNOA 3WSOA 2B8MA 4AI2A 2JB8A 2DCZA 3PL0A 4COUA 2XDVA 4R9CA 2ET1A 1VMJA 5FWEA 5FP7A 3ZSLA 1UYZA 3T2QA 3RI9A 3TRSB 5A7OA 3VHOA 1NA1A 3A0NA 2ILMA 2LUWA 4QX8A 2HWE2 3MUY1 1RUE1 3FJSA 4FBFA 3I8TA 3HBKA 3ZYPA 3DYPA 1RUD3 1F4AA 1PK6C 4YZ5A 5BUVA 1HQLA 1RUH2 2Y34A 3IPVA 5A32B 2WUHA 4XJUA 4PIZA 1JYIA 2ZHLA 5IUQA 3VDDB 1VMHA 3V0AB 1W05A 5FZ9A 5T5LA 4CDUC 1W39A 4RGKA 1JU4A 1D2SA 4Y4YA 5JXHA 2DUOA 4WVWA 2C9AA 2JXAA 2P17A 4LLOA 2RS11 4B4QA 3B3QE 4YZ4A 4LKSA 4JGYC 3B02A 5BV6A 1V70A 3POIA 3WF1A 2HJIA 3W5MA 3VZLA 2PQSA 1AL23 3VDAA 2UYBA 3UJOA 4O9EA 2GAUA 1EUTA 1QGLA 2AZ5A 2CGNA 4COWA 2A3XA 4CE8A 2WFF3 2VAUA 4Q4W1 2R30A 1DHKB 2NQYA 4XXPA 5CFDB 2HBUA 2ZKNA 2P3YA 5ANQA 4DPNA 3U14A 1MACA 1XSRA 2YUEA 1JYVA 3B7MA 4K20A 3ACIA 3O1UA 2VTFA 4GB32 4A3XA 5BNNB 1DFQA 1V6MA 2C5DA 3CMGA 1CAWA 2H0VA 4J6GA 4ZZ5A 3LSDA 1BVP1 2GH2A 2HEWF 2HWB3 3CBNA 3HD8B 2KA3A 4YPJA 2YU1A 3U4SA 3WLUA 2WZR2 3T2PA 4Q26A 1BK0A 3C7FA 1GOFA 4YM2A 3HIFA 3LA2A 5ACA1 1QF3A 3DPRA 4AE2A 3BTAA 3Q8BA 5BNPB 3UGHA 1UL9A 2OX0A 4IEPA 4XZUG 1PVXA 1VBC3 2B4KA 3MV11 3QD6A 2WWUA 1KXGA 1LCLA 4OHYA 3ZN4A 4D6RA 1OD3A 1UKRA 4KWJA 2ZGLA 3ZMOA 3ZXKA 3LOBA 3KGLA 2R041 4JCKA 3NKGA 3WCSA 4XABA 2OUJA 2ET7A 1S55A 1VAMA 5FPZA 5K4LA 3U4XA 3UV9A 1AR82 1PGSA 1YXWA 2G19A 3FBYA 2NZ9A 4Q0UA 3TBDA 4PT6A 2XOMA 2J1AA 2ZS6B 3HNYM 2RDRA 1UZ0A 4MGZE 4TLGA 2EIBA 1EYBA 4RR3B 3AP7A 4Y5Z0 2R071 2OQ6A 5SV8A 3M3QA 2P2KA 1YO8A 3FMGA 5A6YA 1H2LA 1CAUB 2WRAA 1UYXA 2VUJA 5FZ4A 1UD1A 4HKLA 5FOJB 4CPBA 1JUIA 3OUJA 4Q1PA 5T55A 5FZIA 1XNKA 1DU3D 4ZU5A 2WNVC 1F31A 3I54A 4X8NA 1GU3A 2HWD2 3VUOA 3DV8A 3VKMA 1TNFA 1CN1A 4JQRA 2JD9A 2ZGTA 2MEV3 3FHAA 4LBJA 4PJYA 1YIFA 5GM0A 1CZVA 1A3KA 2W68A 2XBO3 1S0DA 3GZUC 1W8NA 4NHYA 1CONA 2VQTA 3VBHC 1DQ1A 1WBFA 2B45X 5LEKA 1HLCA 5BNOA 3ZIWA 5L36A 4AOCA 4IUGA 3ENRA 4PIYA 5EYYA 3T1MA 4AI3A 1O5LA 4D7TA 1OVSA 3AFKA 1AYM1 3GF6A 5FK7A 4HVRA 4TZDA 4CP9B 4XQWA 4CRQA 3VZMA 1VRH2 3CHXA 1R091 2X29A 1SZBA 3E6CC 4UFKA 3FE5A 3J8F3 4YWAA 4BQ2A 1JH5A 4HLTA 4NWWA 4OI1A 4PHZA 2QQKA 4COYA 3BUCA 2RS12 2B9UA 3OD4A 1ND3A 4CCLA 3CZJA 2OZ6A 1RUI1 3C2UA 1UMZA 3RJ2X 4N53B 2E51A 4HK9A 3RYRA 3ZN6A 3H8XA 1LHWA 3HQXA 1JS9A 3I2GA 3KCCA 3P6BA 3RMYA 4LITA 4ARXA 3IMMA 4UFIA 5LK5A 2GZWA 1COV1 1AR93 1MZEA 4FFHA 3OUHA 5FZMA 2Q5TA 1HW5A 3PUQA 5A1FA 5M0TA 1JMUB 1G8WA 4Q4W2 4F7ZA 1VBA3 1OLQA 4KQ7A 4JKKA 2XPJA 4YGEA 1S2KA 4Z2WA 2HEVF 4LORA 4FFGA 2WT1A 4HKWA 4JAAA 4M4RA 4BXSV 4SLIA 5IVCA 3SEPA 1U12A 4CDWB 2FDIA 4E2GA 5FKCA 1GZWA 1W2OA 4JGZB 5D8AB 5ANNA 2WBKA 4IEQA 1NCQA 4DUWA 3AP6A 2QDNA 2RR13 2CAVA 2CY6A 5F6KA 3RWKX 3WF2A 3BU0A 2DCKA 5A33A 2R49A 4BA6A 4EN9B 2CU5A 4YGDA 1WWYA 3MDPA 4IXLA 2QQNA 4EWDA 5LA1A 2BGOA 4LEJA 4XFGA 3C7HA 4JQTA 2YC0A 1S0GA 2BGCA 4QB6A 5ACA2 2VW1A 2X5IA 1GYKA 4EZHA 3MLLA 2CHHA 1MS1A 5C3PA 2ZGSA 1N1YA 2AACA 3ZMNA 2WT0A 1N3QA 4WM8B 5GZEA 4RGGA 4RS5C 4CUCA 5I8YA 3MIHA 4BB3A 3S0MA 1BVVA 4GH4A 3N9PA 3RWNA 2FCTA 4RYDA 1F9KA 1PX3A 3QCWA 2R042 1G7YA 1YI7A 5IYYA 1TQ5A 5A80A 1MS4A 1EPZA 2WT2A 1LGNA 4MUVA 4WM7B 5C33A 2Q1FA 2Z69A 1W2AX 5FZEA 2J1UA 4FPCA 4OI2A 5A1LA 3FN9A 2R072 2JE9A 2HYXA 3ON7A 4I09A 4JTNA 4AVBA 4NN0A 4W6WA 1D2QA 1REDA 1H2MA 1FT9A 2H6CA 2A6XA 1SBDA 5C9AB 4CU7A 1W3VA 1UF2C 2RM21 4QU2A 1NT0A 1DYPA 4K9SA 4R52A 3VBUC 3WNXA 1YFWA 1QJX3 4Y1ZA 1DDLA 2VW2A 4X8PA 1JU3A 5DDJ3 2F6BA 1YHFA 2QCSB 1K5MB 2FCVA 5DAWA 2QQWA 4CEYB 2JWPA 4AEDA 5F37A 2RS31 3KGZA 1KJLA 3HT2A 5GLVA 3W9AA 1OT5A 2YZ4A 3VBSC 5A3LA 2JIJA 3LA3A 5C8CA 3M3EA 4XJZA 3J7MA 4DUVA 4L0PA 2GMMA 1FPN2 4QKNA 3HN3A 1POV3 3HN1A 3TOJA 4KBZA 4O61A 2R6QA 4CP1A 3H9AA 2ZZJA 3LE0A 3VBFB 4CUBA 1SLIA 3IN9A 3MGUA 2ENRA 4P00B 3D0JA 3ORJA 1F5JA 4R9AA 3ABZA 3H50A 4S2GA 4C0HA 5CBLA 3BOWA 2WA3A 1R092 2QZ3A 1AR61 1H1IA 2F4LA 2IZWA 4Y24A 2FDGA 4QD2A 2B9VA 4CEWB 1KFUL 4YZ2A 4QQLA 4I0WB 1PIV1 1OH3A 4URAA 4Z82A 5J3UA 2ZPXA 3EXUA 1G9BA 2DU0A 2EXHA 1VIWB 2VZQA 1O5UA 2PLV3 1X33A 3SC7X 1RUD1 3LGRA 1APNA 1E5HA 1RUI2 1XYOA 4N43B 4AYUA 1GOGA 4IL7A 2VMGA 5FZOA 2BRTA 1Q56A 2P1BA 3DGTA 4UW4A 4CTEA 2JDPA 2W39A 4HSJA 4Q0VA 3AJYA 4HVQA 1GQPA 2QDRA 1RUF3 4MHRA 1COV2 3K46A 3RZGA 4IGQA 2ZEWA 4QPGB 3ZKYA 3Q8EA 5BNNC 4FO9A 3WZ1A 3FHIB 4CXXA 4HPKA 5A3UA 1RUG2 1HB3A 1SDDB 3K75B 1S0BA 4KNCA 5K7PA 3ES4A 2H6BA 4QB1A 4QX2A 5CFCB 3NAPC 5GZFA 4CP0A 2Y38A 5T5OA 3EO6A 5FXVA 3KV6A 5EZWA 1AL21 3NL1A 3RNSA 3SCHA 5IK4A 3JBG3 5FY4A 3TAYA 2OPKA 3OCPA 1RITA 1X50A 1XNBA 2D7FA 2XJQA 3AYEA 5KHKA 1FOD3 4AG4A 2XUMA 5F5IA 1V9U1 2K2SA 2WFF1 4QWNA 1YUDA 3HT1A 5F5AA 4QDQA 1W2NA 2QQVA 1ULPA 2ZA9A 5EYXA 3WP3A 4XIOA 3ZYJB 5HI0A 2VVEA 3OEAA 4EN8B 1QNYA 1WW4A 1W6OA 2XJVA 5D21A 3ZDSA 1GWKA 4OUSA 1GZTA 5F1RA 1W6MB 1ENQA 1VBD2 4QQHA 3SH4A 3L2HA 4QGMA 1OBNA 4CXWA 2XJSA 4ZS2A 1ZZ7A 2DVAA 4XDQA 5JOWA 1GZ9A 2XG3A 1LULA 4V2VA 1LNSA 5LZ6A 1N1TA 3VDBA 3W58A 2YV8A 4EN7B 3G7DA 2HWB1 3V0BA 5FWJA 4RR3C 1FV3A 1V6IA 3ZM8A 1I9RA 3N7MA 1H4GA 5C3QA 4KH9A 3CU7A 2BU9A 2JG8B 4YM0A 1MPXA 2O1QA 2D6NA 4NPMA 5DAVA 4UF0B 1H9WA 4H55A 3I2OA 3ZSMA 4RQPA 4B1MA 5DUUA 2JIGA 1PM7A 1BHGA 3K4DA 4AI8A 4D6SA 3LF7A 2E26A 5K0UA 4JX0A 3ZFEB 2W1SA 4DY3A 2AUYA 4AHXA 2E7AA 5FZCA 1WD4A 1VBC1 3KD4A 2RS53 4HBNA 1ZRDA 3I3EA 1LOGA 5CNAA 4E9KA 1G9CA 2IXKA 3JQXA 3SEEA 2B7YA 4AFAA 4GWMA 2PHUA 2XJUA 4LXLA 2BFUL 4BH9A 2VQUA 4HANA 5KXCA 1IGOA 3I3QA 2H0BA 4YVWA 4L8QA 2W1WA 2PHFA 4YSFA 1FX5A 2D6KA 3BCWA 3WUDA 1C8M3 1UAIA 2ZBJA 4JHTA 1DG6A 1IHMA 3VBRC 5HV0A 2ZACA 3NJZA 1RYYA 4ATFA 1TEIA 2EIDA 4IGPA 1GWLA 2Y6HA 4HMZA 4MH0E 1NE4A 5FYTA 1RTVA 5H9RA 3ITQA 5JDBA 2JE8A 4XFAA 4Y1YA 4OYUA 5AFBA 2CGOA 2QVSB 1YI9A 4ZHNA 3VD7A 2ARCA 1DLLA 4JKLA 2D97A 4PCRA 5FP4A 5KXBA 1IG0A 2MEV1 1GKBA 2D6PA 3SMHA 5A6ZA 1B09A 1CJPA 1HB4A 2JX9A 5FUIA 1TME3 3C7EA 4ES8A 1AR62 1PK6B 5FXXA 5EFUA 1PIV2 4XEZA 1UQXA 3LB9A 4IV1C 1WA4A 2WO7A 1WMDA 2MPFA 1ACCA 5I0SA 1UXXX 4PDWA 4CCJA 1W8ZA 1WLCA 1RUD2 1YWKA 2ZGKA 3KT1A 4CDUB 3H0OA 4CP2A 5FK8A 5K8SA 3HQUA 3MBWA 4YW1A 1RMU3 2VZ1A 2YY1A 2XKOA 4DY5A 3BIEA 3J8F1 3N4MA 4JGYB 2ZJCA 5FBJA 1MEC3 1CAVA 3PTRB 3OPZA 1CWPA 2UY9A 2WQ8A 2W2IA 2OZJA 1CJDA 5FFOC 4Y22A 3ILRA 1AXYA 1REEA 4IGOA 5FZ0A 2Q8DA 3A21A 4FQ4A 1UCXA 3E6BA 2ATFA 2Y0IA 3VZOA 1QOTA 1AL22 1WLDA 3AKPA 5AC92 1AR72 1AR91 3KSCA 5FQ0B 1ZBA3 2KD7A 3E1F1 3GNEA 3N36A 4LLFA 2Z79A 4YVSA 1OA4A 3W21A 1V9U2 1V0AA 2SLIA 2WFF2 3BIWE 1VBA1 5GLUA 2PA7A 1MVQA 5I93A 1GSLA 3N9MA 1G6NA 2ZABA 3SKVA 1UOJA 2WQ4A 3ZKUA 3O1RA 4GA9A 3IDEA 3RQ0A 1IS5A 3ZXFA 2VZPA 3KM5A 4M0HA 3THCA 3O0WA 1VRBA 4FP3A 4F83A 2VOWA 2RV9A 1QJY2 1LOEA 1AJKA 2RR11 3WF4A 3MUZ1 1XYPA 3AYDA 5ABJA 1UYYA 5FZLA 1UMIA 5FUNA 2VMEA 3WP5A 1J1LA 1XJAA 3M8LA 5FOBB 2HWB2 4AVVA 3W20A 4QQ2A 3VN4A 1H2KA 3I7DA 1VPHA 4V2WA 5FY9A 4FAGA 1Q8QA 1YQ6A 4LBLA 1LR5A 4QMAA 4XUNA 1DGRA 2QQOA 1C1LA 2VNGA 2ZGQA 1C5HA 2AGSA 4M3CB 4QX7A 5KXEA 4XDPA 3M7AA 1UOFA 2VOKA 3OGRA 2JG9C 3AP9A 1M06G 2PAKA 3KVBA 4CU6A 1S2BA 1VBC2 1K5MC 1SQ4A 4LTAA 2YBPA 2EXJA 4CEYC 4ES9A 3H3UA 5EP9A 1LJ7A 3FC0A 3O1OA 5KC6A 1W04A 1I5ZA 2GMEA 3K3OA 4O65A 1GZCA 2J1TA 4X6RB 4KU7A 4GXLA 3KV4A 4XIKA 4OVEA 3M1HA 3ZFGC 2Z2SB 1SFNA 1LOFA 1OQ1A 1QJFA 3DEMA 2PHTA 2PHDA 2GSYA 3VBFC 1BK1A 3PVBB 3I2JA 2DVFA 2WLPA 2EAAA 3ZYIB 1PZ8A 4FPEA 4CA9A 3POJA 2WNVB 1JZ3A 2OIIA 4XFHA 3H3LA 4DINB 4YYOA 5L7OA 3CJXA 3JCIA 3TNPB 2R0HA 3WHUA 2YMZA 1FMD3 1QJX1 3P3NA 1IOAA 4YRDA 2VMFA 5EQUA 5SV5A 3MV01 2DBNA 3MF6A 3OOXA 1FNYA 2DWRA 3ZN5A 4AR2A 5DDJ1 2QZ2A 3RZLA 3VBHB 1IG3A 4J1XA 1XB9A 2MEV2 2XQXA 1W6QB 4W8JA 3O1SA 2R1BA 4L9BA 3PMSA 1PM4A 2Q4SA 1RGSA 4N9HA 3C7OA 1ND3B 2K0GA 3HPNA 2NN8A 3AKTA 3ZSJA 1POV1 3I97A 4LR4A 4RD7A 2VBBA 4AVTA 1X82A 4B4RA 1D0HA 4QQPA 1VP6A 2N7GA 3GZTB 5IK7A 1N1SA 1NLQA 2YFZA 2VC9A 1HB2A 1BEV3 2OVUA 5HCHA 2BDRA 2VE1A 2IUWA 3WDWA 3MIBA 1W6PA 4DEVA 3C8XA 5FPVA 5JR7B 2W95A 2ZGRA 3D82A 1O6UA 1RVF3 5JIUA 5LRSA 1UZVA 2V4VA 4LBNA 3V64A 4EYUA 1XE0A 5GALA 3SNMA 1A78A 2PLV1 2GH8A 4DB5A 1CAXA 3ZXLA 3JXSA 1Z0HA 2DF7A 1SLCA 4EJRA 1WKYA 5FYBA 2ZGMA 2WAAA 5T54A 3WG1A 3M70A 3JU9A 3NJXA 4AVSA 4IV3A 5A33B 3J7NA 1H2NA 1WGPA 3KZ4C 1RUF1 5BNQA 1AR92 2E53A 1GICA 2ZMNA 3IKWA 3KHBA 4JDOA 4K3UA 4MVTA 4Y20A 4AI9A 3UGFA 2QE3A 2V09A 2ZAAA 4SBVA 4LHSA 4E4ZA 1HRV3 5K9YA 3FX3A 2PYTA 1CESA 5FJHA 2EF6A 4NIIA 2YYOA 2BNMA 1Y9QA 1V6KA 4MGQA 1SPPB 1OUSA 2XVLA 4P9IA 3CKHA 2RG4A 2ZOEB 3EQEA 1SHWB 1W8WA 3AP4A 3CNAA 3FFZA 3FBMA 3JBG1 4GH4B 2W3JA 2RR12 3DYMA 1DYKA 2YBSA 4YW6A 1GP6A 1BXHA 1FOD1 2QNKA 1DF0A 1FYUA 3BKZA 1A8MA 1QH7A 4JC1A 4CDXC 1OHFA 2EIEA 3FHQA 3N35A 4CU9A 4WVVA 2W1QA 3LD8A 1CIWA 3OY8A 4RS5B 5LCWL 4P02B 3T4HB 1PMJX 1AYN3 1GP4A 5JOZA 5IVFA 5EIYB 4UAPA 5IVBA 3ZSKA 3T08A 2O8OA 2X05A 4QHBA 4CXYA 3WQ7A 3RS6A 1OQDA 4J1WA 3NV2A 1NA1C 4P08A 4B1LA 1Q8VA 3PIJA 2VECA 3B00A 5J7MA 1JOPA 3WNKA 4LKFA 2Z5WA 3POWA 3LKJA 5KHHA 3O1PA 3MI8A 5CEHA 1JYTA 1PGL1 3LEIA 4LQRA 5LEJA 4M4PA 4W6YA 5CZKA 4CCMA 5JLVA 3CJIA 1GNYA 1RHI3 3EMRA 4FXGB 4IW3A 3S30A 4AHWA 4NRMA 5C8CB 5LA0A 5J96B 2JJ6A 3VBUB 3WG2A 4QB2A 2XLGA 1SACA 1XNCA 2C6SA 2YC4A 4GMP3 2RS51 3O5SA 3U78A 5CKQA 2BUKA 2YGMA 3UYJA 1ZRFA 5ISLA 3S5QA 1DLCA 3VKLA 3L9JT 3K4AA 3NKTA 1QJZA 5F3GA 3WDYA 1AVBA 2J7MA 3LPGA 4JHZA 5FZ7A 4AZZA 1R082 2XWBB 3TYJA 3VBSB 4OI0A 2FBEA 1C8M1 2VUCA 4LO6B 5DDJ2 5C5UA 4Z8BA 2WZ8A 5HV4A 1UIKA 2RDQA 4RHV2 1YCIA 5GLZA 3SQOA 1W6NB 5JIAA 2E33A 2DV9A 2UWCA 3KV5A 5JSRA 4NUBA 1ZBE2 5AVPA 1D7PM 2J22A 3POSA 3Q9OA 5JXIA 4K21A 3BPZA 2ZHNA 2RE9A 5FZOB 3MIGA 5HPOA 3DKQA 1HDKA 1CX1A 4QQOA 1TVGA 1IZ3A 2BGPA 1OVPA 3A4UA 4FPFA 4HSLA 4YW3A 2XVKA 1NKGA 1WA6X 4PQQA 3K4ZA 4AI1A 2WZPP 1KGYA 4KWKA 5DPNA 5FJKA 2R32A 4Q8KA 4MGIE 3ZIXA 4HPKB 4LULA 1UY2A 1TME1 3QBQA 3ST7A 1JZ7A 1J3RA 2VULA 2BP6A 2VTXJ 5HXMA 4MGTA 2QQJA 3NSTA 3ZFFA 4FOYA 1DYOA 4XF3A 1SFYA 2DVGA 3ZXJA 2HWF3 4BQYA 5JXGA 1XE8A 2PLV2 4KBBA 2PFWA 5A3PA 3A23A 3IM0A 3DPRC 5A3WA 1WMXA 3RDIA 3VHPA 5C3SA 1ZZ9A 4ZXKA 1Q3EA 4QX3A 5F2WA 5JSPA 1RMU1 1LU2A 2R063 3RSJA 2VO5A 4C1WA 2IWGB 1IQDC 1XPWA 2WLQA 2ZX0A 3QACA 4FCAA 3H8RA 2XMLA 3E6DA 1FV2A 1UYPA 3VV1A 3E5XA 1MEC1 3NAPB 1SEFA 4GJYA 2J1VA 3MYXA 4Y1VA 3V56A 4PBPA 4N7UA 3G6JB 4A4AA 4ITCA 1LGBA 2VZUA 3H1WA 3POGA 3RZZA 1DIWA 3O1MA 4ONUA 2WNUA 3ILFA 5CISA 1GUIA 3FWEA 4MADA 2O8QA 5JOXA 2DBIA 4MOAA 5FREA 3JB8A 1SDWA 1H1AA 1K5JA 2VH9A 1C1FA 3D6EA 3GXUA 4F3JA 3TEYA 4OHWA 4BCUA 4KG0A 1ZBA1 3PURA 1C28A 4KGQA 4YFWA 3R4SA 4K8RB 5A70A 1FOD2 3E97A 5D1IA 5KR7A 2RDNA 4R4ZA 2OPWA 3WD5A 4BE3A 3ACFA 1NCRA 2RDSA 3MW2A 3NWKA 4RQPB 2FZ1A 3LZZA 3E5QA 3OBZA 1HV1A 2NYYA 1O3SA 1BCXA 5B4NA 4UW6A 5K0UB 5G05L 1EPWA 1J1TA 2UWBA 2TUNA 3J7HA 1H8TA 3BN6A 4FFFA 2C9KA 3D0SA 4NJ4A 2AEYA 2VOXA 3MLKA 1Y43B 4XUPA 2L9LA 4JRLA 4XJAA 4OHZA 4BM8A 3MO4A 3WP6A 1HKDA 4LIUA 2DYCA 4TWTA 3K51A 4G3YC 1PO22 1S0IA 3UESA 4EWEA 2Y8KA 3H7YA 4UOJA 4ZU7A 4AAPA 3KHCA 5HBAA 1VBB3 1GNHA 5BNOC 2A5ZA 4NPRA 2D3PA 4OZOA 2WKKA 1PO12 3MF9A 2BV4A 3NJVA 2BPA2 5F3IA 3K2OA 5CADA 3ASIA 2EVXA 3I3DA 5B4XA 1WLTA 1PGW1 1VAVA 2PAEA 1OFSA 3AX4A 3J7LA 4GKYA 3KQRA 2G4IA 5FMOS 4QX1A 5IAVA 1H6YA 1R1A3 1RUE2 3N9OA 2UURA 2WC2A 4XC9A 3KCYA 3R4DB 4PLNA 5E89A 5GLWA 1IQAA 2YGLA 4AW7A 4XE9A 1RUC3 3VBRB 4CCEA 1K12A 3B69A 3LSEA 2OA2A 5FDBA 1ND3C 2QTWB 1POV0 1UW8A 4IETA 2IXLA 3USUB 1D4M3 2YBKA 4OLLA 3AYAA 4ZZ8A 3GCXA 5JVVA 3O1VA 3QLQA 4DXRA 1O7FA 3HAGA 5FXWA 1JYCA 2VOVA 3N3HA 4ZXEA 2PHWA 3AC0A 5FPAA 2GP5A 3OSDA 4CDQA 4AFDA 2G9FA 1D4VB 1YFXA 4M00A 1Y3TA 1FMD1 4AQ2A 4MV2A 1WCSA 3ES1A 4QHZA 4Y1UA 3PUIA 3AMPA 3I2DA 1NCQC 2IFWA 4NE9A 1GMMA 2ZKLA 1KD7A 1CAVB 4IV1B 5IK8A 4LA3A 5A1AA 4NWVA 1OXCA 4E4HA 2IVIB 1TME2 4Y22B 1HV0A 1LOBA 3UKNA 3VZKA 4BIOA 2C1FA 4DRRA 5EJ1B 3RMXA 2ZCWA 2J1EA 1ZZ6A 4E2SA 4YW2A 4ASMB 5KC5A 4XCBA 1VALA 1ND2A 1SCSA 2Z42A 3AJZA 5FY0A 3PVNA 5HCBA 5C4WA 2X5IC 1ENXA 2BOJA 4YGBA 3DKWA 3LDKA 3CDZB 3AMMA 3NVCA 1BEV1 1RMU2 4I0BA 1KITA 1UU5A 1K45A 3GYDA 3I59B 3WR0A 1MQTA 1BLZA 1RVF1 1TG7A 5DZEA 1OA3A 1U5YA 4GH4C 2W92A 4G4FA 3OPWA 3UK9A 4PF1A 3R6SA 4XUTA 4Y26A 2QQMA 3VHNA 4Y1XA 3SXWA 3RZKA 2X8KA 5FMOL 1GWMA 1N3OA 2I2SA 2XWJB 4OFGA 3FZ3A 1ALYA 4A6OA 2UU8A 1OMIA 3C3VA 3J9SA 4N9IA 1AF9A 2NPIA 3O7OA 3OYWB 2CYFA 1UZZA 2ZTNA 4M01A 4XFCA 1JYXA 4AF9A 1ZBA2 5GZCA 5F5QA 2VQ0A 3AL6A 3I2FA 4BK5A 4B3NA 4BQ5A 1HRV1 2ORXA 3OBTA 4UFMA 4CVUA 2YHJA 1OKOA 3E5UA 2G9GA 5CKMA 1OUXA 5H9PA 4A45A 5AVAA 4CCDA 1Z78A 4YZ1A 1KRIA 2YROA 1CPMA 1ZRCA 1SBFA 5L73A 5CG9A 4LOSA 3GBWA 5DAPA 5A7SA 3IZOA 1W28A 1QWRA 1G9AA 3RRDA 3UGGA 4AEDC 1K42A 1YJLA 3M3IA 5C8CC 1DGLA 3VBOC 3APBA 3K77A 3TN93 5CAZA 1WMEA 1AJOA 1UXZA 2D6OX 2QKDA 4HN1A 4QPYA 2JG9B 4A7ZA 4LO5B 3NNGA 2DTYA 1Q43A 3BOPA 1AYN1 4YM3A 1G9FA 5G04L 3NNLA 3WNOA 1O4YA 3S7EA 1PGW2 1UIJA 1NLSA 5F32A 3VBOA 5DQ0A 2LALA 1XXNA 3WV6A 1X9PA 2IFRA 5L7OB 2FQPA 1VMFA 2VR4A 4PQ9A 3JZVA 1HQNA 3URFA 4QKDA 4Q0PA 1QQP3 3ZFGB 4XFBA 5J37A 2VCCA 4LE3A 2LM3A 2DCTA 3WOGA 1AYM2 1LECA 4K6BA 3VBRA 5JSOA 4H3WA 1RHI1 4QXHA 2ARAA 1Q5OA 2GC0A 2ES3A 2VBDA 1BMV1 4HG6B 3A7QA 2VZOA 4O7XA 4GMP1 4ISQA 2BNNA 1FNZA 1WBLA 2XHNA 2A7AA 1RUJ3 4PBOA 4RFT0 1DZTA 4XHXA 1RUNA 4H7MA 2YC2A 5KHIA 1F4HA 4TSVA 4I02A 3GHMA 5FZ3A 3NO8A 2WA4A 4AEKA 4E2QA 5KXDA 5DAXA 1URXA 3FUQA 1IS4A 1W9SA 2NLRA 3ZXAC 2E31A 2XONA 4NPLA 2VMCA 2BFUS 5D2AA 4LBOA 4KGGA 3ACLA 4OULA 5A32A 2BBVA 1XNAA 3WX5A 4UFJA 5LB6A 4HK8A 3VDDA 1BYHA 4I30A 4AFCA 2HWC3 1A6CA 5JMCA 3V0AA 4XJ9A 4UW5A 3WW3A 3POYA 4HONA 4OHVA 1UPSA 1Y7BA 1ZZBA 1Q8OA 4S2FA 4W4ZA 4BQWA 2Q0AA 1UZWA 3POFA 4GB33 5A7WA 4AQTA 2TEPA 1FI2A 2Y6KA 4GULA 1I6XA 4Q2FA 4QXKA 1N47A 4Y3OA 5I8TA 4FPKA 3BPSA 3NNFA 4KWLA 4COVA 2OQ7A 5A3NA 2ZGUA 2GN3A 5BXXA 1BKZA 2GDFA 3WDXA 3DXUA 4ZY9A 1GBGA 3A22A 1VB4A 4XFFA 5DZFA 4NMIA 2WYSA 2HWF1 1DCSA 3AXDA 1IS3A 3K3NA 3IDBB 3TEZA 4MGSA 4RQPC 3ZXEA 5JOYA 4BLIA 1I3HA 3DECA 5CFDA 3ZLIA 1LOAA 2VCAA 5K0UC 2R061 3KB5A 4K8FA 5LA9A 2C4XA 4Z07A 4BQ3A 2Y6LA 5CVRA 5DUXA 3RYPA 1ST8A 2E6VA 3OY8B 2P3IA 1HRV2 4OMCA 3AP5A 5FP8A 2P34A 4C0BA 1XU2A 1IPJA 1WLWA 3BALA 4AGGA 1AR83 4YVWC 4FOWA 2W52A 4UBGA 1OLME 2C0ZA 4FTBA 5JR2A 4CU8A 4M0NA 5DZGA 3WY6A 4CDXB 1LKNA 4K1YA 1VJ2A 1AX0A 3HR9A 5GZGA 1LODA 1RUOA 5BNPA 2P6CA 4UXAA 2WWJA 1DQ0A 3H1YA 2BNOA 4K40A 2NMNA 3GALA 2RM22 4FVVA 3SCGA 5KBFA 4DUXA 1RL3A 4QHOA 3OBAA 2EALA 1W2TA 1O3TA 1QH6A 5FMDA 1DQ6A 5LBBA 5KHJA 3FLPA 4XW3A 1U5ZA 1NA1B 1W0OA 1GQHA 1LTEA 2Y6FA 5JI7A 2RS32 4BLJA 4Q4X3 3O1TA 4BQ4A 2ZMLA 1HN0A 2UWAA 1L7RA 4JVAA 3PHMA 4JZRA 1AX2A 1J59A 1VBB1 2ZEXA 1EAH3 1PZ9A 1QMJA 2XB6C 3NNJA 4PLOA 3IPVB 5FPUA 2XLAA 4UWDA 2A73B 2RJ2A 1OLMA 4QDSA 1CAUA 3IAPA 4PDWC 5LBFA 4GQ7A 1NX9A 3WDTA 4D94A 1CQ9A 1RHI2 1VRH3 2ARXA 1JTZX 2NMOA 3MEPA 1E5IA 1Z7S3 3F2ZA 2XBO1 4Q1RA 1QOOA 3ZYHA 5I0UA 1LOCA 3BYWA 5JZGA 4Q5OA 3ZDVA 1OI6A 2EAKA 2O0OA 2G9ZA 2UY8A 4XETA 5DAQA 1R1A1 1UZYA 5F39A 3VZNA 1JOJA 1RXGA 1DGWX 3GHNA 1RUC1 1G86A 3AZYA 4AVCA 3AKQA 2Y6JA 4P9GA 1S0JA 4R9BA 4W65A 1JODA 1D4M1 4HETA 4YG3A 4AI0A 2O14A 2R16A 5JXJA 4OUEA 3ZFFB 3T4VA 4FI9A 4XPVA 3WP4A 1US3A 4YVSC 1L7LA 3D8CA 3I2IA 4LHLA 4LBQD 4Q4W3 5FYSA 2CGPA 1UNBA 1C4RA 4FPLA 4I3GA 2B5HA 4AHZA 4ASLA 2HEYF 3MFCA 4Y5TA 1CAWB 4MXVA 3SLIA 1YLLA 1AUYA 2Q8OA 3WG4A 3T0BA 4D0QA 3SKJE 1STMA 5FO8B 1Q8SA 2GP3A 4N53A 4AHYA 2V4AA 1U5IA 3UJQA 3S5AA 4LMFA 5ABJC 2Q8EA 3DPRB 4KWUA 5FYVA 4XJWA 3U75A 1ULFA 5JAXA 4BIFA 2HWF2 5FY5A 1NXD1 5IVEA 4TTGA 2GNDA 5F8PA 4CCNA 2BVBA 2LS6A 4YM1A 4CDWA 3CQOA 4OUMA 2R062 1NCRB 4JGZA 3DUIA 2A6ZA 5D8AA 2DURA 3PVOA 1OC1A 4RFRB 4Z2AA 1XC6A 2VXRA 4N90A 5FYCA 1S2EA 1T6BX 2ZGOA 3ALQA 1SMVA 2PQQA 5LA2A 1OOPA 4BPZA 2HBTA 3VHRA 3GJAA 1JZ4A 2ERFA 4GALA 4DMIA 3DL3A 3WEZA 3TEWA 2MHFA 2D40A 2IXJA 2DFBA 1LOFC 4OI4A 3BGAA 3WW2A 1CZSA 3BB6A 4YG0A 2R073 3MIEA 3BVCA 3KCXA 2VPVA 4YG6A 3NRUA 3LAGA 2OYZA 1UX7A 4GWNA 5LBCA 3S57A 3GGLA 4WM8A 3SCFA 1NZIA 4A2UA 2GC1A 2BOIA 1KEXA 5L7OC 3LDRA 1D0GA 2JB4A 4U36A 3RG0A 1DQ4A 3OJBA 2PHRA 1ULGA 3BU7A 5FP3A 2RVAA 2GC2A 2CTVA 2VNOA 5C71A 5A3MA 2GMPA 4NHXA 4WM7A 3RYKA 3VD3A 2BYVE 5BNOB 3WDVA 2CDPA 1OPMA 3R4UA 2VW0A 4N7IA 2P3KA 3OBRA 1WD3A 3ZXDA 3MFAA 4UBHA 4AFMA 3TN91 1FPN3 1LHNA 1VBB2 4AAXA 3WQ1A 1GR3A 3W59A 2QFEA 2WS93 1CR7A 4NIAA 2PMWB 3WXPA 5C9AA 5FP9A 5IT6A 1RINA 2W9XA 2WSVA 3B9IA 3EJKA 3HNMA 3V65A 1OFNA 2VL4A 4D7SA 5DG2A 1NZCA 4QX5A 2JE7A 3VGIA 1REFA 1WMFA 2XBO2 3NJYA 2OXBA 4NR1A 1EV13 1CX4A 5T52A 1WCQA 1QQP1 1YIPA 3ZN6B 4MGKE 4ISRA 4KMQA 3LIGA 3I2KA 1RUC2 1GQGA 2GNTA 4DXTA 2ZAHA 4XAEA 3LEKA 3AZXA 4QM9A 4CCCA 1S1AA 4D8MA 1D4M2 1RJ7A 4IV3C 4HXCA 4I2OA 1COV3 3J8F2 2DU1A 3PIGA 3O0VA 3FL7A 4NROA 4AQ6A 4FSJA 2CWMA 2AYHA 5FZFA 4NIGA 3H42B 2JECA 1RUJ1 1YQ8A 4P9WA 1GZWB 4B4PA 2A6YA 1ND2B 4GWJA 4WVMA 5TSWA 1RUG3 1LU1A 4P9JA 1NCQB 2IXHA 2JDUA 1YJKA 2LRPA 2VJXA 4CEWA 5LK7B 3T0DA 4IEUA 2VMDA 4MO3M 1H9PA 1HRI3 4A3ZA 5FLHA 2F4PA 4C90A 2WDBA 2VUAA 2ZGPA 3TB0A 3MZHA 1SBEA 1QKQA 1WW6A 4N43A 5FMBA 1B35A 3B5LB 5FZGA 1X36A 5LWBA 2P37A 3KQ4B 4QKBA 5L9VA 5CIRA 3MLJA 1BJQA 2K9ZA 4QPIA 3THTA 3L2YA 4DO0A 1VBA2 2ETEA 3SISA 4ARYA 2X5IB 1P8JA 1W8TA 2HWC1 4FPHA 2QQPA 2W47A 1LB2A 1GFF2 2ADDA 2X10A 1VBD3 2XJPA 3N7LA 3R0RA 4GB31 1ZNPA 1NOVA 4JTOA 2A1XA 4Q8LA 4LT5A 1JXNA 4ZS3A 4K7JA 3WNLA 4NHLA 4GIQA 3AXEA 2B42B 4JRAA 5FBZA 4GWIA 4X6QB 4IE6A 3IDCB 1IPKA 2LROA 2A75A 3LEGA 4RN5A 1JBCA 2BTVC 1U5XA 2D93A 1AZDA 5A3OA 3VD4A 1WCKA 1LAJA 5FYHA 4FQZA 1SLBA 5FZBA 1XE7A 4LHKA 2XLFA 3LA7A 2VNRA 4G9SB 3VD9A 3CJIC 5T50A 5H9SA 1W8OA 4IEXA 2W08A 2RJKA 1JZ2A 1DQ2A 1T2XA 4QGNA 2AENA 3WW1A 1CVNA 3I2HA 4LPLA 5EJZB 4FOQA 2J42A 5A7PA 3GBFA 2VQAA 4BWOA 1GV9A 2ZXQA 2ZZQA 4GAZA 4XUQA 1OQEA 1UU4A 2D43A 3PUAA 1QXPA 1IKPA 2VZRA 4TN7A 4CYDA 4AEDB 1AR81 2JENA 1ZRRA 4XQDA 2JG8A 4XJ8A 5AFEA 5KWRA 5FIXA 3VBOB 4ET7A 3MHZA 4UF0A 2E7QA 4R9DA 4IEZA 4Y5SA 4Q4V3 5CG8A 3OEBA 4LBQA 2OUHA 5FKBA 3ZFEA 4JKMA 4QXCA 4COZA 4AVAA 4Z92B 4LNVA 1HXS3 2VZTA 3AZZA 3Q8CA 1ZZCA 3TN92 4W6XA 1VBE3 1HQWA 2JDKA 1QJX2 1PMHX 2JDAA 3ZYFA 1NQDA 4XILA 4JDMA 1WW7A 5CKNA 4LHNA 4K1ZA 1UY0A 2A6WA 4IEVA 4AEJA 4Q4X1 3OF1A 1S0FA 1AR63 1MS8A 2IVJA 4DXZA 3AB0A 1EAH1 1PIV3 3ZFFC 4LK7A 1CZTA 1QQP2 4IEYA 3J4UH 1X8EA 4MXWA 1ZX5A 1HX6A 1RIRA 2IC1A 2OS2A 4QGLA 4LE4A 3PDQA 3RFRA 2VMHA 5I0TA 1VRH1 1GANA 4HT1T 4LKEA 3ECQA 5FMCA 2EICA 4ORFA 5FY8A 1KFXL 5DG1A 2VXJA 2AH2A 1Z7S1 1L7QA 1TNRA 4HVOA 5LRRA 3LPFA 2ID4A 1XBFA 1DGRN 1TZOA 4XQ4A 2V72A 4XTMA 5E16A 1QEXA 2RMU3 2VM9A 4GD4A 2HKXA 1RUJ2 2W87A 3THDA 2B39A 1W06A 4HKOA 1PK6A 2ORZA 4YGCA 5A7WB 4L97A 5CB7A 3OG2A 2PAMA 4PI2A 1AXZA 2WNUC 5HCFA 3LDBA 4A7KA 1E5SA 1YQ5A 1W99A 5LY2A 4C91A 1SG3A 4N8MA 4MYEA 1AR73 4PF5A 3HJRA 5AC93 1RUF2 3KS7A 4MLOA 1ASJ3 4QAWA 4CDUA 2D6MA 3OB8A 1Y9MA 3VDCA 1W6OB 1V9U3 1MVEA 2JDZA 2Q30A 2ZX3A 3MPBA 3WVJA 4HOOA 1UY4A 1NCRC 1OSGA 3D3AA 4E8DA 4JGYA 2HWC2 1QHDA 1OKQA 1NLRA 3H8UA 4QDRA 5C70A 2WAOA 5J09A 1KS4A 4KG8A 1VLNA 2BVVA 3TNQA 4BZ4A 3IAQA 1H8TC 1V6JA 4AWDA 2Y6GA 4JV4A 1QJY3 1V00A 4INDA 3V0BB 3F95A 3JBG2 5LATA 3MPPG 4BOWA 3MICA 4LUMA 4LIVA 1A34A 4UFHA 5T3NA 4E8CA 3CZUA 2CNAA 4OQ9A 2W5FA 1OF3A 1FATA 4GKXA 4M3CE 4XACA 1BBT3 5FQ0A 2P4EA 5FO9B 4GZ9A 4LUKA 4IERA 5A6XA 3S7IA 2D5FA 3ZXGA 2FCUA 2RHPA 3EHKA 2VNVA 1JZ6A 4ZU4A 5FR3A 4CCOA 1DZQA 1KJRA 2DTWA 3JD73 1DZRA 5FZ1A 2A71A 2EXKA 2ZX4A 1ZRIA 1SLLA 5F9TA 3I49A 1JYNA 4YVWB 3RVHA 5J48A 3VKNA 4W50A 4D7YA 1V6OA 4EE2A 4P9LA 4BXFA 1POQA 4XF9A 2Q8CA 2YB7A 3AM2A 3OGVA 1AX1A 1PZ7A 4I01A 1HJFA 1PGL2 2A70A 3JQWA 5CA6A 2E32A 5KHGA 3KF5A 2KM2A 2Y33A 4Q0QA 4XBNA 4C8DA 1YNAA 1XNDA 3KV9A 2PELA 4M3CA 2QUOA 2WN3A 2RS52 3LOIA 5FYUA 3WF0A 2DDUA 1UPIA 5EXOA 4AFBA 2TBVA 1QU0A 1O91A 4CDQC 4XAAA 1NG0A 4XDOA 5IJRA 2HH9A 4XOGA 3VLBB 3U1XA 1W9YA 4ZONA 3IBMA 1C8M2 2VY0A 3GCWA 1PNGA 4NHKA 3N9LA 5JZGB 4LJHA 1QXRA 2D44A 1ODNA 3CLPA 1H30A 1K3IA 3O0XA 5FZKA 1LESA 4Q4X2 2JDNA 5I8SA 4PDWB 4IESA 2I07B 2WFPA 3VL8A 2YG0A 3BTXA 1FPN1 3RZMA 1CD3G 1EAH2 4YZ3A 3NV4A 3AZVA 3P3PA 2V5DA 1C3HA 2OW4A 2WNVA 2QQIA 2WS91 3LQCA 3R05A 3ZO0B 2GC3A 2SBAA 3N9QA 4BK4A 3WINE 1ND2C 3AMQA 1SLTA 4CSWA 5C4WC 2XKPA 4FP2A 1H8VA 1X9TA 4BQXA 4YARA 4AGRA 1J3QA 1SFPA 5DMYA 2D3SA 5IWFA 5I91A 1Z7S2 3AMNA 2GALA 1W9FA 2E7TA 4IEWA 3VBHA 4DRVA 1MQTC 1EV11 5L9RA 2ZEYA 4LKDA 5BPXA 2ADEA 1W90A 5FXZA 1W6QA 2W0XA 2VZVA 1WW5A 4U2AA 5IVJA 1GOHA 1CPNA 3ME2A 3O12A 1W8FA 2QQUA 5A7QA 1JUHA 1ZYBA 4YVSB 5EWSA 4ASKA 1PVC3 3ACHA 4Q4Y3 1BQPA 3POEA 4L99A 3AVSA 3ZPOA 3GBGA 4B7KA 2C24A 1MEC2 3WT3A 1LHVA 3PTYA 4HFSA 4DQAA 2P5BA 4EQVA 1HIXA 2C26A 1RUG1 2W91A 2FDKA 3WHTA 2W46A 5F3EA 1OLRA 2XL7A 1CIYA 1HRI1 1NAEA 1QJU3 1MZ6A 4XZPA 5ABJB 4AEMA 1ENRA 3U07A 3VB9A 3B94A 3Q8FA 1NQJA 1YRZA 4TXWA 2XXZA 3T09A 2Z4FA 5FRAA 4YLZA 4CUAA 5CYYA 3N7JA 3OGJA 4NAOA 1F2NA 1UOBA 1OOPB 4YNIA 4DS0A 1O59A 3SH5A 4IQPA 3WF3A 1W03A 1EUUA 2Y26A 1X7NA 4YW5A 4ATEA 2CSGA 4PIXA 2J1RA 1XRUA 4R4XA 4MSVA 5GZDA 4WZFA 1JN2P 5JPNB 5IFTA 4L11A 3RZJA 3ATGA 1O4ZA 2WJSA 3VKFC 2GU9A 1VBD1 4EV0A 3ZYBA 4LOTA 1YQCA 3NQHA 3AK0A 4KL1A 4L92A 1QXJA 1BZWA 1SPPA 3LCPA 3BTYA 3WNNA 2PTMA 2VZSA 2AEZA 3EBRA 4Q27A 2JDMA 5F3CA 4WV8A 2WQZC 4P9YA 1XU1A 2QJVA 4AXOA 4M3CF 2D6LX 3B93A 2BZDA 3CEWA 2VZ3A 1TMF3 4AK3A 1W0PA 2VUDA 4LBMA 4EWAA 4A44A 3AMHA 3ZYRA 3RJRA 1LEMA 3PU8A 3NV1A 2F17A 5C5TA 1G9DA 2D98A 2Y64A 5FTTC 5F2SA 4RS5A 4QX0A 1J84A 2IXCA 1J58A 4L2NA 3WCRA 2E63A 4FPYA 5E1RA 3IB3A 4FXKB 2NM1A 4Y33A 2HWE3 3FFQA 2BJSA 3IDAA 3T3YA 1XYNA 4XBQA 3I3BA 4H14A 3WQ0A 3DN7A 1R083 4BDVB 1RUH3 4XFIA 1H1MA 1MZ5A 4RL7A 4E27A 3Q8AA 1QDCA 1MR5A 3ELNA 4RHV3 1R1ZA 4Q4V1 3S6PA 4B8EA 1O3QA 5FYMA 1E5RA 3U11A 3WUCA 1ZBE3 5A3TA 5JPMB 1XOYA 3ZSEA 1HXS1 2DFCA 2XR4A 5JMOA 3PJQA 2R0FA 3DYOA 3USSA 3VBUA 3EYPA 3VDDC 3IIAA 4JDNA 2WO2A 5I0RA 1VBE1 3U0ZA 1ULEA 3MIFA 1FMD2 4YW4A 2FD8A 5DXDA 2WS92 2W94A 1W6PB 2V73A 3H7JA 1DQ5A 1Y9GA 3KF3A 1PHMA 3OPTA 3UNPA 3KWVA 3VBSA 4B7EA 1W8HA 5GKAC 5JCTA 2JDHA 4WVMB 3ACGA 1GLHA 2XHKA 4IDZA 1X8MA 3X29B 1EV12 1CAXB 2I45A 4TLFA 3N9NA 1W6NA 4NO4A 1SLAA 3VZJA 3KT7A 4HZFA 4XYXA 4F8AA 5IATA 4OQ8A 3LIHA 4IV3B 3OUIA 4MZUA 1O8PA 4ZPIA 2CAUA 2WWSA 4CCKA 1F15A 4Y20B 1B35B 3AKRA 3DCQA 5L9BA 4AGVA 2ZHKA 1LGCA 4EN0A 5CFDC 4XVHA 2DCYA 2VGDA 4OCTA 1BEV2 4QPIB 2BQPA 3PNAA 4QPWA 4NHMA 2A3YA 4H2AA 1N3PA 1LHOA 3KMHA 1RVF2 2JEMA 3I3MA 2WZR3 3ZVXA 1J83A 1OH4A 4DZGA 1YFYA 2RMU1 2Y0OA 1W9WA 1W3XA 5CU1A 5HCAA 4UT5A 3NV3A 4XF0A 1OF4A 4FTEA 2WL1A 1ULCA 5GLTA 3T1LA 1W2UA 1W0NA 1HRI2 1JHJA 2TNFA 3JUUA 2WR9A 5F5CA 4BQ1A 1KS5A 1QOSA 1Y4WA 1ZVFA 1WZXA 4NRPA 2VTXA 5AC91 1AR71 1KDKA 5FPLA 1NY71 1DGWA 4IE5A 4HL0A 1ASJ1 1O8SA 4WVZA 1YFUA 2PN5A 5FYZA 2CDOA 5BNNA 2VMIA 5BNPC 4QT6A 5IAXA 3MIDA 3LFMA 5BY5A 4E4SA 5DABA 4P9XA 1YYNA 2GN7A 2BWAA 1DBNA 4XUOA 4URTA 3M4FA 4BU2A 2NP0A 1TE1B 2IXIA 3NAPA 5L19A 3B9CA 5J1XA 1ULDA 2XGXA 3HEIA 3BTZA 4NOTA 1QJY1 2CL2A 4EROA 4KU8A 3UETA 1GNZA 4FOVA 1O4TA 3KT4A 2BERA 1PO23 2Q1MA 4XMAA 4C1XA 1PX4A 3FLRA 1KQRA 2WNEA 1F8VA 4DFSA 4IE0A 1JOBA 3HVDA 3UT0A 4NIHA 1NXMA 1BBT1 3CJIB 2WZEA 1LRHA 1PO13 4XMIA 3NNMA 1EY2A 1DP0A 2DVBA 4XURA 1H4HA 2HWD3 3MW4A 4HN0A 5IFPA 1LHUA 4Q29A 4LBQB 5H9QA 1AYN2 3JD71 4AL9A 2R7EB 5JWPA 2B46X 5DN2A 1QNWA 3RI8A 2VG9A 5E88A 2ZEZA 2AREA 4META 4RR3A 3H8OA 5JZGC 3T0AA 2ZGNA 4QKFA 2FDFA 1C5IA 1RUE3 2WIIB 1JZ5A 4DIQA 2XL9A 4IEOA 3QH7A 2I74A 2P6HA 4DNYA 4XTPA 1NE6A 3CO2A 2PXJA 5T5PA 4XF4A 3WNPA 2DUQA 3OGSA 1BMV2 3C7GA 5FO7B 4D6QA 5E6HA 4Q4V2 1I1EA 1QJEA 1VE0A 3INAA 4Z1VA 2PHXA 4MXWB 1HXS2 1V6LA 2RS13 5FLJA 3RZHA 2FMYA 1MS3A 3IT8A 5FPBA 1VBE2 1US2A 1OURA 3LEMA 4UI9L 4DXSA 5FUPA 3P5BA 2A3WA 1UX6A 4XBLA 4XHBA 3NW4A 1UWWA 2ZHMA 1RJ8A 5FY1A 4J25A 5FPXA 3I4IA
chains in the Genus database with same CATH topology
4B29A 1KDMA 2R1DA 3WG3A 3DF0A 3PMEA 3QH6A 4LO4B 4N53C 3USUA 3HBZA 3ZPYA 2XJTA 5C6CA 2XVGA 2ZMKA 3D5OA 3ETQA 3UKVA 1NYWA 2GNMA 5T5JA 5HXVA 3THPA 2ZX2A 4CDWC 5BYNA 4DOUA 2ZX1A 2AR6A 2UYAA 3BODA 4JGZC 5D8AC 3UL2A 1A8DA 3H1MA 4BMEA 5J98B 5JI9A 4I3PA 3WDUA 1MS5A 2WNUB 4IV1A 2RMU2 4PLMA 4FTSA 1OOPC 1IKQA 5ACA3 3OGGA 1RC6A 3HWJA 2D3RA 1H0BA 4ZKTB 3RPQA 1ZM1A 2MNGA 2WINB 1PVC1 2CWSA 2VVFA 1AHSA 4Q4Y1 1NY72 1S0EA 3GZAA 1ASJ2 3UKTA 4QM8A 4D69A 1H8TB 2R043 1PNFA 3I59A 4WM8C 1O3RA 4I0AA 2BW8A 4LO7A 1L3JA 1QJU1 3FLTA 2DUPA 2WSUA 2PHLA 3M3OA 1M4WA 1RB8G 4RA0A 4P5HA 4WM7C 2FMDA 2V5YA 4O9GA 4S2DA 1VB2A 3B01A 3OTFA 2JICA 2YPJA 5E8AA 3OYWA 1BBT2 5FLIA 1U0AA 4WZCA 2BWCA 4V1PA 4AQSA 4EN6B 4OHXA 5C9AC 3AYCA 5GJ6A 4BYYA 4D3WA 4UW3A 2YXSA 2XH6A 3JD72 3PLQA 1N1VA 4FT8A 1E57A 1ENSA 5DUVA 3ROUA 3SHRA 4GMP0 3VL9A 1TMF1 2GNBA 4CZSA 1WUVA 4MGYE 1MZFA 1AYM3 1UU6A 4Q0SA 3AFGA 1LEDA 3ZYGA 2JG9A 1LENA 1R093 5EV7A 2BEOA 4CDQB 1K5MA 4CEYA 1C8NA 2HWE1 2E9QA 2FHRA 3K48A 1R1A2 3AKSA 3VKOA 3MW3A 4RSUA 3IWZA 4LO8A 4CEWC 1R081 2X53S 1RUI3 1RUH1 2ARBA 2JKBA 3ZFGA 2RJLA 4H7LA 2FZ2A 3VBFA 2CV6A 3J26N 4RHV1 3FUOA 5FAXA 4FPJA 4N43C 1B35C 3WW4A 2KXLA 1ZBE1 4TYSA 4QPIC 5C4WB 1FAYA 4QPGC 4RGAA 3M3CA 5DUWA 5J36A 1AL0G 3D4KA 1SCRA 1MQTB 2JD4A 2HYKA 2DVDA 4XXAA 5CFCC 1WCDJ 1OPOA 2YDEA 4BHPA 1QY4A 1MS0A 1ONAA 2Q1ZB 1C57A 2EXIA 3QOPA 4QPGA 3SH3A 1JW6A 3CL1A 3LWCA 1IS6A 1ZREA 4E4DX 1CGPA 1AXKA 1VR3A 5CFCA 1OA2A 4FPGA 1J3PA 1XQNA 1PVC2 3AZWA 1FXZA 4LBKA 3A0KA 4NVPA 1JHNA 4Q4Y2 4FAHA 3CF6E 2DCJA 2WZR1 3ZX7A 5C8WA 2LTNA 5B2GB 2P3JA 2A6VA 3IMNA 5FCCA 4YFZA 4A7YA 2VVDA 5IK5A 2EA7A 3PVEA 1EP0A 1QJU2 2JG8C 1OD5A 1VAKA 1F5FA 1W6MA 1S0CA 2D5HA 3H3ZA 3U10A 3T2TA 3ZFEC 3OD0A 1Q8PA 1MS9A 4WBBA 4BMBA 1ZA4A 2RM23 5EJ3A 2VU9A 1V6NA 1T6GC 1UKGA 3TWIA 3KLSA 3N7KA 4FPOB 1UN1A 3M2MA 4XF1A 4S2HA 4OZXA 2RS33 3SITA 1PO21 3HMYA 3ILNA 1QDOA 2EIGA 3PJYA 4CDXA 4R8HA 4P14A 1ZZ8A 4LA2A 3O14A 2XJRA 1PO11 1PMIA 3JB4C 1TMF2 4MX3A 5F6LB 2HWD1 2B8MA 4AI2A 4COUA 2DCZA 4R9CA 3ZSLA 2ET1A 3RI9A 3TRSB 3VHOA 1NA1A 3A0NA 2ILMA 2LUWA 2HWE2 1RUE1 3FJSA 4FBFA 3I8TA 3ZYPA 1RUD3 1PK6C 4YZ5A 5BUVA 1HQLA 1RUH2 3IPVA 5A32B 4XJUA 4PIZA 1JYIA 2ZHLA 5IUQA 3VDDB 3V0AB 5T5LA 4CDUC 1W39A 4Y4YA 1D2SA 2DUOA 4WVWA 2C9AA 2JXAA 2P17A 4LLOA 2RS11 4B4QA 3B3QE 4YZ4A 4JGYC 3B02A 5BV6A 1V70A 2HJIA 3VZLA 1AL23 2UYBA 3UJOA 4O9EA 2GAUA 1QGLA 2CGNA 2AZ5A 4COWA 2A3XA 2WFF3 4Q4W1 2R30A 1DHKB 2NQYA 4XXPA 5CFDB 2ZKNA 4DPNA 1MACA 2YUEA 3B7MA 4K20A 4GB32 4A3XA 5BNNB 1DFQA 1V6MA 2C5DA 1CAWA 2H0VA 4J6GA 3LSDA 1BVP1 2GH2A 2HEWF 2HWB3 3HD8B 2KA3A 3WLUA 2WZR2 4Q26A 4YM2A 3HIFA 3LA2A 5ACA1 1QF3A 3DPRA 4AE2A 3BTAA 5BNPB 1UL9A 4IEPA 1PVXA 1VBC3 3QD6A 1KXGA 1LCLA 4OHYA 3ZN4A 1UKRA 4KWJA 3ZXKA 2ZGLA 3ZMOA 3LOBA 3KGLA 2R041 4JCKA 3NKGA 3WCSA 2OUJA 2ET7A 1S55A 1VAMA 5FPZA 3U4XA 3UV9A 1AR82 1PGSA 1YXWA 3FBYA 4Q0UA 2NZ9A 3TBDA 2ZS6B 4MGZE 1EYBA 4RR3B 3AP7A 4Y5Z0 2R071 5SV8A 3M3QA 2P2KA 1YO8A 3FMGA 1H2LA 1CAUB 2VUJA 1UD1A 4HKLA 5FOJB 1JUIA 4Q1PA 5T55A 1XNKA 1DU3D 4ZU5A 2WNVC 1F31A 3I54A 4X8NA 2HWD2 3VUOA 3DV8A 3VKMA 1TNFA 1CN1A 4JQRA 4PJYA 2ZGTA 2MEV3 4LBJA 1YIFA 5GM0A 1A3KA 2W68A 2XBO3 1S0DA 3GZUC 1CONA 3VBHC 1DQ1A 1WBFA 2B45X 5LEKA 1HLCA 5BNOA 3ZIWA 5L36A 3ENRA 4PIYA 5EYYA 3T1MA 4AI3A 1O5LA 4D7TA 3AFKA 1AYM1 3GF6A 4HVRA 4TZDA 4XQWA 4CRQA 3VZMA 1VRH2 1R091 2X29A 3E6CC 3FE5A 3J8F3 1JH5A 4HLTA 4NWWA 4OI1A 4COYA 2RS12 2B9UA 3OD4A 1ND3A 2OZ6A 1RUI1 3C2UA 1UMZA 3RJ2X 4N53B 2E51A 4HK9A 3RYRA 3ZN6A 1LHWA 3HQXA 3KCCA 3RMYA 5LK5A 2GZWA 1COV1 1AR93 1MZEA 2Q5TA 1HW5A 2XPJA 1G8WA 4Q4W2 4F7ZA 1VBA3 1OLQA 4KQ7A 4YGEA 1S2KA 4Z2WA 2HEVF 2WT1A 4HKWA 4JAAA 4SLIA 1U12A 4CDWB 4E2GA 1GZWA 4JGZB 5D8AB 4IEQA 1NCQA 3AP6A 2QDNA 2RR13 2CAVA 2CY6A 5F6KA 2DCKA 5A33A 2R49A 4BA6A 4EN9B 4YGDA 3MDPA 4IXLA 4EWDA 4LEJA 4XFGA 2YC0A 1S0GA 2BGCA 5ACA2 2VW1A 2X5IA 1GYKA 3MLLA 1MS1A 2ZGSA 1N1YA 3ZMNA 2WT0A 1N3QA 4WM8B 5GZEA 4RGGA 4RS5C 5I8YA 3MIHA 3S0MA 1BVVA 4GH4A 3RWNA 1F9KA 3QCWA 2R042 1G7YA 1YI7A 1TQ5A 1MS4A 1EPZA 2WT2A 1LGNA 4MUVA 4WM7B 5C33A 2Z69A 4FPCA 4OI2A 4I09A 2R072 2JE9A 4JTNA 4AVBA 4NN0A 4W6WA 1D2QA 1REDA 1H2MA 1FT9A 2A6XA 2H6CA 1SBDA 5C9AB 1UF2C 2RM21 4QU2A 4R52A 1DYPA 4K9SA 3VBUC 3WNXA 1YFWA 1QJX3 4Y1ZA 1DDLA 2VW2A 4X8PA 5DDJ3 2F6BA 1YHFA 2QCSB 1K5MB 4CEYB 4AEDA 2RS31 3KGZA 1KJLA 3HT2A 5GLVA 3W9AA 3VBSC 2YZ4A 5C8CA 5A3LA 3LA3A 3M3EA 4XJZA 2GMMA 1FPN2 1POV3 3HN1A 3TOJA 2R6QA 4CP1A 3H9AA 2ZZJA 3VBFB 1SLIA 3IN9A 3MGUA 2ENRA 3D0JA 1F5JA 4R9AA 3H50A 4S2GA 4C0HA 3BOWA 2WA3A 1R092 2QZ3A 1AR61 1H1IA 2IZWA 4Y24A 4QD2A 4CEWB 1KFUL 4YZ2A 4QQLA 4I0WB 1PIV1 4Z82A 5J3UA 2ZPXA 3EXUA 1G9BA 2DU0A 2EXHA 1VIWB 1O5UA 2PLV3 1X33A 1RUD1 3LGRA 1APNA 4N43B 1RUI2 1XYOA 4AYUA 4IL7A 2VMGA 3DGTA 1Q56A 4UW4A 4CTEA 2W39A 4HSJA 4Q0VA 3AJYA 4HVQA 2QDRA 1RUF3 1COV2 4QPGB 5BNNC 4FO9A 3WZ1A 3FHIB 4HPKA 1RUG2 5K7PA 4KNCA 1S0BA 3ES4A 2H6BA 5CFCB 3NAPC 5GZFA 4CP0A 2Y38A 5T5OA 3EO6A 5EZWA 1AL21 3NL1A 3RNSA 3SCHA 5IK4A 3JBG3 3TAYA 2OPKA 3OCPA 1RITA 1X50A 1XNBA 2D7FA 2XJQA 3AYEA 5KHKA 1FOD3 4AG4A 2XUMA 1V9U1 2K2SA 2WFF1 1YUDA 3HT1A 2ZA9A 5EYXA 3WP3A 3ZYJB 5HI0A 4XIOA 2VVEA 4EN8B 1QNYA 1WW4A 1W6OA 2XJVA 3ZDSA 4OUSA 5F1RA 1W6MB 1ENQA 1VBD2 4QQHA 3SH4A 3L2HA 4QGMA 2XJSA 1ZZ7A 2DVAA 4XDQA 5JOWA 1GZ9A 2XG3A 1LULA 1N1TA 3W58A 2YV8A 4EN7B 3G7DA 2HWB1 3V0BA 4RR3C 1FV3A 1V6IA 1I9RA 3N7MA 1H4GA 4KH9A 3CU7A 2JG8B 4YM0A 2O1QA 2D6NA 1H9WA 4H55A 3ZSMA 4RQPA 5DUUA 1PM7A 4AI8A 5K0UA 3ZFEB 4DY3A 2AUYA 4AHXA 2E7AA 1WD4A 1VBC1 3KD4A 2RS53 4HBNA 1ZRDA 1LOGA 5CNAA 4E9KA 1G9CA 2IXKA 3JQXA 2B7YA 4AFAA 4GWMA 2PHUA 2XJUA 4BH9A 2BFUL 4HANA 5KXCA 1IGOA 2H0BA 4YVWA 4L8QA 2PHFA 4YSFA 1FX5A 2D6KA 3BCWA 3WUDA 1C8M3 1UAIA 2ZBJA 1DG6A 1IHMA 3VBRC 2ZACA 3NJZA 4ATFA 1TEIA 4HMZA 4MH0E 1NE4A 1RTVA 5H9RA 5JDBA 4XFAA 4Y1YA 5AFBA 2CGOA 2QVSB 1YI9A 1DLLA 2D97A 4PCRA 5KXBA 2MEV1 1GKBA 2D6PA 3SMHA 1B09A 1CJPA 2JX9A 1TME3 4ES8A 1AR62 1PK6B 5EFUA 1PIV2 4XEZA 5I0SA 3LB9A 4IV1C 1WA4A 1WMDA 2MPFA 4PDWA 1WLCA 1RUD2 1YWKA 2ZGKA 3KT1A 4CDUB 3H0OA 4CP2A 5K8SA 4YW1A 1RMU3 2YY1A 2XKOA 4DY5A 3J8F1 3N4MA 4JGYB 2ZJCA 1MEC3 1CAVA 3OPZA 2UY9A 2OZJA 1CJDA 5FFOC 4Y22A 3ILRA 1AXYA 1REEA 4FQ4A 1UCXA 3E6BA 2ATFA 2Y0IA 3VZOA 1QOTA 1AL22 1WLDA 3AKPA 5AC92 1AR72 1AR91 3KSCA 5FQ0B 1ZBA3 3N36A 3GNEA 4LLFA 2Z79A 4YVSA 1OA4A 1V9U2 2WFF2 2SLIA 3BIWE 5GLUA 1VBA1 5I93A 2PA7A 1MVQA 1GSLA 1G6NA 2ZABA 2WQ4A 4GA9A 3IDEA 3RQ0A 1IS5A 3ZXFA 3KM5A 4M0HA 3O0WA 4F83A 4FP3A 2VOWA 1QJY2 1LOEA 1AJKA 2RR11 1XYPA 3AYDA 5ABJA 3WP5A 1J1LA 3M8LA 5FOBB 2HWB2 4AVVA 4QQ2A 3VN4A 1H2KA 3I7DA 4FAGA 1Q8QA 4LBLA 1LR5A 4QMAA 1DGRA 1C1LA 2VNGA 2ZGQA 1C5HA 2AGSA 4M3CB 5KXEA 3M7AA 2VOKA 2JG9C 3AP9A 1M06G 2PAKA 1S2BA 1VBC2 1K5MC 1SQ4A 4LTAA 2EXJA 4CEYC 4ES9A 3H3UA 1LJ7A 3FC0A 5KC6A 1I5ZA 2GMEA 1GZCA 4X6RB 4KU7A 4GXLA 4XIKA 4OVEA 3M1HA 3ZFGC 2Z2SB 1SFNA 1LOFA 1OQ1A 2PHTA 2PHDA 2GSYA 3VBFC 1BK1A 3PVBB 2DVFA 2WLPA 2EAAA 3ZYIB 1PZ8A 4FPEA 2WNVB 2OIIA 4XFHA 4DINB 4YYOA 5L7OA 3CJXA 3JCIA 3TNPB 2R0HA 3WHUA 2YMZA 1FMD3 1QJX1 3P3NA 1IOAA 4YRDA 5SV5A 1LB2A 3ZN5A 3MF6A 1FNYA 2DWRA 5DDJ1 2QZ2A 3VBHB 4J1XA 2MEV2 1W6QB 2R1BA 4L9BA 3PMSA 2Q4SA 1RGSA 4N9HA 1ND3B 2K0GA 3ZSJA 2NN8A 3AKTA 1POV1 4LR4A 4RD7A 4AVTA 1X82A 4B4RA 1D0HA 4QQPA 1VP6A 2N7GA 3GZTB 5IK7A 1N1SA 1BEV3 2OVUA 3WDWA 3MIBA 1W6PA 5JR7B 5JIUA 2ZGRA 3D82A 1RVF3 5LRSA 4LBNA 3V64A 5GALA 3SNMA 1A78A 2PLV1 2GH8A 4DB5A 1CAXA 3ZXLA 1Z0HA 2DF7A 1SLCA 4EJRA 3WG1A 2ZGMA 4AVSA 5T54A 5A33B 3M70A 3JU9A 4IV3A 1H2NA 1WGPA 3KZ4C 1RUF1 5BNQA 1AR92 2E53A 1GICA 2ZMNA 3IKWA 4JDOA 4K3UA 4MVTA 4Y20A 2QE3A 2V09A 2ZAAA 4SBVA 4E4ZA 1HRV3 5K9YA 3FX3A 2PYTA 1CESA 2EF6A 2YYOA 2BNMA 1Y9QA 1V6KA 2XVLA 4P9IA 2ZOEB 3EQEA 3AP4A 3CNAA 3FFZA 3FBMA 3JBG1 4GH4B 2RR12 1DYKA 1BXHA 1FOD1 2QNKA 1DF0A 1FYUA 1A8MA 1QH7A 4JC1A 4CDXC 1OHFA 3N35A 4WVVA 1CIWA 3OY8A 4RS5B 1AYN3 5JOZA 3ZSKA 2O8OA 4QHBA 3WQ7A 3RS6A 1OQDA 4J1WA 3NV2A 1NA1C 1Q8VA 2VECA 3B00A 5J7MA 2Z5WA 3POWA 3LKJA 5KHHA 3MI8A 1PGL1 5LEJA 4W6YA 5JLVA 3CJIA 1RHI3 4AHWA 4FXGB 3S30A 5C8CB 5J96B 2JJ6A 3VBUB 3WG2A 2XLGA 1SACA 1XNCA 4GMP3 2RS51 3O5SA 1ZRFA 2BUKA 2YGMA 3VKLA 3L9JT 3WDYA 3NKTA 1QJZA 1AVBA 1R082 2XWBB 3TYJA 3VBSB 4OI0A 2FBEA 1C8M1 4LO6B 5DDJ2 4Z8BA 1UIKA 4RHV2 1YCIA 5GLZA 1W6NB 5JIAA 2DV9A 2UWCA 5JSRA 1ZBE2 5AVPA 3POSA 3Q9OA 4K21A 3BPZA 2ZHNA 2RE9A 3MIGA 1HDKA 4QQOA 1IZ3A 3A4UA 4FPFA 4YW3A 4HSLA 2XVKA 4AI1A 2WZPP 4KWKA 4Q8KA 2R32A 4MGIE 3ZIXA 4HPKB 4LULA 3QBQA 1TME1 3ST7A 1J3RA 2VULA 3NSTA 3ZFFA 4FOYA 4XF3A 1SFYA 2DVGA 3ZXJA 2HWF3 1XE8A 2PLV2 4KBBA 2PFWA 3IM0A 3DPRC 3RDIA 3VHPA 1ZZ9A 4ZXKA 1Q3EA 5JSPA 1RMU1 1LU2A 2R063 3RSJA 4C1WA 2IWGB 2WLQA 4FCAA 2ZX0A 3QACA 3E6DA 1FV2A 3VV1A 3E5XA 1MEC1 3NAPB 1SEFA 3MYXA 4Y1VA 3V56A 4PBPA 4N7UA 3G6JB 4ITCA 1LGBA 3RZZA 3H1WA 1DIWA 4ONUA 2WNUA 3ILFA 3FWEA 2O8QA 5JOXA 5FREA 3JB8A 2VH9A 1H1AA 1SDWA 1C1FA 3D6EA 4F3JA 4OHWA 4BCUA 4KG0A 1ZBA1 4KGQA 1C28A 4YFWA 5F9TA 3R4SA 1FOD2 3E97A 5D1IA 4R4ZA 4BE3A 1NCRA 3MW2A 3NWKA 4RQPB 2FZ1A 3LZZA 3E5QA 1HV1A 2NYYA 1O3SA 1BCXA 5K0UB 4UW6A 1EPWA 1J1TA 2UWBA 2TUNA 1H8TA 3D0SA 2VOXA 3MLKA 1Y43B 4BM8A 4JRLA 4XJAA 4OHZA 4D7SA 3WP6A 1HKDA 4TWTA 2DYCA 3K51A 4G3YC 1PO22 1S0IA 4EWEA 3H7YA 4ZU7A 5HBAA 1VBB3 1GNHA 5BNOC 2A5ZA 4NPRA 2D3PA 2WKKA 1PO12 3MF9A 2BPA2 5CADA 3ASIA 2EVXA 1WLTA 1PGW1 1VAVA 2PAEA 1OFSA 3AX4A 4GKYA 3KQRA 2G4IA 5FMOS 1R1A3 1RUE2 2UURA 2WC2A 3KCYA 3R4DB 4PLNA 5E89A 5GLWA 1IQAA 2YGLA 4AW7A 4XE9A 1RUC3 3VBRB 5FDBA 3B69A 3LSEA 2OA2A 1ND3C 1POV0 1UW8A 4IETA 2IXLA 3USUB 1D4M3 4OLLA 3AYAA 5JVVA 3QLQA 1O7FA 3HAGA 1JYCA 2VOVA 3N3HA 2PHWA 4CDQA 4AFDA 2G9FA 1D4VB 1YFXA 4M00A 1Y3TA 1FMD1 4AQ2A 4MV2A 1WCSA 3ES1A 4Y1UA 3AMPA 3I2DA 1NCQC 2IFWA 2ZKLA 1KD7A 1CAVB 4IV1B 5IK8A 4LA3A 4NWVA 1TME2 4Y22B 1HV0A 1LOBA 3UKNA 3VZKA 4BIOA 2C1FA 4DRRA 3RMXA 2ZCWA 1ZZ6A 4E2SA 4YW2A 4ASMB 5KC5A 3WD5A 1VALA 1ND2A 1SCSA 2Z42A 3AJZA 5HCBA 3PVNA 5C4WA 2X5IC 1ENXA 4YGBA 3DKWA 3AMMA 3NVCA 1BEV1 1RMU2 4I0BA 1KITA 1UU5A 3GYDA 3I59B 3WR0A 1MQTA 1RVF1 5DZEA 1OA3A 1U5YA 4GH4C 4G4FA 3UK9A 3R6SA 4Y26A 3VHNA 4Y1XA 3SXWA 2X8KA 5FMOL 2I2SA 1N3OA 2XWJB 4OFGA 3FZ3A 1ALYA 2UU8A 1OMIA 3C3VA 3J9SA 4N9IA 1AF9A 2NPIA 3O7OA 3OYWB 2CYFA 1UZZA 2ZTNA 4M01A 4XFCA 4AF9A 1ZBA2 5GZCA 5F5QA 2VQ0A 4B3NA 1HRV1 3OBTA 2YHJA 3E5UA 2G9GA 5H9PA 5AVAA 1Z78A 4YZ1A 1KRIA 2YROA 1CPMA 1ZRCA 1SBFA 5L73A 5CG9A 3GBWA 1QWRA 1G9AA 3RRDA 4AEDC 1YJLA 3M3IA 5C8CC 1DGLA 3VBOC 3APBA 5CAZA 3TN93 1WMEA 1AJOA 2D6OX 2QKDA 4HN1A 4QPY<