5L7OC

X-ray structure of triatoma virus empty capsid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
276
structure length
276
Chain Sequence
SKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTERP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
molecule keywords Capsid protein
total genus 43
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oC00
3VBFB 5BNNC 5J96B 1PIV1 1PIV3 1B35C 1SMVA 5BNNA 1AYM2 3VBRB 2TBVA 1FOD1 1FOD3 1PGW2 4JGZC 1NCQC 4AEDC 2RMU2 4CEWC 1RUH2 2BFUS 1NCQA 3DPRA 2R042 3CJIC 4N53B 2X5IC 5A32B 4RS5A 1R081 1R083 2HWE2 4RS5C 3S6PA 5K0UC 5ABJC 1ND2B 1R1A3 1R1A1 2ZTNA 4EJRA 1RB8G 5DDJ2 3ZFFC 1RVF2 2XBO1 2XBO3 4Q4X2 5AC92 3NAPA 3JBG2 4WM7C 4WM8B 1H8TA 1BEV3 1BEV1 3VBUB 3TN92 1NA1B 5C8CA 3VBFC 1RUG2 2XBO2 5C8CC 4N43B 1TME3 1TME1 3VDDA 1OPOA 1AL22 1AUYA 1VBA3 1VBB2 1VBA1 1IHMA 4JGZB 4PDWC 2ZZQA 4AEDB 4GMP0 5CFDB 4PDWA 1C8M3 1C8M1 4QPIB 2GSYA 1MQTA 1PGL1 1OOPB 1Z7S2 4Q4W3 4Q4W1 5ABJB 2PLV2 1ASJ3 1ASJ1 4GH4C 4Q4X3 3DPRC 4Q4X1 4GH4A 1PO12 4LLFA 1WCDJ 1QQP2 5D8AA 1E57A 5ACA2 5D8AC 4WM8C 4QPGB 1OHFA 4IV3C 4WM8A 1AR71 1AR73 4FTBA 2MEV2 1RHI1 1RHI3 5BNOC 1OOPA 3ZXAC 2R073 2R071 1FPN1 1FPN3 2RS32 5L7OC 3J8F3 3J8F1 4CDWA 2RS12 1K5MA 4CDWC 4Z92B 4PDWB 4CDQC 1AYN3 1AYN1 2PLV3 1FPN2 2PLV1 2RS33 1NG0A 1VB2A 2RS31 3JBG3 3JBG1 1MEC3 1MEC1 3VBFA 1RUF3 1RUF1 1PVC3 1PVC1 2QQPA 4NWWA 1VBD1 1VBD3 1CD3G 4YVSB 4N43A 4CDUA 4CEYA 1FMD2 1VB4A 1ZBE2 4CDUC 3LOBA 1AR82 1RUD3 1RUD1 4IV1A 5CFCC 5BNPC 1HQNA 1R1A2 4RR3A 2HWD2 4RR3B 1AR62 1PO22 1AR72 1RUE2 2WFF2 3HAGA 3IDEA 5ACA1 1QJX2 5ACA3 1MQTC 4CEYB 3VDDB 3VBHA 2RMU3 2RMU1 4QPGC 1CJDA 3TN91 5C4WA 4SBVA 3TN93 1BEV2 4AEDA 4CEWB 4CEWA 4GMP1 1VBE2 4GMP3 1EAH2 4RQPA 4Q4W2 5BNOB 1AYN2 3JB8A 3CJIB 2RS11 2RS13 2X5IB 1MEC2 4IV1B 1POV0 1H8TB 2WZR2 1ND3C 5C9AC 1VBB1 1VBB3 5K0UA 1ND3A 5C9AA 1HXS2 4FTSA 2RS53 2RS51 4QPIA 4Q4Y2 1X36A 2R062 5BNOA 2BPA2 1PO23 1PO21 1AR63 1AR61 4FTEA 1NY72 1GFF2 4YVSC 4JGZA 4YVSA 4CDUB 4Q4Y1 4Q4Y3 1QJU2 4WM7B 5FOJB 2WS92 1NA1A 1RUI2 1PO13 1PO11 1NA1C 1HRV2 1ND2A 2BBVA 1EV12 1PGW1 2X5IA 1W39A 3VBSC 3ZFGC 1ZBA2 4N43C 1MQTB 4CDXA 4CEYC 1AYM3 1AYM1 4FSJA 4JGYC 3VDDC 4CDXC 1PGL2 4NWVA 1RUJ2 1QJU1 1QJU3 1VBC2 2GH8A 1R093 1R091 5CFDC 3ZFFA 4GB31 4GB33 3J8F2 3JB4C 1RHI2 2XPJA 2HWE3 2HWE1 2R061 2FZ1A 2R063 2HWD1 2HWD3 3NAPC 3FBMA 4GB32 1K5MB 1H8TC 3VBHC 2R043 2R041 2RS52 4YVWB 1ND3B 1F2NA 5C9AB 1DDLA 1VBD2 4GH4B 3VBUA 2RM22 3DPRB 1AR83 1AR81 1RUD2 1RUC1 1RUC3 1BMV2 2RR11 2RR13 3CJIA 1ZBA3 1ZBA1 3VBOA 2ZAHA 5D8AB 1EV11 1EV13 3ZFEA 1BMV1 4BCUA 3ZFEC 5AC91 5AC93 2RM23 2RM21 4Q4V1 4Q4V3 2R072 3VBSB 3ZFGB 1QJX3 1QJX1 1B35B 1VRH1 1VRH3 1NOVA 5L7OB 2HWC2 3VBOB 2WLPA 1C8M2 5JZGA 4CDXB 1AL23 1AL21 1VBA2 2HWF1 2HWF3 4CDWB 5A33B 2VQ0A 1QJZA 1NCQB 2IZWA 4CDQA 4Y4YA 2HWC1 2HWC3 3VBSA 3ZFGA 1FMD1 1FMD3 1ZBE1 1ZBE3 3NAPB 3VBRA 1AR92 1C8NA 1Z7S3 1Z7S1 4RS5B 5CFCB 2BFUL 4YVWC 5ABJA 5CFCA 5FMOS 1AL0G 1VAKA 1RUC2 4RR3C 1NCRB 1RMU3 1RMU1 3ZFFB 5L7OA 5DDJ3 5DDJ1 2Y26A 1R082 5A32A 4WM7A 1V9U2 2MEV1 2MEV3 4QPGA 2DF7A 3VBUC 2HWF2 1HX6A 1A6CA 5LK7B 1HXS1 1HXS3 4RQPC 1VBC3 1VBC1 5C8CB 1R092 2WZR1 2WZR3 4RFT0 4IV1C 5J98B 1RUG3 1RUG1 3VBOC 1ASJ2 1PVC2 4Y5Z0 5A33A 4IV3A 4QPIC 1RVF1 1RVF3 3JD71 1TMF2 3JD73 1AR93 1AR91 1F8VA 1B35A 2WS93 2WS91 1RUI3 1OOPC 1RUI1 5JZGC 1M06G 5GKAC 5C4WC 1RUE1 1RUE3 1NCRA 4RHV1 4RHV3 1NCRC 1HRI1 1HRI3 5BNNB 1V9U3 1V9U1 1TME2 3VBRC 1RUJ3 1RUJ1 1QJY2 4JGYB 4JGYA 4YVWA 2HWB3 2HWB1 1FOD2 4IV3B 5CFDA 1COV2 1EAH1 1EAH3 1PIV2 4N53A 1VBE3 1VBE1 4RQPB 4N53C 1HRV1 3JD72 1HRV3 1TMF1 1TMF3 2HWB2 2RR12 2WWSA 1BBT2 1COV3 1COV1 1K5MC 1QJY3 1QJY1 3VBHB 3M8LA 5K0UB 1ND2C 4CDQB 1NY71 2WFF1 2WFF3 1D4M3 1D4M1 1HRI2 1POV1 1POV3 1QQP1 1QQP3 5JZGB 1VRH2 5BNPA 4RHV2 1BBT1 1BBT3 1D4M2 5BNPB 5C4WB 4Q4V2 2BUKA 1RUH1 1RUH3 2FZ2A 1RMU2 3ZFEB 1RUF2 5FMOL 1X33A
chains in the Genus database with same CATH superfamily
3VBFB 3WNLA 3VL9A 5J96B 4BQ4A 4FP3A 1SMVA 5I8SA 1ULPA 4XF0A 2CGNA 3VBRB 1FOD1 4XFFA 4BB3A 5BYNA 2WAOA 1W8OA 5E16A 1T2XA 1TNRA 5FY8A 3K48A 5FZAA 5FQ0B 4D8MA 2OQ7A 4JRLA 1WUVA 4MGZE 4DY3A 4QX7A 4CCMA 1NCQA 2ZGRA 5DABA 2FCUA 1S2EA 4PJYA 1IZ3A 3VZOA 1SZBA 2BVBA 3I3EA 3C7GA 3CU7A 3WW3A 3FFQA 4BE3A 3N7MA 3DL3A 4IXLA 5F3EA 2TUNA 5EZWA 4YPJA 1R081 2YBSA 2D93A 1GMMA 4RS5C 3S6PA 1QXPA 1OUSA 3KHBA 5L73A 1ND2B 3POFA 4BQWA 4BQ2A 4QQLA 5FZ3A 1R1A3 2B9UA 4J1WA 2VUCA 4EJRA 1UN1A 4RSUA 1N3OA 3TWIA 2W1QA 2XBO3 1I1EA 4BHPA 2H0BA 1N1TA 2ZGLA 2P6CA 3AZXA 1UKRA 3O1MA 5AC92 1AHSA 3OEAA 3WNMA 3GZUC 3JBG2 4W65A 1SLBA 2OW4A 4CE8A 4QX1A 4P08A 1NLQA 4XEZA 3VBUB 4XUPA 3RZKA 1NA1B 3I59A 3FLRA 5SV5A 2OA2A 3RWKX 4IL7A 3ME2A 2GC2A 2XBO2 3PIJA 3U14A 3PLQA 2BV4A 1TME1 4YM3A 1IGOA 4NN0A 4XTPA 3ZSKA 1U5YA 5F5CA 2D6MA 2WO1A 2R0HA 1AUYA 1VBB2 4CUCA 5JPNB 3RYRA 3FC0A 2ZX1A 4BQ1A 4AEDB 4GMP0 2XHKA 3HQRA 4YSFA 1UWWA 1W6NB 4PDWA 2D97A 4PF5A 3POBA 3FJSA 2Y8KA 3SEPA 1UW8A 3DCQA 4GJYA 4QPIB 3U07A 1HIXA 3THCA 2GSYA 5ERLA 2ZGKA 4LK6A 1H9WA 5FZOA 3ES1A 4QU2A 2ATFA 1MQTA 2JDPA 3GCXA 1CX1A 1QDCA 3C2UA 2CV6A 1MZEA 3HN1A 3AMMA 3VKLA 2ZMNA 2Y38A 4P9IA 4XIKA 1WCKA 4MUVA 2J1UA 4Q4W1 1ZM1A 5FZIA 4B3NA 1YQCA 2V5YA 1JYNA 1ASJ3 1S0FA 1ONAA 5FY0A 4OI2A 2XOMA 3AP9A 4Q4X1 2J1RA 1F5JA 5T52A 1ZNPA 3WZ1A 3VUOA 2GAUA 4QB2A 3MW4A 2YPJA 3POSA 3ZR5A 2ORZA 4K8RB 4XOGA 4ES9A 3CBNA 4ZZ5A 2K9ZA 1RUOA 4QT6A 4LLFA 1WCDJ 4GXLA 1QQP2 3DYMA 5FO8B 2ETEA 2JB4A 3H1MA 3VN4A 2XGXA 4JDOA 3EHKA 4C91A 4D6RA 5ACA2 5IAXA 3ACIA 4WM8C 1KDKA 4AI2A 1SQ4A 2HLEA 1OHFA 4IV3C 2OZ6A 4RN5A 4XUOA 2Q8OA 2WNVA 2RJ2A 3H3UA 1AR71 5DAPA 3CKHA 3VKMA 4OHZA 4IE5A 3AMPA 4W8JA 4A45A 1QH6A 4YGBA 3T1LA 4LOSA 5LY1A 2OS2A 2XH6A 2D43A 4LBLA 1VPHA 3VHNA 1SEFA 1CZTA 3IAQA 3MIBA 5FMCA 4M4PA 2RS32 4K6BA 1DZQA 1F9KA 1U5XA 2W5FA 5A3WA 2W52A 2DDUA 1BCXA 1GOHA 3OJBA 3BCWA 1MS9A 4A41A 1QNYA 1YQ5A 5BXXA 4BM8A 1UD1A 4DMIA 2IFRA 2YBKA 1W6NA 4PDWB 4Z92B 1LECA 5FRAA 1AYN1 1REDA 3M4FA 1MS8A 3LGRA 1YIPA 2PLV3 2RS31 3H8XA 4OUMA 3TYJA 3JBG3 3ILRA 1RUF3 3VBFA 1EPWA 1PVC1 2BJSA 5IVYA 3WDUA 2QQPA 2BVVA 2ZEXA 4NWWA 3ZYFA 2A1XA 4YVSB 2WSVA 4NRPA 1VB4A 3MIFA 3DYOA 4CU6A 1UU6A 2ZX3A 2OPWA 5FAXA 1RUD1 1BXHA 1ULFA 2PHRA 4A4AA 4XF4A 4RA0A 3RFRA 2XKPA 1W0NA 3LFIA 3USSA 1EP0A 1R1A2 4RR3A 4ATEA 3HEIA 3HT2A 1BLZA 2YV8A 3N9OA 3IIAA 1T6BX 1BZWA 4GAZA 3LQCA 1GZWA 4XFAA 4FI9A 4CYDA 1MQTC 1QOOA 4CEYB 2O8OA 5I91A 1CN1A 2V72A 1F5FA 1G9CA 3LCPA 4SLIA 3A22A 4OVEA 2ZAAA 3I2FA 3KMHA 3POWA 3VBHA 4QPGC 3VHPA 3UGHA 1STMA 3GBFA 4ZS2A 1QXRA 3LPGA 2VUDA 4SBVA 2VOTA 3IM0A 4GMP1 1L3JA 1JOJA 4Q4W2 4MGYE 1AYN2 1KS5A 4LBMA 2XR4A 3ZXDA 4M01A 2VL4A 2X5IB 4YLZA 1ZA7A 3AP4A 1UZVA 5IK4A 1KEXA 1POV0 2HBTA 2XWBB 4HONA 3RS6A 4A3ZA 4M0HA 5HXVA 2WZR2 3FZ3A 1JOBA 4I02A 3J7MA 1IOAA 3NV3A 5ANQA 1VBB1 3KGZA 4W6XA 2VW1A 4RYDA 5K0UA 2XKOA 2B4KA 3GNEA 4FTSA 3E5QA 2RS53 4AFDA 1X36A 2CDPA 2R30A 3NSTA 5DAWA 4KWLA 5GLTA 4Z8BA 3OBTA 4TLGA 3O12A 5E89A 4S2DA 5EV7A 4AEKA 1PO23 4DZGA 1AR61 3IAPA 3P1IA 4LBQA 4YM1A 4E9KA 5IK8A 1NY72 1GFF2 3ZYBA 2JDZA 1ZVFA 1E5HA 3BPZA 3B69A 3E97A 4MLOA 1VJ2A 4CDUB 2D3SA 3MGUA 4OQ8A 4WM7B 4UW4A 1WGPA 3K4DA 5FOJB 1PK6B 2CAVA 3NV1A 1NA1A 1RUI2 4CU7A 3NV2A 3J4UH 3KV6A 4QGNA 1CZSA 4CP0A 1XYNA 4NRQA 5HBAA 2BBVA 2JJ6A 5GZFA 1LU2A 4CU9A 4MSVA 1O3TA 3VBSC 3LEMA 2C4XA 4LO6B 3SITA 4DXTA 2O1QA 3QACA 2ARAA 5JOZA 1JOPA 1MVQA 1UCXA 1AYM3 2JG9A 5FUPA 2LRPA 4FSJA 3VDDC 3MFCA 1Q5OA 4QQ2A 4NWVA 2VE1A 3WF3A 1QHDA 5I8TA 2FDGA 1RUJ2 1QJU1 3D0SA 4ISRA 5CFDC 4KWJA 1X50A 4GB31 1LHVA 1YC61 4ZZ8A 2VMDA 3ZSEA 4OQ9A 2LS6A 1O8PA 3CQOA 3FLPA 3EQEA 4TSVA 2XPJA 3WP6A 2VZOA 2HWE3 2XDVA 1KS4A 3DYPA 5T5PA 3ZYIB 1JZ2A 2R061 2FZ1A 5APAA 3ZIXA 3N4MA 2VGDA 1CJPA 3NV4A 1UIJA 4KU7A 2W87A 3FBMA 3LF7A 4OUEA 2GZWA 1KFXL 2BGPA 1H8TC 5F32A 1AXKA 5FBJA 5A3TA 4GKXA 2YFUA 2P37A 1LODA 4ORFA 2W95A 2WSUA 4I0WB 4QKBA 1HB2A 3APBA 5IK5A 1AR83 3AVSA 1RUC1 1I3HA 1BMV2 2NYYA 3NNFA 4J1XA 3ZLIA 3VD9A 3ES4A 4LNVA 4A6SA 1PX4A 1W6OB 5HCHA 1RL3A 3MI8A 1UQXA 1ZBA3 3QLQA 1K5JA 3I2GA 4FCAA 1IS5A 3PUSA 1R64A 3D8CA 5IWFA 4LR4A 2VTXA 3SHRA 1JZ6A 2GN3A 1S4CA 1EV13 1UYXA 1WLTA 2JD4A 1XPWA 2JG8A 2GP5A 2UYAA 2E7AA 4YM0A 1BQPA 1GICA 2FQPA 3GF6A 4QKNA 4BQYA 5AC91 4AVBA 3GZEA 3S5QA 1W05A 3U78A 2RM21 2WT0A 4HG6B 1UZWA 2VM9A 1H1AA 4ARXA 2Y6JA 3B7MA 4MX3A 3OB8A 1QJX3 2J1VA 1B35B 1VRH3 5FPUA 1C3HA 2ADEA 2A73B 2PHUA 2JEMA 1JHJA 1C8M2 1E5RA 1E5IA 1OD5A 4IEXA 1AL23 3VDAA 4CDXB 4CUGA 3MIHA 4QXKA 2HBUA 2NMNA 2XL7A 3EO6A 5LBCA 1QJZA 3V64A 3UETA 5AVAA 1HKDA 3WCSA 3TBDA 1ENRA 1UY3A 1WCUA 4A7ZA 4AAPA 3ZFGA 3SXWA 1UX6A 2AR6A 4LKDA 3PVNA 3A7QA 5KHHA 3VKOA 3S5AA 1ZBE1 4MGIE 4XUNA 4Z82A 1AR92 4Q8LA 3IKWA 4JX0A 1D0HA 3VD3A 1BHGA 2VD7A 2BFUL 4YVWC 4CSWA 1GV9A 5ABJA 2VULA 5CFCA 4EQVA 4K7JA 1AL0G 2YZ4A 2DFBA 1U12A 1NCRB 1RMU1 2XVGA 5C71A 3WG4A 2J7MA 3LEKA 4LUMA 5IAVA 2AEYA 1WLCA 4I30A 3THDA 4P9YA 2BRTA 3CDZB 3FX3A 1VMHA 1H2NA 3E6BA 4H7MA 4HPKB 4LBKA 4LULA 4IGPA 5A32A 4WM7A 2MEV1 2BDRA 1X8MA 1D2QA 2OKXA 1V6NA 1GU3A 4YRDA 3WNKA 3B9CA 2WQ8A 2EXJA 3M3QA 1K3IA 1A6CA 5LK7B 1JZ8A 1S55A 4GKYA 3HOBA 4JTNA 2A6ZA 1NLRA 3OBZA 4XDPA 5JVVA 4Z2AA 4RQPC 3U37A 4QB6A 1EYBA 3OY8A 2O14A 5GZDA 2ES3A 1VBC1 5C8CB 4AHYA 2I74A 1X9TA 2WZR3 2ZGNA 3Q8EA 2ZPXA 3WNOA 1RUG3 1US3A 1W8WA 4PLOA 3ZN5A 1G9BA 3AP7A 5LB6A 1ZRCA 3VB9A 4ASKA 2R1DA 4UI9L 3FHAA 4Q5OA 2HEWF 2X09A 3CZJA 4TLFA 4XXPA 4Y5Z0 3X29B 4B4QA 2N7GA 4QXHA 5K8SA 3ZKUA 4COVA 4NROA 2V73A 4ASLA 2EAAA 5A7OA 4XHBA 5FXZA 1AR93 4A3XA 2WQ4A 4UAPA 3E6CC 4YW2A 1OH3A 2WS93 5FZ8A 4E4HA 1RUI3 1OOPC 2OIIA 1HJGA 4FPGA 3B9IA 4YW1A 4KGGA 5A1LA 1UOGA 3USUB 3BALA 2B46X 3PL0A 5GKAC 5FP3A 3FE5A 5FJHA 4Q0PA 4AQ2A 1LHOA 1WLDA 3C7OA 4RHV3 2G9ZA 1N3QA 5EYXA 1OPMA 1U0AA 4S2GA 2JE8A 2WWJA 3WDVA 4Y1YA 1DP0A 5E6HA 4COYA 3MICA 4JV4A 3NJVA 3JXSA 4UFKA 4CP1A 1AX0A 1GR3A 1LU1A 1RUJ1 3RWNA 4LO8A 1KQRA 2J22A 2P3KA 2A75A 4NUBA 2D40A 4MZUA 4JAAA 4Y5TA 4D7YA 1JZ5A 2Y6LA 1FOD2 2J1TA 3OPZA 1OA3A 1H8VA 3K46A 3FFZA 3KT7A 3UT0A 1COV2 4YW4A 2A70A 2DVFA 1EAH1 1SDDB 1VBE1 2D3RA 2VCMA 4Y20A 5EXOA 5J1XA 2BWCA 5JI7A 4LKFA 4DS0A 3ITQA 2VOWA 4XBQA 4AYUA 2RJLA 4GA9A 4ZHNA 4QX3A 1K5MC 1COV3 4QX0A 3V56A 1AXZA 4FPFA 4XFHA 1XNAA 4JKKA 3HWJA 5GJ6A 3WV6A 4B1LA 2ZMKA 3HPNA 3IN9A 4IETA 2P3JA 3ZPOA 4AVTA 4CDQB 4AGGA 1J3RA 3ATGA 4EN6B 3THTA 1DYOA 2ENRA 3SNMA 4BXFA 1D4M1 1EY2A 2PHFA 3IB3A 4L97A 5F3GA 4LORA 1C57A 4XQ4A 3F95A 4YM2A 4WVMB 4YWAA 5GALA 3WP4A 1YQ8A 4D7SA 1RUNA 1ZZ6A 1POV3 4N90A 4ASMB 1QGLA 1QQP1 2VTFA 4URTA 3FBYA 4XUQA 4YZ2A 1MS0A 2BGOA 2Q30A 4JDMA 5A3PA 4RHV2 3ZO0B 5BNPA 2FDIA 3GGLA 4NOTA 1UAIA 2AEZA 4XBNA 2JECA 5FQ0A 1RUH1 4V2VA 1WBFA 1K12A 3ZFEB 5FMOL 4KWKA 1YFUA 4R9AA 4YFZA 2VZ3A 4CRQA 5FMDA 2DU1A 4PIYA 1PIV3 1XB9A 2BEOA 4XBLA 2YC4A 3BIEA 1UOFA 1IKQA 3U11A 4CCDA 4O7XA 3D4KA 3HMYA 4LO5B 3I3MA 3AJZA 1PGW2 5FYVA 5CG8A 2UY9A 3BKZA 1DZRA 3NL1A 4Q0UA 4CP9B 2EXIA 2B7YA 3G7DA 4XVHA 4AEDC 3SCHA 3EJKA 4CEWC 1Q43A 2BFUS 1F15A 3RYKA 2VXJA 5DZGA 1YJKA 1IG3A 3BN6A 4NHYA 2C9AA 3KCXA 1C28A 4HSJA 3RSJA 2R042 4N53B 4UBGA 4C90A 2OYZA 1UNBA 2V5DA 1ZZ7A 1N1VA 5A32B 3RZHA 2P4EA 3NQHA 4XZPA 2DBNA 1MPXA 1TE1B 2CL2A 2Z4FA 4HK9A 4HBNA 3I2KA 1S0IA 2GNBA 4GD4A 5FLJA 4D94A 3A23A 2WUHA 4GWJA 4AI1A 3BU0A 4LLOA 1H2KA 3WY6A 3ZM8A 1FV3A 1AF9A 2PQSA 1CAXB 1GLHA 3DV8A 3O1PA 3JCIA 4AZZA 1WW5A 4C0HA 3S7EA 2C26A 4QB1A 5A3OA 4IESA 2YMZA 3AL5A 3MPBA 5FY7A 3BTYA 2E33A 2ZX4A 4FOVA 1JU3A 3OD4A 1H8TA 1WMEA 1BEV3 1UX7A 2VCAA 1KJLA 3T3YA 1F4AA 1D2SA 1YRZA 1OH4A 2BNMA 2W92A 3I59B 3AXDA 4FP2A 4R4ZA 2TEPA 3VBFC 1W04A 1SPPA 4F83A 1SLTA 1RUG2 2VR4A 1NQJA 1WKYA 4XF3A 5CIRA 5I0TA 5F2WA 2VNRA 2YPDA 4XJAA 5A7WB 5C8CC 1L7QA 2VMCA 3B02A 4BIFA 2LUWA 4ATFA 1CONA 4YGEA 5C33A 1NLSA 1VBA3 3SMHA 4LE4A 1OUXA 4PDWC 1OF3A 2JB8A 2ZZQA 1DQ4A 3M7AA 1DHKB 4XF1A 2X05A 4OFGA 5JUVA 1C8M3 3WDTA 5LK5A 1RXGA 4YGCA 5HV4A 4DUWA 3I49A 3BU7A 4PIZA 4LUKA 1LOFA 5DAXA 3OPWA 1PGL1 4O9EA 1ZZCA 1GNZA 2DUOA 2VG9A 4QM8A 3T0BA 1UPIA 3WF1A 3FL7A 1E5SA 4DO0A 2WIIB 1MR5A 1Z7S2 2VZVA 3KQ4B 4U2AA 5HXMA 5LBBA 2BNNA 2KM2A 3LEIA 4OULA 5C70A 1WMDA 2DVDA 1VP6A 1GQGA 2Z79A 5JDBA 1V6MA 2WNEA 1H0BA 3DPRC 2OPKA 3IBMA 3MEPA 3PTYA 4GQ7A 3T2QA 4JC1A 1H4HA 2W39A 5J37A 3OY8B 4IGOA 2ZACA 4CCEA 3ZIWA 5ANNA 4BA6A 2GALA 2FMYA 1G7YA 2IWGB 4XFBA 5FZLA 5IFPA 5FZ6A 3QH7A 2WNVC 2YU1A 5D8AC 3FUOA 1CAWB 4KGQA 1SDWA 2BOJA 3PHMA 4Y20B 4FTBA 2IXKA 2I07B 3AVRA 5IK7A 2BYVE 4JVAA 5SV8A 2MEV2 4DPNA 3PUAA 4KG0A 1RHI3 4XURA 5BNOC 4KMQA 1C1FA 1OOPA 1W8ZA 2GC0A 4IEUA 2E32A 1TVGA 2R073 3VV1A 1FPN1 2D3PA 3K4ZA 4JCKA 4FQ4A 5I0DA 3J8F1 4TTGA 4BPZA 1V6KA 1W9FA 5I0RA 5LRSA 3K75B 5G05L 1CAWA 3CZUA 2QQIA 4CDWC 4B29A 2FHRA 4O61A 4CDQC 3LSDA 2QNKA 5FLHA 4LIUA 4DUVA 4BZ4A 3P5BA 1NG0A 1VB2A 5D1IA 1MEC1 2JE7A 4HK8A 2NQYA 2VQAA 4OZXA 4QU1A 2Q8DA 2PYTA 1VBD3 2VUJA 2AENA 3MF6A 4DEQA 3WINE 4YFWA 4N43A 4CDUA 3N9NA 4RGKA 3ZYHA 4NPLA 3MFAA 1DBNA 1SLIA 1UOBA 1S0BA 3RNSA 4YG6A 1AR82 3L2YA 3L9JT 1UY1A 2W46A 5CAZA 2XL9A 1PK6C 4Y5SA 1HQNA 1AXYA 1ODMA 1XNCA 4M4RA 3WF0A 2JENA 4R4XA 1Q8SA 2XJTA 1AR62 4BQXA 3VZMA 1CX4A 3OF1A 2EXHA 4IE6A 1AR72 4M3CF 4AVSA 4LA2A 3OTFA 1Q8VA 2PHTA 2WFF2 4E4ZA 5ACA1 1OA2A 4AEMA 1GWKA 4FXKB 3VDDB 1WA4A 2ZGTA 2RMU1 4Y24A 1ZX5A 2LM3A 3KCCA 4MADA 1CJDA 3TN93 4XABA 1LR5A 1M4WA 1I5ZA 1VBE2 2I45A 3S0MA 1EAH2 3GJBA 5C3PA 3CJIB 3UV9A 4DXRA 2RS11 2CDOA 1FT9A 3CO2A 3IPVA 3AYCA 1HW5A 2C24A 1LRHA 3T08A 1IPSA 3DGTA 1H8TB 3RZZA 5IT6A 2DWRA 2DUPA 3LWCA 1H30A 5FOBB 5A1AA 3BTZA 1LGCA 3AYAA 1DQ2A 4R8HA 4TXWA 5C9AA 3WT3A 1HXS2 3DXUA 4Q4Y2 3Q8CA 3RZLA 3RI9A 2YBPA 2ILMA 2PHDA 5HCBA 5BNOA 2BPA2 4WVMA 5A70A 5FMBA 3W58A 5LBEA 3H8UA 1QJEA 4FTEA 1PM7A 2G1MA 4CPBD 5F9TA 4NAMA 3VDCA 1RJ7A 4GJZA 4YVSA 4Q4Y1 2DCZA 1IS6A 1W6MB 1UO9A 2VW2A 2ZHLA 1ENQA 3JUUA 3LPFA 2F6BA 2RDRA 5FZGA 4EWDA 4F3JA 1PO11 2VVEA 4TWTA 2H0VA 4TZDA 1C1LA 5C3RA 3ZN6B 4ITCA 2BERA 4P9LA 5L9VA 1QJFA 3PU3A 3IPVB 3VD5A 2J1EA 1W39A 2J42A 2VQTA 1DLLA 3ZFGC 3E5XA 1ZYBA 3NVCA 2IUWA 4N43C 4CDXA 4CEYC 3VD7A 5K7PA 3R4SA 1CZVA 1OLQA 3O1SA 5FXWA 2WA3A 3GALA 3SKVA 2UWCA 3UNPA 5FPXA 1O6UA 5GLZA 3FHQA 3SH3A 5C3SA 1VBC2 1DGWX 4ONUA 5A6QA 1R093 5FYCA 4W4ZA 4QQHA 5H9SA 4CA9A 2R32A 3HNYM 5GLVA 3W5NA 3KZ4C 1A34A 2G9GA 5JOYA 3GBWA 4OLLA 3AZZA 3KV4A 2ZGQA 2AACA 5LASA 1UF2C 2HWD1 1WBLA 4Q1PA 3H9AA 2XLAA 3MLLA 2AREA 2IVJA 2NM1A 4AI8A 4RGAA 1R1ZA 3DXTA 4UT5A 4AGRA 5DAVA 2OUJA 2R043 3KCYA 2FD8A 1O4YA 3USUA 4PQ9A 5FREA 1OLMA 4AF9A 4FQZA 5E8AA 4WZCA 4AQ6A 1WZXA 3ILFA 2EIGA 2QCSB 3OUHA 4BIOA 4LK7A 1POQA 1W6PB 5CISA 3ZDVA 2RR13 4LKEA 1F35A 1OKQA 2XQRA 1FYUA 4N7IA 2ERFA 2C1FA 5LY2A 5HPOA 4E2SA 4AGVA 1W2NA 3W9AA 2XQXA 3M1HA 3MV11 4AEJA 2AUYA 3WG3A 2WNVB 2PHXA 3DUIA 5D8AB 3WG1A 2DTYA 4K1ZA 1WD4A 2OVUA 4BCUA 2UU8A 4I2OA 5FYTA 3TEWA 4Q4V1 3O0XA 4RD7A 3MF9A 5JIUA 4ZU4A 4E2QA 5FZ4A 1XSQA 4QXBA 4MGTA 1QU0A 1D0GA 3O14A 3EMRA 3K4AA 3JU9A 3VBOB 4Y3OA 3U4SA 4HKLA 3FUQA 1SHWB 3OGSA 4FAGA 2HWF1 2ZKLA 3O1TA 5A33B 2VQ0A 5LBFA 1DGRN 4CCNA 1VMFA 1WCSA 1OKOA 2HWC1 4KU8A 2WBKA 4IEZA 4KI5M 4LOTA 1FMD3 5CBLA 4A2UA 4F7ZA 4QHZA 3O1RA 3KSCA 1LOAA 2EA7A 2XWJB 4S2HA 2FMDA 5EQUA 1XNKA 1UYZA 1Z7S1 2D7FA 2R49A 3GHMA 3UGFA 4C0BA 4Q8KA 1YI7A 5CFCB 4AVCA 3K3NA 4ZXKA 2WFPA 4XCAA 3RVHA 1PNGA 1JH5A 1MZ5A 1DQ0A 1LOCA 1RUC2 4RR3C 3BI3A 1UY4A 4YG0A 3BTAA 1JYIA 5FYZA 2C5DA 2GP3A 2RHPA 4XMIA 4PCRA 3N7LA 3T1MA 5DDJ3 3KQRA 2RDQA 5GZGA 3AB0A 4FPYA 1OFNA 3HJRA 1WMXA 1CESA 3UL2A 1F4HA 5CEHA 2P2KA 2XLGA 1W0PA 1V9U2 4QHOA 4LE3A 1B09A 4KH9A 2B9VA 1O3SA 1DF0A 1OF4A 1ENSA 1XE7A 4LBJA 2DF7A 1DYPA 4H3WA 2W1WA 2VBPA 4P9WA 2QFEA 3PTRB 4E2GA 1HXS1 3SQOA 5A7WA 3MO4A 3R4DB 1ULDA 3RG0A 5FO9B 2AGSA 5J98B 1GANA 3M3IA 1GNHA 3AKQA 1ASJ2 2H6BA 2KD7A 3DN7A 3MLKA 5F6LB 4AHXA 1QH7A 1PVC2 3AKSA 2E6VA 5JCTA 1PMHX 1A8MA 4PI2A 5IHRA 1PMJX 4UW3A 2E26A 1AX2A 1JHNA 5I0SA 1OURA 4QD2A 1RVF1 2L9LA 4AHWA 3JD71 4UXAA 4XFIA 3VLBB 3AM2A 4D0QA 2DBIA 3AYEA 3LA7A 4INDA 3WP5A 1UMIA 4QAWA 4META 4XIOA 4A7YA 2QBXA 3NJYA 5FZ1A 4CP2A 2CAUA 4UFIA 1RUE1 5FZMA 2CWMA 2HYKA 1CVNA 4QDSA 4OI0A 1WW4A 5A80A 1UZZA 2O8QA 5F3IA 1IG0A 1NCRC 2HKXA 2JDMA 4IEWA 1HRI3 5DZEA 1GKBA 4R52A 3WNNA 1RINA 2FDHA 4ZY9A 4BH9A 4KNCA 4I01A 4ZXEA 5JOXA 4Q29A 1V9U3 3VKNA 3SLIA 1ZRDA 4DXZA 1JMUB 2JG9C 2Y64A 3AJYA 5A3MA 4JGYA 4Q0QA 5DPNA 5FP4A 2GDFA 5EPAA 3UESA 1JU4A 3ZSLA 1VMJA 2WRAA 3SEEA 1W03A 1OXCA 2HWB3 5FWEA 5IVBA 4H7LA 3M70A 4BJ0A 1PK6A 1D4VB 4K21A 5CFDA 5B2GB 1PIV2 2XXZA 2Z5WA 4N53A 2EIDA 4Y26A 4HL0A 5FY1A 4RQPB 2ET7A 1ENXA 1W06A 2VBBA 1HRV3 1TMF1 3K77A 3R05A 3WEZA 3U4XA 4BMBA 4LT5A 2XUMA 1SFPA 2C6SA 1VLNA 4JKMA 4QDRA 5FPAA 4OHXA 4Q1RA 5A7QA 1QJY3 2Z69A 2VO5A 3M8LA 1BVVA 3R0RA 1J3PA 2A3XA 1W90A 4K3UA 1C4RA 4ZPIA 5FZ9A 5K0UB 1QF3A 5CU1A 3RZJA 4XUTA 4FAHA 2C0ZA 3EYPA 3RZGA 1NY71 2WFF1 4H14A 5JR7B 3PJQA 1OFSA 2QQOA 4XAEA 1W3XA 3AFKA 2VNGA 1HRI2 3ZYRA 1NYWA 5H9RA 1DGRA 4ZS3A 5F6KA 5FBZA 5LWBA 5L19A 1V70A 3CJXA 5CADA 1CPNA 1TNFA 3BTXA 1VRH2 3LDBA 1DFQA 3WCRA 1BBT3 2X29A 4HLTA 5FKBA 2MNGA 5BNPB 4WBBA 1GZTA 3W21A 1G86A 3LEGA 1FAYA 3ON7A 2BUKA 1UPSA 2VNOA 3UKVA 3N9LA 4FFHA 1DYKA 2Q1ZB 3O1VA 4MVTA 2BBAA 1YHFA 2XJPA 5DUUA 2XVKA 4ET7A 4D3WA 5BNNA 1V0AA 3E6DA 2TBVA 3QOPA 2CSGA 4LA3A 4DFSA 1FOD3 2KA3A 2ET1A 5FY9A 2A5ZA 1OLME 4JGZC 4WVVA 4BLJA 2D6KA 3ELNA 3TRSB 5HCAA 2BU9A 1NCQC 2QQMA 3K3OA 2P6HA 2QQKA 1J59A 1RUH2 4L0PA 3ZN6A 1JYCA 5LEJA 1Y9GA 2AZ5A 3DPRA 1JYTA 5IVCA 4DRRA 1QIQA 2JDKA 4Q0VA 2W94A 3ZMOA 2XLFA 2P3YA 4LTAA 2X5IC 4I0AA 3KF5A 2YU2A 4RS5A 4AAXA 3ZPYA 3IDAA 1UU4A 3BYWA 3GZTB 1R083 3CIHA 2HWE2 3NO8A 2VMHA 2WZEA 2WN3A 3FMGA 4N9IA 1R1A1 1OQEA 4QX8A 5KXBA 4NRMA 2ZTNA 2OUHA 5C8WA 5DDJ2 5JMOA 2JIJA 1YWKA 3K2OA 4COZA 3HN3A 3OD0A 1LEDA 1MS4A 2VECA 2XBO1 4M3CB 3R6SA 3S7IA 4BK5A 4BOWA 3WW4A 1N47A 3KT4A 3AKRA 4HSLA 2QQLA 1BKZA 2WNUA 3FLTA 2KXLA 2YGMA 3ZSMA 3NAPA 2CWSA 3V0BB 4WM7C 2VY0A 4XILA 4HANA 5IVFA 1UXZA 2KR2A 5EIYB 1PMIA 4QX5A 5L9BA 4DB5A 4CZSA 3TN92 4ARYA 2DFCA 4CXYA 4V1PA 1SBFA 3N3HA 4L8QA 2GN7A 4YNIA 2ORXA 5C8CA 1YI9A 5FK7A 3HBZA 4O9GA 1GZ9A 2FCVA 3LA3A 4QX2A 1TME3 4YARA 5GM0A 4FOQA 4P9JA 3VDDA 4CCKA 1SCRA 5LEKA 1HDKA 1OPOA 1LHWA 1N1YA 3N7JA 1DLCA 4E27A 3LA2A 1IHMA 2JG8B 1G9DA 5CFDB 4NIIA 2Y0OA 3KB5A 3RGBA 2K0GA 4XE9A 5FPLA 1SPPB 2XMLA 1CIWA 1GBGA 3H8OA 4Y1UA 5FR3A 4PLMA 5LATA 4ZU7A 1AJKA 4UF0B 4XTMA 5AVPA 2EIBA 2W0XA 3LKJA 1KJRA 4Q4W3 1OMIA 1ZRIA 5ABJB 3RI8A 1ASJ1 5FKCA 4YGDA 2VTXJ 4D7TA 1J58A 1ULGA 1VRBA 1S0CA 3H7JA 4P14A 4Q4X3 1QOTA 5A3UA 4GH4A 3VZJA 3PDQA 1JYXA 3C7HA 1UYPA 1MS5A 4JHTA 4P9XA 4WZFA 4FO9A 4HN0A 1Y43B 5D8AA 3AZVA 5FXVA 5JPMB 5GZEA 1DQ5A 1H9PA 1LENA 2VOXA 3MHZA 1GUIA 5T3NA 3PVEA 2CY6A 5KXCA 3CF6E 2OZJA 5FIXA 1AR73 5J7MA 2VCBA 4YYOA 3ACFA 4Y4RA 1CAUB 3RYPA 2PAEA 1JUIA 3AP6A 1H1MA 4OI1A 4C8DA 5FV3A 4CXXA 4URAA 2W1SA 4GWMA 1QMJA 2QTWB 3ZXAC 1WD3A 1N3PA 2B8MA 4NAOA 4AWDA 3B00A 2JDNA 3E1F1 5H9QA 2RS12 1K5MA 4EWAA 1V6JA 1G9FA 3OBRA 2Y34A 1TEIA 3GHNA 4TN7A 1AYN3 3RDIA 4XXAA 1N1SA 2PLV1 2RS33 5FK8A 2LALA 4MV2A 1G6NA 2A7AA 2D5FA 2YDEA 3JBG1 4AG4A 1RUF1 1PVC3 2VPVA 2RJKA 2O0OA 2R7EB 5FY5A 4IERA 5CVRA 5KHJA 1G9AA 3DKQA 4PLNA 3SCGA 5C7GA 2IFWA 2JX9A 4CEYA 2W08A 1FMD2 1ZBE2 1CPMA 1H6YA 1U5IA 1ZZBA 1LHUA 2VVDA 3RJRA 1RUD3 5DUVA 3V0AB 1CQ9A 2NPIA 3ZXLA 5BNPC 3LOIA 3OOXA 1KD7A 5IVVA 2W9XA 3ETPA 3PUHA 4MGQA 4DIQA 3BVCA 3OG2A 2DVBA 4OHWA 4XW3A 2W1UA 2JD9A 1W9WA 3H0OA 3UJQA 4OCTA 3QCWA 5F5AA 3IDEA 2E51A 5DAQA 5FUNA 5JMCA 1PZ7A 2QZ3A 4RL7A 4WV8A 4HETA 4JKLA 2YFZA 2GNTA 4E4SA 3I3DA 4AQTA 4YW7A 4NIGA 3GXUA 4XHXA 2RV9A 4CPBA 4MO3M 4NMIA 1PX3A 2ZMLA 1JW6A 3H3ZA 5C4WA 4IEQA 1BEV2 1XU1A 3GCWA 3SC7X 1S0JA 3PVOA 4GMP3 1H2MA 5LA2A 4CEWA 1XXNA 4RQPA 2A6YA 5BNOB 1LTEA 3JB8A 2LTNA 3ALQA 3N35A 4EV0A 4XJUA 3AKPA 3GZAA 3D0JA 3LD8A 2CHHA 1C5IA 2P17A 4LBNA 4IV1B 4HOOA 4BISA 4QXCA 3ACHA 3SH4A 3EB7A 4NIDA 4P9GA 1W6QB 5C9AC 4MXWA 1VBB3 5DUXA 1EUTA 3H1WA 3RPQA 5C6CA 3RZMA 1ND3A 2ARBA 5JWPA 3BUCA 4RFRB 2RS51 2WA4A 4QPIA 5A6XA 2EAKA 3A4UA 5HI0A 5JXJA 5LA1A 4NIHA 4LHSA 2VMIA 4A42A 2YROA 1PO21 4LBQB 2LW8A 1AR63 2WN2A 3I4IA 1PVXA 4JGZA 4E4DX 4IDZA 2ZEZA 3CL1A 1LCLA 1UU5A 1W8TA 4LKSA 3WNXA 2XJQA 3DECA 3H1YA 1WA6X 3PNAA 4UWDA 5DZFA 2WL1A 1LESA 2ARCA 2EIEA 3LFMA 4MH0E 4FPOB 1GYKA 2JICA 4MHUA 4OHYA 1NA1C 1HRV2 2DURA 3I3QA 4D6SA 3O1OA 1PGW1 2IXHA 1W2TA 3M3CA 1G8WA 2X5IA 3KD4A 5BPXA 3HQUA 4LQRA 1YYNA 3NJXA 1RIRA 4HKOA 5EHDA 1AYM1 3HT1A 1S0DA 1FNZA 2H6CA 4B8EA 4XJ9A 2E7QA 3V0AA 2Y6KA 3MW3A 4BXSV 1QJU3 4B4RA 2D5HA 4Y1VA 3PIGA 4L9BA 1OD3A 3ZFFA 3CHXA 4GB33 2ZX2A 3M2MA 2VZPA 2V4VA 4Y22B 3J8F2 3JB4C 4EN7B 1RHI2 5H9PA 2VMGA 2HWE1 1JI6A 2ZZJA 2EXKA 5F8PA 2R063 3LSEA 3NAPC 3B94A 2BOIA 4UFHA 5FPBA 4Q26A 1OVPA 5IUQA 5FTTC 5A3NA 1EUUA 4GB32 4R9BA 1SFYA 1K5MB 3O7OA 4CUAA 4MGSA 2V4AA 1ALYA 4OMCA 1ND3B 1F2NA 1WLWA 1YFWA 3AXEA 1W6QA 3GBGA 5C5UA 1PHMA 4BLIA 1Z0HA 2RM22 4EN0A 1GP5A 3G6JB 4Y1XA 3T2PA 3U1XA 1EPZA 5CG9A 2WLQA 1AR81 3AMNA 3TNPB 3BOPA 4MOAA 1RUC3 3GDBA 3IMMA 4UFLA 1S1AA 2YHJA 3GJAA 2ZEYA 3T4HB 2VCCA 5DN2A 2FDFA 1UY2A 5FYUA 5B4NA 4K9SA 3ZOIA 1ZBA1 3WR0A 3V0BA 2ZAHA 5FDBA 3MV01 4KBZA 4KBBA 4LBOA 4NO4A 1W0OA 4QQOA 4BYYA 3ZDSA 4AQSA 4XAAA 1EV11 4HT1T 1BMV1 3N9QA 4M0NA 2UYBA 3D6EA 5C5TA 2ZHKA 4EYUA 1JUHA 2YYOA 3ZFEC 5AC93 3WP3A 1JTZX 3NMBA 5L36A 2RM23 3VZLA 3ZYGA 5FZBA 3ZFGB 1YIFA 1CR7A 1ZRRA 2GNMA 1WW7A 2OX0A 1QJX1 2Y6HA 2ZGSA 1VRH1 4W50A 4GWNA 3HQXA 1JODA 2HH9A 1RJ8A 4FPKA 4CTEA 5JZGA 4QKDA 2PMWB 1AL21 1VBA2 3C7EA 4JDNA 2WNUC 1X8EA 5IW0A 2ZXQA 2V09A 3HIFA 2WZPP 1LGBA 1V6LA 2QE3A 2ZEWA 5DG1A 4Q2FA 1NKGA 2QQJA 2Y6FA 1IKPA 4Y4YA 1GZCA 3WDYA 3WF2A 2NLRA 4Y22A 4O65A 2CGOA 2FBEA 2FCTA 4GZ9A 1ZBE3 3I2JA 3LZZA 5IVEA 3IDBB 4M00A 3B93A 3I97A 3VBRA 1C8NA 4EE2A 3I2OA 1Y9MA 5K9YA 5T55A 2Q8CA 1IQDC 1SFNA 1DZTA 1TZOA 5FYMA 3UKTA 1W9TA 4XC9A 3TEYA 1W8HA 5F7UA 2EF6A 1J83A 1UMHA 1XOYA 4Y1ZA 3WUDA 1ZRFA 1RMU3 4AR2A 1NUKA 3I8TA 3AC0A 4IGQA 3WDWA 1XE0A 3ZFFB 3WNPA 4PI0A 5L7OA 5FZOB 3UJOA 3ZXFA 3M3OA 3DEMA 3T0AA 5IVJA 4Z07A 4B7EA 3ZX7A 2JWPA 3VL8A 3ILNA 4IQPA 1MS3A 1BK0A 5FJKA 2MEV3 5G04L 2D44A 1REFA 5FYBA 1VALA 2Y60A 1X82A 4QPGA 1NZIA 2HWF2 2R0FA 1LNSA 3URFA 1HX6A 5F5IA 1P8JA 1YCIA 2PFWA 1Q8QA 4H2AA 3O1UA 4BDVB 5LCWL 4AE2A 5E1RA 2VZRA 3LIHA 2CNAA 2ZX0A 4XDQA 4L99A 1VBC3 1HV0A 5TSWA 1QNWA 2UWBA 2WZR1 2YXSA 2ZGPA 2JXAA 1RUG1 1XYOA 3AKTA 3MBWA 2WWUA 4IV1C 5D2AA 3VBOC 3WHUA 3PUQA 4AHZA 3O0WA 4F8AA 3UKNA 2D6PA 3UGGA 1C5HA 1Q3EA 1XC6A 4YZ5A 1KGYA 2ZKNA 5KBFA 1XRUA 2QJVA 1O5LA 1X7NA 2XONA 3MW2A 1O3RA 2A3WA 5I0UA 5A33A 1WMFA 2Q0AA 4A6OA 1JZ3A 4DXSA 2IXCA 4XACA 1TMF2 1S0GA 1AR91 5KHIA 4UF0A 5FZDA 1RTVA 5FZHA 4CCOA 2ZHNA 5LA0A 1F8VA 1JYVA 3HVDA 4LEJA 2WS91 4IE0A 1TG7A 4B1MA 2EALA 2YY1A 1RUI1 4PT6A 5JZGC 1SLCA 4EWEA 1L7LA 5J48A 4I0BA 5FZEA 2HEYF 4Q27A 5J36A 1RITA 1M06G 5C4WC 1A8DA 1HQLA 2JKBA 4YZ3A 4J25A 5FP8A 1LGNA 2ZGUA 1NCRA 4MHRA 2ZCWA 3I2IA 4XCBA 4RHV1 4PQQA 5T5JA 5T5LA 4N9HA 5FZ7A 1PNFA 4PBOA 4Z2WA 5FYHA 1YUDA 1OQ1A 5BY5A 3RMYA 5KWRA 4BWOA 1QKQA 2YC2A 3VBRC 1TME2 1YQ6A 3MIGA 1RUJ3 4HKWA 4AVVA 1QEXA 2VZQA 3P6BA 2SLIA 2VMEA 4P5HA 3WDXA 5BV6A 1GQHA 1JS9A 2XVLA 3B01A 4IW3A 4S2FA 2HEVF 2BWAA 5JAXA 1K45A 3AP5A 2SBAA 1EAH3 3THPA 1O8SA 3I2HA 1VBE3 2PQQA 5KXEA 4W6WA 4I09A 4G3YC 4CVUA 3JD72 4W6YA 1XSRA 2MPFA 3MUZ1 4LITA 5DQ0A 4OI4A 2WWSA 3AFGA 1BBT2 1COV1 2HYXA 4Q0SA 4ZONA 2TNFA 2RDSA 2W91A 1URXA 2YUEA 4I3PA 4U36A 3ZXJA 1ZREA 1CWPA 1ND2C 2VOKA 2CGPA 2W2IA 2A3YA 3POIA 3LB9A 5L9RA 3WHTA 3JQXA 3WW2A 5FZKA 1D4M3 4AW7A 5JXGA 4ZU5A 3IWZA 5HCFA 4XFGA 1PGSA 3VHOA 2NP0A 4LPLA 1POV1 3T0DA 5FZCA 3FWEA 1QQP3 1YLLA 3ORJA 2VJXA 2DCKA 3RMXA 4IEVA 2WT1A 1DQ1A 3SKJE 5BUVA 1D4M2 3A0NA 2IXIA 1SLLA 2VVFA 3A0KA 3F2ZA 4K8FA 4Q4V2 1RUH3 1XJAA 2PHLA 1X9PA 2Z42A 4PBPA 5F39A 5JXHA 1RMU2 4IUGA 3HD8B 4YW5A 1Y9QA 5DXDA 2ZGMA 1V6OA 3VZKA 3WSOA 5BNNC 1PIV1 2P34A 1RC6A 1B35C 5M0TA 1Y7BA 1AYM2 3BPSA 4AFBA 2DCYA 3I2DA 2Z2SB 3FHIB 4XPVA 5CKMA 1PM4A 4GWIA 2JG9B 3TOJA 4AI9A 4FBFA 2Q5TA 2YC0A 2GMPA 3CLPA 1SACA 2DCTA 4EROA 3OEBA 4GIQA 2RMU2 3LDKA 3EBRA 4Z1VA 1S0EA 3H3LA 3CJIC 3Q8FA 4QDQA 3LE0A 1OLRA 5KHGA 3OGVA 3M3EA 2X10A 1PZ9A 3WQBA 1FNYA 5KHKA 4D6QA 1RGSA 4QKFA 1ZZ9A 5LZ6A 1YQ2A 3IDCB 1H4GA 5JOWA 3NKGA 5K0UC 5ABJC 5CA6A 1ST8A 4GALA 1S2BA 2WKKA 4YG3A 1RB8G 3ZN4A 4YZ4A 5GLUA 3ZFFC 1RVF2 4L2NA 3T2OA 4Q4X2 1RYYA 2C9KA 3WQ7A 3WXPA 1QDOA 4BQ3A 2AH2A 3ABZA 3H50A 1YJLA 1W6OA 2GNDA 3J7LA 5F1RA 1O4ZA 5FZFA 1ZA4A 1A78A 2LROA 2DTWA 3J7NA 1UZ0A 4QPYA 2PAMA 3H8RA 4WM8B 1OT5A 2VAUA 1XNDA 2E9QA 3KVBA 1BEV1 5JSOA 5A7PA 2G19A 1KDMA 1GWMA 3OGJA 5JSRA 2JDHA 3QD6A 2B39A 2JE9A 2ZBJA 3WOGA 3DF0A 4N43B 2Y0IA 2MHFA 3OBAA 1HB3A 4OYUA 3HBKA 3ZSJA 3GM8A 2NZ9A 3A21A 1OBNA 1AL22 1VBA1 3N9PA 4JGZB 2XJSA 4QPWA 2F17A 2NN8A 4NPMA 1UZYA 2VU9A 3OCPA 3SCFA 4DUXA 5A1FA 4XJWA 4R9CA 1C8M1 1BYHA 4XDOA 2Q4SA 4NHMA 2A6WA 2WR9A 4MXVA 4WVZA 1XE8A 1LOFC 4IE7A 2WDBA 4KL1A 1HQWA 4XJZA 5A7SA 4K20A 3WQ0A 2D98A 2QUOA 3SH5A 1OOPB 3WQ1A 3MIDA 4KQ7A 2QDNA 3R4UA 2WINB 1NXD1 2WJSA 4CCLA 2NMOA 3RQ0A 3J7HA 3ZMNA 2PLV2 4BMEA 5FXXA 4GH4C 3PU8A 3AK0A 5J3UA 3ZR6A 4BU2A 2X53S 4FT8A 3MDPA 1XQNA 4AI3A 5JIAA 4JTOA 1PO12 3W20A 1Z78A 3QH6A 5EYYA 4IE4A 2VW0A 1J3QA 1ULEA 5IYYA 1H2LA 2JIGA 5FUIA 1DIWA 4AFMA 1E57A 4LHNA 4FPJA 1XYPA 2UURA 4ISQA 5FO7B 4QPGB 3V65A 3K51A 2XUEA 1W28A 1GNYA 5C3QA 1APNA 4CCCA 4WM8A 1LOGA 3Q8AA 1AZDA 5T5OA 2XB6C 4AVAA 2RVAA 5DUWA 4XETA 1XBFA 2WABA 3W59A 4QGLA 2FDKA 1RHI1 2RG4A 1MS1A 4AOCA 2XJUA 4AFAA 1IS4A 5BNQA 1DG6A 4K1YA 2VC9A 3D82A 3ECQA 2R071 4OHVA 1FPN3 5FCCA 5L7OC 3J8F3 1NQDA 2UY8A 3HNBM 4NR1A 5EP9A 5T50A 4CDWA 1W8UA 3E5UA 1VAMA 4MG2A 1CIYA 4WVWA 3B3QE 3OYWA 5GZCA 1K42A 4IEYA 3KV9A 3QBQA 3KF3A 2ZHMA 4B4PA 3ZXGA 1FPN2 1JZ7A 1GOGA 4NIAA 1MEC3 4FPCA 2QQUA 5FYIA 3CNAA 3IMNA 1CAVA 1VE0A 1QXJA 1VBD1 3L2HA 1CD3G 2BNOA 2GU9A 3T09A 3UK9A 4CDUC 3MIEA 4COUA 4X6RB 2ZJCA 3LDRA 5HV0A 3LOBA 4IV1A 4P00B 5CFCC 1W2AX 4H55A 2WAAA 2YB7A 3ZVXA 3U75A 4FPLA 4MYEA 2HWD2 4RR3B 5KR7A 2PTMA 3AX4A 1PO22 4HMZA 5A6ZA 5F3CA 2IC1A 4P5YA 2VZUA 4L92A 1RUE2 4ZKTB 1SBEA 5AFBA 2PN5A 3NNJA 1IS3A 3HAGA 1W9SA 2BP6A 4AL9A 5LRRA 1QJX2 5ACA3 1J84A 4D69A 3S30A 1Y3TA 4PF1A 2E53A 2DUQA 2ZA9A 2P3IA 3WUCA 5A3LA 2DU0A 2GC3A 2F4LA 2RMU3 3BOWA 5J09A 1QOSA 3KLSA 4Y33A 5FPVA 4IEPA 1V00A 4OUSA 3TN91 4AK3A 1SCSA 3C8XA 3ZKYA 4AEDA 4CEWB 2QDRA 4TYSA 3P3NA 1IPJA 5DG2A 4FFFA 4XFCA 2B42B 1OC1A 3VHRA 3MPPG 2D6LX 3WLUA 1UKGA 2YGLA 3ZXEA 4BQ5A 2RS13 3BIWE 2VNVA 1MEC2 3AL6A 1SLAA 2PA7A 2XHNA 3T4VA 2RE9A 2R1BA 2VMFA 3O5SA 1MACA 1XNTA 2WC2A 4X8NA 1ND3C 4RGGA 1MZFA 1GP4A 5JXIA 1O59A 4NE9A 1OI6A 3KM5A 5A6YA 3ST7A 1YO8A 2R062 1NXMA 4NHLA 2ARXA 3VZNA 4CXWA 1UOJA 1NT0A 2CYFA 3NNMA 3PJYA 2Y6GA 3CEWA 1DGWA 4X8PA 4FPEA 1W3VA 4YVSC 2UWAA 4Q4Y3 4X6QB 5EJ1B 1QJU2 2WO3A 5K4LA 1UIKA 3INAA 2WS92 5F5QA 4FFGA 1PO13 3T30A 1D7PM 4K40A 4B7KA 1HLCA 1ND2A 2BW8A 3S57A 1EV12 3WVJA 1IQAA 1OSGA 2B45X 3WX5A 1SG3A 2JDUA 2IVIB 2VUAA 1ZBA2 1LOEA 5D21A 1MQTB 3POYA 1IPKA 4JGYC 4CDXC 1PGL2 2WNUB 3MLJA 1VAVA 2VXRA 5LW9A 4QGMA 2WYFA 2YG0A 2Q1MA 2GH8A 1AX1A 1R091 3IIIA 3LAGA 4QMAA 4YW6A 5FY4A 1KRIA 1CAUA 3C3VA 1BVP1 1FATA 1JXNA 2G9FA 4NHXA 1UYYA 3ZXKA 5FLIA 3D5OA 3OGRA 4JHZA 3EXUA 4GULA 2K46A 1LHNA 3SISA 4A44A 4LMFA 3KVAA 4FOYA 2HWD3 2ID4A 1NX9A 2R16A 3CMGA 1YFXA 4HVQA 4HVRA 4QQPA 2WYSA 4XZUG 4DNYA 2AYHA 2WZ8A 4HN1A 1BK1A 2R041 3VBHC 2RS52 4YVWB 2WQZC 5C9AB 2WO7A 4L11A 2VOVA 1LB2A 1BJQA 1DDLA 1VBD2 4GH4B 5ISLA 2BZDA 2K2SA 2OQ6A 3VBUA 4HZFA 1Q56A 3VKFC 3WG2A 2PXJA 1YNAA 1U5ZA 3DPRB 2J1SA 4UW5A 4C1XA 3KHCA 4MGKE 1OQDA 4AFCA 1RUD2 2RDNA 3PVBB 1Q8PA 2RR11 5AFEA 2XJVA 2D6OX 2BGCA 4XYXA 4P02B 3CJIA 3TAYA 4CCJA 1O91A 4LHLA 4DRVA 5EFUA 1MZ6A 1AVBA 2QQVA 2VZTA 3NNGA 5F2SA 3VBOA 1QWRA 1JYWA 3NWKA 3RRDA 1CGPA 1WWYA 3I54A 3PUIA 3OYWB 2E63A 5KXDA 1TQ5A 2W68A 3AZWA 2WT2A 3ZFEA 4EN9B 3JZVA 1LOBA 2VH9A 4JZRA 2JDAA 5CZKA 1UXXX 4OMDA 2Q1FA 3I7DA 4QM9A 5F37A 2QVSB 1CAVB 3PMSA 1KXGA 1OVSA 1W6PA 4Q4V3 1ULCA 1I6XA 2GMEA 4QHBA 2R072 1JBCA 3H42B 3HNMA 3N7KA 3VBSB 1T6GC 1W2OA 2A6XA 2VBDA 1JZ4A 2OXBA 1FX5A 1GP6A 1FXZA 1NOVA 5FZ0A 2Q8EA 3TB0A 4E8CA 5L7OB 2HWC2 4QWNA 2WLPA 1DCSA 1YEWA 5IFTA 4PHZA 5EWSA 2JDYA 3ACLA 3VDBA 2P1BA 2HWF3 4DINB 3AMQA 4CDWB 2PHWA 2P5BA 4AI0A 3W5MA 1NCQB 2IZWA 1S2KA 3JQWA 4CDQA 4M3CA 3U0ZA 1HN0A 1AJOA 3UYJA 3OUJA 2HWC3 1LJ7A 5CKQA 3BODA 5EJZB 3VBSA 1H1IA 1FMD1 1JN2P 4NPRA 1NE4A 1J1LA 2A71A 2E7TA 3NAPB 5CYYA 3ROUA 2GC1A 4JQTA 2WNOA 3TNQA 3WF4A 2E31A 2W3JA 4ES8A 1F31A 2WO2A 2VQUA 2EVXA 1Z7S3 4DY5A 1GSLA 5FWJA 4RS5B 3NJZA 5FMOS 3VD4A 4UW6A 4FVVA 1VAKA 2B5HA 2GH2A 1W9YA 3POGA 1O4TA 4JQRA 4XMAA 4V2WA 1HV1A 2ZOEB 1HB1A 3ACGA 2VZ1A 1NZCA 2DCJA 2R6QA 4XF9A 5DDJ1 1DQ6A 3BB6A 2ZS6B 3Q8BA 5IJRA 4E8DA 4HPKA 2FDJA 2Y26A 2EICA 4LO4B 1R082 2JKXA 1ACCA 2QKDA 3Q9OA 3NW4A 1HB4A 1VR3A 5CB7A 3PURA 2CU5A 1I5PA 2D6NA 4C1WA 3WW1A 4EN8B 5FYYA 3N9MA 3ETQA 5B4XA 3VBUC 4CUBA 1GWLA 1J1TA 4UYBA 2HJIA 1DGLA 4BK4A 1MVEA 2GMMA 4N8MA 1CAXA 1HXS3 4XQDA 1UL9A 4AXOA 1W8NA 4LIVA 2IXJA 4LJHA 1YXWA 1KFUL 3U10A 1R092 1W6MA 4RFT0 5JLVA 5FP9A 5KC6A 1FI2A 1LAJA 2DVGA 2I2SA 4G4FA 4XJ8A 2CTVA 3ZYPA 3LIGA 3N36A 5FYSA 2JG8C 5DMYA 3P3PA 1WW6A 5FPZA 3MZHA 4NHKA 3TEXA 2X8KA 3C7FA 3NNLA 4IV3A 2G4IA 4QPIC 5FFOC 4XQWA 1W99A 5JSPA 1RVF3 3JD73 1RXFA 4A7KA 3ZYJB 3O0VA 1KITA 3IT8A 4M3CE 3NKTA 1B35A 3OSDA 3AYDA 2OT7A 3WD5A 4CU8A 2IXLA 1H6XA 1O5UA 1VIWB 4NJ4A 2BQPA 1W2UA 1ZZ8A 1RUE3 5FP7A 3I3BA 5GLWA 1ULOA 1I9RA 2DYCA 1HRI1 4LO7A 4FXGB 2QQNA 1LEMA 4LHKA 5BNNB 2ADDA 2BTVC 1L7RA 3J26N 3FN9A 3AZYA 1NAEA 1ODNA 1V9U1 3IZOA 4G9SB 3RJ2X 4YZ1A 4KWUA 2QQWA 1QJY2 1W8FA 4JGYB 4EZHA 4JRAA 4YVWA 4OZOA 5CNAA 2DV9A 4N7UA 3B5LB 2HWB1 2J1AA 4IV3B 1OA4A 4HXCA 3KT1A 4PIXA 1GOFA 3OUIA 2PELA 5EJ3A 3MUY1 1PZ8A 1US2A 1NE6A 2AC1A 1GQPA 3PMEA 5LA9A 5A7NA 4UOJA 4N53C 1Q8OA 1SBDA 3GYDA 3KS7A 4DQAA 3KV5A 1HRV1 1TMF3 1V6IA 2HWB2 5KC5A 4UFMA 2RR12 4YW3A 4FPHA 5IATA 1QY4A 3HR9A 4IEOA 4LXLA 4DEVA 4COWA 4LBQD 1YFYA 1QJY1 1XNBA 3VBHB 2XJRA 2DVAA 1HN1A 3POJA 3KGLA 1FV2A 2ZGOA 5JI9A 2QZ2A 3J9SA 1UY0A 3H7YA 1XU2A 2WFF3 4FFIA 4EZ4A 5T54A 1REEA 2W47A 1GZWB 3BGAA 3OGGA 1O3QA 4J6GA 4KG8A 2VZSA 3KWVA 2ZABA 2Y33A 1HJFA 4I3GA 4FOWA 4HFSA 4DOUA 5E88A 5JZGB 3MYXA 3NRUA 4R9DA 3AMHA 2PAKA 5C3OA 3D3AA 1BBT1 1UMZA 3TEZA 4MXWB 3POEA 4NVPA 3OPTA 3T2TA 2F4PA 5C4WB 5JR2A 2XG3A 4CP9A 1Y4WA 1O7FA 3ASIA 3ENRA 5I8YA 1A3KA 1DU3D 3DKWA 4UFJA 5I93A 2FZ2A 1RUF2 4UBHA 3VGIA 5CKNA 4HVOA 1X33A 2A6VA 1LULA 1WCQA 1LKNA
chains in the Genus database with same CATH topology
3VBFB 3VL9A 5J96B 4FP3A 1SMVA 5I8SA 4XF0A 2CGNA 3VBRB 1FOD1 4XFFA 5BYNA 5E16A 1TNRA 3K48A 5FQ0B 4JRLA 4MGZE 1WUVA 4DY3A 1NCQA 2ZGRA 4PJYA 1IZ3A 3VZOA 2BVBA 3CU7A 3WW3A 3FFQA 4BE3A 3N7MA 3DL3A 4IXLA 2TUNA 5EZWA 1R081 4RS5C 2D93A 3S6PA 1QXPA 5L73A 1ND2B 4QQLA 1R1A3 2B9UA 4J1WA 4EJRA 1UN1A 4RSUA 1N3OA 3TWIA 1I1EA 2XBO3 4BHPA 2H0BA 1N1TA 2ZGLA 3AZXA 1UKRA 5AC92 1AHSA 3GZUC 3JBG2 4W65A 1SLBA 2OW4A 4XEZA 3VBUB 1NA1B 3I59A 3FLRA 5SV5A 2OA2A 4IL7A 3ME2A 2GC2A 2XBO2 3PLQA 1TME1 4YM3A 1IGOA 4NN0A 4XTPA 3ZSKA 1U5YA 2D6MA 2R0HA 1AUYA 1VBB2 5JPNB 3RYRA 3FC0A 2ZX1A 4BQ1A 4AEDB 4GMP0 2XHKA 4YSFA 1W6NB 4PDWA 2D97A 4PF5A 3U07A 3FJSA 1G9CA 1UW8A 4QPIB 1HIXA 2GSYA 2ZGKA 1H9WA 3ES1A 4QU2A 2ATFA 1MQTA 1QDCA 3C2UA 2CV6A 1MZEA 3HN1A 3AMMA 3VKLA 2ZMNA 2Y38A 4P9IA 4XIKA 1WCKA 4MUVA 4Q4W1 4B3NA 1ZM1A 2V5YA 1ASJ3 1S0FA 1ONAA 4OI2A 3AP9A 4Q4X1 3VUOA 1F5JA 5T52A 1ZNPA 3WZ1A 2GAUA 3MW4A 2YPJA 3POSA 4XOGA 4ES9A 2K9ZA 1RUOA 4QT6A 4LLFA 1WCDJ 4GXLA 1QQP2 5FO8B 2ETEA 3H1MA 3VN4A 2XGXA 4JDOA 3EHKA 4C91A 5ACA2 4WM8C 1KDKA 4AI2A 1SQ4A 1OHFA 4IV3C 2OZ6A 2Q8OA 2WNVA 3H3UA 1AR71 3VKMA 4OHZA 3AMPA 1QH6A 4YGBA 3T1LA 2XH6A 2D43A 4LBLA 3VHNA 1SEFA 3MIBA 2RS32 4K6BA 1DZQA 1F9KA 1U5XA 2W52A 1BCXA 3OJBA 3BCWA 1MS9A 4DMIA 1QNYA 5BXXA 4BM8A 5KWRA 1UD1A 4Z92B 2IFRA 1W6NA 4PDWB 1LECA 5FRAA 1AYN1 1REDA 3M4FA 1MS8A 3LGRA 1YIPA 2PLV3 2RS31 4OUMA 3TYJA 3JBG3 3ILRA 1RUF3 3VBFA 1EPWA 1PVC1 3WDUA 2QQPA 2BVVA 4NWWA 4YVSB 2WSVA 1VB4A 3MIFA 1UU6A 2ZX3A 5FAXA 1RUD1 1BXHA 1ULFA 2PHRA 4XF4A 4RA0A 2XKPA 3USSA 1EP0A 1R1A2 4RR3A 4ATEA 3HT2A 2YV8A 3IIAA 1BZWA 1GZWA 4XFAA 4CYDA 1MQTC 1QOOA 4CEYB 2O8OA 5I91A 1CN1A 1F5FA 3LCPA 4SLIA 4OVEA 2ZAAA 3POWA 3KMHA 3VBHA 4QPGC 3VHPA 3GBFA 1QXRA 4SBVA 3IM0A 4GMP1 1L3JA 1JOJA 4Q4W2 4MGYE 1AYN2 1KS5A 4LBMA 3ZXDA 4M01A 4YLZA 2X5IB 3AP4A 5IK4A 1POV0 2XWBB 3RS6A 4M0HA 5HXVA 2WZR2 3FZ3A 4I02A 1IOAA 3NV3A 1VBB1 3KGZA 4W6XA 2VW1A 5K0UA 2XKOA 3GNEA 4FTSA 3E5QA 2RS53 4AFDA 1X36A 3NSTA 2R30A 5GLTA 4Z8BA 4KWLA 3OBTA 3O12A 5E89A 4S2DA 5EV7A 4AEKA 1PO23 4DZGA 1AR61 4YM1A 4LBQA 4E9KA 5IK8A 1NY72 1GFF2 2JDZA 1ZVFA 3BPZA 3B69A 3E97A 4MLOA 1VJ2A 4CDUB 2D3SA 3MGUA 4WM7B 4UW4A 1WGPA 5FOJB 1PK6B 2CAVA 3NV1A 1NA1A 1RUI2 3NV2A 3J4UH 4QGNA 4CP0A 1XYNA 5HBAA 2BBVA 2JJ6A 5GZFA 1LU2A 4MSVA 1O3TA 3VBSC 3SITA 4LO6B 2O1QA 3QACA 5JOZA 1MVQA 1UCXA 1AYM3 2JG9A 4FSJA 3VDDC 3MFCA 1Q5OA 4QQ2A 4NWVA 5I8TA 1QHDA 1RUJ2 1QJU1 3D0SA 4ISRA 5CFDC 4KWJA 1X50A 4GB31 1LHVA 3ZSEA 3FLPA 3EQEA 4TSVA 2XPJA 3WP6A 2HWE3 1KS4A 3ZYIB 5T5PA 2R061 2FZ1A 3ZIXA 3N4MA 2VGDA 1CJPA 3NV4A 1UIJA 4KU7A 3FBMA 2GZWA 1KFXL 1H8TC 1AXKA 4GKXA 2P37A 1LODA 4ORFA 2WSUA 4I0WB 3APBA 5IK5A 1AR83 1RUC1 1I3HA 1BMV2 2NYYA 4J1XA 3ES4A 4LNVA 1W6OB 1RL3A 3MI8A 1ZBA3 3QLQA 4FCAA 1IS5A 3D8CA 4LR4A 3SHRA 2GN3A 1EV13 1WLTA 2JD4A 2JG8A 2UYAA 2E7AA 4YM0A 1BQPA 1GICA 2FQPA 3GF6A 5AC91 4AVBA 2RM21 2WT0A 1H1AA 4MX3A 3B7MA 1QJX3 1B35B 1VRH3 1C3HA 2A73B 2PHUA 2JEMA 1C8M2 1OD5A 4IEXA 4CDXB 1AL23 3MIHA 4QXKA 2NMNA 2XL7A 3EO6A 3V64A 1QJZA 5AVAA 1HKDA 3WCSA 3TBDA 1ENRA 4A7ZA 3ZFGA 3SXWA 1UX6A 2AR6A 5KHHA 3PVNA 3VKOA 1ZBE1 4MGIE 4Z82A 1AR92 4Q8LA 3IKWA 1D0HA 2BFUL 4YVWC 5ABJA 1GV9A 2VULA 5CFCA 4K7JA 1AL0G 2YZ4A 2DFBA 1U12A 1NCRB 1RMU1 2XVGA 3WG4A 4LUMA 1WLCA 4I30A 4P9YA 3FX3A 1H2NA 3E6BA 4H7MA 4HPKB 4LBKA 4LULA 5A32A 4WM7A 2MEV1 1X8MA 1D2QA 1V6NA 4YRDA 3B9CA 2EXJA 3M3QA 1A6CA 5LK7B 1S55A 4GKYA 4JTNA 2A6ZA 1NLRA 5JVVA 4RQPC 5GZDA 1EYBA 3OY8A 2ES3A 1VBC1 5C8CB 4AHYA 2I74A 2WZR3 2ZGNA 2ZPXA 1RUG3 4PLOA 3ZN5A 1G9BA 3AP7A 1ZRCA 2R1DA 3X29B 2HEWF 4TLFA 4XXPA 4B4QA 4Y5Z0 5K8SA 2N7GA 4COVA 2V73A 4ASLA 2EAAA 4XHBA 1AR93 4A3XA 2WQ4A 3E6CC 4YW2A 2WS93 1RUI3 1OOPC 2OIIA 4FPGA 4YW1A 3B9IA 4KGGA 3USUB 3BALA 2B46X 5GKAC 3FE5A 4Q0PA 4AQ2A 1LHOA 1WLDA 4RHV3 1N3QA 5EYXA 1OPMA 1U0AA 4S2GA 3WDVA 4Y1YA 4COYA 3MICA 4JV4A 4CP1A 1LU1A 1AX0A 1GR3A 1RUJ1 3RWNA 4LO8A 1KQRA 2P3KA 2A75A 2D40A 4MZUA 4JAAA 4D7YA 1FOD2 3OPZA 1OA3A 1H8VA 3FFZA 3KT7A 1COV2 4YW4A 2A70A 1EAH1 2DVFA 1VBE1 2D3RA 4Y20A 5EXOA 2BWCA 5JI7A 4DS0A 2VOWA 4XBQA 4AYUA 2RJLA 4GA9A 1K5MC 1COV3 3V56A 1AXZA 4FPFA 4XFHA 5GJ6A 3HWJA 3WV6A 2ZMKA 3IN9A 4IETA 2P3JA 4AVTA 4CDQB 4AGGA 1J3RA 3ATGA 4EN6B 3THTA 2ENRA 3SNMA 1D4M1 1EY2A 2PHFA 4L97A 1C57A 4XQ4A 4YM2A 5GALA 4WVMB 4D7SA 3WP4A 1RUNA 1ZZ6A 1POV3 4N90A 4ASMB 1QGLA 1QQP1 4URTA 4YZ2A 3FBYA 1MS0A 2Q30A 4JDMA 5BNPA 4RHV2 3ZO0B 4NOTA 1UAIA 4XBNA 2JECA 5FQ0A 1RUH1 1WBFA 3ZFEB 5FMOL 4KWKA 1YFUA 4R9AA 4YFZA 4CRQA 2DU1A 4PIYA 1PIV3 2BEOA 4XBLA 1IKQA 3U11A 3D4KA 3HMYA 4LO5B 3AJZA 1PGW2 5CG8A 2UY9A 1DZRA 3NL1A 4Q0UA 2EXIA 2B7YA 3G7DA 4AEDC 3SCHA 3EJKA 4CEWC 1Q43A 2BFUS 3RYKA 5DZGA 1YJKA 2C9AA 3KCXA 1C28A 4HSJA 3RSJA 2R042 4N53B 4UBGA 4C90A 2OYZA 5A32B 1ZZ7A 1N1VA 4XZPA 1TE1B 4HK9A 2CL2A 4HBNA 1S0IA 2GNBA 4D94A 5FLJA 4AI1A 4LLOA 1H2KA 3WY6A 1FV3A 1AF9A 1CAXB 1GLHA 3DV8A 3JCIA 1WW5A 4C0HA 3S7EA 4IESA 2YMZA 3MPBA 2ZX4A 4FOVA 3OD4A 1H8TA 1WMEA 1BEV3 1KJLA 3I59B 1D2SA 1YRZA 2BNMA 4FP2A 4R4ZA 3AXDA 2TEPA 3VBFC 4F83A 1SLTA 1RUG2 5I0TA 1NQJA 4XF3A 5CIRA 5C8CC 2VNRA 4XJAA 3B02A 4BIFA 2LUWA 4ATFA 1CONA 4YGEA 5C33A 1NLSA 1VBA3 3SMHA 4LE4A 4PDWC 2ZZQA 3M7AA 1DQ4A 1DHKB 4XF1A 4OFGA 1C8M3 3WDTA 5LK5A 4YGCA 3BU7A 4PIZA 4LUKA 1LOFA 1PGL1 4O9EA 1ZZCA 1GNZA 2DUOA 2VG9A 4QM8A 1UPIA 2WIIB 1MR5A 1Z7S2 4U2AA 2BNNA 2KM2A 4OULA 5JDBA 1WMDA 2DVDA 1VP6A 1GQGA 2Z79A 1V6MA 2WNEA 1H0BA 3DPRC 2OPKA 3IBMA 3MEPA 3PTYA 4GQ7A 4JC1A 1H4HA 2W39A 5J37A 3OY8B 2ZACA 3ZIWA 4BA6A 2GALA 2FMYA 1G7YA 2IWGB 4XFBA 3QH7A 2WNVC 5D8AC 3FUOA 1CAWB 4KGQA 1SDWA 3PHMA 4Y20B 4FTBA 2IXKA 2I07B 5IK7A 2BYVE 4JVAA 5SV8A 2MEV2 4DPNA 4KG0A 1RHI3 5BNOC 1C1FA 1OOPA 2GC0A 4IEUA 2R073 3VV1A 1FPN1 2D3PA 4JCKA 4FQ4A 3J8F1 4BPZA 1V6KA 5I0RA 5LRSA 1CAWA 4CDWC 4B29A 2FHRA 4CDQC 3LSDA 2QNKA 5FLHA 4BZ4A 1NG0A 1VB2A 5D1IA 1MEC1 2JE7A 4HK8A 2NQYA 2VQAA 4OZXA 2PYTA 1VBD3 2VUJA 2AENA 3MF6A 3WINE 4YFWA 4N43A 4CDUA 3MFAA 1DBNA 1SLIA 3RNSA 1S0BA 4YG6A 1AR82 3L2YA 3L9JT 5CAZA 2XL9A 1PK6C 1HQNA 1AXYA 1XNCA 2JENA 4R4XA 1Q8SA 2XJTA 1AR62 3VZMA 1CX4A 3OF1A 2EXHA 1AR72 4M3CF 4AVSA 4LA2A 3OTFA 1Q8VA 2PHTA 2WFF2 4E4ZA 5ACA1 1OA2A 4AEMA 4FXKB 3VDDB 1WA4A 2ZGTA 2RMU1 4Y24A 1ZX5A 2LM3A 3KCCA 1CJDA 3TN93 1LR5A 1M4WA 1I5ZA 1VBE2 2I45A 3S0MA 1EAH2 3CJIB 3UV9A 2RS11 1FT9A 3CO2A 3IPVA 3AYCA 1HW5A 1LRHA 3DGTA 1H8TB 3RZZA 5IT6A 2DWRA 2DUPA 3LWCA 1H30A 5FOBB 1LGCA 3AYAA 1DQ2A 4R8HA 5C9AA 3WT3A 1HXS2 4Q4Y2 3RI9A 2ILMA 2PHDA 5HCBA 5BNOA 2BPA2 4WVMA 3W58A 3H8UA 4FTEA 1PM7A 5F9TA 1RJ7A 4YVSA 4Q4Y1 1IS6A 1W6MB 2DCZA 2VW2A 2ZHLA 3JUUA 1ENQA 4EWDA 4F3JA 2F6BA 1PO11 2VVEA 4TWTA 2H0VA 4TZDA 1C1LA 3ZN6B 4ITCA 4P9LA 3IPVB 1W39A 3ZFGC 1DLLA 3E5XA 1ZYBA 3NVCA 4N43C 4CDXA 4CEYC 5K7PA 3R4SA 1OLQA 2WA3A 3GALA 2UWCA 5FPXA 5GLZA 3SH3A 1VBC2 1DGWX 4ONUA 1R093 5H9SA 4QQHA 2R32A 5GLVA 3KZ4C 2G9GA 5JOYA 3GBWA 4OLLA 3AZZA 2ZGQA 1UF2C 2HWD1 1WBLA 4Q1PA 3H9AA 2XLAA 3MLLA 2AREA 2NM1A 4AI8A 4RGAA 1R1ZA 4AGRA 2OUJA 2R043 3KCYA 1O4YA 3USUA 4PQ9A 5FREA 4AF9A 4FQZA 5E8AA 4WZCA 4AQ6A 3ILFA 2EIGA 2QCSB 4BIOA 1W6PB 2RR13 1OKQA 1FYUA 4N7IA 2ERFA 2C1FA 4E2SA 4AGVA 3W9AA 3M1HA 4AEJA 2AUYA 3WG3A 2WNVB 2PHXA 3DUIA 5D8AB 3WG1A 2DTYA 4K1ZA 1WD4A 2OVUA 4BCUA 2UU8A 4I2OA 4Q4V1 3O0XA 4RD7A 3MF9A 5JIUA 4ZU4A 4E2QA 1QU0A 1D0GA 3O14A 3JU9A 3VBOB 4HKLA 3FUQA 4FAGA 2HWF1 2ZKLA 5A33B 2VQ0A 1DGRN 1WCSA 2HWC1 4KU8A 4IEZA 5CBLA 1FMD3 4A2UA 4F7ZA 3KSCA 1LOAA 2EA7A 2XWJB 4S2HA 2FMDA 1XNKA 1Z7S1 2D7FA 2R49A 4C0BA 3GHMA 4Q8KA 1YI7A 5CFCB 4AVCA 4ZXKA 2WFPA 1PNGA 1JH5A 1MZ5A 1DQ0A 1LOCA 1RUC2 4RR3C 4YG0A 3BTAA 1JYIA 2C5DA 4XMIA 2RHPA 3T1MA 4PCRA 3N7LA 5DDJ3 3KQRA 5GZGA 3AB0A 4FPYA 1OFNA 1CESA 3UL2A 2P2KA 2XLGA 1W0PA 1V9U2 4LE3A 1B09A 4KH9A 1O3SA 1DF0A 1ENSA 1XE7A 4LBJA 2DF7A 1DYPA 4H3WA 4P9WA 2QFEA 4E2GA 1HXS1 3R4DB 1ULDA 3RG0A 5FO9B 2AGSA 5J98B 1GANA 3M3IA 1GNHA 3AKQA 1ASJ2 2H6BA 3DN7A 3MLKA 5F6LB 4AHXA 1QH7A 1PVC2 3AKSA 2E6VA 5JCTA 1A8MA 4UW3A 1AX2A 1JHNA 5I0SA 4QD2A 1RVF1 4AHWA 3JD71 4UXAA 4XFIA 3VLBB 3AM2A 3AYEA 3LA7A 4INDA 3WP5A 4META 4XIOA 4A7YA 4CP2A 2CAUA 1RUE1 4OI0A 2CWMA 2HYKA 1CVNA 1WW4A 1UZZA 2O8QA 1NCRC 2HKXA 4IEWA 1HRI3 5DZEA 1GKBA 4R52A 1RINA 4BH9A 4KNCA 4I01A 5JOXA 4Q29A 1V9U3 3VKNA 3SLIA 1ZRDA 4DXZA 2JG9C 3AJYA 5A3MA 4JGYA 4Q0QA 2GDFA 3ZSLA 2HWB3 4H7LA 3M70A 1PK6A 1D4VB 4K21A 5CFDA 5B2GB 1PIV2 4N53A 2Z5WA 4Y26A 4HL0A 4RQPB 2ET7A 1ENXA 3R05A 1HRV3 1TMF1 3U4XA 4BMBA 4LT5A 2XUMA 1VLNA 4OHXA 4Q1RA 1QJY3 2Z69A 3M8LA 1BVVA 3R0RA 1J3PA 2A3XA 4K3UA 1C4RA 5K0UB 1QF3A 5CU1A 4FAHA 2C0ZA 1NY71 2WFF1 4H14A 5JR7B 3PJQA 1OFSA 3AFKA 2VNGA 1HRI2 3ZYRA 1NYWA 5H9RA 1DGRA 5F6KA 5FBZA 5L19A 1V70A 3CJXA 5CADA 1CPNA 1TNFA 1VRH2 1DFQA 3WCRA 1BBT3 2X29A 4HLTA 2MNGA 5BNPB 4WBBA 1G86A 1FAYA 2BUKA 1UPSA 2VNOA 3UKVA 1DYKA 2Q1ZB 4MVTA 2XJPA 1YHFA 5DUUA 2XVKA 5BNNA 4D3WA 3E6DA 3QOPA 2TBVA 4DFSA 4LA3A 1FOD3 2KA3A 2ET1A 2A5ZA 4WVVA 4JGZC 4BLJA 2D6KA 3ELNA 3TRSB 5HCAA 1NCQC 1J59A 1RUH2 3ZN6A 1JYCA 5LEJA 2AZ5A 3DPRA 4DRRA 4Q0VA 3ZMOA 2XLFA 4LTAA 2X5IC 4I0AA 4RS5A 3ZPYA 1UU4A 3GZTB 1R083 2HWE2 3NO8A 2VMHA 3FMGA 4N9IA 1R1A1 1OQEA 5KXBA 2ZTNA 2OUHA 5C8WA 5DDJ2 1YWKA 4COZA 3OD0A 4M3CB 1LEDA 1MS4A 2VECA 2XBO1 3R6SA 3S7IA 4BOWA 3WW4A 1N47A 3KT4A 3AKRA 4HSLA 1BKZA 2WNUA 3FLTA 2KXLA 2YGMA 3ZSMA 3NAPA 2CWSA 3V0BB 4WM7C 2VY0A 4XILA 4HANA 1PMIA 4QX5A 4DB5A 4CZSA 3TN92 2DFCA 4V1PA 1SBFA 3N3HA 4L8QA 2GN7A 4YNIA 5C8CA 1YI9A 3HBZA 4O9GA 1GZ9A 3LA3A 1TME3 4YARA 5GM0A 4FOQA 4P9JA 3VDDA 1SCRA 5LEKA 1HDKA 1OPOA 1LHWA 1N1YA 3N7JA 4E27A 3LA2A 1IHMA 2JG8B 1G9DA 5CFDB 2Y0OA 3KB5A 2K0GA 4XE9A 1CIWA 1GBGA 4Y1UA 4PLMA 4ZU7A 1AJKA 4XTMA 5AVPA 2W0XA 3LKJA 1KJRA 4Q4W3 1OMIA 5ABJB 3RI8A 1ASJ1 4YGDA 4D7TA 1J58A 1ULGA 1S0CA 3H7JA 4P14A 4Q4X3 1QOTA 4GH4A 3VZJA 1MS5A 4P9XA 4WZFA 4FO9A 4HN0A 1Y43B 5D8AA 3AZVA 5JPMB 5GZEA 1DQ5A 1H9PA 1LENA 2VOXA 5T3NA 3PVEA 2CY6A 5KXCA 3CF6E 2OZJA 1AR73 5J7MA 4YYOA 3RYPA 1CAUB 2PAEA 1JUIA 3AP6A 1H1MA 4OI1A 4GWMA 1QMJA 3ZXAC 1WD3A 1N3PA 2B8MA 4AWDA 3B00A 5H9QA 2RS12 1K5MA 4EWAA 1V6JA 1G9FA 3OBRA 1TEIA 3GHNA 1AYN3 3RDIA 4XXAA 1N1SA 2PLV1 2RS33 2LALA 4MV2A 1G6NA 2A7AA 2D5FA 2YDEA 3JBG1 4AG4A 1RUF1 1PVC3 2VPVA 2RJKA 2O0OA 4IERA 5CVRA 5KHJA 1G9AA 3SCGA 4PLNA 2IFWA 2JX9A 4CEYA 2W08A 1FMD2 1ZBE2 1CPMA 1U5IA 2VVDA 1ZZBA 1LHUA 3RJRA 3V0AB 1RUD3 5DUVA 1CQ9A 2NPIA 3ZXLA 5BNPC 3LOIA 1KD7A 2DVBA 4OHWA 4XW3A 3H0OA 3UJQA 3QCWA 3IDEA 2E51A 5JMCA 1PZ7A 2QZ3A 4RL7A 4WV8A 4HETA 4E4SA 2GNTA 4AQTA 4XHXA 2ZMLA 1JW6A 3H3ZA 5C4WA