5L7OC

X-ray structure of triatoma virus empty capsid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
276
structure length
276
Chain Sequence
SKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTERP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oC00
1RUD2 1VBC3 1PIV2 1FMD2 3VBSC 5CFDB 2R062 2RM23 2RR11 1Z7S2 1AL22 1FOD3 4CDWA 4YVWB 5BNPA 1BEV1 1HRI2 3JB4C 5D8AC 1TMF3 1EV11 3JBG1 4JGYC 4FTBA 3HAGA 1A6CA 1X36A 4RS5C 1CJDA 4QPIA 5AC93 2R041 4CDUC 1VBB1 4CDXC 5C9AC 1RUC1 1PO21 4NWVA 1AYN3 2XBO3 4JGZC 4QPIC 1RUD3 3IDEA 4Q4V2 1AR91 5A33A 4GH4A 5C4WA 1Z7S3 1AL23 3NAPA 4Q4X2 1B35A 1HRI3 3VBSB 4GB32 3VBOC 1HRV2 4CEWB 1QJY2 1B35C 1VBE1 1ND3A 5D8AB 1VRH1 1AR81 1RHI2 3VBFB 1QQP2 4RS5B 3VBRC 3J8F2 5K0UB 4AEDC 1NCRA 1VBA3 2HWC1 4RQPA 4Q4V3 4CDUB 4CDXB 5C9AB 4QPGA 1RUI1 5FMOS 4JGZB 2HWB3 5JZGA 1NCRC 1W39A 4CDQC 1X33A 1RUF1 5ABJC 4GB33 2PLV1 1HXS2 1HRV3 2FZ1A 1RVF1 1GFF2 1TME2 1QJY3 5CFCA 1F8VA 1H8TA 3JD72 2WWSA 3VBOB 3S6PA 1R1A2 3VBUC 1M06G 1PO11 1V9U2 1NY71 1COV1 1QQP3 2RMU1 5DDJ1 5CFCC 4Q4W1 4PDWA 3J8F3 1AR61 1RUJ3 1POV0 1ND2B 1RUG2 2X5IB 3ZFGA 3VBRB 4IV3A 4YVSC 1R082 1AL0G 1QJU1 4FSJA 1NG0A 1HXS3 3CJIC 3ZFFA 1QJX1 3VDDC 4LLFA 2GSYA 1R091 4CDQB 3JD73 2RR12 5ABJB 5FOJB 5J98B 4CEYB 1R1A3 3ZFFC 2WFF1 2RS53 3DPRA 1V9U3 1RUE1 3JBG2 5J96B 3DPRC 1RUG3 1FPN2 5C8CA 2MEV1 2R042 4WM8A 1R083 1MEC1 1RUC2 1PO22 1BBT2 2RS12 4N53A 1C8M3 4IV1B 4N43B 4YVSB 2DF7A 3TN91 5ACA2 3VBHC 4EJRA 2BPA2 5BNNA 3FBMA 3M8LA 2RR13 4N53C 3CJIB 3VDDB 4CDWC 5BNNC 1VBC1 3JBG3 5BNPC 1NA1A 1OHFA 2RM21 1BMV2 1RMU1 4WM7B 1VBE2 1FPN3 4Q4Y3 4GMP1 2HWF2 4RHV2 2TBVA 2R043 1VRH2 1TMF1 5A32B 1AR82 4BCUA 2IZWA 1BBT3 1PIV3 2RS13 1FMD3 1K5MA 1AYM1 2R063 2HWC2 5ACA3 5AC91 2HWE2 4GH4C 1AYN1 5C4WC 2XBO1 2RS32 3VBHB 1RUD1 1RUF2 3NAPC 1RVF2 4JGYB 1Z7S1 1AL21 4CDWB 1ZBA2 2HWF3 1HRI1 4RHV3 1OPOA 1ND3C 4FTEA 1NCQA 1VRH3 1PO12 4FTSA 2RMU2 2HWC3 2Y26A 4QPIB 5LK7B 1D4M2 1NOVA 1PVC2 2HWE3 2X5IA 4Q4X3 4RQPC 1ASJ1 1PGL1 4QPGC 1CD3G 5L7OA 2RS33 5JZGC 1VBA1 1RUF3 4Q4V1 1QJX2 5A33B 4GH4B 5C4WB 2FZ2A 1MQTA 5L7OC 1R092 2HWB1 4RR3A 1OOPA 2R071 1RHI3 3NAPB 1B35B 1ZBA3 4CEYA 1VB4A 1H8TC 1ZBE1 2XPJA 3ZFEA 1HRV1 1OOPC 2BBVA 1AR72 1QJY1 1ND3B 5BNOA 4PDWC 4AEDB 1D4M3 1PVC3 4SBVA 3ZFGC 1QQP1 2WS92 1VBD2 4IV3C 3J8F1 1NCRB 1RUJ1 4RQPB 4IV1A 1TME3 5CFDA 1QJX3 4YVWA 1SMVA 1R093 5JZGB 1BEV2 3LOBA 1EV12 1AUYA 2GH8A 3VBUB 1C8NA 1IHMA 1AR73 2BFUL 5CFCB 1H8TB 3JD71 1RMU2 2WZR1 1VBB2 2RS51 1V9U1 2WS93 1TMF2 1EAH1 1VBD3 2HWD1 4PDWB 5C8CC 4WM8C 1AR92 1AYM2 1RUG1 1POV1 3ZFGB 4IV3B 1PGW1 1RUH1 1R081 1BEV3 3VBSA 4Z92B 1EV13 2XBO2 1C8M1 3ZFFB 4CEWA 1FOD1 5D8AA 2VQ0A 1NA1C 1RMU3 4JGYA 1VBB3 3VBFA 1RUC3 4CEWC 1PO23 4GMP3 3DPRB 4RS5A 5K0UA 4CDUA 4CDXA 1AR93 5C9AA 1AYM3 3VBFC 1RUI2 1FPN1 4JGZA 4Q4Y1 5K0UC 1K5MC 5C8CB 4WM8B 1ASJ2 2PLV2 1PGL2 1QJZA 1BBT1 1PIV1 2RS11 4N53B 1FMD1 2R061 1VBA2 5ACA1 4Y5Z0 1VBE3 5BNNB 3VBOA 5BNPB 2HWB2 1AR83 2R072 1NY72 1COV2 5DDJ2 1ZBE2 4Q4W2 1RB8G 1AR62 1NA1B 1NCQC 1ND2A 2QQPA 1BMV1 1RUI3 3VBRA 5FMOL 4AEDA 2BUKA 2HWF1 4RHV1 1QJU2 1ND2C 1ASJ3 2X5IC 2PLV3 1VB2A 1K5MB 1RUJ2 1RVF3 4CDQA 2HWE1 5ABJA 4Q4X1 4NWWA 1HX6A 2WFF2 4GB31 1PO13 2R073 1RUE2 1MQTC 2RS31 1COV3 2RMU3 5DDJ3 4RR3C 1ZBE3 4Q4W3 1AR63 4CEYC 3VBUA 1F2NA 3ZFEC 1RHI1 2MEV2 2ZTNA 1ZBA1 1MEC2 2WZR2 1QJU3 5BNOC 1NCQB 2RS52 2ZAHA 1DDLA 2HWD2 1EAH2 4N43A 4YVSA 3TN92 4QPGB 4Y4YA 1D4M1 1PVC1 4IV1C 5CFDC 3CJIA 4N43C 1PGW2 1HQNA 1RUH2 2WFF3 3VDDA 1HXS1 4YVWC 5L7OB 1RUE3 5GKAC 1VBC2 1C8M2 1TME1 2RM22 3ZXAC 4RFT0 4GMP0 4WM7A 1FOD2 1MQTB 1R1A1 4RR3B 1OOPB 2MEV3 5A32A 2WZR3 1MEC3 1VAKA 4WM7C 2HWD3 1EAH3 3ZFEB 3TN93 2BFUS 1AR71 5AC92 2WLPA 5BNOB 1WCDJ 2ZZQA 1POV3 4Q4Y2 1AYN2 3JB8A 1E57A 3VBHA 1RUH3 2WS91 1VBD1
chains in the Genus database with same CATH superfamily
4LIUA 4QDQA 1KD7A 1ENSA 3I59B 4A2UA 4AVSA 1FMD2 3B9IA 1F9KA 2WQZC 3AZVA 3B69A 3VBSC 2YBSA 1UU5A 3AZYA 1POQA 5FY7A 2XG3A 1AL22 4IDZA 1QJEA 5J37A 1BEV1 3POIA 4A7ZA 2QE3A 3WXPA 1YQ6A 4FTBA 2Q0AA 1GLHA 3KV9A 1ZVFA 5T52A 1X36A 1GZWB 4FPGA 4IE7A 3WUCA 4RS5C 2XWJB 3M1HA 1O4ZA 4D94A 2VM9A 2VO5A 2D6MA 3FMGA 3K48A 3W9AA 2R041 5A3WA 4CDUC 3POSA 4ASKA 1E5IA 4QB1A 3E5QA 1HV1A 1UU6A 2VGDA 2CWSA 3ZYPA 1AYN3 3H50A 1UZWA 3M3QA 3PUHA 4LTAA 3A22A 4CCJA 1OA4A 2D5FA 4E9KA 1RXFA 2ZGTA 3AL5A 3ZPOA 5IVEA 3S7IA 1JZ2A 1CPNA 4LO7A 4GH4A 5C4WA 1YEWA 4QX3A 2AENA 1AX0A 1MZ6A 1Z7S3 2ZZJA 3WINE 1IGOA 1QWRA 4PQ9A 1H4HA 2UY8A 1JYNA 3S0MA 3VBSB 1WWYA 4GB32 4XZPA 1UWWA 3ZYHA 2JECA 2UWAA 4MGQA 2E63A 3AJZA 5IT6A 1PZ9A 1STMA 5FQ0A 4FPJA 4XE9A 1QJY2 2AUYA 1B35C 1EP0A 2ZX4A 2EIGA 3WDUA 1AHSA 4FXKB 3H3LA 4DXSA 3I3QA 1WKYA 2LUWA 1GOGA 1IPSA 4XJAA 1QQP2 5FPXA 4RS5B 3SMHA 2VVDA 3OUHA 4L92A 4LHSA 4LHLA 4V2WA 2WNUA 3UJOA 5K0UB 1YIPA 1JUHA 2DVFA 4RQPA 2RE9A 4XC9A 4CDUB 5DABA 4Y1YA 1LESA 4V1PA 4I09A 1LOGA 1RUI1 3I2FA 4K21A 3H3ZA 4CPBA 1GOFA 5JZGA 1LNSA 5A1FA 4MYEA 1LHNA 1D0GA 1SLBA 4XAEA 4AQ2A 4DEVA 4DY5A 3KT1A 1JZ5A 2NYYA 3ZVXA 3OPTA 1YUDA 3HBZA 3MFAA 4GULA 1HXS2 4GJYA 4JRAA 2C1FA 2WDBA 5ISLA 3IDCB 4QGNA 2PAEA 3AFGA 3QH7A 2LRPA 2NN8A 1H8TA 2YHJA 2Q4SA 3GBGA 1F8VA 2P2KA 5IK4A 3S6PA 4CU8A 4KU7A 2P3IA 3ZSEA 5FZ7A 3VBUC 5B2GB 1M06G 2DCZA 2VQUA 3H7YA 3ROUA 2Q1MA 4BZ4A 5DDJ1 3SH4A 3POGA 3J8F3 1GQGA 4QKDA 2XKPA 3NV3A 4L99A 1ND2B 1Y9MA 2W91A 5FTTC 3ZFGA 4CCLA 5IVJA 3WQBA 3ZXGA 2G9GA 4YVSC 1XNKA 1GWLA 3JXSA 2UU8A 1A8MA 2Z5WA 4FSJA 2JD4A 3AL6A 2YYOA 2YBKA 4P14A 4C8DA 3W59A 1AX2A 1L7RA 3E97A 4CUCA 2J1VA 3LEIA 2PQSA 2VUAA 5TSWA 3CJIC 5GM0A 3DN7A 4RGAA 1QJX1 1SCRA 3SNMA 1R091 5FDBA 3W20A 3THPA 1LENA 5T55A 2RR12 1J3QA 1RGSA 4E8CA 1L7LA 3K3NA 2WT0A 3NNLA 4UYBA 3VLBB 5J98B 2Y64A 1R1A3 4A7YA 3LSEA 5KBFA 3VHOA 3BVCA 3DPRA 1MS4A 1Z0HA 1H2MA 1RUE1 5F37A 3GBWA 3PVNA 3OUJA 2XLFA 2ZGNA 1ENXA 3DXUA 3MLKA 4GKXA 1O7FA 2BGPA 1GNZA 2EF6A 1SBEA 4KI5M 1YFUA 5F3EA 4J25A 3ACIA 4OMDA 1WLWA 1Y43B 5A7SA 2EA7A 5BNQA 1DQ0A 2B5HA 5GZGA 3O1MA 1R083 2OVUA 4XJWA 2CDOA 2JIJA 4G4FA 3Q8CA 3WD5A 4Y1UA 5FYTA 1MVQA 1N3PA 4MSVA 5FAXA 4YVSB 5FZMA 5KXCA 4FPOB 3TN91 4YM3A 2GMEA 2VBBA 4YGCA 2JDPA 3I2DA 4JTOA 1F4HA 1UQXA 4XBLA 4EJRA 4LJHA 5BNNA 1CZVA 2PHUA 2FCTA 2WO1A 1I1EA 4XABA 2Z69A 2VVFA 1LU2A 1SZBA 2XR4A 4QM9A 3H8OA 2WN2A 3CJIB 2YUEA 3KGLA 3J7HA 1WCSA 5F32A 1W99A 3VV1A 1B09A 1D7PM 3JBG3 2QQNA 3LEGA 2OUHA 3IM0A 2V73A 4PBPA 5JPMB 4QMAA 3UJQA 2RVAA 4NIHA 3E5XA 3HR9A 5HXMA 1VBE2 2D93A 3CKHA 1JU3A 3A4UA 2DBIA 2DUOA 2AH2A 2WO2A 5EIYB 4RHV2 5JR7B 4XFFA 4AQSA 2Y34A 4D69A 1AR82 2VR4A 3P3PA 2BEOA 4Y5SA 1LGBA 2IZWA 2WAAA 5F9TA 5KHIA 2A5ZA 1FMD3 1W04A 3NL1A 3TOJA 4JCKA 4PT6A 3M3CA 3H8RA 2VQAA 5ACA3 1JZ3A 2HJIA 3KV5A 1W0NA 2ADEA 4MUVA 1DHKB 2VH9A 2WO3A 1DGRA 1D2QA 3QH6A 4Q0SA 2FCUA 3N3HA 3NV4A 2XJUA 5FMBA 3ILRA 3MEPA 4RFRB 3S7EA 4GH4C 3TB0A 4B7KA 5C4WC 2XBO1 1H4GA 2RS32 2TNFA 3MIBA 3THTA 2JICA 4CZSA 4H7MA 1RUF2 3RZLA 1CQ9A 3MLLA 4XUOA 4WZFA 2ZX3A 5A70A 1AL21 4LR4A 5DG1A 3QACA 1MZFA 3B3QE 5A3LA 1ZBA2 3FWEA 4EYUA 1V6LA 2VMCA 4S2GA 5H9PA 4MH0E 4UBGA 4IGOA 2IWGB 4TLGA 3UK9A 4CVUA 4KL1A 4BK4A 3B02A 2B4KA 1ULDA 2ZGRA 2AZ5A 4ONUA 3UKVA 3NV1A 4UI9L 5HCFA 5LK7B 1NOVA 2WNUC 4U36A 2HWE3 4ZZ5A 4CEYC 4RQPC 2NQYA 1UY4A 4TN7A 4BYYA 4COYA 3ZYIB 5FPZA 5FXZA 4MX3A 3BB6A 2I45A 1ENQA 3K3OA 3KCYA 5JIUA 5L7OA 2Z42A 5JZGC 3NWKA 3O1RA 1S2EA 2YC0A 2QDNA 1V6KA 4GH4B 4D7YA 5C4WB 1WCUA 2P1BA 3FLPA 2FZ2A 5HI0A 2TUNA 3PL0A 3V0BA 4Y1ZA 5D2AA 2RJLA 4FP2A 1OOPA 3QOPA 2ZGMA 2ARCA 3IMMA 4IXLA 4CEYA 1VB4A 1H8TC 1M4WA 1ZBE1 4FPYA 3RJ2X 2HYXA 1LHVA 1CR7A 2X09A 3VGIA 3MYXA 3ZFEA 3O1TA 4E2QA 4LBLA 2FDFA 2BBVA 1ZREA 2VZPA 1QJY1 4N8MA 1WMDA 2Y6FA 3ZLIA 5FWJA 2GP5A 1D4M3 1PVC3 2VZOA 4NIIA 2BGCA 3N35A 3NO8A 4AAPA 3BI3A 3Q9OA 3A0KA 4XYXA 5DAVA 2WR9A 1TG7A 3A7QA 3DL3A 1QQP1 3ZFGC 3ZR6A 1VBD2 1O8PA 1JBCA 2JDKA 4OMCA 5FCCA 2YZ4A 3J7MA 4RQPB 3RG0A 5CFDA 4D6SA 2CYFA 4P9IA 2GMPA 1BVP1 1LOFA 2VY0A 3R4SA 2VXJA 3RWKX 5JZGB 2VW2A 1W9SA 2NMNA 2VCCA 4FCAA 3OSDA 5K4LA 3CLPA 4HBNA 3AVSA 5T5LA 1F5JA 5KXBA 1HKDA 5DUXA 3WZ1A 1OQ1A 2CU5A 2PXJA 4FP3A 4QQPA 1NKGA 2HH9A 2B7YA 3F95A 4LT5A 2WYSA 4LULA 3KCXA 1FX5A 5DN2A 2BFUL 1O6UA 2W95A 3IAPA 1H8TB 2Y6KA 4QHBA 5FZEA 5KHGA 4I2OA 3T2OA 3CNAA 2WZR1 1DYKA 1DQ5A 3GZUC 5F2SA 4UW6A 2XVGA 1TMF2 4XIOA 1OXCA 4WVMA 1YFYA 1GZ9A 5FBZA 2KXLA 3ENRA 1QY4A 4LKFA 3ZMNA 3OGGA 4B1LA 3FX3A 1POV1 2E51A 3ZFGB 4IEZA 2B9UA 4ATEA 5F1RA 5FZDA 5JWPA 3IAQA 3V56A 2A6XA 3OPZA 5JIAA 2PHDA 1EV13 1YLLA 4DOUA 2ATFA 4Q26A 4HFSA 4Q1PA 3CHXA 5DAXA 4YW3A 3WNLA 4BK5A 4YZ5A 5LY1A 3JUUA 4CEWA 4XJ8A 5L73A 3DCQA 1FOD1 1IZ3A 1UN1A 2JKBA 5D8AA 3VKLA 1XYPA 1P8JA 4FPLA 3BTZA 1RMU3 2VZRA 4S2DA 3CBNA 5FKBA 3OGVA 1XPWA 4GMP3 3DPRB 4ATFA 4E2GA 3KMHA 4HPKA 4QX7A 4DXRA 1PM4A 2OA2A 1R1ZA 2DCTA 2VC9A 1V6JA 4B1MA 1AR93 1KDKA 3PUIA 2RJ2A 3G6JB 4J1WA 4W6YA 2CTVA 3P1IA 4P08A 4Q4Y1 3LIHA 3LEMA 2PHFA 3D4KA 3M2MA 3MDPA 3AMPA 5FR3A 1RC6A 1BZWA 1OD5A 1QJZA 1RITA 1PIV1 4QB6A 4XFHA 4AHZA 1JYTA 4UFLA 4QD2A 5JXJA 1VBA2 5FKCA 4LE4A 1GZCA 1SDWA 1UX6A 3AYEA 1VBE3 3H3UA 5BNNB 5BNPB 4AI0A 4E4DX 2WFPA 2J42A 2UWBA 5C5UA 5F39A 1ZRRA 2VZSA 1TQ5A 5JMOA 4BIOA 1PX3A 1AR83 2R072 4XF3A 2VMHA 4CCCA 4Q4W2 1RB8G 3FBYA 2B46X 5F6KA 3SITA 4IGQA 1ZZ6A 4XOGA 3VKFC 1BYHA 2XL9A 1WW7A 5FMOL 5A6XA 4AEDA 2BUKA 5ANQA 4RHV1 2D3SA 1FNYA 4BM8A 4P5YA 4KGQA 1W3VA 1ASJ3 3IPVB 2PLV3 5LBEA 1VB2A 4OI0A 3QBQA 4IEPA 3IKWA 5FMDA 3WV6A 1T6GC 1IG3A 2Q8DA 4CDQA 2JJ6A 1YFWA 1ST8A 3LB9A 2OX0A 4Q4X1 4L97A 1WCQA 1Y9GA 4IL7A 3ZO0B 1ODNA 2XOMA 5EPAA 4ZKTB 1MZ5A 2RS31 5FPUA 3ACHA 5FP9A 4D8MA 4XMAA 4NOTA 3TEWA 1AR63 5J48A 2FCVA 1QOOA 3FJSA 3P3NA 1PGSA 2A7AA 3NKGA 2ORZA 4K40A 4LITA 1W06A 2E53A 4MXVA 4ZY9A 1F2NA 3DV8A 5FZHA 1A78A 1UKGA 1WLDA 3ZFEC 5FMCA 1O4YA 1RHI1 5IVCA 1LHUA 3VDCA 1ZBA1 1MEC2 4ES8A 1O8SA 1C28A 3LA2A 2JB4A 2W68A 3EJKA 5JOYA 4NAMA 2H6CA 5IYYA 2HWD2 1EAH2 1OLMA 3NVCA 5GZEA 3CO2A 1ZYBA 1LEDA 4Y4YA 5AVAA 4MO3M 1XNBA 2JENA 1O3TA 4KNCA 1OKQA 3MF6A 2C5DA 3H42B 3UKNA 2Y6JA 5CFDC 1CAWA 1JOJA 1PGW2 2WN3A 3J9SA 4CP9A 4YW4A 5L7OB 1LOFC 5GKAC 3MI8A 5FK8A 3SLIA 3KT7A 4PHZA 3V0AB 2WNVA 3INAA 1Y7BA 5FXXA 1MVEA 4RFT0 5FYZA 3ZM8A 3ES4A 3ZXAC 4HSJA 4HLTA 4XBNA 1HB1A 4TTGA 2OYZA 3V0BB 1H8VA 3D6EA 3I2GA 1OOPB 2MEV3 4QB2A 5B4XA 3RZZA 1QXPA 5LBBA 5JXGA 5L9VA 2O0OA 1G9AA 5J3UA 4BH9A 5CA6A 5FZ3A 2W94A 5BV6A 1K42A 4P9GA 2X53S 3ZFEB 1X9PA 1GKBA 1YQ5A 2DYCA 3O0WA 4YW1A 3MICA 1UYXA 2R7EB 3WHTA 4Y22A 5IVYA 2ZGUA 3AVRA 1SCSA 1ZZBA 4COVA 4R9DA 1UY0A 4IUGA 3VHRA 1JXNA 3D5OA 5FZ0A 1AYN2 4K1ZA 4NN0A 3VBHA 2SBAA 1S4CA 4XIKA 1F5FA 1VBD1 4F8AA 4A42A 1VBC3 2O8QA 2ZACA 5FUPA 4CTEA 5CFDB 1ENRA 3WG3A 4Y24A 1AXKA 1UMIA 1GP5A 1Z7S2 3M3OA 3NJZA 2F4PA 4Q0QA 5F3CA 3JB4C 4CPBD 1UZVA 5D8AC 1TMF3 1AXZA 4RYDA 3I7DA 2CSGA 2N7GA 5FUNA 4PQQA 3T2TA 4JHZA 4DZGA 4ZU7A 2R30A 3O7OA 4LA2A 2B42B 2JDAA 3EBRA 3WCSA 4B4PA 3HAGA 2JE7A 3HD8B 1J59A 2YY1A 3B93A 4HKOA 3JZVA 5FO8B 4KMQA 4LEJA 3KT4A 1W0OA 1OH4A 2OS2A 4FT8A 4IGPA 4OUSA 5C3QA 1JYVA 2BW8A 1D2SA 1RUC1 1PO21 1FAYA 2A3WA 4FQ4A 3WF3A 1G8WA 4QPIC 4ZS2A 4JC1A 4BOWA 1BK1A 1J58A 4WVMB 3NQHA 3NJYA 1S0JA 3DEMA 2D98A 1IKPA 1KJRA 1MS9A 4A7KA 1GWKA 4Z82A 3NAPA 2GU9A 1B35A 2RDRA 3BODA 3FE5A 1PMHX 4OI4A 4RN5A 4W8JA 2PTMA 1CN1A 3HOBA 5DUUA 2DU1A 3MPBA 1RL3A 1ULOA 2B9VA 1UZZA 2W1WA 1LRHA 4CEWB 4JDNA 2ZGPA 5C33A 5HV4A 4NJ4A 4RL7A 1ND3A 4O61A 1F15A 5D8AB 1UAIA 2K9ZA 5LA2A 1CVNA 2AYHA 3AZWA 3I2JA 5ERLA 1VRH1 3WDYA 5T5PA 3KVAA 1SACA 3CDZB 2W52A 3UYJA 3ZIXA 1BLZA 4HPKB 2JWPA 3J8F2 4AEDC 3E6BA 1VBA3 2HWC1 4D6QA 5IVFA 4Q8KA 3U10A 3PVBB 5L9RA 1FI2A 4K8RB 3W5MA 1HB2A 2FQPA 4OULA 4LHKA 2VUJA 1WA6X 2R1BA 2ET7A 3GGLA 2E32A 4BLJA 4Z2WA 2W1UA 3EMRA 3BU0A 4CDQC 1NUKA 2VJXA 1WMEA 4H2AA 4L2NA 1J1LA 2W39A 4KWUA 3PLQA 4YFZA 1HRV3 3PDQA 1WZXA 3SEEA 1GFF2 2QJVA 1TME2 3GDBA 3GYDA 4CUBA 4EN6B 5K8SA 3J4UH 2WWSA 3BIEA 1ZRFA 3PTRB 1R1A2 4XTMA 1JU4A 2PA7A 1Q8OA 2QQKA 3LF7A 3MIGA 2XJTA 4XW3A 1PO11 3AM2A 5FUIA 4YARA 5CEHA 3T1LA 3BTXA 1GANA 4XHBA 2RMU1 3WCRA 5LEKA 4Q4W1 1IQDC 4HXCA 4PDWA 2ZEWA 3RYRA 3BU7A 5FOBB 3I3BA 4R9CA 4XF1A 2GC0A 2TEPA 2VNVA 3IZOA 5H9SA 4KG8A 1SLAA 1VR3A 2X5IB 5I0UA 4TWTA 4IV3A 3KM5A 4FOVA 1R082 3EYPA 4LKDA 4QAWA 3O5SA 2UURA 4G9SB 2GC1A 1LB2A 1ZZ7A 3D82A 3NW4A 1SBDA 2WIIB 4XVHA 3VDAA 4KGGA 4A6OA 4DO0A 4M0HA 2E7AA 1UPSA 2P37A 2XONA 4NROA 3RNSA 2D40A 2ZGKA 3JU9A 2YC4A 2AEZA 4HT1T 4CDQB 5FOJB 2W3JA 2LM3A 3AMHA 1GR3A 2WNVC 2XQXA 3GZEA 3LKJA 3ZFFC 3VKMA 2ZHLA 2AC1A 1UXXX 1MS0A 1XOYA 1YYNA 1ALYA 1LOAA 3JBG2 4DPNA 1BHGA 3O1VA 1NXD1 1N3QA 1W9TA 3VHNA 4IEUA 2R6QA 5FJHA 1MZEA 2DURA 4GKYA 5GLZA 1YJKA 2QQMA 5A7WA 5DXDA 3ELNA 4Q5OA 2Z4FA 5C8CA 5T5OA 4AOCA 2V5DA 2EIEA 2QTWB 1MEC1 2Y33A 2WT2A 3O0VA 4OLLA 4MGSA 5FZBA 5HBAA 5DUWA 4UW3A 2DF7A 5ACA2 5CKNA 3VKNA 1UY2A 1IPKA 2YG0A 2D44A 4NAOA 3VBHC 5E89A 3BKZA 1GICA 4V2VA 3BCWA 5FZGA 5C71A 5HCBA 1X8EA 1HQWA 1SLLA 5EFUA 1TVGA 1CAWB 5CADA 2VUDA 2GNMA 4CP9B 5C3PA 2XLGA 1JHNA 2JDHA 3FUOA 4JKKA 1CX4A 2WNVB 3CJXA 4HN0A 1FPN3 3OUIA 4AGVA 3OY8A 1W8NA 2R043 4AVCA 1QXJA 2O8OA 1J3RA 2BBAA 3ZKYA 1V6IA 4D6RA 4BMEA 3OGSA 1BBT3 4X8NA 2QZ2A 2RS13 5FZIA 5IWFA 1OFSA 3RZHA 1K5MA 1AYM1 5F3GA 2D6KA 2R49A 3CF6E 2Z2SB 2GDFA 2I74A 5FFOC 2WNOA 3A0NA 4LKEA 2HWE2 1W8WA 1CZTA 2RDSA 2Y60A 3BPSA 3HVDA 4QGMA 4UFHA 4Y22B 2W46A 4EZHA 4LBQB 1UOFA 4QX5A 4MV2A 1VJ2A 3BIWE 4K7JA 1AYN1 3T3YA 3O1OA 4ZPIA 3VBHB 2R32A 3S5AA 1REFA 2JDUA 4HZFA 2Y8KA 3NAPC 5F8PA 5B4NA 2VMIA 4Y26A 2PYTA 4GD4A 2D7FA 2PAKA 1BCXA 2WABA 4LMFA 4YYOA 1RVF2 4CYDA 4QGLA 1Z7S1 5J36A 5G04L 2PN5A 1GZTA 2BV4A 5DZFA 4EN0A 2HWF3 3ZPYA 4FXGB 5A3OA 1OPOA 1ND3C 5EYXA 5C70A 5HCAA 4FTEA 5CIRA 1W6OA 5I93A 2ZCWA 5LRRA 4AVBA 3ZSLA 1LGNA 1DGWA 4XXAA 2Q8EA 2Y26A 1JZ4A 4BPZA 3FC0A 2A71A 3MIEA 1G9DA 1D4M2 4Z92B 1PVC2 5FY9A 3OB8A 4INDA 2B8MA 4UAPA 2A3XA 5BXXA 5BUVA 1UO9A 3JCIA 1PGL1 4CCMA 1YC61 1ULPA 5CKMA 1UYPA 5KWRA 4LA3A 2C9KA 2JB8A 4FPCA 4ZU5A 5CISA 1HJFA 3R4UA 2DVDA 3CMGA 3ZXKA 2G1MA 4AVTA 1MQTA 1U5XA 1DGRN 4PIXA 3DECA 3ZMOA 2DTYA 4Q29A 4C0BA 3NAPB 2VQTA 1B35B 2UYBA 3MO4A 2ZEZA 1YI9A 3FLTA 3R6SA 4ARYA 4ET7A 4NIAA 1QNWA 2V5YA 2P6HA 5FIXA 1W8TA 4CCKA 1ND3B 2WO7A 4PDWC 2Y6GA 5HCHA 2FDKA 4SBVA 4NMIA 4COZA 2ZMLA 5I8TA 1WW5A 4IV3C 3J8F1 3USUA 3OBRA 4AK3A 4FFGA 3N9MA 3RWNA 1DBNA 3I49A 5LBCA 4IV1A 1TME3 4GZ9A 1JYXA 2Y6HA 1UOGA 4FOYA 4I01A 2YPDA 1QJX3 3FZ3A 3BPZA 1YWKA 4XUTA 4YVWA 1R093 5E1RA 1OBNA 3HEIA 3VUOA 4HVOA 3ES1A 3LOBA 1J1TA 2JDYA 2FDGA 3KZ4C 1EV12 3KGZA 5FYIA 5J7MA 3TEZA 4OUEA 5FPAA 3IDBB 1XYOA 5FLJA 3ZYJB 1QDCA 2EXJA 4NHLA 3MIHA 1W9FA 3SISA 2XVLA 3VBUB 3I54A 5LCWL 3AXEA 1MS5A 4DXZA 5LB6A 5C8WA 1RMU2 4AW7A 4JHTA 3G7DA 2WQ8A 2JDMA 3J26N 4IEXA 1N1TA 3WW4A 2XJPA 3C7FA 4H55A 1UU4A 4Y4RA 2WS93 3T2QA 2RHPA 3WR0A 1O5UA 4PDWB 4AQTA 2WSVA 5C8CC 3GBFA 2QUOA 4QX1A 5LK5A 3RJRA 5F5IA 2AEYA 2DVGA 1AR92 1C1LA 2ENRA 2MNGA 2ZKLA 3AP5A 3DUIA 5EWSA 1QNYA 2VBDA 2BP6A 4B4RA 4MGTA 4LPLA 4IV3B 2IXJA 1DG6A 4Q0UA 1RUH1 1R081 4IE4A 2CGOA 4GIQA 4NVPA 1DGWX 1PNFA 4BIFA 3PMEA 2W47A 4QT6A 5CBLA 2J22A 4AEKA 2RG4A 4OUMA 1F4AA 3MUY1 4CU7A 4B3NA 2IXHA 3FFQA 3I8TA 1LHOA 2WQ4A 2A6VA 3A21A 2VQ0A 4QXHA 5DZGA 4LQRA 4E8DA 1NZCA 1XXNA 2JG8A 3ZSMA 4JGYA 1IKQA 2CGNA 2XH6A 5LASA 1VBB3 1GBGA 4UFMA 2VW1A 5HV0A 4NE9A 4BQ5A 4JX0A 1MS3A 4UT5A 4BMBA 3K46A 4PI2A 4DRRA 4LXLA 4LBKA 1S0GA 4CDXA 3B5LB 5C9AA 3VBFC 2CY6A 2XKOA 1J84A 2GP3A 1NAEA 2GN3A 1JN2P 4JGZA 1BKZA 1DQ2A 2AREA 3LEKA 1SBFA 2GN7A 1K5MC 3K4DA 4O65A 5A7WB 4AGRA 3OD4A 5C8CB 5HPOA 2VCAA 4EE2A 1ASJ2 3ZSKA 2PLV2 1XYNA 1FMD1 2G9FA 4IESA 4OHZA 4CU9A 3LGRA 2NPIA 2ZHMA 3WQ0A 3MPPG 4QPWA 2YBPA 5ACA1 3S5QA 3ACFA 1LECA 2QQVA 1GUIA 3VBOA 4K20A 2HEVF 5FZAA 3WF0A 3ITQA 4N7UA 1C1FA 2HWB2 2VOVA 2GNDA 1I5PA 2QDRA 2A73B 1WLTA 2C0ZA 2HBTA 1H2LA 1NY72 2L9LA 4JZRA 4EN9B 4CXXA 1CX1A 1GQHA 1KQRA 3ZN6A 1AR62 2V09A 1GU3A 3LD8A 4PIZA 4CXYA 3UGFA 1QKQA 2EIBA 2QQPA 3U4XA 3VBRA 1VMJA 2EAAA 3T30A 2DWRA 3RQ0A 4QXKA 4UW5A 3H1WA 3OY8B 3VD5A 1KFXL 5D1IA 3O14A 1QIQA 4JDMA 1ZRCA 2BGOA 2XHNA 1TNRA 2WBKA 5FYBA 4MLOA 4MHUA 3K51A 5FY4A 3WOGA 4XDOA 1K5MB 1NT0A 4UW4A 3GM8A 1RUJ2 2C9AA 1RVF3 4ZXEA 2HWE1 2VZQA 5ABJA 1W8ZA 3TBDA 1U5YA 5A6YA 1H0BA 2LTNA 4AFMA 1JI6A 1YI7A 4NWWA 1HX6A 5CYYA 4GB31 2YU2A 1EPZA 4LBQD 1GOHA 1MQTC 1COV3 5FQ0B 1ZBE3 1A34A 1UPIA 3SKJE 1WBLA 5A3UA 1HIXA 4AEJA 2P3YA 4PF1A 2ETEA 2A3YA 3B94A 4NPLA 1ZA4A 1UXZA 1WW6A 1R64A 1EPWA 1S55A 1X7NA 1URXA 3CL1A 2MEV2 2XXZA 4OHWA 5LBFA 3BGAA 2Q8CA 4AFDA 3HJRA 4L11A 1QJU3 3POFA 2RS52 2WNUB 1DDLA 3TEYA 1W6OB 4S2FA 5CKQA 1HJGA 1Z78A 4LBNA 4MGYE 1V70A 3UT0A 5LEJA 3RZGA 1HN1A 3MW2A 4XFGA 2XVKA 3IN9A 4O9GA 3WDXA 2VMGA 3C7OA 1D4M1 2ZS6B 1PVC1 4IV1C 2Q30A 3WHUA 4N43C 4Y1XA 2VCMA 4AGGA 2WFF3 5A3NA 1QXRA 3BOPA 1HXS1 4YVWC 4FVVA 1DP0A 1VBC2 3ON7A 4UOJA 1XE7A 1KRIA 1C8M2 1XNAA 3WP4A 3N7MA 4OHVA 3KV6A 4HVRA 4GMP0 2ZMKA 4IQPA 2BWCA 2JE8A 2Q1FA 3R4DB 4GA9A 1MQTB 4H3WA 2OUJA 3SEPA 5FY1A 4NRPA 5I8SA 2VULA 1XC6A 3LA3A 2AR6A 2WZR3 1XU1A 5DPNA 2WRAA 4WBBA 4OFGA 4WM7C 4EZ4A 4AYUA 5FREA 2C6SA 1ZZ8A 5KR7A 1Q8QA 2KR2A 1A8DA 1OSGA 3RFRA 1W6NA 4DS0A 4Z2AA 2WLPA 2EVXA 3KB5A 1WCDJ 4YZ2A 1SHWB 1POV3 4JQRA 4Y3OA 1UL9A 4D0QA 3OBTA 1DQ6A 2CHHA 4NUBA 2PMWB 3NJXA 4QWNA 2ZMNA 1O91A 2W0XA 3USUB 2PQQA 4N9HA 3MV01 5F2WA 4GAZA 3RMYA 3ASIA 2R062 2RM23 2XDVA 3U4SA 1PMJX 2RR11 1FOD3 5CG9A 4YVWB 4AVVA 5IK5A 3FLRA 4EWAA 1V6NA 3OBZA 2WWJA 4AFCA 1EV11 1YJLA 2WNEA 2JG8C 3J7LA 4WV8A 4JGYC 3P6BA 4ZU4A 1A6CA 2KA3A 4A3XA 1LOEA 4WZCA 3TNQA 4I0BA 3ZYGA 1CJDA 5FYMA 4QPIA 3ST7A 3ZSJA 1Y3TA 2YMZA 5AC93 2QQLA 3N9OA 4XBQA 3OYWA 3C2UA 4KBBA 2VNGA 4CDXC 5C9AC 5A6ZA 2EALA 4NHYA 3AMMA 3M7AA 4DY3A 4FOWA 4JGZC 2XJSA 3NSTA 2H0BA 1I5ZA 1RUD3 2JKXA 4BA6A 1ZZCA 3LAGA 1CAXA 5IFTA 2WUHA 5EYYA 1AR91 1DLLA 5AFBA 1S0FA 4GALA 5A33A 4CUGA 4CCNA 2A70A 4XAAA 2YDEA 5FBJA 4GWJA 1WD4A 3D0JA 1Y4WA 1QOSA 2FHRA 3NRUA 4O9EA 4JQTA 5C5TA 5I0SA 1HRI3 1QU0A 1WA4A 3POYA 4QPYA 1N47A 3VBOC 4Q27A 3GCWA 1HRV2 2R1DA 2R16A 1LOCA 3FUQA 5KC5A 1VBE1 2BJSA 1XNCA 5IW0A 3OTFA 1UYYA 2VZUA 2JG8B 1C4RA 3AMQA 2HKXA 1AR81 5LA1A 4N90A 1CIYA 2VTFA 3VBRC 1OUXA 3GCXA 5L36A 5JSRA 1SLTA 1VALA 2Y0OA 5CB7A 3LCPA 1MACA 4LHNA 4Q4V3 3M3IA 4CDXB 1REDA 5C9AB 2ORXA 4QPGA 3W5NA 2YU1A 2QKDA 1RYYA 4MG2A 4JGZB 3AMNA 1NYWA 2HWB3 3N9LA 2CWMA 2A1XA 2XJQA 1NCRC 1JHJA 2MPFA 3AFKA 2JG9A 2QQWA 4F7ZA 1JZ8A 1LULA 1X33A 1RUF1 1I9RA 2V4AA 1OURA 3N7KA 4PLOA 1AZDA 2PLV1 4GWIA 4AHXA 5ABJC 1YRZA 2GALA 1KGYA 4FFHA 4EN8B 4PJYA 1AF9A 1MS8A 2FZ1A 1K12A 1W8OA 3D3AA 4I3GA 1O59A 1G9FA 2K2SA 3AXDA 3VBOB 5FV3A 5JI9A 4JKLA 3A23A 2O14A 3AC0A 3ATGA 3KVBA 4Z07A 5IFPA 1Q3EA 5E8AA 4QHZA 2WZ8A 5H9QA 1NY71 5CFCC 1T2XA 2E7QA 2E9QA 5FO7B 1JYIA 3ZN6B 1AR61 2ARAA 3VZJA 2PFWA 3VL8A 1RUJ3 1H30A 4CCEA 4DFSA 1S0BA 2HEWF 3DF0A 3HQXA 2WZPP 4IE6A 2D97A 3BN6A 3POWA 4CSWA 3VBRB 3ZXDA 2VL4A 3E5UA 2CNAA 2DCYA 5FZFA 4EWDA 1OPMA 1AL0G 4PF5A 3MW4A 3BTAA 4OHXA 4TLFA 1DQ1A 5CU1A 3WW2A 4D7SA 5JR2A 5FZOA 3I2HA 4ZXKA 3N4MA 1RJ8A 2P3KA 3B01A 4AG4A 1UD1A 5A1AA 4NIGA 3ZFFA 2XHKA 3UV9A 4LO5B 5E88A 2GSYA 1XBFA 3JD73 5ABJB 4XQ4A 1CJPA 1UZYA 2BQPA 4WVVA 4QKNA 1XNDA 2VPVA 4CEYB 3ECQA 1H9PA 3EHKA 2RS53 1V9U3 3S30A 2ZXQA 4TYSA 1KITA 2IXLA 4X6RB 5FK7A 1JODA 1WUVA 4R52A 4XCAA 3NJVA 1LEMA 2VMEA 5DAWA 4XF4A 1DU3D 1FPN2 1RUG3 1XRUA 4LO6B 4MGZE 2PHRA 2WKKA 3HNYM 2J1UA 1TEIA 3POEA 5GALA 3LDRA 4DNYA 2MEV1 4OCTA 2R042 3H7JA 1SFPA 4HSLA 4JRLA 2JD9A 4MGIE 4CE8A 2G9ZA 3AYDA 4XMIA 1BBT2 1C57A 2RS12 1LTEA 3QLQA 3WEZA 1C8M3 1XE0A 4AWDA 3BYWA 5KXDA 2FBEA 3KCCA 1HB4A 2HLEA 1UOBA 1O3QA 1XJAA 4UF0A 3OEBA 3ZDVA 2BPA2 4YM0A 2G4IA 1CONA 3GNEA 2VVEA 2WL1A 4N53C 3U11A 4DUVA 1O3SA 3VDBA 1H2KA 2EXIA 1UMZA 3OJBA 2UYAA 4GWNA 4F3JA 2WA4A 1DLCA 2CAUA 3K75B 4XQWA 3ZYBA 1VBC1 2GC2A 3AKSA 1OHFA 1Y9QA 2OIIA 2P5BA 3MF9A 1SDDB 1QH7A 2FMDA 1W2UA 4ASMB 4CRQA 3SH5A 4C0HA 2VOTA 3T2PA 1EUUA 1MS1A 2HWF2 2YPJA 4P5HA 3OGRA 3LZZA 1UW8A 1XU2A 3T0BA 5AFEA 1TMF1 4LNVA 4AZZA 3KHBA 2GH2A 4ISRA 1S0CA 2UWCA 1Q8VA 1N3OA 2E26A 1CAUA 4XFAA 1WBFA 2R063 3WNNA 3VKOA 1W6NB 2EICA 2VD7A 1O4TA 4ARXA 4X8PA 1VMHA 2KM2A 3T1MA 4XACA 5GZCA 1OLME 1SFYA 3D0SA 2OT7A 1QOTA 2WSUA 3AKQA 1F31A 4COWA 5FLHA 3PNAA 1OF4A 4MGKE 3SCHA 1CWPA 2VECA 2X29A 4W50A 3UGHA 1DQ4A 5FRAA 4P9WA 4I30A 4TSVA 3VD9A 5FZ1A 3RVHA 3IBMA 1RXGA 3KV4A 3DYMA 5FZ6A 5FP4A 3TRSB 1NQJA 1LAJA 4OHYA 2VNOA 5FO9B 5EJ3A 3EQEA 3ZR5A 4P00B 3U78A 1VRH3 1H9WA 4DUXA 4AXOA 5F7UA 1LU1A 1HW5A 5FY5A 3THDA 5EJZB 4BDVB 3WDVA 3X29B 2HWC3 1W6MA 1OF3A 4QM8A 1V0AA 3C7EA 5FP8A 3HQUA 3VD7A 3POJA 4QPIB 2V4VA 3HBKA 1V6OA 2VBPA 3U14A 4NHXA 4D3WA 3OYWB 1CAVA 4XJZA 4CP0A 4QXBA 4QPGC 2YFUA 1CD3G 3PTYA 3TYJA 4XCBA 1VRBA 1KJLA 1UIKA 1VBA1 1ZZ9A 1W6PA 4WVWA 1CAXB 2JG9C 3LDBA 4SLIA 5EJ1B 4MADA 4DEQA 1YQCA 1QJX2 2A75A 2JDZA 5IAVA 3VN4A 5A33B 5T54A 1R092 1W8UA 5AVPA 4KQ7A 1XQNA 2BNMA 2R071 1Q5OA 4OI1A 2OPKA 1GV9A 3WG4A 3LE0A 4ZHNA 4META 2WAOA 1LCLA 1IG0A 2XPJA 3C7HA 1WGPA 3MIFA 5KHHA 3WY6A 1HRV1 3DKWA 2ZHKA 4AQ6A 2IFRA 5CG8A 4YSFA 5IK7A 2A6YA 5BNOA 2XUEA 1ZX5A 4AEDB 4BJ0A 2IXCA 1SPPA 5LW9A 1QH6A 4KWJA 4W6WA 2X8KA 4XZUG 1D0HA 4HOOA 3AJYA 4YNIA 4JDOA 1J83A 1OLQA 5JDBA 3OF1A 1CGPA 2WS92 1PHMA 5GLWA 2BERA 4QDRA 1JOBA 4W6XA 5C3SA 5J09A 4G3YC 1U12A 3VZOA 1UY3A 1GQPA 2YXSA 2ZX0A 2JE9A 3SHRA 5JOXA 5K7PA 3PHMA 5FLIA 2XQRA 3SQOA 5F5QA 5I0DA 1S0IA 4Z8BA 3ZYFA 2JG9B 1UZ0A 3HNMA 4YW2A 1AUYA 1VLNA 2X05A 4MXWA 3VZNA 4ITCA 4AI2A 4YG3A 1YO8A 4RGGA 4A4AA 4IERA 5KHJA 1NE6A 1C8NA 1DZRA 1IHMA 3I97A 4K8FA 4KWLA 4XPVA 3LWCA 4C90A 3BTYA 1AR73 5F5AA 2DUQA 1YNAA 3WNMA 4I0WB 2W08A 1I3HA 4YRDA 2XJRA 1VBB2 2DCKA 3MBWA 5JLVA 4P02B 2QZ3A 2ZPXA 3U07A 2BOIA 5FYCA 1OA2A 4IEOA 5JXHA 2HWD1 1EAH1 3KSCA 2ZGLA 4U2AA 1CESA 1RJ7A 3B7MA 1ACCA 3QCWA 3O1PA 3HT1A 5GJ6A 5A3PA 4XFCA 1UMHA 4DRVA 4NIDA 4QU1A 1GNHA 1PGW1 4BU2A 2IVIB 4DUWA 1BEV3 4NO4A 4F83A 2FDIA 1ZRIA 2CV6A 2XBO2 3PURA 5FZOB 5FZKA 4YGDA 2BWAA 4B4QA 1RTVA 1IS6A 4HVQA 2VMFA 2VU9A 3JQXA 3PUQA 3V64A 1YIFA 2Q8OA 3WF1A 1FV3A 2WWUA 3ABZA 3WW3A 3USSA 4DQAA 3IDAA 2H0VA 1JOPA 1WW4A 1CPMA 5JAXA 2YB7A 3WP6A 5A7PA 3VBFA 1A3KA 1G7YA 1FXZA 1OQDA 3E1F1 2ZHNA 3LDKA 3VZLA 2FD8A 4QU2A 2W5FA 4NHMA 1W2TA 1APNA 5FYVA 4Q0VA 1W03A 3N9QA 1TZOA 4S2HA 1AYM3 2RDQA 2VUCA 3KLSA 1UNBA 2D5HA 1FPN1 1VE0A 4GQ7A 4XDPA 3ZOIA 5K0UC 4LUKA 2QCSB 5IJRA 4E27A 3V0AA 3LFMA 4LKSA 4EWEA 2P3JA 4PLNA 2PELA 3WF4A 1W2OA 3VB9A 1WMFA 2XUMA 3CQOA 1W05A 2O1QA 2NP0A 1BBT1 2VXRA 2RS11 3H8UA 3HPNA 3RDIA 5KHKA 1UY1A 3GF6A 1JMUB 3AKRA 3MV11 4QX0A 4Y5Z0 3WLUA 3VD4A 2QFEA 3FL7A 2RDNA 4QX2A 4UF0B 4HMZA 1HN0A 3RI8A 2HYKA 4MZUA 5H9RA 3ZFFB 2PAMA 2AGSA 3AB0A 4BXSV 2Y6LA 1K3IA 4ZZ8A 3GJAA 4JV4A 1FYUA 1COV2 1OI6A 1W9WA 4FI9A 4GXLA 1ZBE2 4UXAA 3ZN4A 3E6CC 5GLTA 4CCDA 2G19A 4AI3A 5M0TA 5IATA 4B7EA 3WX5A 1RUI3 2BNNA 4Q2FA 2MHFA 2PHXA 4O7XA 2HWF1 4YM1A 1QJU2 4CP2A 1IS4A 2ADDA 1ND2C 3RYPA 4IE0A 5APAA 5SV8A 3HN3A 4NR1A 4XF9A 1S1AA 2XB6C 2OQ6A 3AYCA 4OZOA 3T09A 4A3ZA 2GNBA 2RV9A 1CAUB 2IFWA 2ZEYA 4P9LA 1N1SA 2JXAA 5KC6A 4LUMA 1NX9A 4KBZA 1HLCA 4NRQA 2D3PA 3LSDA 5FPLA 5IUQA 3N9PA 1Q8SA 2DTWA 5FYHA 1YQ2A 2WFF2 4GJZA 4QQ2A 4N7IA 3WDWA 1TE1B 5DDJ3 5FXVA 4EROA 2QQIA 3O12A 4BQ1A 4IETA 4UFJA 1WLCA 4YW6A 4R8HA 4AE2A 1MPXA 4AFBA 4M0NA 4YWAA 2ERFA 5T5JA 2ZBJA 3RZKA 1O3RA 2ZTNA 5IK8A 2QQJA 1UOJA 2WZR2 2W87A 2BU9A 2V72A 4IEYA 5BNOC 2ZAHA 5I0TA 5FZ9A 4IEVA 3CU7A 4Y33A 5DG2A 4UWDA 4WVZA 2DU0A 4N43A 1EUTA 1LOBA 1Q43A 2ZKNA 4YZ4A 1W6MB 4Y20A 5JOWA 3LQCA 2W2IA 4BQYA 2AACA 3SH3A 1XB9A 1DZTA 1HDKA 4NPMA 4E4HA 1CAVB 1FATA 5FZLA 1HQNA 1NE4A 2ID4A 3VDDA 3D8CA 5F6LB 1HV0A 4Q0PA 4XILA 1RUE3 3T0DA 3NNJA 4LORA 1W6PB 2PHTA 4IE5A 1QMJA 1TME1 1VIWB 3IWZA 2RM22 3I2IA 4HK8A 1W2NA 3M70A 1OLRA 4LBOA 4WM7A 2BRTA 1FOD2 1R1A1 2J1TA 2BDRA 3PIGA 4OI2A 2VG9A 2EIDA 5A32A 1ONAA 2A6ZA 4K1YA 5E16A 3PU3A 2EXKA 1TNFA 4LK7A 2P6CA 2BVVA 3TN93 4FAGA 1RUOA 2BFUS 2IXIA 4X6QB 5AC92 3KQ4B 5BNOB 5BPXA 1YXWA 3PMSA 4A44A 1SPPB 4L9BA 4L0PA 1VP6A 3EB7A 2F6BA 4Q4Y2 4AHWA 2IXKA 4JTNA 1RUH3 1ULCA 2WS91 3CZJA 4R9BA 1H1MA 1RUD2 4CP1A 1OQEA 3VZKA 4BQ2A 1PIV2 3OGJA 4KG0A 4EN7B 4HETA 1AVBA 2J1AA 2ZGSA 4YFWA 4XQDA 4BLIA 3AP4A 4CDWA 1Q8PA 5BNPA 1S0DA 3MGUA 1HRI2 3QD6A 5K9YA 2VOWA 3UESA 2OQ7A 3JBG1 2CGPA 2YC2A 3ILFA 4MXWB 2J1SA 3T08A 1JYWA 2J1RA 1KFUL 1QEXA 4JKMA 2LW8A 3APBA 4XFBA 4BB3A 1ZA7A 5A7QA 5FXWA 2WZEA 5T50A 5LA9A 5C6CA 5CNAA 1VBB1 1RINA 3AP6A 1C5IA 3GXUA 1QGLA 4HL0A 4NWVA 2QNKA 2XBO3 3JQWA 2VW0A 3WDTA 4A45A 5EHDA 3IDEA 3IPVA 2IVJA 1W28A 4Q4V2 5JOZA 3IB3A 5JPNB 4ZS3A 3OCPA 2A6WA 1OT5A 2XGXA 1AL23 3ACGA 3AP9A 3O1SA 4FFIA 4C1WA 1J3PA 1US3A 4Q4X2 5F5CA 1FV2A 2XL7A 3MZHA 2P4EA 2W9XA 3Q8FA 4I02A 3RMXA 3WF2A 3NMBA 3N9NA 4DXTA 2BTVC 2ARBA 3H0OA 2JX9A 3RSJA 4Y1VA 3H1YA 3SC7X 1UCXA 3BALA 1NLSA 2FMYA 1K45A 1PZ8A 1K5JA 2OZJA 2YGMA 4B29A 1RHI2 3VBFB 2DVBA 5ANNA 4LIVA 3KF3A 2BVBA 2R0FA 2E7TA 3CZUA 2VZTA 4AVAA 1NCRA 4LBMA 4QQHA 5SV5A 3URFA 5EZWA 1SQ4A 1WMXA 1H2NA 1JS9A 2J1EA 2ZOEB 3U1XA 2K0GA 2BOJA 5FMOS 3UGGA 3FHIB 3K4ZA 1XSQA 3PUSA 1C5HA 2VMDA 3TWIA 4OQ9A 3U37A 5LZ6A 4BE3A 1W39A 3L2HA 1BQPA 4K3UA 5GZDA 5DMYA 3EXUA 4GB33 2WYFA 2Z79A 3H1MA 1IQAA 1GP6A 2GAUA 4DIQA 5C3RA 1G6NA 1DFQA 1RVF1 3R0RA 1QJY3 5CFCA 4XTPA 4JVAA 3JD72 3I2OA 2R0HA 3GZTB 3VHPA 2DDUA 4YLZA 5FP7A 3FN9A 4FPEA 3WQ1A 3O0XA 1V9U2 2VZ3A 4QHOA 1QQP3 1COV1 1AX1A 2JIGA 2ARXA 3J7NA 5A80A 4BWOA 2Y38A 1PK6A 1NQDA 3DYOA 5LRSA 1POV0 1V00A 1W9YA 2E31A 4HN1A 1DYPA 3LOIA 4CCOA 1RUG2 2HEYF 4XXPA 4ASLA 4BQ3A 4M3CA 4RSUA 4A41A 3AZXA 1ULGA 1QJU1 2VTXA 2B45X 1NG0A 2OKXA 2VTXJ 1REEA 1BVVA 1HXS3 4XURA 1HB3A 2CAVA 2YROA 3RI9A 3VDDC 3WP5A 3WQ7A 3ALQA 4LLFA 3THCA 1SFNA 4XDQA 5EQUA 1W0PA 1W8HA 1HQLA 1V6MA 3N7JA 4P9YA 1JZ7A 1W2AX 1I6XA 2WFF1 2F4LA 3Q8EA 4YG0A 5DAQA 4RA0A 2QQOA 3OBAA 4AI1A 1X50A 1G9CA 2OXBA 1PX4A 1E5HA 4PCRA 1PM7A 1RIRA 2BYVE 5J96B 3DPRC 3T4VA 2XLAA 4OYUA 1QF3A 3VD3A 3MIDA 2K46A 2W92A 2D43A 4WM8A 2VCBA 3WNKA 4PLMA 1RUC2 1PO22 2YV8A 4AHYA 3F2ZA 4N53A 4IV1B 4JAAA 4N43B 4MHRA 4XEZA 2D6OX 2JDNA 3RRDA 4AI9A 4YZ1A 2RJKA 3AK0A 4Y20B 2ZGQA 3H9AA 4W4ZA 5JI7A 1H1IA 1PNGA 3FBMA 3HN1A 3M8LA 3I3MA 2RR13 3WNOA 3KQRA 1LODA 1QHDA 5FPVA 2OZ6A 2Q5TA 5FZ4A 1JUIA 2P34A 3VDDB 3ZYRA 1LR5A 4CDWC 5I0RA 1DF0A 4IEQA 1GP4A 5BNNC 1C3HA 4J6GA 2OPWA 3SCGA 5BNPC 1N1YA 1NA1A 4GWMA 4B8EA 3K4AA 1OMIA 4K9SA 2WLQA 2RM21 1ULFA 3MUZ1 3PJYA 1BMV2 1GYKA 1N1VA 1RMU1 1DZQA 1S2KA 4WM7B 3K2OA 1YQ8A 1SG3A 3HIFA 2VOXA 2C26A 4Q4Y3 4GMP1 5GLVA 3TAYA 3WG2A 3S57A 2PHLA 2TBVA 5FP3A 1VRH2 5A32B 3O1UA 1RUNA 3T4HB 4BCUA 2BNOA 4IEWA 4XUNA 5CZKA 4BHPA 4E2SA 3FFZA 1PIV3 1UIJA 3AYAA 3ZXJA 1W8FA 2WT1A 4ORFA 4AL9A 2HWC2 3HT2A 2Y0IA 1ULEA 1T6BX 3WW1A 3WUDA 3HNBM 2ZX2A 1S0EA 4TXWA 5AC91 2ILMA 1NLRA 2OW4A 1FNZA 2WC2A 1OA3A 5IVVA 4UBHA 4CUAA 3K77A 1ZNPA 1BJQA 3BOWA 1RUD1 4YW5A 4M3CE 4H7LA 5FZCA 3ZKUA 3IMNA 3LFIA 4A6SA 2DUPA 1AXYA 3ZXFA 4ES9A 4JGYB 1W6QA 5D21A 1ZM1A 4CDWB 4DMIA 5L19A 4YW7A 2EXHA 1AJKA 1HRI1 1WD3A 4RHV3 1NCQA 4Y5TA 1PO12 4FTSA 2W1SA 2ZA9A 2RMU2 3C3VA 2ES3A 2UY9A 1XSRA 3KHCA 3VZMA 3WT3A 4BQWA 3POBA 2WA3A 5A1LA 3WG1A 3ZN5A 1JH5A 3ETPA 3H8XA 1NXMA 2X5IA 4LBJA 4Q4X3 5A6QA 2DV9A 4PBOA 5BYNA 3MHZA 4AEMA 2GC3A 4CU6A 1ASJ1 4OQ8A 3GJBA 2ET1A 3UKTA 4BQXA 3WVJA 4R9AA 2RS33 5FY0A 3PIJA 3AP7A 3R05A 4YZ3A 1RUF3 4Q4V1 2LROA 1LJ7A 3GZAA 5LWBA 3TNPB 3VL9A 1KXGA 2HWB1 5L7OC 5DQ0A 4HG6B 4RR3A 3SXWA 2GNTA 4FO9A 2JEMA 5T3NA 1RHI3 3FHAA 3NNGA 2YGLA 4LE3A 4Q1RA 3M4FA 1LKNA 1ZBA3 4FFFA 5I91A 2GZWA 3I2KA 5FJKA 2BZDA 3DYPA 3GHMA 4ISQA 1OOPC 2VNRA 1AR72 3HMYA 2DCJA 4M4RA 3CEWA 1SLIA 5F3IA 1PK6C 2IUWA 4C91A 5L9BA 4I3PA 3W58A 3KD4A 1KEXA 1CZSA 3OPWA 1EYBA 1F35A 4YG6A 4I0AA 5GLUA 1MR5A 1NCRB 1WCKA 3I59A 1BK0A 1RUJ1 4XUQA 3GALA 3C7GA 3PVEA 3WNXA 4Z1VA 4PIYA 5A3MA 2PHWA 2NZ9A 5KXEA 1SMVA 2NLRA 2ZGOA 1EY2A 1SLCA 3V65A 3M3EA 3MW3A 1BEV2 4M00A 4R4XA 4BQ4A 4Q8LA 1Q56A 4HKWA 1JYCA 1XNTA 4E4ZA 4XJ9A 3UNPA 1U5ZA 2QQUA 2VOKA 2GH8A 3UL2A 1GZWA 1GMMA 2XJVA 2ZJCA 5CFCB 3JD71 3LIGA 3RYKA 1JZ6A 4FQZA 5FYUA 4FOQA 1QDOA 2LS6A 2QBXA 3L9JT 4XUPA 1H1AA 2RS51 4LK6A 3PUAA 4XF0A 1DCSA 1V9U1 4AR2A 1UYZA 1IOAA 1VBD3 4LOTA 4QX8A 1PK6B 4WM8C 3NKTA 5G05L 4BXFA 3T0AA 4EQVA 1AYM2 4UFIA 2WJSA 3GHNA 4YPJA 3ZXLA 3RZJA 1RUG1 4TZDA 1LHWA 1YHFA 2ZEXA 5DZEA 4NPRA 4M3CB 4XFIA 3AKPA 3HQRA 1UX7A 3DXTA 4KU8A 4LBQA 4RGKA 4ZONA 3VBSA 4D7TA 2VZ1A 3LA7A 3N7LA 4LO4B 1CIWA 4URTA 3ZIWA 5FZ8A 4COUA 1XE8A 3ZXEA 1C8M1 4FPFA 4C1XA 2H6BA 1U0AA 4MVTA 1U5IA 2E6VA 4YGBA 5FYSA 5JSOA 4QXCA 1YCIA 1OD3A 2WINB 2XMLA 1NA1C 5A3TA 4OZXA 3B00A 1RUC3 4CEWC 1IS5A 1PO23 4RS5A 5JCTA 2I07B 5BY5A 1W3XA 2KD7A 5K0UA 4M3CF 3DKQA 3LPGA 5C3OA 4CDUA 1AJOA 3ZDSA 2D6NA 2FDJA 3MLJA 4CXWA 1RUI2 5EV7A 3KF5A 3Q8AA 2D3RA 2LALA 3U0ZA 3AX4A 3ORJA 3EO6A 4WM8B 1US2A 2X10A 4KH9A 2QVSB 4HKLA 3WNPA 3PVOA 4AAXA 1GSLA 1OC1A 1PGL2 1DYOA 4N53B 5CVRA 4FPKA 5DAPA 4NRMA 3W21A 2XWBB 2R061 3U75A 1NZIA 4P9JA 1W90A 3RGBA 2DFCA 4AI8A 3HWJA 1UF2C 1IS3A 4YGEA 4EV0A 2HBUA 1L3JA 1KS4A 1O5LA 3UETA 4HONA 5DDJ2 1UKRA 3L2YA 1X8MA 3ACLA 3NNMA 2ZX1A 1BXHA 1OVSA 2D6PA 4QKBA 4QQOA 1NA1B 3KWVA 1NCQC 1ND2A 4W65A 3ME2A 1G9BA 1IPJA 1BMV1 2DBNA 3OOXA 5IVBA 3OD0A 3I4IA 4HK9A 5LATA 1JW6A 3TEXA 4KWKA 4P9XA 3I3DA 1KS5A 2X5IC 5JVVA 1OH3A 3ETQA 4LLOA 3RS6A 1E5RA 2FDHA 1PMIA 3NV2A 2EAKA 5I8YA 4K6BA 5J1XA 5EP9A 5JSPA 2CDPA 4L8QA 4MOAA 3WSOA 2W1QA 5LY2A 5C7GA 1PO13 5CAZA 4H14A 2R073 3SKVA 1RUE2 1S2BA 2GMMA 3CIHA 2RMU3 4RR3C 5E6HA 1H6XA 1X82A 4Q4W3 5A7NA 2F17A 3NNFA 4LOSA 5HXVA 5IHRA 1GNYA 1SEFA 2VE1A 3N36A 4E4SA 5FPBA 5FWEA 3VBUA 3B9CA 5JUVA 3WP3A 3DGTA 1VMFA 2SLIA 3I3EA 2VZVA 3C8XA 4R4ZA 4CA9A 3AKTA 2YFZA 1W6QB 4M4PA 2I2SA 3AZZA 1G86A 3BUCA 3FHQA 1QJFA 3OG2A 5DUVA 4QQLA 4AF9A 4LO8A 2ZAAA 1NCQB 1D4VB 1OKOA 5GZFA 3RPQA 4XJUA 4HANA 1ODMA 3OEAA 2P17A 4YVSA 3TN92 1DGLA 2J7MA 4QPGB 4BISA 4XETA 5JMCA 3PJQA 5FY8A 1JTZX 2D6LX 1E5SA 2B39A 1H6YA 4PI0A 4AFAA 4UFKA 4DB5A 4QDSA 1DIWA 3CJIA 4XHXA 5LA0A 2CL2A 1LGCA 3KS7A 1RUH2 3Q8BA 1GWMA 3SCFA 5EXOA 5FYYA 1PVXA 2DVAA 2IC1A 2VAUA 3IT8A 1OFNA 2NMOA 4QKFA 1ZRDA 3IIAA 4DINB 1VAVA 2ZABA 4FBFA 3RZMA 3MFCA 1KDMA 3LPFA 4RR3B 4OVEA 4IW3A 4RD7A 3PU8A 1VAMA 1MEC3 1X9TA 1VAKA 1FT9A 1L7QA 1VPHA 3E6DA 1NLQA 4NHKA 4YM2A 5JXIA 2HWD3 1EAH3 2C4XA 5A7OA 2NM1A 4FAHA 5IAXA 2Q1ZB 2C24A 1AR71 2E33A 4J1XA 4M01A 3IIIA 3P5BA 1OUSA 2DFBA 2ZZQA 3ILNA 1YFXA 1OVPA 4FPHA 4N9IA 3JB8A 1PZ7A 1E57A 4URAA 3ZX7A
chains in the Genus database with same CATH topology
1KD7A 1ENSA 3I59B 4A2UA 4AVSA 1FMD2 3B9IA 1F9KA 2WQZC 3AZVA 3B69A 3VBSC 1UU5A 3AZYA 2XG3A 1AL22 5J37A 1BEV1 4A7ZA 2QE3A 3WXPA 4FTBA 2Q0AA 1GLHA 1ZVFA 5T52A 1X36A 1GZWB 4FPGA 3WUCA 4RS5C 2XWJB 3M1HA 1O4ZA 4D94A 2D6MA 3FMGA 3K48A 3W9AA 2R041 4CDUC 3POSA 3E5QA 1HV1A 1UU6A 2VGDA 2CWSA 3ZYPA 1AYN3 3H50A 3M3QA 4LTAA 4E9KA 1OA4A 2D5FA 2ZGTA 3S7IA 1CPNA 4LO7A 4GH4A 5C4WA 2AENA 1AX0A 1MZ6A 1Z7S3 2ZZJA 3WINE 1IGOA 1QWRA 4PQ9A 1H4HA 2UY8A 3S0MA 3VBSB 4GB32 4XZPA 2JECA 2UWAA 2E63A 3AJZA 5IT6A 1PZ9A 5FQ0A 4FPJA 4XE9A 1QJY2 2AUYA 1B35C 1EP0A 2ZX4A 2EIGA 3WDUA 1AHSA 4FXKB 2LUWA 4XJAA 5FPXA 1QQP2 4RS5B 3SMHA 2VVDA 4L92A 3UJOA 4LHLA 5K0UB 2WNUA 1YIPA 1JUHA 2DVFA 4RQPA 2RE9A 4CDUB 4Y1YA 1LESA 4V1PA 4I09A 1LOGA 1RUI1 4K21A 3H3ZA 5JZGA 4MYEA 1LHNA 1D0GA 1SLBA 4DY5A 4AQ2A 3KT1A 2NYYA 3ZVXA 1YUDA 3HBZA 3MFAA 4GULA 1HXS2 4JRAA 2C1FA 3IDCB 4QGNA 2PAEA 3AFGA 3QH7A 2NN8A 3GBGA 1H8TA 2YHJA 2Q4SA 1F8VA 2P2KA 5IK4A 3S6PA 4KU7A 2P3IA 3ZSEA 3VBUC 5B2GB 1M06G 2DCZA 3H7YA 3ROUA 2Q1MA 4BZ4A 5DDJ1 3SH4A 3J8F3 1GQGA 2XKPA 3NV3A 4L99A 1ND2B 5FTTC 3ZFGA 3ZXGA 2G9GA 4YVSC 1XNKA 2UU8A 1A8MA 2Z5WA 4FSJA 2JD4A 4P14A 2YYOA 3W59A 1AX2A 3E97A 5TSWA 2VUAA 3CJIC 5GM0A 3DN7A 4RGAA 1QJX1 1SCRA 3SNMA 1R091 5FDBA 3THPA 1LENA 5T55A 2RR12 1J3QA 1RGSA 4FAHA 3VUOA 2WT0A 3VLBB 5J98B 4A7YA 1R1A3 5KBFA 3LSEA 3VHOA 3DPRA 1MS4A 1Z0HA 1H2MA 1RUE1 3GBWA 3PVNA 2XLFA 2ZGNA 1ENXA 3MLKA 4GKXA 1O7FA 2EF6A 1GNZA 1SBEA 1YFUA 1WLWA 1Y43B 2EA7A 5BNQA 1DQ0A 2B5HA 5GZGA 1R083 2OVUA 4XJWA 4G4FA 3WD5A 4Y1UA 1MVQA 1N3PA 4MSVA 5FAXA 4YVSB 5KXCA 4FPOB 3TN91 4YM3A 2GMEA 4YGCA 3I2DA 4JTOA 4EJRA 4XBLA 5BNNA 2PHUA 1I1EA 2Z69A 2VVFA 1LU2A 4QM9A 3CJIB 2YUEA 3KGLA 1WCSA 3VV1A 1B09A 3JBG3 2OUHA 3IM0A 2V73A 4PBPA 5JPMB 4QMAA 3UJQA 3E5XA 3HR9A 1VBE2 2D93A 3A4UA 2DUOA 2AH2A 4RHV2 5JR7B 4XFFA 4AQSA 4D69A 1AR82 3P3PA 2BEOA 1LGBA 2IZWA 5F9TA 5KHIA 2A5ZA 1FMD3 3NL1A 3TOJA 4JCKA 3M3CA 2VQAA 5ACA3 2HJIA 4MUVA 1DHKB 2VH9A 4Q0SA 1DGRA 1D2QA 3QH6A 3N3HA 3NV4A 2XJUA 3S7EA 3ILRA 3MEPA 4B7KA 3TB0A 4GH4C 5C4WC 2XBO1 1H4GA 2RS32 2TNFA 3MIBA 3THTA 2JICA 4CZSA 4H7MA 1RUF2 1CQ9A 3MLLA 4WZFA 2ZX3A 1AL21 4LR4A 5DG1A 3QACA 1MZFA 3B3QE 5A3LA 1ZBA2 3FWEA 1V6LA 4S2GA 5H9PA 4MH0E 4UBGA 3UK9A 2IWGB 4KL1A 3B02A 1ULDA 2ZGRA 2AZ5A 4ONUA 3UKVA 3NV1A 5HCFA 5LK7B 1NOVA 2WNUC 4U36A 2HWE3 4RQPC 2NQYA 4COYA 4BYYA 3ZYIB 5FPZA 4MX3A 3BB6A 2I45A 1ENQA 3KCYA 5JIUA 5L7OA 2Z42A 5JZGC 3NWKA 2YC0A 2QDNA 1V6KA 4GH4B 4D7YA 5C4WB 2FZ2A 3FLPA 5HI0A 2TUNA 3V0BA 4Y1ZA 2RJLA 4FP2A 1OOPA 3QOPA 2ZGMA 4IXLA 4CEYA 1VB4A 1H8TC 1M4WA 1ZBE1 4FPYA 3RJ2X 1LHVA 1CR7A 3VGIA 3MYXA 3ZFEA 4E2QA 4LBLA 2BBVA 1ZREA 1QJY1 1WMDA 1D4M3 1PVC3 2BGCA 3N35A 3NO8A 3Q9OA 3A0KA 4XYXA 3DL3A 5CAZA 3ZFGC 1QQP1 1VBD2 1JBCA 5FCCA 2YZ4A 4RQPB 3RG0A 5CFDA 2CYFA 4P9IA 2GMPA 1BVP1 1LOFA 2VY0A 3R4SA 5JZGB 2VW2A 2NMNA 4FCAA 3CLPA 4HBNA 5T5LA 1F5JA 5KXBA 1HKDA 5DUXA 3WZ1A 1OQ1A 4FP3A 4QQPA 2B7YA 4LT5A 4LULA 3KCXA 1FX5A 4AFBA 2BFUL 1H8TB 4QHBA 5KHGA 4I2OA 3CNAA 2WZR1 1DYKA 1DQ5A 3GZUC 4UW6A 2XVGA 1TMF2 4XIOA 4WVMA 1YFYA 1GZ9A 5FBZA 2KXLA 3ENRA 1QY4A 3ZMNA 3OGGA 3FX3A 1POV1 2E51A 3ZFGB 4IEZA 2B9UA 4ATEA 5F1RA 5JWPA 3V56A 2A6XA 3OPZA 5JIAA 2PHDA 1EV13 1YLLA 4DOUA 2ATFA 4Q26A 4HFSA 4Q1PA 4YW3A 4YZ5A 3JUUA 4CEWA 4XJ8A 5L73A 1FOD1 1IZ3A 1UN1A 2JKBA 5D8AA 3VKLA 1XYPA 4FPLA 1RMU3 4S2DA 4GMP3 3DPRB 4ATFA 4E2GA 3KMHA 4HPKA 2OA2A 1R1ZA 2DCTA 1V6JA 1AR93 1KDKA 3G6JB 4J1WA 4W6YA 2CTVA 4Q4Y1 3M2MA 2PHFA 3D4KA 3MDPA 3AMPA 1RC6A 1BZWA 1OD5A 1QJZA 1RITA 1PIV1 4XFHA 4AHZA 4QD2A 1VBA2 4LE4A 1GZCA 1SDWA 1UX6A 3AYEA 1VBE3 3H3UA 5BNNB 5BNPB 4AI0A 4E4DX 2WFPA 2UWBA 1ZRRA 1TQ5A 4BIOA 2R072 1AR83 4XF3A 2VMHA 4Q4W2 1RB8G 3FBYA 2B46X 5F6KA 3SITA 1ZZ6A 4XOGA 3VKFC 1BYHA 2XL9A 1WW7A 5FMOL 4AEDA 2BUKA 4RHV1 2D3SA 1FNYA 4BM8A 4KGQA 1ASJ3 3IPVB 2PLV3 1VB2A 4OI0A 3QBQA 4IEPA 3IKWA 3WV6A 1T6GC 4CDQA 2JJ6A 1YFWA 3LB9A 4Q4X1 4L97A 4IL7A 3ZO0B 4ZKTB 1MZ5A 2RS31 4XMAA 4NOTA 1AR63 5J48A 3FJSA 1QOOA 4K40A 3P3NA 1PGSA 2A7AA 3NKGA 4MXVA 3SCGA 4CEYC 2E53A 1F2NA 3DV8A 1A78A 1UKGA 1WLDA 3ZFEC 1O4YA 1RHI1 1LHUA 1ZBA1 1MEC2 4ES8A 1C28A 3LA2A 5JOYA 2W68A 3EJKA 2H6CA 2HWD2 1EAH2 3NVCA 5GZEA 3CO2A 1ZYBA 1LEDA 4Y4YA 5AVAA 1XNBA 2JENA 1O3TA 4KNCA 1OKQA 3MF6A 2C5DA 3UKNA 5CFDC 1CAWA 1JOJA 1PGW2 3J9SA 4YW4A 5L7OB 1LOFC 5GKAC 3MI8A 3SLIA 3KT7A 2WNVA 3INAA 1Y7BA 1MVEA 4RFT0 3ZXAC 3ES4A 4HSJA 4HLTA 4XBNA 2OYZA 3V0BB 1H8VA 3D6EA 1OOPB 2MEV3 1G9AA 3RZZA 1QXPA 2O0OA 5J3UA 4BH9A 5CA6A 5BV6A 4P9GA 2X53S 3ZFEB 1GKBA 2DYCA 3O0WA 4YW1A 3MICA 3WHTA 4Y22A 2ZGUA 1SCSA 1ZZBA 4COVA 4R9DA 3VHRA 1JXNA 3D5OA 1AYN2 4K1ZA 4NN0A 3VBHA 2SBAA 4XIKA 1F5FA 1VBD1 4F8AA 1VBC3 2O8QA 2ZACA 4CTEA 5CFDB 1ENRA 3WG3A 4Y24A 1AXKA 1Z7S2 3M3OA 3NJZA 2F4PA 4Q0QA 3JB4C 5D8AC 1TMF3 1AXZA 3T2TA 3I7DA 4DZGA 2N7GA 4ZU7A 2R30A 3O7OA 4LA2A 2B42B 3EBRA 3WCSA 4B4PA 3HAGA 2JE7A 3HD8B 1J59A 2YY1A 3B93A 4HKOA 3JZVA 5FO8B 4LEJA 3KT4A 1W0OA 4FT8A 4OUSA 2BW8A 1D2SA 1RUC1 1PO21 1FAYA 2A3WA 4FQ4A 1G8WA 4QPIC 4JC1A 4BOWA 1BK1A 1J58A 4WVMB 1S0JA 2D98A 1IKPA 1KJRA 1MS9A 4A7KA 4Z82A 3NAPA 2GU9A 1B35A 3BODA 3FE5A 4OI4A 2PTMA 1CN1A 5DUUA 2DU1A 3MPBA 1RL3A 1UZZA 1LRHA 4CEWB 4JDNA 2ZGPA 5C33A 4RL7A 1ND3A 5D8AB 1UAIA 2K9ZA 1CVNA 2AYHA 3AZWA 1VRH1 3WDYA 5T5PA 1SACA 2W52A 3ZIXA 4HPKB 3J8F2 4AEDC 3E6BA 1VBA3 2HWC1 4Q8KA 3U10A 3PVBB 1FI2A 4OULA 2FQPA 4LHKA 2VUJA 2R1BA 2ET7A 4Z2WA 4BLJA 4CDQC 1WMEA 4L2NA 1J1LA 2W39A 3PLQA 4YFZA 1HRV3 1GFF2 2QJVA 1TME2 3GYDA 4EN6B 5K8SA 3J4UH 2WWSA 1ZRFA 1R1A2 4XTMA 2PA7A 3MIGA 1Q8OA 4XW3A 4YARA 2XJTA 1PO11 3AM2A 3T1LA 1GANA 4XHBA 2RMU1 3WCRA 5LEKA 4Q4W1 4PDWA 3RYRA 3BU7A 5FOBB 4R9CA 4XF1A 2GC0A 2TEPA 5H9SA 4KG8A 1SLAA 1VR3A 2X5IB 5I0UA 4TWTA 4IV3A 3KM5A 4FOVA 1R082 3O5SA 2UURA 4G9SB 2GC1A 1LB2A 1ZZ7A 3D82A 3NW4A 1SBDA 2WIIB 4KGGA 4M0HA 2E7AA 1UPSA 2P37A 3RNSA 2D40A 2ZGKA 3JU9A 4HT1T 4CDQB 5FOJB 2LM3A 3AMHA 1GR3A 2WNVC 3LKJA 3ZFFC 3VKMA 2ZHLA 1MS0A 1YYNA 1ALYA 1LOAA 3JBG2 4DPNA 1NXD1 1N3QA 3VHNA 4IEUA 2R6QA 1MZEA 2DURA 4GKYA 5GLZA 1YJKA 5DXDA 3ELNA 5C8CA 5T5OA 3O0VA 1MEC1 2WT2A 4OLLA 5HBAA 5DUWA 4UW3A 2DF7A 5ACA2 3VKNA 1IPKA 3VBHC 2D44A 5E89A 1GICA 3BCWA 5HCBA 1X8EA 1HQWA 1SLLA 5EFUA 1CAWB 5CADA 2GNMA 2XLGA 1JHNA 3FUOA 1CX4A 2WNVB 3CJXA 4HN0A 1FPN3 4AGVA 3OY8A 2R043 4AVCA 1QXJA 2O8OA 1J3RA 1V6IA 4BMEA 4X8NA 1BBT3 2RS13 2QZ2A 1OFSA 1K5MA 1AYM1 2D6KA 2R49A 3CF6E 2Z2SB 2GDFA 2I74A 5FFOC 3A0NA 2HWE2 4QGMA 4Y22B 4LBQB 4QX5A 4MV2A 1VJ2A 3BIWE 4K7JA 1AYN1 3VBHB 2R32A 1REFA 4HZFA 3NAPC 2VMIA 4Y26A 2PYTA 2D7FA 2PAKA 1BCXA 4YYOA 1RVF2 4CYDA 4QGLA 1Z7S1 5J36A 2PN5A 5DZFA 4EN0A 2HWF3 3ZPYA 4FXGB 4FTEA 1OPOA 1ND3C 5EYXA 5HCAA 5CIRA 1W6OA 5I93A 2ZCWA 5LRRA 4AVBA 3ZSLA 1LGNA 1DGWA 4XXAA 2Y26A 4BPZA 3FC0A 2A71A 3MIEA 1G9DA 1D4M2 1PVC2 4INDA 2B8MA 2A3XA 5BXXA 5BUVA 3JCIA 1PGL1 5KWRA 4LA3A 4FPCA 4ZU5A 3R4UA 2DVDA 3ZXKA 4AVTA 1MQTA 1U5XA 1DGRN 4PIXA 3ZMOA 2DTYA 4Q29A 4C0BA 3NAPB 1B35B 2UYBA 1YI9A 3FLTA 3R6SA 1QNWA 2V5YA 1ND3B 4PDWC 4SBVA 4COZA 2ZMLA 5I8TA 1WW5A 4IV3C 3J8F1 3USUA 3OBRA 4AK3A 3RWNA 1DBNA 4IV1A 1TME3 4FOYA 4I01A 1QJX3 3FZ3A 3BPZA 1YWKA 4YVWA 1R093 5E1RA 4HVOA 3ES1A 3LOBA 1J1TA 3KZ4C 1EV12 3KGZA 5J7MA 3ZYJB 3IDBB 1XYOA 5FLJA 1QDCA 2EXJA 4NHLA 3MIHA 3SISA 2XVLA 3VBUB 3I54A 3AXEA 1MS5A 4DXZA 5C8WA 1RMU2 4AW7A 3G7DA 4IEXA 3J26N 1N1TA 3WW4A 2XJPA 4H55A 1UU4A 2WS93 2RHPA 3WR0A 1O5UA 4PDWB 4AQTA 2WSVA 5C8CC 3GBFA 2QUOA 5LK5A 3RJRA 3AP5A 2DVGA 1AR92 1C1LA 2ENRA 2MNGA 2ZKLA 3DUIA 5EWSA 1QNYA 4B4RA 4IV3B 2IXJA 1DG6A 4Q0UA 1RUH1 1R081 2CGOA 4GIQA 4NVPA 1DGWX 1PNFA 4BIFA 3PMEA 4QT6A 5CBLA 4AEKA 4OUMA 4B3NA 2IXHA 3FFQA 3I8TA 1LHOA 2WQ4A 2A6VA 5DZGA 2VQ0A 1NZCA 1XXNA 2JG8A 3ZSMA 4JGYA 1IKQA 2CGNA 2XH6A 1VBB3 1GBGA 2VW1A 1MS3A 4BMBA 4DRRA 4LBKA 1S0GA 4CDXA 3B5LB 5C9AA 3VBFC 2CY6A 2XKOA 2GN3A 1JN2P 4JGZA 1BKZA 1DQ2A 2AREA 4AYUA 1SBFA 2GN7A 1K5MC 4AGRA 3OD4A 5C8CB 1ASJ2 3ZSKA 2PLV2 1XYNA 1FMD1 2G9FA 4IESA 4OHZA 3LGRA 2NPIA 2ZHMA 3WQ0A 3MPPG 5ACA1 1LECA 3VBOA 4K20A 2HEVF 4N7UA 1C1FA 2HWB2 2VOVA 2GNDA 2QDRA 2A73B 1WLTA 2C0ZA 1H2LA 1NY72 4EN9B 1GQHA 1KQRA 3ZN6A 1AR62 2V09A 4PIZA 1QKQA 2QQPA 3U4XA 3VBRA 2EAAA 2DWRA 3RQ0A 4QXKA 4UW5A 3H1WA 3OY8B 1KFXL 5D1IA 3O14A 4JDMA 1ZRCA 1TNRA 4MLOA 3K51A 3WOGA 1K5MB 4UW4A 1RUJ2 2C9AA 1RVF3 2HWE1 5ABJA 3TBDA 1U5YA 1H0BA 2LTNA 4AFMA 1YI7A 4NWWA 1HX6A 4GB31 1EPZA 4LBQD 1MQTC 1COV3 5FQ0B 1ZBE3 1UPIA 1WBLA 1HIXA 4AEJA 2ETEA 2A3YA 3B94A 1ZA4A 1WW6A 1EPWA 1S55A 1X7NA 1URXA 3CL1A 2MEV2 4OHWA 4AFDA 4L11A 1QJU3 2RS52 2WNUB 1DDLA 1W6OB 4S2FA 1Z78A 4LBNA 4MGYE 5LEJA 1V70A 3MW2A 4XFGA 2XVKA 3IN9A 4O9GA 3WDXA 2VMGA 1D4M1 2ZS6B 1PVC1 4IV1C 2Q30A 3WHUA 4N43C 4Y1XA 4AGGA 2WFF3 1QXRA 3BOPA 1HXS1 4YVWC 4FVVA 1VBC2 1XE7A 1KRIA 1C8M2 3WP4A 3N7MA 4OHVA 4HVRA 4GMP0 2ZMKA 4IQPA 2BWCA 3R4DB 4H3WA 4GA9A 1MQTB 2OUJA 5I8SA 2VULA 3LA3A 2WZR3 2AR6A 1XU1A 4WBBA 4OFGA 4WM7C 5FREA 1ZZ8A 1Q8QA 1A8DA 1OSGA 1W6NA 4DS0A 2WLPA 2EVXA 3KB5A 1WCDJ 4YZ2A 1POV3 4JQRA 1UL9A 3OBTA 1DQ6A 2ZMNA 1O91A 2W0XA 3USUB 2PQQA 4N9HA 3RMYA 3ASIA 2R062 2RM23 2RR11 1FOD3 5CG9A 4YVWB 4AVVA 5IK5A 3FLRA 4EWAA 1V6NA 4AFCA 1EV11 1YJLA 2WNEA 2JG8C 4WV8A 4JGYC 4ZU4A 1A6CA 2KA3A 4A3XA 1LOEA 4WZCA 3TNQA 4I0BA 3ZYGA 1CJDA 4QPIA 3ST7A 3ZSJA 1Y3TA 2YMZA 5AC93 4XBQA 3OYWA 3C2UA 4KBBA 2VNGA 4CDXC 5C9AC 2EALA 3AMMA 3M7AA 4DY3A 4FOWA 4JGZC 2XJSA 3NSTA 2H0BA 1I5ZA 1RUD3 4BA6A 1ZZCA 3LAGA 1CAXA 5EYYA 1AR91 1DLLA 5AFBA 1S0FA 4GALA 5A33A 2A70A 2YDEA 1WD4A 3D0JA 1QOSA 2FHRA 4O9EA 5I0SA 1HRI3 1QU0A 1WA4A 3POYA 4QPYA 1N47A 3VBOC 4Q27A 1HRV2 2R1DA 2R16A 1LOCA 3FUQA 5KC5A 1VBE1 1XNCA 3OTFA 2JG8B 1C4RA 3AMQA 2HKXA 1AR81 4N90A 3VBRC 5L36A 5JSRA 1SLTA 1VALA 2Y0OA 5CB7A 3LCPA 1MACA 4LHNA 4Q4V3 3M3IA 4CDXB 1REDA 5C9AB 4QPGA 2QKDA 4JGZB 3AMNA 1NYWA 2HWB3 2CWMA 2XJQA 1NCRC 2MPFA 3AFKA 2JG9A 4F7ZA 1LULA 1X33A 1RUF1 1I9RA 4PLOA 5ABJC 3N7KA 4AHXA 1AZDA 2PLV1 1YRZA 2GALA 4EN8B 4PJYA 1AF9A 1MS8A 2FZ1A 4I3GA 1G9FA 2K2SA 3AXDA 3VBOB 5JI9A 4Z07A 3ATGA 1Q3EA 5E8AA 5H9QA 1NY71 5CFCC 2E7QA 1JYIA 2E9QA 5FO7B 3ZN6B 1AR61 3VZJA 4DFSA 2PFWA 3VL8A 1RUJ3 1H30A 1S0BA 2HEWF 3DF0A 3HQXA 2WZPP 2D97A 3POWA 3VBRB 3ZXDA 3E5UA 2CNAA 2DCYA 1OPMA 1AL0G 4PF5A 3MW4A 3BTAA 4OHXA 4TLFA 1DQ1A 5CU1A 3WW2A 4D7SA 4ZXKA 3N4MA 1RJ8A 2P3KA 3B01A 4AG4A 1UD1A 3ZFFA 2XHKA 3UV9A 4LO5B 5E88A 2GSYA 3JD73 5ABJB 4XQ4A 1CJPA 1UZYA 2BQPA 4WVVA 1XNDA 2VPVA 4CEYB 3ECQA 1H9PA 3EHKA 2RS53 1V9U3 3S30A 4TYSA 1KITA 2IXLA 4X6RB 1WUVA 4R52A 1LEMA 4XF4A 1DU3D 1FPN2 1RUG3 1XRUA <