5L7OC

X-ray structure of triatoma virus empty capsid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
276
structure length
276
Chain Sequence
b'SKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTERP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oC00
1D4M1 2HWB1 4RQPB 4Q4X3 2XBO3 5BNOA 4RQPC 3ZXAC 4Q4V1 4PDWA 1VBC1 4RFT0 3TN93 2RM22 2GH8A 2HWC1 4FSJA 1RUI2 1POV1 4CDXA 1QJX2 4JGZA 1B35B 4CDXB 2R062 5J98B 3J8F3 3VBRC 2WZR1 3VDDB 1AR93 1V9U2 5J96B 1HX6A 3VBFC 1GFF2 2WFF2 1RUH2 1QJU3 1ZBE1 2RS11 1FMD1 1EAH3 1ND3B 2WS91 5K0UA 4CEWB 1AR72 3JBG2 1ND3C 1AR83 4CEWC 4FTEA 2MEV3 4Q4Y2 4WM7A 1NCQA 1RUE3 4N53A 5BNNB 4N53B 2PLV2 4RS5C 1K5MB 1VBB2 4CDUA 1AR61 1AL21 1HXS1 1FOD2 1R1A2 2RS53 5C8CC 1MEC1 5BNPB 2RS33 1RUJ2 1R081 3JD73 5BNPC 4GH4A 3ZFGC 1PIV2 1F2NA 4GMP1 1C8M1 4AEDA 1X33A 4N43C 1COV2 5FMOS 3VBOB 2BFUL 1QQP1 1VBD3 4YVWB 1HRV1 1AYN2 3CJIA 1PVC2 1RMU3 4YVWC 1D4M2 1VRH1 2HWB2 1NA1B 1RUD3 1PO21 1RUF3 1NA1C 1NY71 4GB33 1VAKA 1EV11 4Q4V2 1VBC2 1PGL1 5ACA2 1IHMA 1ND2B 4CEYC 1RUC3 1Z7S1 1R093 1ND2C 1RVF3 2R043 4RR3B 4RR3C 1VBA3 3VBHA 3NAPA 2WZR2 3LOBA 2ZTNA 2HWF1 3ZFFA 1ZBE2 1A6CA 2RS12 1FMD2 2WS92 3ZFFB 1H8TA 4CDWA 3JB8A 1VBE3 1TME3 4CDWB 1RUI3 1QJX3 1FPN1 1NOVA 3FBMA 5L7OA 5DDJ1 1HQNA 1BBT1 3VBSA 2BPA2 1AR62 1AL22 5C9AB 5CFDC 5CFCA 1HXS2 2WFF3 4QPIA 5FMOL 4Q4X1 2Y26A 1MEC2 1R082 1BEV1 2HWE3 1PO11 5ABJB 3TN91 3JBG3 4CDQA 4IV3C 4Q4Y3 4RQPA 4Y5Z0 1NCRC 1BMV1 1HRI1 1VB2A 1QQP2 3J8F1 1AR91 1HRV2 4SBVA 1VBB3 1VRH2 1R1A3 1B35A 1QJU1 1PO22 1NY72 5AC93 2VQ0A 3IDEA 1EV12 3VDDA 3VBRB 1PGW1 1AR81 1TMF2 2MEV1 3VBFB 2R071 5A33B 5D8AC 4Y4YA 1RHI3 1ND3A 2RR13 4CEWA 5C4WC 1AYN3 5BNOC 4IV1C 2WWSA 1PVC3 4PDWC 2RS51 3VBUB 5BNNA 4GMP0 2ZAHA 1E57A 3VBUC 3M8LA 1MQTC 2RS31 1K5MA 4RS5B 1NG0A 3JD71 5A32B 4JGZC 1RB8G 1VBC3 4Q4W3 5ACA3 4RHV2 5C8CB 1RUG1 5BNPA 1FPN2 1QJY1 4JGYC 5DDJ2 1VBD1 3ZFGB 1RMU1 5K0UC 1RUD1 4N43B 1RUF1 1AL0G 2X5IC 4GB31 3VBOA 4WM7C 1AYM1 1ZBE3 1ZBA3 4YVWA 2HWD1 1BEV2 1PO12 1NA1A 1RUC1 1R091 1RVF1 2QQPA 1BMV2 2WLPA 1HRI2 1VBA1 4CEYA 3J8F2 1ND2A 4CEYB 1AL23 1HXS3 3HAGA 2HWC2 1ASJ3 4RR3A 1QJU2 4AEDC 2GSYA 1PGW2 1OHFA 1AR82 2RMU3 2MEV2 1VBE1 4YVSB 1TME1 4GMP3 3DPRC 2R072 4YVSC 5FOJB 5LK7B 4EJRA 1X36A 2ZZQA 1OOPC 2RM23 2IZWA 2RS52 4QPGC 2RS32 1C8NA 2HWE1 5C9AA 1TMF3 2R063 5CFDB 1V9U3 3VBHC 1RUG2 2BUKA 2XBO1 1RUH3 4WM8B 5ABJA 1POV0 1QJY2 1VBD2 4WM8C 1NCRA 4IV3B 1AR73 1RMU2 1C8M2 1NCRB 1H8TC 1RUD2 2DF7A 1CJDA 1RUF2 4GB32 5AC91 1AYM2 1W39A 2HWD2 3ZFEC 2PLV3 1QJZA 5JZGB 1RHI1 1R092 5JZGC 1FOD3 4RHV3 2RR11 3VBRA 5CFCC 1VBA2 1EAH1 5DDJ3 4FTBA 1RUJ3 3VBFA 5A33A 1PIV3 1PVC1 5D8AB 1PGL2 5C4WA 1RUE1 4CDQC 1Z7S2 5C4WB 2XPJA 4IV1A 1COV3 1BEV3 1PO13 5BNOB 4IV1B 4Q4W1 2BFUS 1VBE2 3VBUA 1TME2 5ACA1 1SMVA 1MQTA 4PDWB 1D4M3 1MQTB 2HWB3 4RS5A 5A32A 2HWF2 1HRI3 4JGZB 1B35C 4CDXC 4Q4V3 3VDDC 5C8CA 4JGYA 2HWC3 1POV3 2FZ1A 1VB4A 4JGYB 3ZFGA 1ZBA1 2HWE2 5K0UB 2X5IA 2WZR3 1BBT2 4N43A 2R073 2X5IB 4WM7B 1NCQB 4Z92B 4Q4X2 2XBO2 1NCQC 5BNNC 2RS13 1FMD3 2WS93 4N53C 4FTSA 3TN92 1K5MC 1ASJ1 4CDUB 2R041 5AC92 4CDUC 2RMU1 4NWVA 1DDLA 1AR92 4BCUA 4GH4B 1AR63 1RHI2 4GH4C 4AEDB 1RUG3 2RR12 1F8VA 1M06G 1MEC3 3DPRA 1QJY3 1EAH2 4YVSA 1R083 3VBOC 3DPRB 2RM21 1C8M3 1RUE2 3CJIB 1RUI1 1OOPA 1QJX1 3CJIC 1AYM3 1OOPB 1WCDJ 2HWD3 4NWWA 1TMF1 2R061 1QQP3 4Q4W2 4QPGA 2TBVA 2BBVA 2FZ2A 1HRV3 1V9U1 4LLFA 4QPGB 1VRH3 2WFF1 3JB4C 3S6PA 1RUH1 1PO23 5CFDA 1EV13 3JD72 1AR71 3JBG1 3VBHB 4Q4Y1 5GKAC 3NAPB 3NAPC 4WM8A 1OPOA 1Z7S3 1ZBA2 4IV3A 2PLV1 3ZFFC 1AUYA 1VBB1 1H8TB 1FOD1 1CD3G 4RHV1 1R1A1 3ZFEA 4CDWC 2HWF3 3ZFEB 1RUJ1 5L7OB 5JZGA 1PIV1 5L7OC 1ASJ2 1RUC2 5C9AC 3VBSB 1RVF2 5CFCB 2R042 3VBSC 1FPN3 4QPIB 1COV1 2RMU2 4QPIC 5D8AA 5ABJC 1AYN1 1BBT3 4CDQB
chains in the Genus database with same CATH superfamily
5T3NA 3E6DA 3POWA 3OYWA 1W03A 1YLLA 2EAAA 1OVPA 4RQPB 5FPAA 4XE9A 1ZYBA 2XBO3 2VMFA 3I2JA 3OYWB 4IERA 3I59B 4RQPC 5FV3A 3ZXAC 1L7LA 1UPIA 4Q4V1 4UWDA 1U5XA 2H6CA 1MZEA 1VBC1 4PDWA 3WW2A 3TN93 4MYEA 1LHOA 4Y22B 4AG4A 2HWC1 4AE2A 3KGLA 4F7ZA 4AVAA 2VTFA 1QJX2 4JGZA 1PNFA 4K3UA 4QXCA 5CISA 1A8DA 1MACA 1OKOA 1QJFA 2A6VA 3SH3A 3V56A 1J84A 3J8F3 3VDDB 3R6SA 5KHHA 2UY9A 5FPBA 1JZ5A 1FYUA 3HQRA 3RZHA 2J7MA 1C1FA 2ARXA 2Y38A 4XMAA 1RUH2 3MUY1 3KCYA 5B4NA 2WSUA 1H30A 1FMD1 1ND3B 2Y33A 3QOPA 5F3IA 3T2PA 1TQ5A 4MGZE 4BXFA 2O1QA 1ND3C 3PMEA 4OHWA 1QH6A 3NL1A 4E2SA 1KXGA 4CU6A 3N3HA 5GLZA 2AC1A 2D93A 2YYOA 2WAOA 3VZMA 5A70A 4QXKA 1SFNA 2GC0A 2PHXA 5JXIA 4LHLA 4AF9A 1X8EA 2PLV2 4M4PA 4RS5C 5J1XA 1K5MB 1UYZA 4EQVA 1D7PM 2W46A 4X8PA 3D6EA 4QHOA 4CDUA 1AR61 5JOYA 1ENQA 5FJHA 1JTZX 1FOD2 1GUIA 2ZS6B 4BLIA 5LA1A 1IGOA 2WUHA 3IPVA 1QIQA 2YGMA 5C5TA 4GWMA 5C8CC 1K42A 1UZZA 3UETA 2Y6KA 1VAMA 4GH4A 1GQHA 3MIGA 4L99A 1GWMA 3LCPA 3NV2A 4QXBA 4NIAA 2JIGA 3WV6A 5G05L 4XCAA 5FZ8A 2I07B 2NMOA 1UY1A 2E7TA 4N43C 5JR2A 1B09A 2YG0A 4HXCA 1W6MA 1YHFA 3WF0A 2R0HA 1QQP1 3GHNA 1VBD3 3GALA 2CYFA 1RMU3 1XBFA 1WCKA 4MZUA 1QHDA 2BYVE 1LODA 2HWB2 4UFHA 2BWCA 2GNMA 5GZCA 4Q27A 1OPMA 1RUF3 1NY71 2D7FA 4GB33 4QX1A 1JN2P 1LRHA 4V2WA 1N3OA 1W6NA 4D6SA 3GXUA 2QE3A 4FXGB 4H14A 5LBEA 2FCVA 5L9RA 4PLNA 2X29A 2P4EA 1L7QA 3EB7A 5F2SA 4YG6A 5FO7B 2VUAA 4QDQA 2WQZC 5E16A 2R043 4AVBA 1ZRIA 1TNRA 2PHTA 3PUQA 1C5HA 2RV9A 2FMYA 4OI1A 3MUZ1 4C1XA 5CKQA 5E1RA 3USSA 2XJVA 4PF5A 5FZ0A 1NLRA 2QQUA 2ZTNA 5GJ6A 2RS12 4C0BA 1D2QA 1O3SA 4LKFA 1IZ3A 1O4TA 3RG0A 1Y3TA 3H42B 3AKPA 4R52A 2J42A 4ES9A 5EP9A 4IE6A 1OC1A 1W3XA 1ZZ9A 4U2AA 2K46A 3RWKX 5L7OA 3VL9A 2W52A 5IVCA 5ANQA 1DYKA 4FPKA 3PNAA 2YB7A 2BP6A 3KS7A 4NPMA 1BBT1 3VBSA 3ZKUA 5JXHA 1AL22 1UYYA 1WLCA 2P3IA 5IK8A 4H2AA 2FDIA 3I3QA 1RXGA 1H6XA 4QHBA 3TWIA 2JDKA 1R082 1BEV1 4ZKTB 1PO11 1OKQA 1UF2C 2YHJA 3CQOA 3U78A 4MG2A 3INAA 4ZU4A 4IV3C 4Q4Y3 3POEA 4E27A 1F4AA 2VBDA 4FBFA 4NIGA 3MPPG 5BUVA 2ZGSA 1BMV1 3PHMA 4LA2A 4W65A 4BMEA 2ZMLA 5I8YA 2BVBA 3AX4A 3H1WA 4F8AA 1UY3A 1AR91 1HRV2 1JS9A 2WLQA 1LHVA 4XDPA 1JZ3A 2PHWA 5F2WA 3I2KA 1B35A 1UOFA 4PIYA 4OI4A 4CU7A 2BNMA 2I74A 1OF3A 1DGRN 1W9FA 3DKWA 3I2GA 5D2AA 3IDEA 4YWAA 4ZS2A 4UBGA 5JVVA 5AC93 3K48A 4M3CA 4B4RA 2XVGA 1OLRA 1HV0A 2HEWF 3ILNA 3VBFB 2R071 3WW4A 5JDBA 1XE7A 1RHI3 3AM2A 3MIFA 1OLME 1Q5OA 2WWJA 1OD5A 1ST8A 4PIXA 1ENRA 5C4WC 1LGBA 3VB9A 2Y6GA 2WKKA 5FYZA 3DEMA 4XJ8A 4HVRA 4NPLA 3WF2A 4QM8A 5FUIA 4YM0A 3HMYA 1AYN3 2RJLA 2WWSA 1PVC3 5EYXA 4B7KA 1UXZA 1WBFA 5BNNA 3P3PA 1VLNA 4QMAA 2PA7A 4EROA 3CL1A 1MQTC 4XTMA 4FFHA 2HBUA 5IAVA 4P00B 3WDTA 3JD71 4XFBA 3MLLA 3T1MA 3ZN5A 1RB8G 1VBC3 3VHPA 1CJPA 2NPIA 3L2HA 3H8RA 4H3WA 2DBNA 2YFZA 3VDBA 1WCQA 2GU9A 4QKNA 4R4XA 5DPNA 1YQ5A 5E89A 4BQ1A 4RGAA 5BNPA 4UT5A 1FPN2 4MXWB 2XJSA 2J1EA 3NNGA 3LSEA 3WG1A 3ZFGB 4BYYA 5AVAA 4JKLA 3O1VA 2WA3A 2JG9B 4NE9A 4B4PA 4AQTA 3FHQA 2JG9C 5K0UC 1AX2A 4ZXEA 1BVVA 3PIGA 1RUD1 4W50A 3U4XA 2X5IC 2PHUA 3VBOA 4UYBA 2VQTA 2ET1A 1ZBA3 3KZ4C 1EUUA 5CVRA 1MZ6A 5FP8A 1S0EA 5C3QA 3O0VA 4YPJA 2W1SA 4HN0A 4NMIA 1GP4A 4KWUA 1QXPA 1I1EA 3ZYPA 1JW6A 1RUC1 3I8TA 2E7QA 2X53S 1R64A 3K4AA 2KXLA 4U36A 1W8TA 1O3TA 2WLPA 1IPJA 4MXVA 1VBA1 1G9FA 1ONAA 3SCGA 1LOCA 4COYA 3ZXGA 2KM2A 4JVAA 2RJKA 1YIPA 4XXPA 2LROA 2HWC2 1ASJ3 3V64A 4E4ZA 2E53A 1QJU2 1SLCA 1S0CA 4AEDC 3RZMA 1AX1A 5A7NA 1J1LA 1JZ4A 1KS5A 1LHWA 3S30A 4RGGA 4XBNA 5EJZB 4Q1RA 1PGW2 4HK9A 3BOWA 1AR82 4IEPA 1V6NA 1KFXL 3MIDA 1JZ2A 4YVSB 1TME1 3M2MA 2D6OX 4HETA 5DAVA 1UPSA 4FAGA 4YVSC 2ARAA 5FOJB 5FO8B 5LK7B 1DG6A 2VE1A 4IGQA 4AHXA 5DUXA 4LORA 4EJRA 5JSOA 4LKEA 3O1TA 4LBKA 3U0ZA 2EAKA 3Q8FA 5DABA 2CU5A 3WD5A 1YEWA 3ZXEA 1JOBA 2VR4A 3OPWA 1LEMA 2JDHA 4YM1A 3QH7A 3PMSA 1UYPA 2TUNA 2XHNA 5FZAA 3I7DA 5T54A 4BQWA 3TEWA 4ATEA 3I49A 2RS32 1H1IA 1I5PA 3WDXA 2HWE1 1IPSA 2V09A 1BCXA 2XOMA 2VCCA 5C9AA 3D5OA 2P1BA 3HT1A 5FY8A 1V9U3 2CV6A 1JZ8A 3AK0A 1NX9A 5FZFA 4DY5A 1JI6A 2D5FA 2NM1A 2D6LX 3JU9A 5EQUA 1LJ7A 2FQPA 2YUEA 3RQ0A 2J22A 3OF1A 2W94A 2VZVA 3KCCA 1YIFA 1E5IA 2JDAA 2ET7A 3RI8A 3T30A 3TEXA 2JXAA 1DGWA 1H8TC 1MVEA 3WOGA 1AYM2 1W39A 1DQ0A 4XFHA 3AMPA 3OSDA 1MZ5A 3AZXA 2HWD2 4OQ9A 5FR3A 3JQWA 2QTWB 1QJZA 1W8OA 5HCAA 5JZGB 4AFMA 5J36A 2OZJA 1R092 5JZGC 2AH2A 4X6RB 4PT6A 2XQXA 1UU5A 3VBRA 4BE3A 5CFCC 4HLTA 2Y6LA 3APBA 1RUJ3 1PNGA 1XNAA 2WO7A 3MHZA 5DAXA 5A33A 1PIV3 4AZZA 2XJRA 2B7YA 1PZ8A 4NR1A 4LO6B 1KDMA 3IDAA 1UMHA 1BHGA 2GP3A 1X9TA 2VOVA 2QQNA 4CU8A 2XPJA 5SV5A 1K3IA 4IV1A 2J1TA 2ZHKA 1NUKA 1RITA 4D0QA 2G9GA 1SFPA 1BEV3 4OI2A 1PO13 2HKXA 4GA9A 4GQ7A 3FE5A 4IV1B 4Q4W1 5ERLA 1VBE2 5FYYA 5ACA1 5A1AA 4CE8A 1JZ6A 3L2YA 2IVIB 3ENRA 1D4M3 4ARXA 1DYOA 2C4XA 3IMMA 2ZHNA 1ZZCA 1G9BA 4CDXC 2XVLA 1AJKA 5B2GB 1TEIA 2VGDA 4XUQA 4FVVA 4M0HA 4JGYA 1OBNA 5HCFA 4LLOA 4ATFA 2FZ1A 2ZOEB 1ULEA 1VB4A 4JGYB 3T1LA 3M3QA 3KMHA 2D6MA 5BXXA 4D3WA 1LEDA 1U5ZA 2XJQA 4AI0A 2ID4A 2ZKLA 4P14A 3RNSA 2DCZA 5BNQA 5JMOA 1BBT2 3CLPA 4BU2A 2R073 2WNUB 1HDKA 4QT6A 4Z92B 4YGDA 2Y6HA 4A6OA 4FQZA 2R49A 1QXJA 2LUWA 2D44A 2WS93 4N53C 3S7EA 5LASA 4LNVA 4CUGA 3AL5A 3M3CA 1LKNA 3B93A 1GV9A 1YFWA 2FCUA 3C7OA 3A22A 4L92A 3KT1A 4XF3A 2QDNA 3IZOA 3PLQA 1OUXA 2VW0A 1AR92 4LK7A 4BCUA 2YC2A 3N9LA 4R9DA 3ZIWA 2VZRA 2ZGOA 2IXLA 3AB0A 4BB3A 1SLAA 3UJQA 5CAZA 3CF6E 2VZQA 3IIAA 3PIJA 2ZX2A 1M06G 1YYNA 3CIHA 1EAH2 3DPRA 3GF6A 3O1SA 5CA6A 1L3JA 3DPRB 3PVNA 1Q8QA 4GWIA 4PBPA 2IFWA 4HSLA 3MO4A 4MGKE 2VZPA 1QJX1 4NROA 4FP3A 2F4PA 1W3VA 2YZ4A 4LHKA 2R16A 4LLFA 2A3XA 2OPKA 5IT6A 1W9YA 3R4UA 5CZKA 3RZLA 1QJEA 5FLIA 3U10A 2P34A 4DB5A 3JB4C 2D3SA 2VZ1A 1RUH1 2BQPA 2ZGPA 5DAQA 1ULDA 2PHFA 1XPWA 3O0XA 5CFDA 4BH9A 3JD72 3HNMA 4UI9L 4BQXA 3H8XA 3WP4A 3VBHB 1JH5A 4GULA 2O8OA 2GMPA 1S0IA 2RG4A 3BPZA 4O65A 1PMJX 4ARYA 2EIDA 4WM8A 5BY5A 4OVEA 4CP0A 1Z7S3 1L7RA 3FL7A 2FDKA 4A3ZA 3OGVA 2PLV1 3VGIA 1W05A 1GR3A 3FN9A 2A5ZA 4WVMA 5KXDA 4OCTA 5FBJA 1CAXA 4QPYA 3MGUA 3WW3A 3OOXA 1FOD1 4WVMB 1NZIA 4CDWC 5LA2A 2D6KA 1MS4A 4XJ9A 5FP3A 3OG2A 3AKTA 1O91A 5L73A 3ACFA 3UGHA 2WWUA 1QY4A 3CMGA 4FOYA 3U75A 3EQEA 1Q8PA 4Y1ZA 3ETPA 4COWA 3EHKA 1RUC2 5KHKA 2VCBA 3AYAA 3H1YA 2VPVA 4WZFA 3NRUA 1UW8A 4QPIB 2ADEA 5FP9A 2Y0IA 5FYMA 4C90A 5K7PA 1FXZA 2AGSA 1H9WA 4LE4A 3FZ3A 4QPIC 5D8AA 2Q1FA 3BN6A 5ABJC 5EJ1B 4INDA 4CDQB 3WQ0A 5JCTA 1Q8OA 1SLLA 1LU1A 2HWB1 2XR4A 2WJSA 4A7ZA 4ASLA 2X05A 3T2OA 3PVEA 2GN7A 1HLCA 5BNOA 1BJQA 1Z78A 3WQ7A 4BMBA 1Y9MA 1W8WA 2RM22 5A7QA 1IKQA 1IS6A 1RUI2 4IEOA 4YM3A 3U11A 5H9PA 4CTEA 2C5DA 4HZFA 2Z69A 3TEZA 5LBCA 2W2IA 1UY2A 2YC0A 3UGGA 1AZDA 5DMYA 2C9AA 2R062 1BLZA 3I3EA 3H50A 4K20A 4Y20B 3ZYJB 2A6XA 3Q8CA 4EN8B 2JKXA 3MW2A 5FY4A 4QQPA 2WFF2 2E9QA 3A21A 3E97A 2HEYF 2R1BA 2VC9A 4XBQA 2BNNA 3ZSMA 1FATA 1NXMA 3CZJA 3HPNA 2RS11 3FLRA 2BTVC 1S2EA 2WC2A 2B5HA 1LECA 5FPVA 1G9DA 2P3YA 2MEV3 5LY2A 2ILMA 1BQPA 1H9PA 4NAMA 4WM7A 5DUUA 4LO8A 1IQDC 1REDA 4CP2A 1UMZA 2B39A 3AP7A 1UOGA 3IB3A 4IL7A 5FY0A 1H2LA 2AENA 4COVA 1DZQA 1AL21 2AEYA 3VKMA 4QB6A 1CESA 4L11A 1R1A2 1UWWA 2RS53 4B3NA 1CAVB 4HPKB 2JEMA 1XE8A 2QQIA 2CGOA 2IXKA 4XF9A 3GYDA 4OUEA 1R081 4YZ3A 4QHZA 3LA7A 4IE5A 4YM2A 1F2NA 1K12A 2WINB 5F3EA 2F6BA 4O61A 1RXFA 4ORFA 3HBKA 5KXBA 4R8HA 4AL9A 1RJ7A 5JI7A 2JDMA 2BGOA 4AW7A 4YFZA 3O1PA 2BWAA 4RD7A 2BFUL 2O14A 4Z07A 4YVWB 1HRV1 3SEPA 3CJIA 1JXNA 2QUOA 4D6QA 3B5LB 4YVWC 2PMWB 3AZVA 1GMMA 4WVZA 1W2NA 3VV1A 4Z2AA 3OUJA 4TZDA 1PK6B 2PXJA 1QH7A 1PK6C 5A3MA 1ZA4A 1FAYA 3VZOA 3ZXJA 3WG4A 1C4RA 5ACA2 1SQ4A 1ND2B 3WNKA 2IVJA 3ZN6B 4XVHA 4LBLA 5E6HA 1ND2C 4A7YA 4IEXA 5J7MA 5FP4A 1JHJA 5BPXA 3NO8A 3POJA 4DFSA 4A41A 1MVQA 3NAPA 4KNCA 3MW4A 4P9WA 5KHGA 2WZR2 3H3UA 3VKOA 3OGSA 2H6BA 3HNYM 2YV8A 3UESA 5IVBA 4XBLA 1F5JA 1H8VA 4CRQA 4IQPA 1JUIA 1UMIA 4BQ4A 3WSOA 2ZGRA 3VDCA 2HWF1 1ZBE2 2A3YA 4GKXA 2H0VA 5I0DA 3MIHA 1O8SA 1IG3A 2DVDA 3WY6A 1X8MA 3IMNA 4UF0B 4AGVA 3KB5A 2G4IA 2RDRA 3EYPA 1DQ1A 2YXSA 4J6GA 2CDPA 4NUBA 2I45A 1QJX3 3C8XA 1FPN1 2JJ6A 5F6LB 5F3CA 3LEIA 4BXSV 4MADA 3KQ4B 3I4IA 5KXCA 3VUOA 3W59A 2A7AA 1POQA 2JG8B 4ITCA 5JPNB 2FDGA 1ZZ6A 2NZ9A 3A7QA 4OUSA 4Q4X1 3VZJA 1H6YA 1MEC2 3K51A 3FUOA 3WVJA 4AVTA 5HV4A 2E26A 4AXOA 5I8TA 1W8UA 3M4FA 3NNLA 1W8HA 3W21A 1WMFA 3AFKA 1US2A 2QKDA 2PELA 4RQPA 4Y5Z0 3T3YA 1NCRC 1WLDA 4META 4XQDA 1Y7BA 3KVBA 5I0RA 3I59A 4LBOA 4N8MA 1OF4A 1MS9A 2DCKA 3GBFA 4C91A 2FDFA 3AL6A 1WD3A 2EIGA 2ZKNA 3H0OA 4Y22A 5D1IA 3GNEA 2D5HA 1F5FA 5T52A 3MYXA 4EN9B 1VRH2 3UKVA 5GM0A 1AF9A 2WQ8A 1GICA 3IBMA 2VVEA 2V72A 4QM9A 1UU6A 1QJU1 5EZWA 4NIDA 1PO22 2D97A 3T0BA 3S57A 1EV12 3VDDA 1NQJA 2E51A 2VNRA 1PGW1 1SDWA 4Q0QA 1AR81 3ZR5A 1ZRDA 1RTVA 3QD6A 3VZNA 3WQBA 1OA4A 1GZ9A 2NLRA 4JV4A 3FJSA 5A80A 5JXJA 4L97A 1I9RA 4FPJA 2LTNA 3D0SA 1EY2A 1ND3A 3LSDA 2RR13 2B45X 5FY5A 4DMIA 1J83A 4XIOA 4UOJA 5EV7A 1MS3A 2PFWA 3ZXFA 1PVXA 3R4SA 5CKMA 5KXEA 3D3AA 3ZLIA 2VQAA 1CAWB 5F5QA 2UY8A 4PDWC 1CAUB 4K8RB 5EWSA 3USUB 3VBUB 2OPWA 3DKQA 5FZCA 3VBUC 1S0JA 2RS31 4YW4A 1UU4A 1K5MA 4OYUA 1GP5A 4RS5B 4AQSA 1H4GA 3WXPA 3ZOIA 4JGZC 2C0ZA 3NSTA 3M3EA 3VKFC 4FXKB 1HB2A 5HCHA 1RGSA 4FFGA 4AAPA 4ZU5A 4J1XA 5IWFA 2YBSA 5FY7A 3T2QA 5C8CB 2HH9A 3OD0A 2XMLA 4S2HA 1QNYA 1WZXA 2Y0OA 4JQRA 1UZ0A 3ZXDA 4EV0A 2VZOA 4H7LA 2FBEA 2R1DA 4NN0A 3DYMA 4Q8KA 5GLUA 2OQ7A 3I54A 4QB1A 1G9CA 2QQJA 1T6GC 3J7MA 2DYCA 4N43B 3Q8EA 3KGZA 4OHXA 1AYM1 4N9HA 5DUVA 5FY9A 2HWD1 5A3WA 1JYVA 2SBAA 4RGKA 1JU3A 4CCJA 3V0BB 2X10A 3VLBB 4KWJA 2WZPP 5FZKA 4PQ9A 1VMJA 4CXXA 1R091 1RVF1 4EWDA 1UOBA 5GZGA 1V6JA 2ZACA 5A3LA 1HRI2 4O9EA 2VMCA 2PN5A 1XC6A 1IKPA 1YUDA 3J8F2 4IETA 5CADA 2CSGA 1NLQA 3E6BA 1AL23 5EYYA 4DUVA 3VDAA 1GP6A 1KS4A 3POBA 1VE0A 5DQ0A 3NNMA 5FPLA 2ZX4A 4LJHA 2Q8CA 4D8MA 2DUQA 4AQ6A 4F3JA 5A7OA 4CP9B 3LEMA 4ES8A 2RMU3 4GKYA 4JX0A 4WBBA 5KHIA 4XAEA 1VBE1 3N7JA 4W4ZA 2CAUA 2VJXA 5BYNA 3ROUA 3ZM8A 4G9SB 3BKZA 4DXRA 3AFGA 4UAPA 4XILA 4YZ2A 3BI3A 3MZHA 3B3QE 3LD8A 4G4FA 5JMCA 1OOPC 5J3UA 5E88A 1GZWB 3WEZA 3WNPA 2XXZA 2EXIA 3QCWA 5D21A 2V4VA 1MZFA 3KF3A 3AMMA 4WVWA 2ZEWA 4QPGC 3CO2A 5FYIA 3WHTA 5DZEA 3ST7A 2XGXA 3DUIA 2VZTA 2ETEA 2B46X 2VCMA 1BKZA 2BJSA 2YBPA 3GGLA 3LF7A 1GNZA 3DGTA 4GAZA 5I0SA 3BTXA 4GALA 4WVVA 1YJLA 4AFBA 4GJYA 3V65A 3C7EA 2AYHA 1ACCA 4AGRA 4Z8BA 5FZ6A 4AI8A 3S0MA 1QNWA 1QJY2 1OT5A 1VBD2 4CXYA 5FXWA 1H0BA 2DCYA 4IV3B 2IXIA 1AR73 2V73A 2VXRA 5K8SA 1CVNA 1KQRA 1RMU2 1O59A 2P3KA 2VMEA 5FZEA 3OJBA 2VOXA 2UWBA 3MICA 1RUF2 4GB32 2JDNA 2VNVA 3AKRA 2W68A 1IQAA 3LB9A 1Q3EA 1ZA7A 4LHSA 2QCSB 4KWKA 4AVCA 1W2OA 4DZGA 2BOJA 1MS5A 3K3NA 4I09A 4CZSA 2GC1A 1JOPA 3ACIA 3O0WA 1WKYA 1AX0A 2E33A 1M4WA 3DCQA 4N7UA 3ACLA 4S2FA 1ZRCA 3K4ZA 2Q1MA 3AKSA 4HOOA 4LBQA 1EAH1 1PZ7A 4NIHA 4NO4A 3VBFA 2WO3A 1ULGA 1J3QA 3OBZA 4LBQB 1D2SA 2JB4A 2P37A 4W8JA 5C4WA 1XE0A 1ZVFA 1SG3A 3BPSA 1FV2A 5DG2A 5C4WB 4JTNA 1S55A 1UAIA 2EIEA 3PURA 1UO9A 1COV3 1OD3A 1WGPA 3H7JA 4QGNA 1OQ1A 3B9IA 1E5SA 4LO7A 4XFGA 4V2VA 3WNLA 3ON7A 4IE7A 3CDZB 1F31A 1MQTA 1SBFA 3AC0A 5JIAA 5L9BA 4M3CF 2BDRA 1MQTB 1W04A 1LENA 1WLWA 2BGCA 2HWF2 1LU2A 4K1ZA 3AJZA 1LULA 4AVSA 1WUVA 1B35C 3M70A 4OUMA 1C28A 4B1MA 2QFEA 5F7UA 4Q4V3 3C7FA 3PDQA 2ZGTA 3NV4A 5LBFA 3WUDA 5FOBB 1SCSA 4I30A 1YFUA 4A45A 3OD4A 2HWC3 4MXWA 1I6XA 3S5QA 4CXWA 1KFUL 4CVUA 4MSVA 3ZFGA 1X7NA 2Y34A 5I0TA 2JG9A 3J9SA 1HJFA 2UYBA 2W47A 5K0UB 1OLMA 2X5IA 3GBGA 2C6SA 3Q8AA 4IEUA 4PJYA 1DIWA 5DAPA 1AR62 3ZIXA 1IS4A 2X5IB 3ACGA 1NCQB 1QMJA 2ARCA 4Q4X2 1YXWA 3WHUA 4XEZA 1EUTA 1JUHA 1NCQC 2VOWA 3ZO0B 4YFWA 5BNNC 2Q8OA 2CGPA 2GNDA 1FMD3 2Y60A 2LW8A 4FCAA 2V5YA 1V6OA 4D7TA 1AJOA 2GDFA 2XUMA 4G3YC 4Q0PA 5HI0A 2QQLA 2WNEA 1UKGA 3D82A 3NNJA 4YW1A 2ZCWA 5FUNA 4EN7B 5T5JA 3LIHA 5AC92 3BTZA 1DCSA 2P6HA 3FHIB 1JYCA 4XJUA 1DLLA 2RJ2A 1UX7A 1W9SA 1F15A 1S0BA 4NWVA 5LEJA 2BZDA 1ENSA 1W2UA 4CPBD 4P5YA 5DN2A 4NHLA 1AR63 1RHI2 1C3HA 1XYNA 2VCAA 4AEDB 2R0FA 4JDOA 2BV4A 3NJVA 3GZUC 1F8VA 3I2FA 3ILFA 3GBWA 2W1UA 4KU7A 1ULCA 4YVSA 4HG6B 4DRRA 4BHPA 3VBOC 2RM21 1XYOA 1XXNA 3AJYA 1RUE2 4JQTA 4LXLA 4EZHA 1RUI1 3ZR6A 2B42B 4CP1A 3ZSEA 1QOOA 1UY4A 2KR2A 1AYM3 4PHZA 3H1MA 3BYWA 2A6WA 1WCDJ 2HBTA 2HWD3 3I3BA 2VD7A 1TMF1 2R061 1QQP3 3ILRA 2JKBA 2TBVA 3B02A 3MW3A 4I0WB 2JDPA 4DPNA 1O4ZA 2Y8KA 2YY1A 1V70A 3URFA 2PAKA 4ET7A 3FHAA 1SCRA 1WWYA 3VL8A 2WFF1 4JRLA 2VNOA 1VALA 4B8EA 2AR6A 3N7MA 1NZCA 3B01A 5LCWL 2B9VA 5CFCA 2A71A 2XWBB 5FP7A 3B00A 1FI2A 2A75A 4BQ3A 4CCEA 1OPOA 3PTYA 1WA4A 4GWJA 2C26A 1ZBA2 3I97A 4MGTA 2D3RA 2QZ3A 3VD7A 1JYWA 4BPZA 1YQ2A 3LIGA 3ZFFC 2ZEYA 2OYZA 4P9GA 1H8TB 5BV6A 1RUNA 4RHV1 1GANA 1R1A1 4Q29A 2WZEA 4AWDA 1K45A 5C5UA 2Q5TA 5FYTA 3PUSA 3T4VA 4C8DA 5JZGA 3MEPA 5FZOB 1QWRA 2JD9A 2B8MA 3SKJE 3WW1A 5IFPA 1ASJ2 3C2UA 4OMDA 2P5BA 3H8UA 1HQLA 5C9AC 1D0GA 1RVF2 1SEFA 5CFCB 4XPVA 1REEA 3KHCA 5CG9A 3B94A 5FY1A 3WNMA 4MX3A 1X82A 3WP5A 5F9TA 1RUOA 4KI5M 1JZ7A 3PUAA 2VMDA 5FBZA 3WCSA 1BBT3 1SLTA 2VUDA 2OA2A 3AYCA 3GM8A 1G7YA 4RFRB 5CKNA 3AMQA 3TBDA 4XETA 2IXJA 3UNPA 4F83A 5FJKA 1IG0A 3H9AA 3GZAA 3OGJA 1VRBA 2CY6A 4DRVA 3B69A 4RFT0 2JE7A 1KRIA 5C9AB 3C3VA 5FYHA 3CKHA 1O8PA 2GH8A 4Q0VA 3SHRA 5F37A 4FSJA 1POV1 1J3PA 1VJ2A 1AXZA 4BISA 4CDXA 5JIUA 1VMHA 1H2NA 4OMCA 4UW5A 4AHYA 1S0GA 1BK1A 3AKQA 4CDXB 4JTOA 1FNZA 2PHDA 3SMHA 3HD8B 5C71A 2VZSA 3VBRC 3SXWA 2WZR1 3UKNA 1AR93 1V9U2 4PLOA 2C1FA 3ZVXA 1P8JA 2ZBJA 2ARBA 1BYHA 4YZ5A 1GFF2 1WD4A 4NHMA 4LTAA 1GKBA 1QKQA 1DZRA 5FAXA 4ZHNA 5FZHA 2E7AA 1ZBE1 2VZUA 1EAH3 1VR3A 4LPLA 5FMDA 2DU0A 4CEWB 3JBG2 2OT7A 2WNUA 2Z4FA 4CEWC 1PX4A 4LIVA 5ANNA 4FTEA 4LOSA 5FZ3A 4UW3A 1IOAA 1SPPA 2PYTA 2VMHA 4N53A 4KGGA 3H7YA 4B7EA 4CCOA 4DOUA 1A8MA 1SPPB 4XF4A 5IATA 4N53B 3LPFA 4MH0E 3IDBB 3KCXA 2XJPA 3UYJA 1C1LA 1W0OA 3GDBA 1VBB2 3HN3A 3N35A 3SQOA 3ZKYA 2WNVC 2Z42A 3AZYA 1NXD1 2HYKA 4QGLA 1UL9A 1MEC1 5H9RA 4D69A 4AHZA 4AR2A 5LB6A 4Y1YA 1RUJ2 4YG3A 3JD73 4LUKA 5IFTA 1PIV2 4GZ9A 2WBKA 2VOTA 1C8M1 2G1MA 5C3OA 1QF3A 1ENXA 3IAQA 2XWJB 5J37A 2R7EB 4MGIE 1APNA 2PTMA 2QQOA 4JKKA 4QX3A 5A3UA 4AHWA 3EJKA 5IK5A 3EXUA 3AVSA 5FMOS 4NHKA 1GWKA 2CTVA 3TOJA 4QKFA 3GJAA 3LA2A 2WZ8A 4HSJA 4P02B 3S5AA 3DV8A 1LOFC 5GZDA 1D4M2 1PMIA 1VRH1 1X9PA 5L36A 5GZFA 3HQXA 1G9AA 3RMXA 1NA1B 4OQ8A 1U12A 1RUD3 3J7NA 4E2GA 3OEAA 1PO21 2RDSA 1NA1C 4PCRA 4A6SA 5KHJA 1N1SA 2AZ5A 2WN2A 1EV11 3GHMA 1UIJA 2KA3A 4UW6A 3KHBA 3RPQA 2XL9A 2BU9A 2GALA 1PX3A 2ZEXA 3H3ZA 3POSA 2GN3A 3HQUA 1PGL1 4RN5A 1CPNA 2HLEA 4QX8A 1IHMA 3TAYA 4CEYC 4KQ7A 1RUC3 3ZSLA 4Y3OA 3SH5A 5JLVA 1XB9A 1LOBA 1LHNA 4H55A 4RR3B 3WLUA 4XUTA 3N9NA 2V4AA 5HXVA 1H2KA 1VBA3 4RR3C 3VBHA 4L0PA 1RJ8A 5FZGA 2FHRA 3MPBA 5C3PA 2XLGA 3HIFA 4YNIA 3I3DA 5FYVA 4HKOA 4XC9A 1GZCA 1KJLA 1ZNPA 4TWTA 4MGQA 1ZRFA 2VVFA 4LBMA 5CNAA 1SBEA 4HVQA 2LALA 2RHPA 3NV1A 5FCCA 2WS92 3FFQA 4K21A 4MHUA 4PI2A 2TEPA 4CDWA 4PBOA 1TME3 1YQ8A 1EYBA 2VG9A 3I2DA 4N9IA 4CDWB 3I2OA 4XCBA 4UW4A 1RUI3 3A23A 4Q0SA 2NYYA 1NOVA 3FBMA 2BERA 4FPLA 3K46A 4HANA 1A3KA 3E5XA 5JOWA 3BIWE 3CZUA 1HQNA 2KD7A 3C7GA 3MBWA 4M0NA 3HWJA 1LCLA 2CAVA 5FYUA 2ZX3A 3R05A 3UT0A 4XMIA 1HXS2 1YQ6A 5CFDC 1UN1A 3T4HB 4E4HA 4FPHA 1OFSA 1S0DA 2WFF3 4QPIA 5FMOL 4QX7A 2Y26A 1OA2A 3WT3A 1V6KA 3THTA 4DXZA 4TYSA 3QH6A 4JHTA 2J1AA 3HVDA 2HWE3 2XH6A 3OPTA 3LGRA 4X6QB 1H2MA 3TN91 4TLFA 5ABJB 3OBTA 4CDQA 2ATFA 1HKDA 4DY3A 3UKTA 4OFGA 1V6MA 5A7PA 4NPRA 3ZYRA 2VUCA 1OUSA 2DTWA 3THPA 1HRI1 1PM7A 1VB2A 1Y4WA 3AVRA 3PJYA 4ISRA 4XUNA 3J8F1 5I91A 3IIIA 4DQAA 5IVFA 1LGCA 4CCNA 3KM5A 1ULOA 1NE6A 1O6UA 1RIRA 4UFKA 4UFJA 3RYPA 1R1A3 5F3GA 5FMBA 3W9AA 1LOGA 3Q9OA 2LRPA 1SLBA 4P08A 5C7GA 2W87A 4Y20A 2GH2A 3JQXA 4IEZA 4I3GA 4XFAA 3MIEA 4XW3A 5AFBA 1TMF2 5FPXA 1W28A 2Q4SA 3MLJA 2UURA 5D8AC 4Y4YA 2WN3A 3KF5A 3HN1A 3WR0A 1YJKA 2DUOA 4EWAA 3RFRA 1CQ9A 5F5IA 1PGSA 5BNOC 4Z2WA 1MS0A 1UZWA 4W6XA 2P2KA 4J25A 5T5LA 2XKOA 2P17A 1W8NA 5A6YA 3M8LA 5FZ1A 5C3RA 4ONUA 5FLJA 1W99A 3A4UA 1NG0A 5A32B 2HJIA 4XYXA 5A6ZA 2JDUA 2OQ6A 4Q4W3 4NIIA 3HT2A 1CAVA 4HPKA 5ACA3 2XQRA 3V0AB 4RHV2 1CIYA 2P6CA 4XIKA 3FWEA 1R1ZA 2UU8A 2VO5A 4HMZA 5FZDA 3U14A 4COZA 1QJY1 5DDJ2 1VBD1 2WDBA 4PQQA 3WNXA 3WNNA 1HN1A 3ZYHA 1UY0A 1RMU1 3TEYA 2BBVA 2QNKA 3OUIA 4HL0A 4ZPIA 3WDVA 3OB8A 5FYBA 5CB7A 4QQLA 1RUF1 4GB31 1XNBA 3FFZA 4WM7C 1ZBE3 4YVWA 2I2SA 4Q5OA 5I8SA 2W0XA 2LS6A 1JYIA 1W6QA 4ASMB 4COUA 3N9OA 5F1RA 4LA3A 1UYXA 2OXBA 5IAXA 1W6QB 4AQ2A 4JZRA 1PK6A 4MLOA 2QQPA 2R30A 3KQRA 3W58A 1JYXA 3BTAA 1NQDA 4IEYA 1BXHA 1T6BX 4QU2A 4BQ2A 1WBLA 2DVFA 1ND2A 4M01A 3ZN6A 1DGWX 2K9ZA 4LR4A 4FPYA 5FXXA 3ORJA 1CR7A 1S0FA 1W90A 3D8CA 4LIUA 4NVPA 4YW5A 1PM4A 5LA9A 3R4DB 5T5OA 2ZGKA 2GSYA 1AVBA 4KGQA 3WP3A 2C24A 1XYPA 2H0BA 4YGBA 2MEV2 5CU1A 1A34A 2WO1A 1UX6A 1WW6A 2Z2SB 5IYYA 2W3JA 2VECA 4QXHA 2BNOA 3GJBA 4BK5A 4JKMA 3AXDA 1H4HA 3K75B 1UXXX 5F6KA 3VZKA 1I3HA 4UF0A 3MI8A 2WABA 3NNFA 2WRAA 2W39A 3ABZA 3POFA 3OGGA 2Z5WA 3I2HA 4R9CA 1H1MA 1XRUA 4DUWA 2RS52 4JHZA 5LRRA 3OUHA 5EFUA 1X50A 2JIJA 3AZWA 4Y5TA 2WT1A 1QOSA 3PUIA 4CCLA 2YFUA 4UXAA 2JG8A 4AVVA 4XHBA 3O7OA 3T2TA 5IW0A 4Y26A 3T0DA 4Z82A 3AP4A 4QB2A 1RUG2 1D4VB 2ZXQA 3MFCA 2W1QA 1RUH3 1UZVA 1NYWA 4XABA 3ZDSA 4D94A 2IXHA 4XHXA 4YW2A 3VD4A 1NCRA 2GP5A 5EHDA 1C8M2 1NCRB 3RGBA 4P9XA 2DF7A 3EBRA 1CJDA 5CG8A 1UOJA 5AC91 3UV9A 3C7HA 2VTXA 2WNOA 4A2UA 5I93A 1YNAA 2JE9A 5L9VA 5T55A 4LHNA 3ZFEC 4B4QA 3AYDA 2PLV3 4I01A 4XZPA 4BM8A 3GZTB 4AI9A 5JOXA 2EICA 3BIEA 3NV3A 2JDZA 1NLSA 2A3WA 1FV3A 2PAMA 4YW6A 3J4UH 1RHI1 1U5YA 3E5QA 5M0TA 4FOVA 1FOD3 1A78A 4ZU7A 2DU1A 1DF0A 3LQCA 4L2NA 2WR9A 5JAXA 3BU7A 2RVAA 4MO3M 3IKWA 5FWJA 1FX5A 3GZEA 4YW3A 3DN7A 1QU0A 1PVC1 1PGL2 3POIA 1E5RA 1HV1A 1RUE1 1RYYA 1I5ZA 1MR5A 1AXYA 2PHRA 2Y64A 2FDJA 2ZHMA 2HEVF 1OH4A 1WCSA 2ZEZA 2MPFA 3LPGA 2GMEA 5EPAA 1WMXA 1ZREA 4YARA 2B9UA 3AP9A 3I2IA 1CAWA 4QKBA 3USUA 1CAUA 3VBUA 1SMVA 4PDWB 5A6QA 1XNCA 1BZWA 1YQCA 2HWB3 3RDIA 4RS5A 3BALA 3WF3A 1CWPA 1HRI3 4JGZB 5A6XA 4ZXKA 2NN8A 1S4CA 2XVKA 2ZGQA 3VDDC 5C8CA 2ORZA 4ZY9A 4CUAA 1PHMA 1SBDA 3PVBB 2GZWA 4E8DA 2A70A 5FQ0A 2WL1A 1ZBA1 3THDA 3WZ1A 2JICA 4K40A 4FOQA 5FQ0B 2VOKA 2ZGMA 4MHRA 4AGGA 3ZMNA 5FIXA 1JOJA 2J1SA 4NAOA 1JMUB 3CNAA 4N43A 3RZZA 3VD3A 4YW7A 4EYUA 2NQYA 3OEBA 4BQ5A 1DGLA 2A6YA 2CDOA 2GC2A 1DP0A 2XBO2 3V0BA 3SC7X 1US3A 1GOHA 2OS2A 2RS13 4FTSA 5EJ3A 3EO6A 2D6NA 3TN92 1ODNA 2XLAA 4I0BA 2WT2A 1K5MC 3F2ZA 4JCKA 4IEWA 4LO5B 3FLPA 1ASJ1 3T08A 4DUXA 3EMRA 4CDUB 2BVVA 3AMHA 2NMNA 3ZSKA 2ZGLA 1N1TA 4CDUC 2OW4A 3IPVB 2W5FA 1LR5A 4GXLA 2DFCA 5IVVA 2VXJA 3RJRA 3TB0A 2E31A 2C9KA 5FDBA 1JYNA 4GH4B 1MPXA 2OX0A 3ACHA 2OUHA 4XAAA 4A4AA 1O3QA 3IWZA 4GH4C 4XUPA 5H9QA 3PTRB 4JC1A 4D6RA 2RR12 3RZGA 3WDYA 3TNQA 4LQRA 4CP9A 3VKLA 1QJY3 2P3JA 4MV2A 1N1YA 2VULA 2DURA 3IT8A 5C33A 1W6MB 1R083 2R6QA 2JDYA 1LOEA 1PZ9A 1XU1A 3ES4A 3O14A 4FPCA 5F8PA 2X8KA 1SZBA 1YFYA 1OOPA 1O3RA 4YZ1A 1Y9GA 3ZXLA 1OOPB 1GZWA 3ZN4A 1QEXA 3OTFA 4NWWA 4BOWA 1YCIA 4QPGA 1ULPA 2FZ2A 4HBNA 1KJRA 4O9GA 2EF6A 1IS5A 1HRV3 1RL3A 1V9U1 1W6NB 3VHRA 3BU0A 4JDMA 4QPGB 3WUCA 5I0UA 4LMFA 1JU4A 2J1UA 4IGPA 2IC1A 1CIWA 1BVP1 1JYTA 2ADDA 4LULA 1G8WA 1K5JA 2DUPA 3FC0A 3JBG1 2YU1A 4NHXA 4XFFA 3SKVA 1RC6A 5GKAC 4A42A 4PF1A 3CU7A 1STMA 4KBBA 4XFCA 3NKGA 4URTA 4XACA 2ZZJA 4N90A 4YGCA 1W06A 3AYEA 4IV3A 3HBZA 5J48A 4ZONA 3JZVA 5L19A 3HR9A 3O1MA 1C57A 1LTEA 4BLJA 1MS8A 1AUYA 1VBB1 2HYXA 4GWNA 1V0AA 5A1LA 5DZGA 1VAVA 4LEJA 2EALA 3AZZA 3MDPA 1UIKA 4C1WA 4YZ4A 2WT0A 2HWF3 5CEHA 2XG3A 4LKDA 3DXTA 1RUJ1 5L7OB 1ZZ8A 4BWOA 5HCBA 1WMEA 2PQSA 1PIV1 5FLHA 4CCCA 5L7OC 2RDQA 4LOTA 2IWGB 4RYDA 5EXOA 5APAA 2V5DA 1NKGA 2WA4A 4M3CE 3VBSB 2FMDA 4CCKA 2F4LA 2R042 3KSCA 1O5UA 3KV5A 3VBSC 1FPN3 4DNYA 3M3IA 1YRZA 1XSRA 3UGFA 2RMU2 1CZSA 2J1RA 4D7SA 4QPWA 1W9TA 2QQWA 3AMNA 4W6YA 4AI2A 3RVHA 1DZTA 4XQWA 1D4M1 4DO0A 2DFBA 3E1F1 3NKTA 3O12A 4CCMA 4EN0A 1OFNA 1VMFA 4X8NA 4E4SA 4IEVA 4Q4X3 3KV9A 5SV8A 2XUEA 3LAGA 3LWCA 4A7KA 1W0PA 3NW4A 3MFAA 1HW5A 2YC4A 3LFIA 2AEZA 2W1WA 4ISQA 2XHKA 3MV11 1XNTA 1UKRA 3DXUA 4A3XA 1GQPA 1XOYA 1W0NA 1TE1B 1W9WA 2VMIA 3CJXA 3PU8A 4H7MA 1B35B 5TSWA 3UJOA 1HJGA 4UFMA 3DF0A 5F5CA 3M3OA 5DXDA 3OBRA 3NJZA 3OBAA 4QGMA 3ZXKA 3ASIA 4QX2A 4KWLA 5J98B 3TNPB 5J96B 4M3CB 1HX6A 2JWPA 2WIIB 4D7YA 5HV0A 3VBFC 2PAEA 4QDSA 3WDUA 3MLKA 3NJYA 5FUPA 2YU2A 4AK3A 1QJU3 4QWNA 2ZMKA 2VU9A 3PUHA 3LDKA 5K0UA 2WS91 1TG7A 5FYCA 2EXHA 3WCRA 1AR72 1N3PA 2ZMNA 1AR83 4IW3A 4Q4Y2 2W95A 3RZKA 1NCQA 1RUE3 2VUJA 2ZGUA 1XU2A 4P9JA 2Y6JA 5BNNB 1GBGA 2EXJA 2SLIA 1HQWA 2WAAA 3H3LA 2L9LA 1Q8SA 1DQ2A 3UK9A 2VAUA 5JR7B 2CWMA 1J58A 2WQ4A 3K3OA 3AXEA 3POGA 2XLFA 3VN4A 1HXS1 2XJUA 3N9QA 2VQUA 4AI1A 4Q8LA 5FYSA 1MS1A 4LO4B 4BJ0A 1YC61 5FK7A 2RDNA 1SHWB 2RS33 3GCWA 5BNPB 5LY1A 3SLIA 1WA6X 5BNPC 3ZFGC 3KV6A 1D0HA 4GMP1 5A1FA 4AEDA 2EA7A 4Z1VA 4P9IA 5GALA 1OXCA 1X33A 5K9YA 4BA6A 4K1YA 2E6VA 2Q1ZB 2ZAAA 3OCPA 4XJAA 1COV2 4FPEA 4IGOA 3VBOB 4FPOB 4FOWA 4AYUA 4E8CA 1AYN2 4DS0A 3NMBA 3SH4A 1PVC2 1YI7A 4OULA 5FWEA 3W5NA 4NRMA 1Z0HA 4BQYA 1V6LA 2CWSA 1LESA 3L9JT 1GOFA 5JI9A 1VAKA 3VZLA 4Q4V2 4YRDA 3NWKA 5DAWA 4JRAA 4L9BA 4I2OA 1VBC2 4Y33A 2CHHA 2D40A 3BTYA 3N7KA 2A73B 3LEKA 3BB6A 1LGNA 3BOPA 3O1OA 2QDRA 3PU3A 3KT7A 1Z7S1 4DIQA 1FNYA 1R093 1RVF3 2FCTA 3P3NA 1DBNA 4L8QA 4YLZA 2FD8A 3CBNA 1OQDA 5FZBA 4B1LA 4Q26A 3W20A 3WDWA 4AEKA 1WLTA 4K8FA 2BOIA 4K7JA 2DVBA 2A6ZA 1Y43B 3LOBA 2BRTA 2IXCA 1DQ5A 3A0NA 5FPZA 1DQ4A 1NT0A 1UNBA 4QU1A 3WG3A 3ZFFA 1A6CA 2DVAA 1FMD2 1KDKA 4FP2A 3HEIA 3ZFFB 4KBZA 3M7AA 1H8TA 1Q8VA 4QQHA 3LA3A 3JB8A 1OLQA 4XOGA 1TZOA 1VBE3 4XUOA 2UWCA 3OGRA 4CUCA 2GNBA 3ELNA 3KLSA 1DLCA 1F35A 2N7GA 4NJ4A 4LT5A 4P5HA 3HOBA 4FPFA 1TVGA 1DHKB 3CEWA 5DDJ1 2QJVA 3LDRA 3N7LA 5FZOA 3WNOA 3ETQA 3M1HA 3RZJA 3RWNA 3QACA 1JODA 5JSRA 2QQKA 2IUWA 2BPA2 2Q0AA 4KH9A 4E2QA 2O8QA 3N36A 5FZIA 3WINE 1T2XA 1EPWA 3PVOA 2XKPA 1E5HA 2LM3A 2O0OA 4SLIA 4YSFA 5KR7A 3LDBA 3ITQA 1OA3A 4GIQA 4TN7A 5ISLA 5LK5A 5AVPA 4BDVB 4EZ4A 4MGYE 1SFYA 1S2KA 4QQ2A 3Q8BA 2VW2A 4URAA 3JBG3 2K0GA 5JOZA 3I3MA 3SEEA 4M00A 4I3PA 2DDUA 3VHOA 1O4YA 2W9XA 2QBXA 5E8AA 1OSGA 4K9SA 4A44A 1GOGA 3FMGA 1QQP2 4SBVA 1VBB3 2QVSB 1W2AX 1YWKA 3OY8A 3THCA 5FRAA 3G6JB 3ZYGA 4E9KA 1EP0A 5IVEA 3U07A 2UYAA 3OY8B 4Q1PA 5DG1A 3ALQA 2GMMA 1NY72 5FXZA 4UFLA 3HNBM 2VQ0A 2YROA 4NOTA 2DVGA 3U37A 3VBRB 4DEQA 2MEV1 5C8WA 3SNMA 4ZZ8A 4FPGA 2VY0A 4P9LA 3FLTA 2EVXA 5FKCA 4MUVA 4FAHA 5A33B 4OHVA 1O7FA 3AP6A 3ZX7A 1NAEA 1W2TA 4MOAA 5GLVA 1SLIA 1UD1A 4CEWA 4OZOA 3AP5A 5HPOA 5LWBA 1GQGA 4Y5SA 5IUQA 5FZ4A 4Y4RA 4HKLA 3KD4A 4BK4A 4IV1C 2NP0A 4HVOA 5DUWA 4W6WA 1XNKA 2RS51 4FFFA 4Q0UA 1QOTA 4GMP0 2E32A 4UFIA 4XFIA 2ZAHA 1E57A 3FX3A 4XURA 4OZXA 1N3QA 2CGNA 3LFMA 2WNVA 2YMZA 3MF6A 3SCHA 3LEGA 3BUCA 3WG2A 1SDDB 1UZYA 5LATA 1GYKA 3LZZA 2WNVB 2ZX0A 4XF0A 2OKXA 1S2BA 3ZSJA 1OI6A 5A3OA 1G86A 1OURA 4KG0A 4K6BA 4KMQA 1RUG1 3WP6A 3BODA 1BK0A 1J59A 2VBPA 2YBKA 2ZHLA 4JGYC 3U1XA 1AXKA 1IPKA 2VZ3A 2Z79A 1HN0A 3IM0A 3KT4A 4FO9A 4PI0A 1W8ZA 1GSLA 4LBNA 1JHNA 1ZM1A 1DU3D 2XONA 3ZPOA 5J09A 3ZMOA 2D6PA 2WNUC 3W5MA 3N9MA 4BZ4A 2GNTA 3P5BA 1AL0G 2MNGA 3IN9A 3WF1A 3K4DA 1KITA 5GLTA 1LOFA 1BEV2 1PO12 2WSVA 4HKWA 3E6CC 1QXRA 1Q56A 3BCWA 1VPHA 2DBIA 5CYYA 4BIFA 1NA1A 2ZJCA 1LHUA 3J26N 4QKDA 2DCTA 2QQMA 1WW4A 3K77A 1BMV2 2IFRA 4S2DA 3U4SA 2XL7A 3ME2A 2DWRA 4P9YA 1G6NA 3JUUA 5FPUA 4MVTA 4CEYA 5IK4A 4OI0A 4KL1A 1ALYA 1XSQA 4LK6A 1C5IA 5LEKA 5GLWA 5KBFA 4Q2FA 3O5SA 4QQOA 3WX5A 4CEYB 1HXS3 1V00A 2QZ2A 3BVCA 3HAGA 3K2OA 3N9PA 3P6BA 4RR3A 5JUVA 3VKNA 4IEQA 4XDOA 1URXA 4I02A 1CX4A 1Y9QA 4R9AA 4RSUA 3T0AA 3ES1A 4EE2A 4HK8A 1OHFA 3B7MA 2ZGNA 1XQNA 2YDEA 4GMP3 3DPRC 2R072 1ZZ7A 4FT8A 4HONA 5G04L 1GU3A 4DEVA 1S1AA 2WO2A 1WCUA 2JB8A 3J7HA 1X36A 1O5LA 5A3TA 2ZZQA 2EIBA 3KV4A 3NJXA 4PLMA 3RRDA 4S2GA 5CIRA 5IK7A 5JWPA 4LITA 1VP6A 4KG8A 4XDQA 3ZDVA 1LOAA 2RM23 1UCXA 2D98A 2IZWA 5IHRA 1PMHX 5F39A 5C3SA 4TTGA 2JX9A 2YPDA 3PL0A 5K4LA 1GNHA 2E63A 1ODMA 1C8NA 1DGRA 1VIWB 2ENRA 1KD7A 1TNFA 4IUGA 1TMF3 2R063 1GWLA 2DCJA 2R32A 5FKBA 5CFDB 1DFQA 3VBHC 4CCDA 4O7XA 2YPJA 4PIZA 5IVYA 3JXSA 2CL2A 2G19A 1KGYA 3MV01 3D4KA 4YG0A 5FTTC 5C70A 2X09A 2BUKA 4CU9A 1HB4A 2XBO1 4WM8B 5ABJA 1GLHA 1J3RA 1JBCA 1POV0 1F4HA 3RSJA 4WM8C 3X29B 4ZZ5A 2WFPA 2JE8A 3FBYA 3ZYBA 2W91A 1W8FA 4IESA 4WV8A 4XTPA 1RUD2 1CAXB 4LBQD 3RYKA 5FMCA 3IDCB 4HFSA 4N7IA 2UWAA 1SACA 1QDCA 4JDNA 4CUBA 4HT1T 1W6OA 3ZPYA 4AOCA 4RHV3 4AAXA 2RR11 4XZUG 1W6OB 5C6CA 1OH3A 4RA0A 1VBA2 4Y1XA 5DDJ3 3SISA 1HB1A 3NVCA 4FTBA 5KC5A 2ES3A 1N47A 5T50A 4EWEA 2MHFA 5D8AB 4DXTA 2AREA 4IDZA 3KVAA 4ZS3A 3VD5A 1XJAA 4B29A 3RI9A 1Z7S2 4CDQC 5EIYB 1ZZBA 4LE3A 3LKJA 5HBAA 5IVJA 3S7IA 1LB2A 4YGEA 2F17A 5A3NA 5T5PA 5BNOB 4CYDA 3RS6A 2BFUS 3CHXA 1TME2 2ORXA 4AEJA 1ZX5A 2JENA 2PQQA 5KWRA 2J1VA 4BIOA 4QDRA 2ZABA 2GC3A 2VTXJ 3B9CA 5GZEA 5A32A 1V6IA 5FXVA 4AI3A 1QGLA 5AFEA 1IS3A 3DECA 3ECQA 4GD4A 4UBHA 4TSVA 4HN1A 4XQ4A 2K2SA 4QX5A 5B4XA 4M4RA 3V0AA 4ASKA 1CX1A 2JECA 4Y1VA 1POV3 2AACA 3TYJA 2G9FA 1CONA 1GNYA 2A1XA 3QBQA 1QDOA 2HWE2 3LE0A 4FQ4A 1ULFA 3RMYA 4AFCA 4QD2A 4R4ZA 3DYOA 2VM9A 2WZR3 5FK8A 5F5AA 4C0HA 4CSWA 2VBBA 5CBLA 2YGLA 3PJQA 1HB3A 4WM7B 3ZYFA 4XJZA 2QQVA 5A3PA 5JXGA 1OMIA 4YYOA 1KEXA 5FZMA 3N4MA 4Y1UA 3FUQA 1CPMA 2R041 3OPZA 2XDVA 2XJTA 3POYA 4AFAA 3DYPA 5F32A 2EXKA 1RINA 1CZTA 3HJRA 4NRQA 2RMU1 3E5UA 2WYFA 1YO8A 5IJRA 5LZ6A 1FT9A 1U0AA 4E4DX 3P1IA 1DDLA 3F95A 3RYRA 1F9KA 2TNFA 1ZRRA 3KWVA 4AFDA 3R0RA 1RUG3 2ZA9A 2VNGA 4JAAA 4EN6B 3RJ2X 1MEC3 2GAUA 4IXLA 4AEMA 4TXWA 3GCXA 1C8M3 3NQHA 1CN1A 3CJIB 2BW8A 4CPBA 2B4KA 3A0KA 3CJIC 2BEOA 3JCIA 4KU8A 5H9SA 2RE9A 2Y6FA 1LAJA 2ZPXA 5FFOC 5FZ7A 3SCFA 4OHYA 4TLGA 4NHYA 2W92A 4Q4W2 1W6PA 4OLLA 3SITA 2D3PA 2DV9A 1W6PB 2CNAA 2VVDA 3D0JA 2XB6C 1VRH3 4NRPA 3O1UA 2WYSA 4IE4A 4LBJA 1CZVA 1WMDA 3S6PA 3BGAA 3MF9A 1WW5A 3VHNA 1PO23 1N1VA 1EV13 1YFXA 3O1RA 4R9BA 1AR71 1H1AA 5FREA 5LA0A 4Q4Y1 3NAPB 3ATGA 2OVUA 2BGPA 3WQ1A 5HXMA 5A7WA 3NAPC 4QX0A 2BBAA 5JSPA 2AUYA 4RL7A 4MGSA 2OZ6A 5A7WB 1GZTA 5FZLA 3WF4A 4FI9A 1HIXA 2W08A 2Q30A 1XNDA 2VW1A 5LW9A 1DQ6A 3H8OA 2Q8EA 2Q8DA 1UQXA 5A7SA 1J1TA 3IAPA 4Y24A 1NE4A 1WW7A 5LBBA 1DYPA 1CD3G 3DL3A 4CA9A 3ZFEA 1CGPA 4GJZA 5FZ9A 3UL2A 3T09A 3ZFEB 1EPZA 5KC6A 5JPMB 4V1PA 5FO9B 2G9ZA 2VH9A 4FFIA 4OHZA 4QAWA 3ZYIB 2DTYA 1YI9A 3TRSB 3J7LA 2VL4A 3LOIA 4WZCA 2VMGA 1LNSA 4XJWA 2JG8C 2ZX1A 4XXAA 1OQEA 4J1WA 4XF1A 2OIIA 5DZFA 1AHSA 2ERFA 4DXSA 4LUMA 1OVSA 1COV1 2JD4A 2FDHA 3QLQA 2D43A 1U5IA 2PHLA 5LRSA 1REFA 4DINB 3VD9A 1AYN1 4I0AA 4IE0A 4LKSA 3MIBA 1Q43A 3G7DA 2OUJA
chains in the Genus database with same CATH topology
5T3NA 3E6DA 3POWA 3OYWA 1YLLA 2EAAA 4RQPB 4XE9A 1ZYBA 2XBO3 4IERA 3OYWB 4RQPC 3I59B 3ZXAC 1UPIA 4Q4V1 1U5XA 2H6CA 1MZEA 1VBC1 4PDWA 3WW2A 3TN93 4MYEA 1LHOA 4Y22B 4AG4A 2HWC1 4AE2A 3KGLA 4F7ZA 4AVAA 1QJX2 4JGZA 1PNFA 4K3UA 1A8DA 1MACA 2A6VA 3SH3A 3V56A 3J8F3 3VDDB 3R6SA 5KHHA 2UY9A 1FYUA 1C1FA 2ARXA 2Y38A 4XMAA 1RUH2 3KCYA 2WSUA 1H30A 1FMD1 1ND3B 3QOPA 1TQ5A 4MGZE 2O1QA 1ND3C 3PMEA 4OHWA 1QH6A 3NL1A 4E2SA 1KXGA 3N3HA 5GLZA 2D93A 2YYOA 3VZMA 4QXKA 1SFNA 2GC0A 2PHXA 4LHLA 4AF9A 1X8EA 2PLV2 4RS5C 1K5MB 4X8PA 3D6EA 5JOYA 4CDUA 1AR61 1ENQA 1JTZX 1FOD2 2ZS6B 4BLIA 1IGOA 3IPVA 2YGMA 5C8CC 4GWMA 1UZZA 1VAMA 4GH4A 1GQHA 3MIGA 4L99A 3LCPA 3NV2A 3WV6A 2I07B 2NMOA 2E7TA 4N43C 1B09A 1W6MA 1YHFA 2R0HA 1QQP1 3GHNA 1VBD3 3GALA 2CYFA 1RMU3 1WCKA 4MZUA 1QHDA 2BYVE 1LODA 2HWB2 5GZCA 2BWCA 2GNMA 4Q27A 1OPMA 1RUF3 1NY71 2D7FA 4GB33 1JN2P 1LRHA 1N3OA 1W6NA 2QE3A 4FXGB 4H14A 4PLNA 2X29A 4YG6A 5FO7B 2VUAA 2WQZC 5E16A 2R043 4AVBA 1TNRA 2PHTA 1C5HA 2FMYA 4OI1A 4C1XA 5E1RA 3USSA 2XJVA 4PF5A 1NLRA 2ZTNA 5GJ6A 2RS12 4C0BA 1D2QA 1O3SA 1IZ3A 1O4TA 3RG0A 1Y3TA 3AKPA 4R52A 4ES9A 1ZZ9A 4U2AA 5L7OA 3VL9A 2W52A 1DYKA 4FPKA 3PNAA 3KS7A 1BBT1 3VBSA 1AL22 1WLCA 2P3IA 5IK8A 4QHBA 3TWIA 1R082 1BEV1 4ZKTB 1PO11 1OKQA 1UF2C 2YHJA 3INAA 4ZU4A 4IV3C 4Q4Y3 4E27A 4FBFA 3MPPG 5BUVA 2ZGSA 1BMV1 3PHMA 4LA2A 4W65A 4BMEA 2ZMLA 5I8YA 2BVBA 3AX4A 3H1WA 4F8AA 1AR91 1HRV2 2WLQA 1LHVA 2PHWA 1B35A 4PIYA 4OI4A 2BNMA 2I74A 4AHWA 1DGRN 3DKWA 4BA6A 5AC93 3IDEA 5JVVA 4UBGA 3K48A 4M3CA 4B4RA 2XVGA 1OLRA 1HV0A 2HEWF 3ILNA 3VBFB 2R071 3WW4A 5JDBA 1XE7A 1RHI3 3AM2A 3MIFA 1Q5OA 4PIXA 1OD5A 1ENRA 5C4WC 1LGBA 2WKKA 4XJ8A 4HVRA 4QM8A 4YM0A 3HMYA 1AYN3 2RJLA 2WWSA 1PVC3 5EYXA 4B7KA 1WBFA 5BNNA 3P3PA 1VLNA 4QMAA 2PA7A 4EROA 3CL1A 1MQTC 4XTMA 3WDTA 3JD71 4XFBA 3MLLA 3T1MA 3ZN5A 1RB8G 1VBC3 3VHPA 1CJPA 2NPIA 3L2HA 4H3WA 2GU9A 4R4XA 5E89A 4BQ1A 4RGAA 5BNPA 1FPN2 4MXWB 2XJSA 3LSEA 3WG1A 3ZFGB 4BYYA 5AVAA 2WA3A 2JG9B 4B4PA 4AQTA 2JG9C 5K0UC 1AX2A 1BVVA 1RUD1 3U4XA 2X5IC 2PHUA 3VBOA 2ET1A 1ZBA3 3KZ4C 5CVRA 1MZ6A 1S0EA 3O0VA 4HN0A 1I1EA 1QXPA 3ZYPA 1JW6A 1RUC1 3I8TA 2E7QA 2X53S 2KXLA 4U36A 1O3TA 2WLPA 1IPJA 4MXVA 1VBA1 1G9FA 1ONAA 3SCGA 1LOCA 4COYA 3ZXGA 2KM2A 4JVAA 2RJKA 1YIPA 4XXPA 2HWC2 1ASJ3 3V64A 4E4ZA 2E53A 1QJU2 1SLCA 1S0CA 4AEDC 1AX1A 1J1LA 1KS5A 1LHWA 3S30A 4RGGA 4XBNA 3WINE 4Q1RA 1PGW2 4HK9A 3BOWA 1AR82 4IEPA 1V6NA 1KFXL 3MIDA 4YVSB 1TME1 3M2MA 2D6OX 4HETA 4FAGA 1UPSA 4YVSC 5FOJB 5FO8B 5LK7B 1DG6A 4AHXA 5DUXA 4EJRA 5JSOA 3U0ZA 2EAKA 3WD5A 3ZXEA 1LEMA 4YM1A 3QH7A 3PMSA 2TUNA 3I7DA 5T54A 4ATEA 2RS32 1H1IA 3WDXA 2HWE1 2V09A 1BCXA 5C9AA 3D5OA 3HT1A 1V9U3 2CV6A 3AK0A 4DY5A 2D5FA 2NM1A 2D6LX 3JU9A 1LJ7A 2FQPA 2YUEA 3RQ0A 3OF1A 3KCCA 1YIFA 2ET7A 3RI8A 2JXAA 1DGWA 1H8TC 1MVEA 3WOGA 1AYM2 1W39A 1DQ0A 4XFHA 3AMPA 1MZ5A 3AZXA 2HWD2 3JQWA 1QJZA 5HCAA 5JZGB 4AFMA 5J36A 2OZJA 1R092 5JZGC 2AH2A 4X6RB 1UU5A 3VBRA 4BE3A 5CFCC 4HLTA 3APBA 1RUJ3 1PNGA 5A33A 1PIV3 2XJRA 2B7YA 1PZ8A 4NR1A 4LO6B 1KDMA 2VOVA 2XPJA 5SV5A 4IV1A 2ZHKA 1RITA 2G9GA 1BEV3 4OI2A 1PO13 2HKXA 4GA9A 4GQ7A 3FE5A 4IV1B 4Q4W1 1VBE2 5ACA1 3L2YA 3ENRA 1D4M3 2ZHNA 1ZZCA 1G9BA 4CDXC 2XVLA 1AJKA 5B2GB 1TEIA 2VGDA 4FVVA 4M0HA 4JGYA 5HCFA 4LLOA 4ATFA 2FZ1A 2ZOEB 1ULEA 1VB4A 4JGYB 3T1LA 3M3QA 3KMHA 2D6MA 5BXXA 4D3WA 1LEDA 1U5ZA 2XJQA 4AI0A 2ZKLA 4P14A 3RNSA 2DCZA 5BNQA 1BBT2 3CLPA 2R073 2WNUB 1HDKA 4QT6A 4Z92B 4YGDA 4FQZA 2R49A 1QXJA 2LUWA 2D44A 2WS93 4N53C 3S7EA 4LNVA 3M3CA 1LKNA 3B93A 1GV9A 1YFWA 4L92A 3KT1A 4XF3A 2QDNA 3PLQA 2VW0A 1AR92 4BCUA 4R9DA 3ZIWA 2ZGOA 3AB0A 2IXLA 1SLAA 3UJQA 5CAZA 3CF6E 3IIAA 2ZX2A 1M06G 1YYNA 3DPRA 1EAH2 3GF6A 5CA6A 1L3JA 3DPRB 3PVNA 1Q8QA 4PBPA 2IFWA 4HSLA 4MGKE 1QJX1 4FP3A 2F4PA 2YZ4A 4LHKA 2R16A 4LLFA 2A3XA 2OPKA 5IT6A 3R4UA 5FLIA 3U10A 4DB5A 2P34A 3JB4C 2D3SA 1RUH1 2BQPA 2ZGPA 1ULDA 2PHFA 3O0XA 5CFDA 4BH9A 3JD72 3WP4A 3VBHB 1JH5A 4GULA 2O8OA 2GMPA 1S0IA 3BPZA 4WM8A 5BY5A 4OVEA 4CP0A 1Z7S3 2PLV1 3VGIA 1GR3A 2A5ZA 4WVMA 5KXDA 1CAXA 4QPYA 3MGUA 3WW3A 1FOD1 4WVMB 4CDWC 2D6KA 1MS4A 4XJ9A 3AKTA 1O91A 5L73A 1QY4A 4FOYA 3EQEA 1Q8PA 4Y1ZA 4COWA 3EHKA 1RUC2 5KHKA 3AYAA 3H1YA 2VPVA 4WZFA 1UW8A 4QPIB 4C90A 2Y0IA 5K7PA 1FXZA 2AGSA 1H9WA 4LE4A 3FZ3A 4QPIC 5D8AA 5ABJC 4INDA 4CDQB 3WQ0A 5JCTA 1Q8OA 1SLLA 1LU1A 2HWB1 2WJSA 4A7ZA 4ASLA 3PVEA 2GN7A 1HLCA 5BNOA 1BJQA 1Z78A 3WQ7A 4BMBA 2RM22 1IKQA 1IS6A 1RUI2 4IEOA 4YM3A 3U11A 5H9PA 4CTEA 2C5DA 4HZFA 2Z69A 2YC0A 1AZDA 2C9AA 2R062 3H50A 4K20A 4Y20B 3ZYJB 2A6XA 4EN8B 3MW2A 4QQPA 2WFF2 2E9QA 3E97A 4XBQA 2HEYF 2R1BA 3ZSMA 2BNNA 1FATA 1NXMA 2RS11 3FLRA 2BTVC 2WC2A 2B5HA 1LECA 1G9DA 2MEV3 2ILMA 1BQPA 1H9PA 5DUUA 4WM7A 4LO8A 1REDA 4CP2A 1UMZA 2B39A 3AP7A 4IL7A 1H2LA 2AENA 4COVA 1DZQA 1AL21 3VKMA 1CESA 4L11A 1R1A2 2RS53 4B3NA 1CAVB 4HPKB 2JEMA 1XE8A 2CGOA 2IXKA 4XF9A 3GYDA 1R081 4YZ3A 4YM2A 3LA7A 1F2NA 2WINB 2F6BA 4ORFA 5KXBA 4R8HA 1RJ7A 5JI7A 4AW7A 4YFZA 2BWAA 4RD7A 2BFUL 4Z07A 4YVWB 1HRV1 3CJIA 1JXNA 2QUOA 3B5LB 4YVWC 3AZVA 4WVZA 3VV1A 4TZDA 1PK6B 1QH7A 1PK6C 5A3MA 1ZA4A 1FAYA 3VZOA 3ZXJA 3WG4A 1C4RA 5ACA2 1SQ4A 1ND2B 3ZN6B 4LBLA 1ND2C 4A7YA 4IEXA 5J7MA 5BPXA 3NO8A 4DFSA 1MVQA 3NAPA 4KNCA 3MW4A 4P9WA 5KHGA 2WZR2 3H3UA 3VKOA 2H6BA 2YV8A 4XBLA 1F5JA 1H8VA 4IQPA 1JUIA 2ZGRA 2HWF1 1ZBE2 2A3YA 4GKXA 2H0VA 3MIHA 3WY6A 2DVDA 4AGVA 1X8MA 3IMNA 3KB5A 2G4IA 1DQ1A 2YXSA 4J6GA 2I45A 1QJX3 1FPN1 2JJ6A 5F6LB 3I4IA 5KXCA 3VUOA 3W59A 2A7AA 2JG8B 4ITCA 5JPNB 1ZZ6A 2NZ9A 4OUSA 4Q4X1 3VZJA 1MEC2 3WVJA 3K51A 3FUOA 4AVTA 4AXOA 5I8TA 3M4FA 1WMFA 3AFKA 2QKDA 2PELA 4RQPA 4Y5Z0 1NCRC 1WLDA 4META 4XQDA 1Y7BA 5I0RA 3I59A 4LBOA 2DCKA 1MS9A 3GBFA 4C91A 1WD3A 2EIGA 2ZKNA 3H0OA 4Y22A 5D1IA 3GNEA 2D5HA 1F5FA 5T52A 3MYXA 4EN9B 1VRH2 3UKVA 5GM0A 1AF9A 4QM9A 1GICA 3IBMA 2VVEA 5EZWA 3ZIXA 1UU6A 1QJU1 1PO22 2D97A 1EV12 3VDDA 1NQJA 2E51A 2VNRA 1PGW1 1SDWA 4Q0QA 1AR81 1ZRDA 1RTVA 3QD6A 3VZNA 1OA4A 1GZ9A 2NLRA 4JV4A 3FJSA 4L97A 1I9RA 4FPJA 2LTNA 3D0SA 1EY2A 1ND3A 3LSDA 2RR13 2B45X 4DMIA 4XIOA 5EV7A 1MS3A 2PFWA 3ZXFA 1PVXA 3R4SA 5KXEA 2VQAA 1CAWB 5F5QA 2UY8A 4PDWC 1CAUB 5EWSA 3USUB 3VBUB 3VBUC 1S0JA 2RS31 4YW4A 1UU4A 1K5MA 4RS5B 4AQSA 1H4GA 3WXPA 4JGZC 2C0ZA 3NSTA 3M3EA 3VKFC 4FXKB 1RGSA 4ZU5A 4J1XA 5C8CB 3OD0A 4S2HA 1QNYA 2Y0OA 4JQRA 3ZXDA 4EV0A 4H7LA 2FBEA 2R1DA 4NN0A 4Q8KA 5GLUA 3I54A 1G9CA 1T6GC 2DYCA 4N43B 3KGZA 4OHXA 1AYM1 4N9HA 5DUVA 2HWD1 3V0BB 2SBAA 3VLBB 4KWJA 2WZPP 4PQ9A 1R091 1RVF1 4EWDA 5GZGA 1V6JA 2ZACA 5A3LA 1HRI2 4O9EA 2PN5A 1IKPA 1YUDA 3J8F2 4IETA 5CADA 3E6BA 1AL23 5EYYA 1KS4A 2ZX4A 2DUQA 4AQ6A 4F3JA 4ES8A 2RMU3 4GKYA 4WBBA 5KHIA 1VBE1 3N7JA 2CAUA 5BYNA 3ROUA 4G9SB 3AFGA 4XILA 4YZ2A 3MZHA 3B3QE 4G4FA 5JMCA 1OOPC 5J3UA 5E88A 1GZWB 2EXIA 3QCWA 1MZFA 4WVWA 3AMMA 4QPGC 3CO2A 3WHTA 5DZEA 3ST7A 2XGXA 3DUIA 2ETEA 2B46X 1BKZA 1GNZA 3DGTA 5I0SA 4GALA 4WVVA 1YJLA 4AFBA 3V65A 2AYHA 4AGRA 4Z8BA 4AI8A 3S0MA 1QNWA 1QJY2 1VBD2 1H0BA 2DCYA 4IV3B 2IXIA 1AR73 2V73A 2VXRA 5K8SA 1CVNA 1KQRA 1RMU2 2P3KA 3OJBA 2VOXA 2UWBA 3MICA 1RUF2 4GB32 3AKRA 2W68A 1IQAA 3LB9A 1Q3EA 2QCSB 4KWKA 4AVCA 4DZGA 1MS5A 4I09A 2GC1A 3O0WA 1AX0A 1M4WA 4N7UA 3ACLA 4S2FA 1ZRCA 2Q1MA 3AKSA 4LBQA 1EAH1 1PZ7A 4NO4A 3VBFA 1ULGA 1J3QA 4LBQB 1D2SA 2P37A 5C4WA 1ZVFA 1FV2A 5DG2A 5C4WB 4JTNA 1S55A 1UAIA 1WGPA 1COV3 3H7JA 4QGNA 1OQ1A 3B9IA 4LO7A 4XFGA 5JIAA 1F31A 1MQTA 1SBFA 4M3CF 1MQTB 1LENA 1WLWA 2BGCA 2HWF2 1LU2A 4K1ZA 3AJZA 1LULA 4AVSA 1WUVA 1B35C 3M70A 4OUMA 1C28A 2QFEA 4Q4V3 2ZGTA 3NV4A 3WUDA 5FOBB 1SCSA 4I30A 1YFUA 3OD4A 2HWC3 4MXWA 1I6XA 1KFUL 4MSVA 3ZFGA 1X7NA 5I0TA 2JG9A 3J9SA 2UYBA 5K0UB 2X5IA 3GBGA 4IEUA 4PJYA 1DIWA 1IS4A 2X5IB 1NCQB 1QMJA 4Q4X2 1YXWA 3WHUA 4XEZA 1JUHA 1NCQC 2VOWA 3ZO0B 4YFWA 5BNNC 2Q8OA 2CGPA 2GNDA 1FMD3 4FCAA 2V5YA 1V6OA 4D7TA 1AJOA 2GDFA 2XUMA 4G3YC 4Q0PA 5HI0A 2WNEA 1UKGA 3D82A 4YW1A 2ZCWA 4EN7B 5T5JA 5AC92 3FHIB 1JYCA 4XJUA 1DLLA 1S0BA 4NWVA 5LEJA 1ENSA 1W2UA 4NHLA 1AR63 1RHI2 1C3HA 1XYNA 4AEDB 2R0FA 4JDOA 1F8VA 3GZUC 3ILFA 3GBWA 4KU7A 1ULCA 4YVSA 4DRRA 4BHPA 3VBOC 2RM21 1XYOA 1XXNA 3AJYA 1RUE2 1RUI1 2B42B 4CP1A 3ZSEA 1QOOA 1AYM3 3H1MA 2A6WA 1WCDJ 2HWD3 4LBKA 1TMF1 2R061 1QQP3 3ILRA 2JKBA 2TBVA 3B02A 3MW3A 4I0WB 4DPNA 2BBVA 2YY1A 1O4ZA 3URFA 1V70A 2PAKA 1SCRA 3VL8A 2WFF1 4JRLA 2VNOA 1VALA 4B8EA 2AR6A 3N7MA 1NZCA 3B01A 2A71A 2XWBB 3B00A 1FI2A 2A75A 1OPOA 3PTYA 1WA4A 1ZBA2 2D3RA 2QZ3A 4BPZA 3ZFFC 2OYZA 4P9GA 1H8TB 5BV6A 1RUNA 4RHV1 1GANA 1R1A1 4Q29A 4AWDA 2Q5TA 5JZGA 3MEPA 1QWRA 2B8MA 3WW1A 1ASJ2 3C2UA 3H8UA 1HQLA 5C9AC 1D0GA 1RVF2 1SEFA 5CFCB 4XPVA 1REEA 5CG9A 3B94A 4MX3A 1X82A 3WP5A 5F9TA 1RUOA 3WCSA 5FBZA 1BBT3 1SLTA 2OA2A 3AYCA 1G7YA 3AMQA 3TBDA 4XETA 2IXJA 4F83A 3H9AA 3GZAA 3OGJA 2CY6A 4DRVA 3B69A 4RFT0 2JE7A 1KRIA 3C3VA 2GH8A 4Q0VA 3SHRA 4FSJA 1POV1 1J3PA 1VJ2A 1AXZA 4CDXA 5JIUA 1H2NA 4UW5A 4AHYA 1S0GA 1BK1A 3AKQA 4CDXB 4JTOA 1FNZA 2PHDA 3SMHA 3HD8B 3VBRC 3SXWA 2WZR1 3UKNA 1AR93 1V9U2 4PLOA 2C1FA 3ZVXA 2ZBJA 2ARBA 1BYHA 4YZ5A 1GFF2 1WD4A 4NHMA 4LTAA 1GKBA 1QKQA 1DZRA 5FAXA 2E7AA 1ZBE1 1EAH3 1VR3A 4CEWB 2DU0A 3JBG2 2WNUA 4CEWC 4FTEA 4UW3A 1IOAA 2PYTA 2VMHA 4N53A 4KGGA 3H7YA 4B7EA 4DOUA 1A8MA 4XF4A 4N53B 4MH0E 3IDBB 3KCXA 2XJPA 4COUA 1C1LA 1W0OA 4CRQA 1VBB2 3N35A 2WNVC 2Z42A 3AZYA 1NXD1 2HYKA 4QGLA 1UL9A 1MEC1 5H9RA 4D69A 4AHZA 4Y1YA 1RUJ2 4YG3A 3JD73 4LUKA 1PIV2 1C8M1 1QF3A 1ENXA 2XWJB 5J37A 4MGIE 1APNA 2PTMA 3EJKA 5IK5A 3EXUA 5FMOS 4NHKA 2CTVA 3TOJA 3LA2A 4HSJA 3DV8A 1LOFC 5GZDA 1D4M2 1PMIA 1VRH1 5L36A 1G9AA 5GZFA 3HQXA 3RMXA 1NA1B 1U12A 1RUD3 4E2GA 1PO21 1NA1C 4PCRA 5KHJA 1N1SA 2AZ5A 3GHMA 1EV11 4UW6A 1UIJA 2KA3A 3RPQA 2XL9A 2GALA 3H3ZA 3POSA 2GN3A 1PGL1 3TAYA 1CPNA 1IHMA 4CEYC 4KQ7A 1RUC3 3ZSLA 5JLVA 3SH5A 1LOBA 1LHNA 4H55A 4RR3B 3WLUA 5HXVA 1H2KA 1VBA3 4RR3C 3VBHA 1RJ8A 2FHRA 3MPBA 2XLGA 3HIFA 4YNIA 4HKOA 1GZCA 1KJLA 1ZNPA 4TWTA 1ZRFA 2VVFA 4LBMA 5CNAA 1SBEA 4HVQA 2LALA 2RHPA 3NV1A 5FCCA 2WS92 3FFQA 4K21A 2TEPA 4CDWA 4PBOA 1TME3 2VG9A 1EYBA 4N9IA 3I2DA 4CDWB 4UW4A 1RUI3 4Q0SA 2NYYA 1NOVA 3FBMA 4FPLA 4HANA 1A3KA 3E5XA 5JOWA 3BIWE 1HQNA 4M0NA 3HWJA 1LCLA 2CAVA 2ZX3A 3R05A 5CFDC 4XMIA 1HXS2 1UN1A 4FPHA 1OFSA 1S0DA 2WFF3 4QPIA 5FMOL 5JSRA 2Y26A 1OA2A 3WT3A 1V6KA 3THTA 4DXZA 4TYSA 3QH6A 2HWE3 2XH6A 5ABJB 3LGRA 4X6QB 1H2MA 3TN91 4TLFA 3OBTA 4CDQA 2ATFA 1HKDA 4DY3A 3UKTA 4OFGA 1V6MA 4NPRA 3ZYRA 2DTWA 3THPA 1HRI1 1PM7A 1VB2A 3PJYA 4ISRA 3J8F1 5I91A 4DQAA 1LGCA 3KM5A 1NE6A 1RIRA 3RYPA 1R1A3 3W9AA 1LOGA