5L7OC

X-ray structure of triatoma virus empty capsid
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
276
structure length
276
Chain Sequence
SKPLTTIPPTIVVQRPSQYFNNADGVDQGLPLSLKYGNEVILKTPFAGTSSDEMALEYVLKIPNYFSRFKYSSTSLPKQVLWTSPVHPQIIRNHVTVVDAPGQPTLLAYATGFFKYWRGGLVYTFRFVKTNYHSGRVQITFHPFVGYDDVMDSDGKIVRDEYVYRVVVDLRDQTEATLVVPFTSLTPYKVCADVFNSANRPKYNYEPRDFKVYDNTTDQFFTGTLCVSALTPLVSSSAVVSSTIDVLVEVKASDDFEVAVPNTPLWLPVDSLTERP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title X-ray structure of Triatoma virus empty capsid: insights into the mechanism of uncoating and RNA release in dicistroviruses.
pubmed doi rcsb
molecule tags Virus
total genus 43
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5l7oC00
3NAPA 2ZAHA 4QPGC 1EV12 4CDQC 3VBUC 1RUC1 1RB8G 1VBA1 4JGZA 4CDWB 3VDDA 1HXS1 1PVC1 1AYM3 5ABJA 2X5IB 3ZFEA 2XPJA 3VBOA 1RUD3 1VBD2 5K0UA 5D8AC 1FMD2 1RMU3 1PIV3 1X36A 4CDUA 5C8CB 1RUF2 4FTBA 1H8TA 3DPRB 1ND2B 2RS11 2R041 5BNNA 1NA1C 1VBE2 1D4M3 2FZ2A 1RVF3 1RHI2 3VBRA 3JD72 4YVWB 1FMD1 2HWE3 4CDXC 5AC91 1FOD2 1QJY1 1QQP1 1AL23 1VB4A 3ZFGC 4YVSB 3S6PA 4N43A 1K5MA 3FBMA 1RHI1 2WFF3 1ASJ1 1E57A 5C8CC 1RMU2 1TME2 3IDEA 1ZBE2 4RQPA 1F8VA 2R073 5JZGA 1ND2C 5BNPA 4RHV1 1MQTB 1RUI3 4CEWA 4Y4YA 3TN93 3VBSB 1VB2A 1RVF2 4YVWC 2R061 1RUH1 2RMU1 4SBVA 2FZ1A 1TME1 1ZBE1 1V9U1 4Z92B 3VBFB 4CEYA 5A33A 5C4WC 3NAPB 1NCQB 4IV3B 4Q4W1 1RUC3 3VDDB 1VBA3 4Q4X1 2WFF2 1HXS3 1PVC3 5ABJB 3ZFEB 1PGW1 4WM8B 5BNOC 1PO22 1HRI1 3VBOB 1GFF2 5K0UB 2R072 1AR61 1EAH2 2GSYA 1SMVA 1PGL2 1RUI2 1H8TB 3TN92 5A32A 4RR3B 3M8LA 1NY72 2RS13 1AR91 2RR12 5FOJB 2R043 2HWD1 4QPIA 1PO21 1AUYA 1OOPA 3VBRB 1R092 3ZFFA 3VBFC 1EAH1 1FMD3 1PGL1 5AC93 1X33A 1WCDJ 1QJY3 1NCQC 4IV3C 1QQP3 4RFT0 2RR11 1A6CA 4N43B 1RUC2 1VBA2 1HXS2 1PVC2 4WM8C 2RM21 1R091 1RHI3 3VBOC 4Y5Z0 5C9AA 5K0UC 1ASJ3 3VBHB 1H8TC 4GH4A 4RQPB 4RR3C 1COV1 3ZXAC 5J96B 1BEV1 4GB32 1VRH2 4RHV3 4JGYA 2RS12 2R042 3VBRC 3CJIC 2GH8A 1IHMA 2R063 1RUH3 2RMU3 1B35A 2ZTNA 4WM7A 1TME3 5AC92 1QJY2 1ZBE3 5CFCB 1HQNA 1V9U3 3JB4C 1QQP2 5A33B 4GB31 1VRH1 1NCRA 4N53C 1DDLA 4Q4W3 2HWC1 4Q4X3 5CFDA 3VBHC 1ASJ2 2BFUL 3LOBA 1HRI3 4BCUA 1AR63 4CDWC 2BPA2 2VQ0A 5ACA1 4RHV2 2X5IC 4QPGA 5A32B 3VBUA 1RUG1 1R081 1AR93 1RUH2 2BUKA 2R062 2RMU2 2HWD3 1PO23 5CFCC 3ZFFB 3DPRC 1V9U2 4IV1B 1HRV1 1EAH3 5D8AA 4LLFA 4RS5B 3JBG2 4Q4W2 2RR13 1C8M2 1PO12 1NA1A 4Q4X2 5L7OB 1AL0G 2RM23 1R093 1PGW2 1HRI2 4GMP1 4CDXA 1TMF1 4YVSC 1AR62 4GH4B 5GKAC 2HWB2 3JBG1 1COV3 3ZFGA 4JGZB 1BEV3 1C8M1 1AYN1 1PO11 1AR92 1NG0A 2QQPA 1POV1 1Z7S1 2HWD2 4FTSA 3ZFFC 2Y26A 1BMV1 4IV1C 1B35B 5C8CA 4CDUB 1MQTC 1ND3A 2HWB1 3VBSC 1VBB1 4RS5C 1ND2A 1RUJ1 4GB33 5LK7B 1D4M1 1VRH3 5BNNB 5L7OC 1QJU2 2HWF1 1HX6A 1VBC2 1C8NA 2RM22 4YVWA 2WZR1 2HWC3 3NAPC 1AL21 1R1A2 4JGZC 5C4WA 3VDDC 1COV2 1RUE2 2WS91 1BEV2 1K5MB 1QJU1 4GMP0 3ZFEC 5ABJC 5ACA3 1VBC1 3VBUB 1W39A 1B35C 1RUG3 1R083 1ZBA2 4CDUC 2RS32 5BNOA 1R1A1 2PLV2 5JZGB 1RUE1 5BNPB 5BNNC 4PDWA 4CEWB 1QJX1 1ZBA1 2HWC2 2RS31 3J8F1 5FMOL 2PLV1 1BBT2 5J98B 1F2NA 3VBFA 4GMP3 4CDXB 4CEYB 4NWWA 1CJDA 4N43C 1TMF3 1K5MC 1NCQA 4IV3A 1AR71 4Q4Y1 2MEV1 2RS51 1MEC2 1OHFA 5ACA2 3ZFGB 3JBG3 4Q4V1 1C8M3 1AYN3 1PO13 1RUG2 1R082 4WM8A 4RQPC 1BBT1 1POV3 1Z7S3 2ZZQA 5JZGC 5DDJ2 1AR82 5BNPC 1HRV2 4CEWC 1ND3B 1EV11 2XBO2 4AEDA 1MEC1 4RR3A 2HWB3 1VBB3 4CDQA 1RUJ3 5FMOS 4QPIB 2HWF3 1OOPB 3CJIA 1VBD1 5DDJ1 1AR81 2WZR3 4CEYC 2XBO1 1RUF1 1TMF2 1FPN2 4FSJA 5C4WB 2BFUS 1VBE1 1AYM2 2WS93 1QJZA 1QJU3 1AYN2 4N53A 3JD71 1VBC3 1Z7S2 3HAGA 1FOD1 5C9AB 1RUD2 1BMV2 3VBHA 1PIV2 1ND3C 1FPN1 5BNOB 3JB8A 1R1A3 1NOVA 1AYM1 1VBB2 4CDWA 1RUE3 4PDWB 1RUJ2 4QPIC 4JGYB 1D4M2 2X5IA 1OOPC 2HWF2 1RUD1 2WLPA 1RMU1 2HWE2 2WZR2 1PIV1 1QJX3 1ZBA3 2TBVA 2RS33 4WM7B 5CFCA 3J8F3 4EJRA 2PLV3 3DPRA 1AL22 1CD3G 1NCRB 2WWSA 1RVF1 2WS92 1AR73 4Q4Y3 2MEV3 2RS53 4FTEA 2DF7A 1OPOA 5C9AC 2HWE1 4Q4V3 5CFDB 4GH4C 1VAKA 1BBT3 1M06G 4YVSA 4PDWC 4JGYC 4AEDB 1EV13 1MEC3 4QPGB 4CDQB 2WFF1 4WM7C 1QJX2 3CJIB 2IZWA 2R071 1VBD3 3J8F2 4IV1A 5DDJ3 1AR83 2BBVA 1NCRC 1POV0 1RUI1 5D8AB 1HRV3 4NWVA 2XBO3 1MQTA 1RUF3 3TN91 3VBSA 1AR72 4Q4Y2 1NY71 2MEV2 2RS52 4RS5A 5CFDC 1VBE3 4Q4V2 1NA1B 5L7OA 4N53B 3JD73 1FOD3 4AEDC 1FPN3
chains in the Genus database with same CATH superfamily
1H0BA 4ASLA 5F5IA 4OQ9A 3AMNA 3MW2A 3OYWA 1XC6A 1RUC1 1EUTA 2VPVA 3ZPYA 5FPXA 1YFUA 1PVC1 4XFIA 2JWPA 4UT5A 1UAIA 3U1XA 5GZCA 4GWNA 2XL7A 1WW6A 2JG9A 1GP4A 1ULFA 4FXKB 4P5YA 3D0JA 3NJVA 4CDUA 2W95A 2GC3A 5DABA 1RUF2 2VMEA 3NNFA 4C1WA 2H6BA 4AQTA 1EPWA 2D93A 2Q4SA 1HIXA 3OGGA 3ZPOA 5A3UA 4BQWA 2ZHMA 2R041 3BTXA 2EIDA 2JDZA 3AFKA 2A3YA 3J7HA 1RVF3 1J3QA 1EYBA 5J48A 4GWMA 4ISRA 3VBRA 1MS1A 4YVWB 2KXLA 4FPKA 5KR7A 3BB6A 4FCAA 3RYRA 4BQXA 1YCIA 3LA3A 1RINA 5FJHA 4C0BA 2I07B 3CZJA 5A7WB 4HONA 3KT1A 3S0MA 3NV1A 3ZM8A 1VB4A 1GNHA 3ZFGC 1R1ZA 4YVSB 3ROUA 2XG3A 1GLHA 3FLPA 1DG6A 2ARXA 3FMGA 4AGGA 5F1RA 4BYYA 1G7YA 3I3QA 3IM0A 3USUB 4DS0A 1U12A 1YNAA 4XFHA 4XDPA 1E5SA 2WFF3 4LT5A 1OA2A 1NX9A 5C8CC 2YHJA 2WUHA 2XQRA 5LRRA 2WO1A 5DQ0A 5LA0A 2ILMA 2LS6A 2OUHA 4NVPA 1J3RA 2W92A 5FZHA 3VHPA 2QCSB 5FR3A 1ND2C 1WGPA 5KHKA 1H2KA 5L9RA 2VECA 4CEWA 1VJ2A 1TZOA 4Y4YA 5AFEA 1VR3A 3H50A 4EWEA 3TN93 1UX7A 2PELA 1UCXA 3ILRA 1G9CA 2QQNA 3NJYA 1RVF2 3L9JT 3MV11 2PHXA 4SBVA 4W6WA 1CZSA 1OQDA 3OGVA 1TME1 3PVBB 5CISA 4KH9A 4NIIA 2Y6LA 1DLLA 2VMCA 4E2GA 2BWCA 4EZ4A 5JDBA 2IXHA 4YW1A 4YZ5A 2GNBA 5A33A 3I2KA 4R9DA 5T3NA 3VL9A 4XUPA 3ZN6B 5J36A 5K9YA 5KXEA 1XNCA 1NCQB 2EIBA 2HEWF 4IE4A 4IV3B 5HCHA 2DVGA 2ERFA 1W8UA 4R4ZA 4XBNA 4FPGA 4GWIA 3WW2A 3VDDB 2ZS6B 4W6XA 1VBA3 3KGLA 4GAZA 3POSA 1JHJA 4J1WA 2WFF2 2EALA 3UYJA 4CA9A 4JTOA 2AZ5A 3N7MA 1C1LA 4BXSV 1TEIA 1O8PA 3ME2A 4IEQA 3WNKA 2JX9A 3WNMA 4FO9A 1GFF2 2J1UA 1ULEA 4HANA 1AR61 1S2BA 3H1WA 1DYPA 4XIKA 4FAGA 5K0UB 2EXKA 2WT2A 1Q5OA 2VZ3A 2EVXA 5IT6A 2MHFA 5F7UA 3RJRA 3TN92 3H42B 5A32A 4XHXA 3I8TA 4RR3B 3RZZA 1ULDA 2WSVA 3AP7A 3M8LA 3RS6A 4E2SA 1AR91 2TUNA 1PO21 1W8WA 5AVAA 2PHLA 1MS9A 4NHKA 3VBFC 3INAA 2Q30A 3BKZA 1DP0A 1GWLA 4EYUA 5AC93 1X33A 4NHXA 5JCTA 1QJY3 5FZMA 4OHYA 4MXWB 4E4HA 3KV9A 1F35A 4PLMA 3RZMA 2JG8C 4I0BA 1GMMA 5CNAA 5FYBA 4IDZA 4N43B 1XE7A 4Q2FA 1VBA2 3VD9A 3OBTA 2VE1A 5K8SA 2BV4A 4CU7A 1F5JA 1R091 1RHI3 4LO6B 4XVHA 1JZ8A 5GZFA 3VBOC 3WQ1A 2LALA 4URTA 4COUA 1DGRN 3N9MA 1D2SA 1O8SA 4BLJA 5BY5A 4NN0A 5IFTA 3GHNA 4KU7A 5FBJA 4UFKA 3ZXAC 3I3BA 4PLOA 3WSOA 5JOYA 1W6PA 4GB32 2YXSA 1VRH2 4JGYA 4NAMA 4LBOA 4GQ7A 5I0RA 1QEXA 4Q0SA 5CIRA 5I91A 5C5UA 3K77A 2RDRA 4LJHA 4L11A 5JSOA 1SQ4A 1YFWA 1RUH3 1VRBA 3WDXA 4TXWA 3S30A 4K8FA 2V72A 2ATFA 4WM7A 5AC92 2Y6JA 2NZ9A 2Y6HA 1QJY2 1OPMA 5CFCB 3K4AA 3LGRA 1W2TA 2KR2A 4QB2A 3UETA 4BH9A 3LFIA 1X7NA 2GAUA 3M3QA 4D0QA 2VH9A 1KDMA 2VBBA 1YHFA 2NPIA 4UW6A 3R05A 4LEJA 1LOFC 4XFAA 3TRSB 4N53C 2RJKA 3ALQA 1WWYA 1JMUB 4KWJA 3UGFA 4NUBA 2UURA 3Q8CA 3KF5A 3KHBA 4P9LA 4ZU7A 5EXOA 5HPOA 2BFUL 4BQ1A 4PIZA 3MDPA 5EPAA 5SV5A 3WNNA 1LOAA 2C5DA 4LULA 1HKDA 1WBLA 2VZVA 4QX8A 1SLLA 4M3CE 1E5RA 2B46X 2NQYA 4CDWC 3PURA 3E6DA 5GALA 2CGPA 2VQ0A 1D0HA 2YU1A 3CLPA 3KVBA 4IEXA 5FYUA 5IK4A 2TEPA 4OI0A 2Q8CA 4UW5A 4EZHA 2Y64A 4OQ8A 2DV9A 4XF9A 4NHLA 3MIHA 2XUMA 1RUH2 2BUKA 3OJBA 4QM8A 4JKMA 4M3CF 1PNGA 5FY5A 4KNCA 4FP2A 1PMHX 4P9JA 4IV1B 1QJEA 4V1PA 3H8XA 4EN6B 5D8AA 4IGPA 3E5QA 1OA4A 1WLTA 5T50A 1O6UA 3B02A 5DUXA 3NNLA 2ZMNA 1IG3A 4CTEA 2DUQA 3JBG2 4Q26A 1ULCA 2RR13 5FXVA 3WOGA 2B8MA 2JDYA 4L8QA 1AL0G 4NRQA 5LEJA 4RA0A 3HNBM 4YM1A 3SCHA 1PGW2 3VHRA 4CCJA 1GICA 5E1RA 1Z0HA 3H7YA 3KS7A 3VD4A 5ISLA 4CDXA 1TMF1 4DZGA 1Q3EA 1V70A 5C3PA 5FDBA 3LA7A 4GH4B 2QBXA 3AMMA 4KI5M 2UWBA 1COV3 1PVXA 1DHKB 2Z69A 2NYYA 1C8M1 1WMEA 1AYN1 2FHRA 2LUWA 2VZQA 4JGZB 4AEMA 2FQPA 3AL6A 4B8EA 1NG0A 2A3WA 2Y60A 1Z7S1 5ANQA 4JV4A 1Q8PA 3ZFFC 2Y26A 3ZIXA 1AXYA 4AAXA 4AGVA 1BMV1 4BIOA 3AP4A 1B35B 1WCKA 3M1HA 2C0ZA 2W1WA 3B69A 5FUPA 1W2AX 1ZRDA 3N9QA 1CAUA 4MGTA 5FP3A 1GP6A 5L73A 4XXAA 1VBB1 1DGRA 4W50A 1RUJ1 1UZVA 4R52A 1BHGA 5A70A 5LK7B 1D4M1 3RZKA 2XMLA 2DCZA 1K42A 3MIFA 4XTMA 1W6OA 3GBWA 1POQA 1VBC2 4Y1YA 1NT0A 3K3NA 3U07A 4JQRA 3H7JA 3O0XA 4COVA 5FPLA 4A2UA 1JU3A 1L7RA 2E26A 3ZXFA 3JQWA 2X05A 4CXWA 2SLIA 2QKDA 2XXZA 1QDCA 2XJQA 4HMZA 3ACFA 2WKKA 4FT8A 4LBQA 5E16A 4K21A 5FZIA 4AK3A 1QMJA 1I5ZA 2A6YA 2ADDA 2CGOA 3GF6A 1COV2 1US3A 4D6SA 1KS4A 1O4ZA 5EYYA 1QJU1 3U78A 1N3PA 5ACA3 3FBYA 1DYKA 2D3SA 3CZUA 3ZDSA 3VUOA 3CNAA 5J7MA 2JG9C 2WQZC 1CAXB 2Q8DA 1R083 1OLME 4CDUC 1X8MA 1LEMA 3I2DA 4EROA 1R1A1 2YG0A 4Q1PA 1JBCA 1UXZA 4CCLA 2A70A 1SLAA 5JZGB 5HV4A 4OI1A 3GZTB 4PDWA 3ZMOA 5E89A 2MNGA 4UFMA 2VZRA 1CX1A 3U14A 3AP6A 4ARXA 1RXGA 1N1VA 5LRSA 3RZJA 5A7NA 2PMWB 3ECQA 3PL0A 4EE2A 2AUYA 5FYIA 3ZMNA 3IDCB 1O4TA 4QHOA 2ZX3A 4CE8A 2BNNA 4FPJA 3RYKA 4XJUA 3VN4A 3WY6A 5IVFA 5JSRA 5KC5A 3ZYJB 4FOWA 4CEYB 5IAXA 5H9RA 2B39A 4FQZA 3GBGA 1PZ7A 3RWNA 5M0TA 2K46A 1CVNA 4CP2A 2I45A 3SKVA 1DCSA 4Q29A 3S57A 5ACA2 2YBSA 4XZPA 3ZFGB 3TNPB 4DEVA 2DU0A 1PO13 5FREA 1R082 3R4SA 4Q0QA 4Y33A 3THTA 2W2IA 5JPNB 4MYEA 1H30A 1POV3 2WWUA 3IMNA 4GKYA 3HN1A 1W8TA 1N1SA 3WUCA 4LE3A 3MUY1 5EJZB 3WQ7A 1GSLA 1HRV2 4H7LA 4CEWC 1ND3B 2VZ1A 2XBO2 2Y6GA 4Y1ZA 5FZFA 3DF0A 5JAXA 1MEC1 1KS5A 4D7YA 3DUIA 4IE0A 1SLCA 3P3NA 2HWB3 1K5JA 2PHFA 3QACA 4LUKA 4CP9B 3AVRA 2OT7A 1YC61 4RN5A 3OY8B 3V0AB 1OF3A 3A22A 3Q9OA 1IS3A 5KC6A 1YQ5A 1W3VA 4GXLA 3T2OA 4MV2A 2YB7A 5DDJ1 2WNVA 2CY6A 2XGXA 2UYAA 2WIIB 3AMPA 2ZZJA 1RUF1 2YFUA 3GJBA 4QU1A 4LIVA 4DNYA 3AZXA 5JIAA 4Z07A 4XURA 5DZFA 2BFUS 1XRUA 3KQRA 4LHNA 1AYM2 1QXRA 3SLIA 1O59A 2GALA 4OULA 4JDMA 4XDOA 4A41A 2OZ6A 1DGWX 1A8MA 1UN1A 1RUD2 5JPMB 1LOCA 2Z79A 2DFBA 2JEMA 1AX2A 3VBHA 4ZZ8A 1Y9MA 3A21A 2AENA 3POFA 3BTYA 2OUJA 3J4UH 5LK5A 1KD7A 3AB0A 1C5IA 2XR4A 4NPMA 2WL1A 1OUSA 3EO6A 1RUE3 1Y3TA 2JDHA 5DUWA 2LM3A 3M3OA 3OG2A 4PBOA 1LHOA 4RD7A 1H4HA 2O8QA 5FCCA 1BXHA 4GKXA 4QX2A 3O0VA 2HWE2 3BIEA 1IS4A 4FFFA 2ZGTA 4YW4A 2J1SA 1ZNPA 1A3KA 4E8CA 3NV3A 2PLV3 3DPRA 3BI3A 1G9FA 4TWTA 3POEA 1DF0A 1KFUL 5F6LB 4E4SA 1W6MB 4LOSA 1NCRB 1MS8A 2IFRA 3NV4A 1CIWA 2VM9A 1RVF1 3DKWA 3RWKX 2MEV3 2CHHA 5GLTA 1H9PA 2JG8B 2DF7A 1OPOA 2QQOA 3GJAA 4F83A 1OKOA 4Q4V3 1F4HA 5J1XA 4KU8A 4PQQA 4FPHA 4XILA 1JZ7A 3POGA 1JZ2A 1BBT3 5DAVA 3MPPG 4P9IA 3Q8AA 5FUNA 2Z4FA 3NKTA 4JGYC 4Z8BA 3RGBA 4AEDB 3ZYHA 5KHIA 2IUWA 1L7LA 4N9IA 3W5NA 4D94A 4CP0A 4N7IA 4QX0A 4YM3A 4O61A 3MW4A 5A7OA 1GZWA 2WFF1 4META 1ODMA 4WM7C 5HI0A 2J42A 2Q1ZB 3GALA 2XHNA 4JKKA 3UGGA 4N90A 2BGCA 2HBUA 5CYYA 3WQ0A 4CCEA 4DO0A 4Z2WA 3UK9A 4WZCA 4CUBA 2DTYA 5CKQA 4YLZA 1MQTA 1RJ8A 3TN91 1CIYA 5FK8A 3ZYGA 2X8KA 3GZAA 2ZMLA 1SFYA 3KT4A 2Q8OA 3VBSA 2MEV2 3GCXA 1NLRA 4RS5A 4BMEA 5A1LA 5DAPA 2VG9A 1ULPA 1VBE3 2JDMA 2P34A 4MHUA 4Q4V2 4XE9A 4PF5A 4N53B 5L7OA 3R0RA 4ORFA 3JD73 3POIA 3GDBA 4I3GA 4XACA 1UYYA 3RMYA 1G9DA 4B7EA 1FPN3 2LW8A 2ZAHA 4CDQC 5FJKA 1UY3A 3DGTA 2XUEA 1RB8G 1VBA1 2XLFA 3OPWA 4CDWB 4M0NA 5L9VA 1UQXA 1KITA 2XLAA 2VNGA 5ABJA 3ZFEA 3E6BA 3ZYBA 2BVBA 2DU1A 4GALA 3PJYA 2RJ2A 4XQWA 4MG2A 2XPJA 2VY0A 3QCWA 4HETA 1AVBA 3VBOA 1R64A 3AYEA 3NSTA 5D8AC 2XQXA 1FMD2 4DOUA 3DKQA 4XAAA 1PIV3 1V0AA 1UYPA 1X36A 2Y38A 4HG6B 4I0AA 4P9YA 2B42B 2G9FA 2XJSA 4YW7A 4JDOA 4COZA 1OH3A 4LITA 2QQUA 4QQPA 1PK6A 4BISA 2A6XA 1Y9QA 4LKSA 3T2QA 3WG1A 2QFEA 4TTGA 4DUXA 5FLHA 1VBE2 1D4M3 3MIDA 4YW5A 2FZ2A 3U11A 1JI6A 3W9AA 4D7TA 4BXFA 2P2KA 1DQ1A 1OLQA 3B9IA 3JD72 3TB0A 4Q0UA 4NJ4A 4XZUG 1JOPA 2P37A 4CDXC 5AC91 2RHPA 4G3YC 4JX0A 1QJY1 3CJXA 4FOVA 3AXDA 4UW4A 2E7TA 3OPZA 3RZLA 5FXXA 5CU1A 4EN8B 3WCRA 3VGIA 2NP0A 2BYVE 3I59A 5D21A 2E33A 1RIRA 1W8OA 3APBA 3FBMA 4CU9A 2BP6A 5FPBA 1RHI1 1DGWA 4Y22B 5FPUA 1O5LA 4XUTA 5LB6A 4YPJA 5B2GB 4Y5TA 5H9QA 3WG4A 3MLKA 3OOXA 2G19A 3WCSA 1SPPA 4LR4A 3VZOA 3AKQA 1CAVA 4RQPA 1ZBE2 1IG0A 4CXYA 2R073 4C8DA 5BNPA 5K7PA 4LO7A 1RUI3 5A6QA 5FP8A 4XOGA 1GZCA 3FFZA 1FATA 3FHAA 5FPZA 2W91A 4U36A 4UAPA 1VB2A 3ZLIA 3SEPA 1UXXX 1RUH1 1UOFA 2E31A 2GNMA 1FNZA 1A78A 3OCPA 4GD4A 4I02A 4K7JA 1BK1A 4LBMA 4ZS3A 4P9WA 4RL7A 1OC1A 4AWDA 4DXRA 1RUNA 2JE7A 3POBA 4UFIA 3U75A 3T0BA 3I3EA 3WNLA 2CDOA 5IVCA 4L9BA 2AEZA 1FV3A 1XNKA 4B1MA 1XU1A 4FP3A 4XF4A 1Z78A 1HW5A 3OYWB 1LGCA 4K6BA 2BWAA 5IJRA 3WVJA 5BPXA 4QPYA 1JU4A 1B09A 4F7ZA 4CPBD 5IFPA 4JZRA 4P08A 2GMPA 2EXHA 1PGW1 4WM8B 4DB5A 2IXJA 2ORZA 2DWRA 3PVOA 2FDJA 2JG9B 1GOFA 2VNRA 1WLWA 2R072 3F95A 4Q5OA 1EAH2 2JXAA 1AHSA 1W04A 1SMVA 1WZXA 3AFGA 1PGL2 2VCCA 1JYNA 3N9NA 1RUI2 3TBDA 3WW1A 4B7KA 2WFPA 4L99A 3SMHA 4IQPA 1W0NA 4AI8A 5LA1A 1FNYA 5I8YA 3HD8B 1NY72 4L97A 1HN1A 4QPIA 5FKBA 2Y0IA 3VL8A 3O1UA 1HQWA 5B4XA 4TN7A 3VBRB 1JN2P 2W5FA 3F2ZA 3ZVXA 3EB7A 3ZFFA 2XDVA 4Q0VA 1NQDA 2XONA 4LHSA 3U4SA 1WCDJ 5J09A 1URXA 2SBAA 2RDSA 4HKWA 2IVJA 3A0NA 4LQRA 3RMXA 3HQRA 3AYAA 1PMJX 5APAA 2V73A 2RR11 4PT6A 5FLIA 3MV01 1LKNA 1U5ZA 5HCFA 3I2JA 3THDA 5KBFA 4K20A 4Y5Z0 2ID4A 2FDFA 4LA3A 4DY5A 1Q8OA 1ASJ3 3A7QA 4XW3A 5F8PA 4DRVA 1H8TC 3ZYIB 1UY1A 1XOYA 4HVRA 3C7EA 3ACGA 3GBFA 4MGYE 3T4HB 1COV1 1REFA 1UMHA 4N7UA 5J96B 2VJXA 4BK4A 2VVEA 2ET7A 1PM4A 3HIFA 4RHV3 1SG3A 4XCAA 2PQSA 5FYCA 5JXIA 2YFZA 3LF7A 2GH8A 5FZ3A 4HLTA 2WNVC 2R063 2E9QA 1O4YA 2ZTNA 2VQAA 4BQ3A 1LOBA 2DUPA 1KEXA 1CAWA 3JB4C 1V9U3 4ZZ5A 1OKQA 2QE3A 2VOKA 3LD8A 1W9FA 4GA9A 4QM9A 4Y1UA 4M3CA 4AEJA 5A33B 1QXPA 1S55A 1FT9A 1KJLA 2J7MA 3RSJA 1ZX5A 4FQ4A 1OURA 1RGSA 2J1AA 3BOPA 5IK5A 3PIGA 3RFRA 2ET1A 5CFDA 4QXCA 4AVTA 3VBHC 5GZGA 4NIAA 3TEZA 1ASJ2 4NAOA 3T09A 2XJTA 5FWEA 2ARCA 3E5XA 3MF6A 5C6CA 2DCYA 1WLCA 5IWFA 4OUEA 4RHV2 3THPA 1QY4A 5ACA1 4QPGA 5FAXA 2VVFA 4OI4A 5A32B 2A6WA 3NMBA 1ENSA 3IN9A 3VBUA 2A73B 2QJVA 3OGSA 4NIGA 1R081 3CDZB 3PUAA 2R062 2VW0A 1X8EA 2HWD3 3PNAA 4IGOA 4ARYA 5T5OA 1EUUA 2I2SA 4UYBA 4ZY9A 4GULA 3DPRC 4Y1XA 5A3WA 5LA2A 1D4VB 1BVVA 1V9U2 1HRV1 4D6QA 3SCGA 1UIJA 1X82A 3J26N 5DAXA 4D69A 1LHVA 4Y20A 2WQ4A 5FOBB 2WT1A 2J1RA 3HQUA 3HJRA 1VMHA 2QQJA 4JKLA 2IC1A 2BU9A 4QB1A 1NA1A 3T0AA 3KCCA 5FV3A 4CPBA 1KRIA 4NROA 1YEWA 4KBZA 3QD6A 3K4ZA 5BV6A 2PHTA 4PCRA 1ZM1A 2RDNA 3CHXA 1H1MA 4ES8A 3N36A 3PMSA 5C3RA 3U10A 4R9BA 3DL3A 3EMRA 3I97A 2P6HA 2E7QA 4LBJA 4UBHA 3GZUC 3O1SA 3BUCA 3VZMA 1C57A 1W6PB 1S0DA 3IDAA 1BEV3 2ZA9A 1OH4A 1PO11 3QLQA 4ZHNA 3LZZA 2JKXA 1H1IA 4XQ4A 5CKNA 2HWD2 1POV1 1UO9A 2H0VA 2W94A 1UL9A 4Y4RA 3D82A 2QQPA 4ASMB 4BIFA 3AP9A 1WMXA 3VKOA 1V6IA 2JE8A 1MQTC 2HYXA 1YYNA 2R16A 3LIGA 4OMDA 3T4VA 2J1VA 2HWB1 3N9LA 1UZYA 4XUNA 2GP3A 3VBSC 4RS5C 3LKJA 2IXKA 1MZ6A 4GB33 3HT1A 1VRH3 4QQHA 1LOEA 1ZZ7A 5BNNB 1W06A 5L7OC 1LCLA 2PFWA 1C8NA 3K4DA 5EV7A 4YVWA 3MLJA 2ETEA 2JICA 4I0WB 1HLCA 2HWC3 2OIIA 4TLGA 1K3IA 2D6PA 4ZXKA 5A7WA 1OLMA 2TNFA 3OPTA 4QGLA 2CYFA 4F8AA 5DXDA 4YFZA 2BBAA 5DZEA 5C4WA 3D4KA 3AZZA 3NNMA 1RC6A 1BEV2 1K5MB 1LHUA 1ACCA 1VMJA 2CWMA 2VGDA 2VTXJ 2ZGSA 1QGLA 5FZ6A 3USUA 4P5HA 2D40A 4TZDA 1ALYA 1W39A 1D2QA 1YI7A 4XF3A 2ZGUA 1RUG3 4BLIA 1NXD1 3SISA 1W90A 3UKNA 1JXNA 1ZBA2 1DZQA 4LBQD 2RS32 4QPWA 5FYSA 3HQXA 5BNOA 3JU9A 2BVVA 2P3IA 2VZTA 2CAUA 1CR7A 3B7MA 3N35A 1AXKA 5FZOB 1PK6C 2RDQA 2X09A 3EQEA 2C26A 3GNEA 4LORA 1RUE1 2PAMA 2VMIA 4XDQA 4HVQA 4NIHA 4AW7A 1V6MA 1QH7A 3OUJA 5HBAA 1J84A 1YIPA 2PYTA 1MS3A 2EAAA 3ABZA 4QX1A 2W68A 2O8OA 2X10A 2W08A 2DVDA 2C24A 5ERLA 2GP5A 1CZVA 3AYCA 2HWC2 2KD7A 1MVQA 2ZGPA 3H1MA 2DDUA 3WDUA 2ES3A 3VB9A 3GHMA 2PLV1 2P3JA 2VBPA 4DEQA 3ZXLA 4GMP3 4C91A 4CDXB 4NWWA 5GJ6A 1CJDA 3MO4A 3ZN6A 1W8ZA 1CPMA 4OI2A 1NCQA 4IV3A 3KD4A 2G4IA 5IK7A 2MEV1 2QQLA 3S7IA 4PF1A 1OHFA 4XIOA 2A1XA 5LASA 4AI1A 5EHDA 3JBG3 4QGMA 2VNVA 3UJOA 4Q4V1 1UU4A 4AFDA 4IE5A 1RUG2 2A71A 3ZSJA 2WA4A 3C7HA 4RQPC 1BBT1 5CA6A 5FZLA 2VOVA 2BZDA 1XSQA 1AR82 1FXZA 1X9PA 1GWMA 2W3JA 1LHWA 4HOOA 2YYOA 5BNPC 1J83A 4ONUA 2W47A 1N1TA 2DCJA 1LECA 4RR3A 5FZ1A 1D7PM 4CDQA 4XJWA 1DQ2A 4DFSA 3IZOA 2JIGA 5FMOS 1H2MA 4XC9A 3H1YA 1CWPA 1NZIA 1AZDA 1RTVA 4WV8A 1REEA 1OOPB 1US2A 3CJIA 4LA2A 4BPZA 3AZVA 1RJ7A 5JLVA 4CCDA 1FI2A 3FLRA 3NW4A 1LODA 3SXWA 5EP9A 4DXZA 4A6OA 1ZREA 4LBQB 4MXWA 3G6JB 2ZGLA 2HKXA 3N4MA 2OQ7A 1VAVA 1V6KA 3OD0A 4CCCA 2WABA 2FCTA 5GZDA 4AHZA 2ZHNA 1VBE1 2BOJA 2GZWA 1XE0A 2WS93 4QQOA 5FO7B 3UT0A 5DUVA 1X9TA 4LPLA 5C71A 1JZ3A 3JD71 1VBC3 5JI9A 4WVMA 1LULA 4GJYA 5F3CA 3R4UA 3K3OA 2DVFA 5LY2A 5C9AB 4HZFA 1QOTA 3J7NA 1MR5A 5EZWA 5A3OA 3T2PA 3LB9A 3MICA 3VD5A 1FPN1 4DY3A 2C1FA 4DQAA 3ZFEC 2YDEA 5A6ZA 3B01A 4E4ZA 3NL1A 2D3RA 4UXAA 1OFNA 3FUOA 4LUMA 4PDWB 4B1LA 4QPIC 2E32A 4AVSA 5F37A 1SBFA 4HVOA 2X5IA 3E97A 3C2UA 4QGNA 2OVUA 2HH9A 2YBKA 4GZ9A 3AVSA 3LIHA 2WA3A 5KWRA 3D3AA 4XJAA 3ORJA 2WLPA 4IESA 4XBQA 1UD1A 1O7FA 3A23A 2Q8EA 1PIV1 4JC1A 1QJX3 3NVCA 4X8NA 3W58A 3B00A 3KMHA 2IXIA 1N3QA 5CFCA 3B9CA 3J8F3 1AL22 2FDKA 3C7GA 1LHNA 2GMEA 4IUGA 5DG2A 2VUAA 5LATA 5C3QA 3PMEA 3PTYA 1T6BX 1YIFA 5FP9A 2WS92 4MLOA 5I8TA 4FPFA 4CCKA 4QT6A 3WINE 2OA2A 4Y26A 3UESA 1UKRA 4YGCA 4QKDA 3ON7A 5FZEA 2EXIA 1E5HA 4LO5B 4YZ1A 1MS5A 3FX3A 2ZBJA 4O9EA 3AYDA 4KGQA 1SLBA 5FY8A 3TNQA 1CPNA 2C9KA 4YSFA 4L0PA 3MBWA 3PUSA 1STMA 3RNSA 1T6GC 2K0GA 2ZMKA 4B4RA 1EV13 2W1UA 2O0OA 3ES1A 3LPFA 4XBLA 1ZRIA 2JJ6A 4QQ2A 5JOZA 4XMIA 3KGZA 4RYDA 1QJX2 1SBDA 2VMGA 4BA6A 1JODA 5FY9A 4UFLA 2IZWA 1OD5A 2R071 2WNVB 4K40A 1VBD3 3J8F2 4IV1A 3ZSKA 2EA7A 1GU3A 1W6QA 2YUEA 5FY0A 4UFJA 5FO8B 2ZX2A 3S7EA 2BBVA 1RUI1 4QKFA 1HRV3 1C28A 1RXFA 1TNFA 2C4XA 2MPFA 2XBO3 3H8UA 3TEWA 1JHNA 1VP6A 4QB6A 4JRAA 1NY71 3WNOA 1ZZ6A 2B7YA 4ZU4A 1ENXA 3RQ0A 5CFDC 1H6XA 1O5UA 2BGPA 4IEYA 1H1AA 2PXJA 2XB6C 3BCWA 4LHKA 4XPVA 1J59A 4NIDA 4NR1A 1P8JA 3O14A 5EYXA 4CXXA 1CJPA 4CVUA 1A34A 3QOPA 4AFBA 5F5QA 2AH2A 3JCIA 2ZEZA 2GH2A 4HN1A 3NAPA 2OX0A 3OF1A 4QPGC 1EV12 1GP5A 4C1XA 4O7XA 1WBFA 2W9XA 5EQUA 3VBUC 3HN3A 1HB4A 3IMMA 4JGZA 1W2OA 2BDRA 3ZSMA 4A7YA 1AYM3 4XJ8A 5IHRA 1SLIA 2YGMA 1UW8A 2V5DA 3WP3A 5EIYB 2WN2A 4BQ4A 1LEDA 2ZHKA 1XYNA 2AGSA 3LAGA 3LOIA 2WNUA 4AE2A 1U5XA 1RUD3 2D43A 1VBD2 1UX6A 1WMFA 3WW4A 4FPEA 5KHGA 2R0HA 1MZFA 5C8CB 3M3IA 3HNMA 5HV0A 2CL2A 4PIXA 1S0JA 3WDYA 1O3RA 1QNWA 1H8TA 2A6VA 3DPRB 4CYDA 4D3WA 1LGNA 3BIWE 4YWAA 4W65A 1S4CA 1LOGA 1ND2B 2JB8A 5BXXA 1FV2A 2BJSA 2V4AA 1YJKA 2YY1A 3OUHA 1NA1C 2OYZA 5CB7A 4COWA 3BTZA 2B45X 1LGBA 2YV8A 2CSGA 1W3XA 4X8PA 4LO4B 2WLQA 5HXVA 4W4ZA 1DQ6A 2IWGB 2HWE3 4HN0A 3OGRA 1CESA 4EN0A 1GYKA 1WA4A 4KQ7A 2JECA 3LSEA 1GQHA 1JUHA 1XB9A 1JS9A 1LU2A 3V65A 3T08A 1QNYA 3O1RA 2F4PA 4BMBA 1U0AA 4MVTA 3UL2A 2R30A 4CCNA 1RUOA 4JTNA 3ITQA 4PI2A 3H3ZA 1XBFA 4UF0B 4I30A 3V0BB 3KM5A 1ASJ1 2ZACA 3NNGA 1W9TA 4K1ZA 5A7QA 1Q56A 4YG0A 3VKFC 4URAA 1TME2 2F17A 3IDEA 5E88A 1F8VA 3ENRA 5J37A 3DYMA 3ZDVA 4A4AA 1UZZA 1OXCA 4JCKA 4V2VA 5JZGA 4RHV1 5IAVA 1MQTB 2O1QA 1J3PA 2XVGA 2VUJA 4YW2A 2CV6A 3VBSB 1YUDA 3O1MA 4YVWC 1SACA 3WP5A 4FFGA 2R061 1Y4WA 2JDNA 2YC4A 4IL7A 5FRAA 2OPKA 4LBKA 2A3XA 1AF9A 4JRLA 3WDTA 4J25A 1V9U1 4Z1VA 4P14A 3LEGA 1DFQA 4Z92B 4YYOA 3T3YA 4IERA 3VBFB 4CEYA 1UKGA 5C4WC 3U37A 2LTNA 4QXKA 4Z82A 1BKZA 3I2OA 4YG3A 1IOAA 5FYYA 3ZO0B 4R9CA 4Q1RA 4CU8A 4S2GA 2YC0A 4XABA 3FL7A 2IXCA 4G4FA 1HXS3 2J22A 3FZ3A 5ABJB 3ZFEB 4B4QA 4PHZA 3PLQA 2OXBA 3ACHA 1OFSA 1PO22 5BNOC 2D6LX 4LHLA 2WC2A 1KDKA 1VIWB 2Q1MA 1LB2A 3VBOB 2DTWA 1LESA 4KL1A 2GSYA 4Y5SA 1PNFA 3TOJA 2WBKA 3NNJA 1O3TA 1VMFA 3DECA 5F3EA 5FYMA 5F32A 3BN6A 1WMDA 3MIGA 3ATGA 1PK6B 3WV6A 5LW9A 4IETA 5J3UA 1OT5A 1HJFA 4P9XA 4ZS2A 3PU8A 1WCUA 4FPLA 3ACLA 4MXVA 3LQCA 4OFGA 4LBNA 2RS13 2GMMA 2HWD1 4JVAA 3WG3A 2JDPA 2D3PA 3IPVA 2ZX4A 3UKTA 1R092 2QQMA 3K51A 4HSLA 2WN3A 1KFXL 5JXGA 2O14A 1FMD3 3FHIB 4R4XA 5DN2A 1PGSA 1NCQC 4IV3C 1UOJA 2OKXA 1QQP3 1TVGA 5FBZA 4RFT0 5K4LA 1G9BA 4QDRA 4DRRA 1PX3A 1QKQA 3I59B 4LKFA 3FLTA 3WXPA 2F4LA 4WZFA 1HXS2 3WHTA 3ELNA 4OHWA 4WBBA 3B94A 3LEIA 3ZYFA 1C3HA 2QUOA 1NE6A 5K0UC 4YW6A 5F5CA 1LAJA 2QDNA 1XXNA 3FFQA 2RV9A 4HPKB 1ENQA 1SPPB 4MZUA 4RQPB 4E8DA 5LY1A 2GC2A 4RR3C 3AL5A 3ZYRA 1BEV1 2UWCA 1UIKA 3MW3A 1S0BA 1TE1B 3ZXGA 2RS12 4QWNA 2HBTA 1N47A 1OVPA 2W1SA 3VZLA 4BOWA 3CJIC 4KWLA 2A6ZA 1IHMA 4AQSA 3LDKA 2L9LA 4ASKA 1AJOA 2RMU3 2XOMA 4O9GA 1QJFA 4U2AA 4ITCA 5FZ4A 2F6BA 3H3UA 2H0BA 4FPYA 3SEEA 1ZBE3 2VUDA 2XL9A 1HQNA 4V2WA 4W8JA 2ZGMA 1QQP2 3HWJA 2WDBA 4GB31 2UU8A 1VRH1 1NCRA 4YM0A 2ZGKA 3O7OA 3O0WA 5EFUA 5T54A 3ZIWA 3WF0A 1DDLA 3DV8A 2BERA 3LEMA 4Q4W3 2HWC1 2Y0OA 2G1MA 2QQIA 3KQ4B 3LA2A 1LNSA 4Q4X3 3BTAA 4XJZA 5G05L 3ZX7A 4ZKTB 3TEYA 3RZHA 2OS2A 2JB4A 5LCWL 3LOBA 1HRI3 5FY7A 5FPVA 4XFBA 3Q8EA 4BCUA 2YC2A 2WINB 4UFHA 1RITA 1U5YA 4NO4A 2QTWB 1AX1A 2XJUA 2AREA 3WHUA 2X5IC 2GC0A 5LBBA 1TNRA 3D8CA 2E53A 3N3HA 2VOTA 1IKQA 4FFHA 3WF2A 1LJ7A 1RUG1 4OYUA 4QX7A 2LROA 2VZSA 2RMU2 1W05A 3K2OA 4OHVA 3AZWA 3GZEA 4XF0A 5CFCC 3TWIA 3K48A 4AHXA 1I9RA 3ZFFB 2J1EA 5C3SA 3BALA 1EAH3 1GZTA 1HN0A 3HOBA 3RYPA 3KHCA 4LLFA 4O65A 1OF4A 3EHKA 1KXGA 4GJZA 2ORXA 5A3TA 2XH6A 1XNAA 3N7LA 4MOAA 4YFWA 2BTVC 2XWJB 5LBEA 1UY0A 4Q4W2 3MFAA 1FAYA 1MPXA 5A80A 1C8M2 4P00B 4QHBA 4Q4X2 1VPHA 4R9AA 5F2WA 1GKBA 2RM23 1GANA 1QDOA 4YM2A 5LBFA 1HRI2 4GMP1 4UW3A 2V5YA 4CU6A 4H7MA 1QIQA 3POJA 2CAVA 1YQ2A 5HCBA 5LWBA 1UY4A 4DUVA 3AJZA 4J6GA 4XF1A 2D6OX 3PU3A 1GQPA 2Y34A 2XWBB 2ZABA 3PIJA 3UJQA 3SC7X 5I93A 3JBG1 2YZ4A 1DLCA 2BW8A 3OUIA 5FXZA 4JDNA 3I49A 2VTXA 4BU2A 2B9VA 4IV1C 2VBDA 2R7EB 1LRHA 4TYSA 5BYNA 3G7DA 5F2SA 2PAKA 2PN5A 3CIHA 3MIEA 3I2GA 4CDUB 5FWJA 1Q8SA 3POWA 2WR9A 1CAWB 5CAZA 4CUAA 3SKJE 3WD5A 5L19A 2QNKA 3ZXJA 3VDAA 2DVAA 1O3SA 2P6CA 4CCOA 4A44A 2VVDA 2XJRA 1EPZA 1QJU2 2GNDA 3TAYA 1Q43A 3OEBA 2RM22 1JTZX 1DIWA 4D6RA 2WWJA 1JW6A 3W20A 4IEUA 1UMIA 3HBKA 4IE7A 3LSDA 1W6NA 2UY8A 2NLRA 1DQ0A 3AKSA 3NAPC 2V4VA 1AL21 4EWAA 5FTTC 4YZ3A 3NWKA 1R1A2 1CN1A 2G9ZA 1JH5A 3I54A 4JGZC 4BQ2A 3IIAA 1W9WA 1W28A 2PTMA 3ETQA 2WS91 1S1AA 2CWSA 3H3LA 3PUIA 4FOQA 4GMP0 4L2NA 4ZONA 4Y22A 4AOCA 1VBC1 2VU9A 3DN7A 3KLSA 2WNUC 3VBUB 1REDA 2BGOA 4Y24A 2H6CA 5IVEA 5D1IA 1B35C 3WLUA 3KZ4C 4YZ2A 4QXBA 4KWUA 4HFSA 4IEZA 1JOJA 2RG4A 4FFIA 4OUSA 4AVCA 4MSVA 2WYSA 1Y9GA 5CEHA 4AFCA 4KBBA 2K9ZA 2HYKA 5DAQA 2DURA 2PHDA 1F5FA 4YGBA 4CEWB 3OB8A 4E9KA 3SCFA 5FPAA 5H9SA 1GOGA 3VZJA 2DUOA 1HB3A 1VLNA 5F3GA 2Q5TA 1HV1A 5IVVA 4ZPIA 3RI9A 1QOOA 1OBNA 1QJX1 3WP6A 3M70A 4KGGA 3D6EA 4RGGA 3H0OA 3J8F1 4PI0A 5FMOL 1OD3A 3DCQA 3I2HA 5A3PA 1F2NA 3AKRA 1OI6A 4RGKA 3X29B 5EJ1B 4RSUA 2FDIA 5FQ0A 4M01A 4IGQA 4FBFA 3ILNA 5KHJA 3AM2A 2VULA 4P9GA 1MEC2 4F3JA 2OPWA 2XJPA 4AYUA 2FCVA 3LEKA 4XUQA 3FUQA 1S2KA 1BQPA 1W9YA 3RG0A 4AI2A 3BYWA 2ZX0A 1WUVA 4TLFA 5C70A 4WM8A 2VCAA 1YXWA 2ZZQA 4EN9B 1IS6A 4K9SA 5JZGC 5DDJ2 1GZ9A 2YPDA 5FYTA 4E4DX 3RPQA 2WJSA 3I2FA 5JVVA 1EV11 2WNOA 3TYJA 1OLRA 1ZA4A 5KHHA 2IXLA 3AKPA 3ZN4A 4EWDA 2EXJA 2ARBA 5C5TA 1JYTA 2JD9A 4LBLA 2P17A 4BB3A 5JXJA 2HWF3 4KWKA 1ZYBA 2XLGA 4A3ZA 1VAMA 1MZEA 4Q27A 1VBD1 5G04L 5FZGA 4R8HA 2BQPA 2FD8A 2DYCA 2WZR3 5FZCA 4CEYC 3HEIA 3FWEA 4RGAA 3PUQA 1YQ6A 3SHRA 2XBO1 2KA3A 3VZKA 3C7FA 3SH5A 3IKWA 4OZXA 4DMIA 4CP1A 1IZ3A 3MUZ1 3ZN5A 3L2YA 5C4WB 3IWZA 5DZGA 2R32A 1ULGA 3JQXA 3BGAA 5T5PA 1ST8A 4CUCA 1QJZA 3K75B 3IAPA 4MGQA 1PZ8A 4IEOA 5DPNA 4AI9A 3KCYA 3OGJA 4INDA 1ND3C 5BNOB 5LBCA 5FUIA 4QD2A 2J1TA 4YRDA 4H55A 1AXZA 1IKPA 2BNMA 1E5IA 1AYM1 2HEYF 3P5BA 2ZEXA 3C7OA 3SITA 4HSJA 5I0UA 4JGYB 2YU2A 2D44A 1W8NA 2ZGRA 2XJVA 3CL1A 2HWF2 1VALA 4KMQA 4YGEA 1NLQA 2C9AA 1RUD1 1QOSA 2IVIB 3EYPA 4X6QB 5C8WA 5JUVA 4UBGA 2WZR2 2TBVA 2WT0A 1ZBA3 2HJIA 1BYHA 2Y6FA 2RS33 3H9AA 5D2AA 4WM7B 1NLSA 1O91A 3IAQA 3MF9A 4OMCA 3ZR6A 2CGNA 3AXEA 4WVWA 4AVBA 4EJRA 1CD3G 5L9BA 3WNXA 4QKBA 1SFNA 2ADEA 3IB3A 5I0TA 5FZDA 2WAAA 4LMFA 5A3MA 5FIXA 1XYPA 1YFYA 1AR73 4BJ0A 4Q4Y3 4CUGA 2W0XA 2RS53 5I0DA 2VXJA 2WZPP 5CVRA 5C3OA 2YPJA 4QDSA 3MYXA 3OD4A 3WQBA 2A5ZA 2HWE1 4MO3M 3MFCA 4QAWA 1UZWA 3QH6A 2QQVA 2VCMA 2VMDA 3AMQA 5BNQA 1YJLA 3OEAA 4FPOB 1VAKA 2AC1A 1HV0A 1CQ9A 2VL4A 1NYWA 3KV6A 5IVYA 1Q8QA 3V64A 1CONA 4I3PA 4W6YA 4X6RB 4YVSA 5IUQA 1I1EA 2WO7A 1LU1A 4ISQA 5I0SA 2Q0AA 4KG8A 1DYOA 4JQTA 4CDQB 5F6KA 3RZGA 4AFMA 1QH6A 5IW0A 3ZXEA 1YQCA 1JOBA 3O1VA 2BOIA 2UY9A 3CJIB 1BK0A 2JENA 1S0CA 3GXUA 2QDRA 1MS4A 1SLTA 1V6JA 3AJYA 5FZ7A 1SCSA 1AR83 5JMCA 5JI7A 1NCRC 1NE4A 1POV0 4XHBA 5D8AB 5T55A 3WF3A 3O1PA 2EAKA 3SNMA 3PDQA 2CNAA 1AR72 4Q4Y2 2RS52 4ATEA 4BE3A 2PHWA 1N1YA 4XFGA 2RE9A 3PHMA 5A7PA 2ZOEB 5A3NA 3ASIA 4WVMB 2FMDA 3ZOIA 1T2XA 4HL0A 5SV8A 1IPKA 1SBEA 1FOD3 2HEVF 3MLLA 4B29A 1TQ5A 2GU9A 3RRDA 5H9PA 1KJRA 3LCPA 4AEDC 1W2UA 3GM8A 4XFCA 1F15A 3WF4A 1V00A 1AJKA 3ZXKA 4H14A 4UOJA 3O1TA 2FDGA 5AVPA 3VDDA 1HXS1 4AAPA 2X5IB 3ZKYA 3LE0A 4AL9A 2PAEA 4P02B 2ZEYA 1YWKA 1UMZA 2JD4A 3H8RA 5B4NA 3DEMA 2Y8KA 3FC0A 2RJLA 3HNYM 5K0UA 1RMU3 4CZSA 3N7JA 3MHZA 4XYXA 1CAUB 1CX4A 4FTBA 2NM1A 3M3CA 4IEPA 4AGRA 4HK9A 4BQ5A 1UF2C 4XJ9A 2UYBA 3P1IA 4LXLA 4PLNA 5JWPA 2RS11 5CKMA 2VXRA 4LO8A 3WZ1A 3O1OA 5BNNA 5T5LA 2VQTA 5FP7A 3AK0A 3Q8FA 1ZZ9A 1RHI2 1W6OB 1WW5A 3IT8A 3DXTA 3UGHA 1GBGA 1K45A 1FMD1 1IQAA 4MGZE 4LTAA 1FOD2 5T52A 2VZUA 3GYDA 1JZ6A 1ZRRA 2W1QA 4OCTA 2NMNA 2CU5A 2FCUA 1QQP1 3E6CC 3MPBA 1OQEA 5HCAA 1AL23 2NMOA 5FMDA 1GNYA 3WP4A 5DUUA 3V56A 3S6PA 1IGOA 5A1FA 5KXBA 4BM8A 3HVDA 4N43A 4A7ZA 1K5MA 1LTEA 3UNPA 4XMAA 1WCSA 2WAOA 4XCBA 1ZA7A 1JYCA 3ZR5A 1E57A 4DUWA 1S0IA 4Y3OA 4M4PA 4YARA 1RMU2 1HB2A 1WW4A 1C4RA 2FMYA 1UWWA 5FZOA 2P3YA 2PHRA 5LA9A 1WCQA 2ARAA 3LDRA 3OBAA 5FZ8A 1SZBA 1W6QB 1J1TA 1UU5A 2R1BA 2WQ8A 3P6BA 4AXOA 4OZOA 3SH4A 3MIBA 4IEVA 1LR5A 3W5MA 4NRPA 2R1DA 2LRPA 4RFRB 1JYWA 4BWOA 3VKMA 2A7AA 4AHWA 1W9SA 1W03A 2JDUA 4PJYA 5JR2A 3QH7A 4A6SA 3PVEA 4BDVB 3SH3A 1LENA 2R0FA 2RMU1 4TSVA 3JXSA 2FZ1A 4WVVA 4XXPA 1YLLA 4UWDA 1XJAA 1ZBE1 4LKEA 1ZZCA 2K2SA 2B4KA 2WZEA 2PA7A 4YGDA 3NAPB 3I2IA 4OHXA 1OVSA 3IBMA 1H8VA 3K46A 4XQDA 4AI0A 5JIUA 2VZOA 3OSDA 4Q4W1 3VHNA 4AG4A 4NPRA 1RUC3 4EQVA 3N7KA 4Q4X1 1XU2A 1PVC3 2VC9A 1CGPA 5LZ6A 1APNA 5JXHA 1UU6A 2D97A 4LK7A 1HRI1 1N3OA 2WNUB 3M2MA 3S5AA 2W39A 4AEKA 4OHZA 4FOYA 5FXWA 5CG9A 3CKHA 3KV4A 1TG7A 1H2LA 4ET7A 4JAAA 5CADA 1H8TB 2WSUA 5GLVA 2DBNA 2HLEA 2RR12 1DZRA 2XHKA 5FOJB 2R043 1EP0A 1RYYA 3CQOA 4S2FA 1AUYA 1OOPA 5JOWA 2Z42A 4ZXEA 5F3IA 1PHMA 1C5HA 2XKOA 2ZGNA 1EAH1 4XETA 3MZHA 3POYA 4AFAA 2W52A 1PGL1 4MH0E 1UNBA 4QX5A 1Y7BA 3DYOA 3A4UA 4A42A 2BRTA 2IFWA 2ZEWA 2ZX1A 4M4RA 1A6CA 5A6YA 1RUC2 1BLZA 1NQJA 3BPSA 3D5OA 4WM8C 1PVC2 4QU2A 2RM21 1UYZA 4QQLA 4CCMA 4FAHA 3DXUA 3E5UA 3KSCA 5C9AA 5CBLA 2I74A 4QKNA 2VW1A 5ANNA 1VE0A 3VBHB 1JYXA 4I2OA 3CMGA 4GH4A 5FYVA 2QVSB 2GNTA 4K3UA 4XTPA 4FXGB 3BU0A 4HKLA 2E51A 2QQWA 3VD7A 2WZ8A 2R042 1BZWA 1V6LA 3VBRC 1XNDA 3ZKUA 2XVLA 1NXMA 1F4AA 4FPCA 2DBIA 2A75A 1G86A 1B35A 4MGIE 3HPNA 3RVHA 1TME3 2D6MA 2VQUA 2E63A 4K1YA 2VUCA 1PX4A 1JZ5A 3DYPA 3EBRA 3T1LA 2QZ2A 1O3QA 5EWSA 2VMHA 1V6NA 5FLJA 5E6HA 4OLLA 4AR2A 5FY1A 1RL3A 3IIIA 3KT7A 3VD3A 2YROA 1WD4A 5C7GA 2ZAAA 3J9SA 2R49A 2WRAA 5FY4A 3U4XA 1IPSA 5HXMA 1CZTA 2QZ3A 1XNTA 2X29A 2E6VA 2VW2A 5IVJA 2DCTA 1C1FA 2XVKA 4AQ6A 4NOTA 1AR63 2YGLA 2BPA2 1YO8A 2V09A 4OUMA 4XFFA 1G9AA 3NO8A 4SLIA 1XPWA 2Q1FA 2ZJCA 1GZWB 1SCRA 1SDWA 1UY2A 1Y43B 1CAXA 3CBNA 1AR93 3THCA 3W21A 5ABJC 3IPVB 1PO23 3O12A 5A7SA 4AI3A 3AP5A 4QX3A 3ETPA 3BVCA 3J7LA 1KQRA 4PBPA 4I01A 4IEWA 1BJQA 1ZRCA 1ONAA 4AZZA 2WYFA 2PQQA 1IQDC 3BOWA 4ATFA 4Q0PA 4JHTA 4RS5B 3LFMA 3NRUA 4B4PA 2AYHA 5JSPA 1PO12 1UOBA 1I3HA 3IDBB 1DZTA 1GWKA 2FBEA 3WX5A 5L7OB 1H2NA 2Z5WA 1R093 2P4EA 3D0SA 4DXSA 2PHUA 4B3NA 1PZ9A 4QDQA 3P3PA 2G9GA 3LPGA 4XUOA 4YVSC 1EY2A 4BK5A 2WNEA 4AVVA 1OA3A 3AMHA 2RVAA 2B9UA 4C90A 4EN7B 1AR62 3KWVA 2VMFA 4L92A 5FYZA 4QMAA 5DAWA 3HMYA 2ZPXA 5AFBA 5GKAC 2HWB2 5IYYA 3U0ZA 3ZFGA 1J1LA 2VTFA 1U5IA 2D7FA 4HKOA 1WKYA 1AR92 1PMIA 3WEZA 4WVZA 1QF3A 2VR4A 4MX3A 2AACA 3WNPA 3B5LB 1WLDA 4D7SA 4FTSA 1W8FA 1HB1A 3MGUA 1YI9A 3EJKA 4NHMA 4KG0A 4HXCA 3ST7A 1WW7A 5C8CA 1DGLA 2JKBA 1ND3A 3QBQA 3WR0A 1WD3A 3O5SA 1XQNA 4GWJA 4CRQA 3WDWA 4K8RB 1OSGA 4BHPA 1GNZA 1ND2A 3JZVA 4G9SB 4NMIA 1J58A 3WG2A 5F5AA 4CP9A 1DBNA 3FJSA 2HWF1 2AR6A 2ZHLA 3OY8A 5FP4A 5T5JA 1HX6A 3ACIA 3VDCA 3V0AA 1QXJA 1ODNA 1GOHA 2JDKA 4AHYA 2WZR1 3MI8A 2D98A 2ZGOA 1NZCA 3T0DA 5GM0A 3KVAA 3W59A 4DXTA 1H6YA 1GV9A 3BPZA 5FZ0A 3S5QA 2JE9A 2D5HA 1ENRA 5FMCA 4Q8LA 3I3MA 1QU0A 1JZ4A 3VDDC 3KB5A 3I4IA 1X50A 4E2QA 1RUE2 1JYVA 1G6NA 2BNOA 2VOXA 1NAEA 2KM2A 2R6QA 4YG6A 3OBRA 4UF0A 2GN3A 3RI8A 5IK8A 1UPIA 1ZZ8A 4IW3A 1D0GA 4NRMA 4XAEA 3T1MA 3VKNA 3V0BA 2Z2SB 1NUKA 3FHQA 4LNVA 3L2HA 4D8MA 1XYOA 1H9WA 1W99A 3AZYA 1DU3D 4IE6A 1CAVB 2PLV2 3URFA 4DPNA 3AKTA 5KXCA 3PTRB 1DQ5A 4YW3A 1GUIA 2ZCWA 3VDBA 2FDHA 2GN7A 1L3JA 1UYXA 4MADA 3N9OA 3CF6E 5FZBA 5BNNC 5BNPB 3FE5A 3NV2A 5EJ3A 2WO3A 2N7GA 1QWRA 3WT3A 2P5BA 5JR7B 4Z2AA 3HT2A 4YNIA 1ZBA1 2RS31 4M0HA 5GLZA 3UKVA 1Q8VA 4AVAA 2W87A 2JIJA 2E7AA 2VNOA 1BBT2 2BEOA 1HJGA 5J98B 1W2NA 4BQYA 3CEWA 3VBFA 3USSA 3T2TA 3JUUA 3ZSLA 1WA6X 1A8DA 1PM7A 1W6MA 1DQ4A 1TMF3 1K5MC 3J7MA 3KV5A 4N43C 1OQ1A 2GDFA 5FZAA 1AR71 3ILFA 2VOWA 3E1F1 2RS51 4Q4Y1 5FMBA 2JG8A 4MHRA 2EF6A 4LK6A 1C8M3 1MZ5A 1AYN3 1W8HA 1S0EA 1W0PA 3I7DA 4MGKE 2DCKA 3M4FA 4CSWA 1Z7S3 4I09A 3VV1A 4NPLA 3M7AA 2VZPA 2AEYA 1YRZA 4QHZA 3SQOA 1MVEA 4AQ2A 4QXHA 5A1AA 4AEDA 1M4WA 1HDKA 3TEXA 4LLOA 4ES9A 1VBB3 1ULOA 3C8XA 4C0HA 2OZJA 3KCXA 1RUJ3 4HBNA 3UV9A 3N9PA 4QPIB 2OQ6A 1ZRFA 2EIEA 2EIGA 1XE8A 2ENRA 1FYUA 3PUHA 1UPSA 5FFOC 4EV0A 1AR81 4HK8A 1S0GA 2P3KA 3R6SA 2ZXQA 1W6NB 1H4GA 4N8MA 1TMF2 1FPN2 4NE9A 3ZYPA 5IVBA 3CU7A 3BU7A 4FI9A 5FYHA 4Q8KA 5FK7A 4HT1T 4FSJA 3LWCA 4LE4A 1S0FA 2CTVA 3B3QE 3RDIA 3PJQA 1BVP1 5E8AA 4ZU5A 1XNBA 1LOFA 1QJU3 1AYN2 4LOTA 1SDDB 4N53A 5I8SA 3KF3A 2QQKA 1Z7S2 3HAGA 5A3LA 1FOD1 4DIQA 1BMV2 4HPKA 2ZKLA 5FKCA 1ZVFA 1PIV2 3FN9A 3GCWA 2EICA 2JDAA 2UWAA 2D5FA 4IXLA 5FZKA 5L36A 2VAUA 3JB8A 4FVVA 4COYA 1R1A3 3NJXA 1NOVA 2VD7A 5GZEA 3NQHA 4N9HA 5KXDA 5F39A 1XSRA 1VBB2 4CDWA 2YBPA 1RUJ2 3AC0A 3R4DB 1D4M2 2C6SA 1SEFA 1OOPC 1SHWB 5DG1A 3HBZA 4H3WA 1YQ8A 2VO5A 2WO2A 1UZ0A 4A45A 1OMIA 2VCBA 1RMU1 4AF9A 4OVEA 5A6XA 3ES4A 1BCXA 3B93A 4NHYA 1OUXA 1JUIA 4LKDA 1ZZBA 5FZ9A 2XKPA 5BUVA 1UOGA 4Y1VA 5C33A 2DFCA 1HQLA 4M3CB 5TSWA 3PVNA 2ZKNA 5FQ0B 3WDVA 2WWSA 3OBZA 3MEPA 2D6KA 4J1XA 4JHZA 1AX0A 2B5HA 2D6NA 4FTEA 1K12A 5GLUA 1F9KA 3Q8BA 4UI9L 5C9AC 2Y6KA 3H8OA 1JYIA 1FX5A 3GGLA 3OTFA 1F31A 3WW3A 2GC1A 5CFDB 5FO9B 3T30A 2YMZA 4E27A 2OW4A 4GH4C 1I6XA 3HR9A 1M06G 1KGYA 5JOXA 4YZ4A 4DINB 1GR3A 3CO2A 4PDWC 1YFXA 3WF1A 5CZKA 3EXUA 4BZ4A 5GLWA 5DMYA 1IS5A 1L7QA 4M00A 4PIYA 1MEC3 4QPGB 4GIQA 4MGSA 1V6OA 1IPJA 1G8WA 1S2EA 3LDBA 5F9TA 3WUDA 4S2HA 4A3XA 5LEKA 5JMOA 1W0OA 3I3DA 4PQ9A 3NJZA 4LIUA 1MACA 2NN8A 3M3EA 5DDJ3 3C3VA 2DVBA 2W46A 4H2AA 1MS0A 4NWVA 1I5PA 3VKLA 1RUF3 3ZSEA 2CDPA 5IATA 4XEZA 3NKGA 4A7KA 5CG8A 4Y20B 3VHOA 4MUVA 3RJ2X 3ZXDA 1QHDA 1NA1B 3A0KA 3VZNA 2P1BA 4S2DA 1NKGA 2Y33A 2ZGQA 3AX4A 3VLBB 3BODA 2X53S 1SFPA 1GQGA
chains in the Genus database with same CATH topology
1H0BA 4ASLA 3AMNA 3MW2A 3OYWA 1RUC1 2VPVA 3ZPYA 5FPXA 1YFUA 1PVC1 4XFIA 1UAIA 5GZCA 4GWNA 2XL7A 1WW6A 2JG9A 1ULFA 4FXKB 3D0JA 4CDUA 2GC3A 1RUF2 4C1WA 2H6BA 4AQTA 1EPWA 2D93A 2Q4SA 1HIXA 3OGGA 2ZHMA 2R041 2JDZA 3AFKA 2A3YA 1RVF3 1J3QA 1EYBA 5J48A 4GWMA 4ISRA 3VBRA 1MS1A 4YVWB 2KXLA 4FPKA 3BB6A 4FCAA 3RYRA 1YCIA 3LA3A 1RINA 4C0BA 2I07B 3KT1A 3S0MA 3NV1A 1VB4A 1GNHA 3ZFGC 1R1ZA 4YVSB 3ROUA 2XG3A 1GLHA 3FLPA 1DG6A 2ARXA 3FMGA 4AGGA 5F1RA 4BYYA 1G7YA 3IM0A 3USUB 4DS0A 1U12A 1YNAA 4XFHA 2WFF3 4LT5A 1OA2A 5C8CC 2YHJA 5LRRA 2ILMA 2OUHA 4NVPA 1J3RA 3VHPA 5KHKA 2QCSB 1ND2C 1WGPA 1H2KA 2VECA 4CEWA 1VJ2A 4Y4YA 5AFEA 1VR3A 3H50A 4EWEA 3TN93 2PELA 1UCXA 3ILRA 1G9CA 1RVF2 3L9JT 2PHXA 4SBVA 4W6WA 1OQDA 3PVBB 1TME1 4KH9A 1DLLA 4E2GA 2BWCA 5JDBA 2IXHA 4YW1A 4YZ5A 2GNBA 5A33A 5T3NA 4R9DA 3VL9A 3ZN6B 5J36A 5KXEA 1XNCA 1NCQB 2HEWF 4IV3B 2DVGA 2ERFA 4R4ZA 4XBNA 4FPGA 3WW2A 3VDDB 2ZS6B 4W6XA 1VBA3 3KGLA 3POSA 4J1WA 2WFF2 2EALA 4JTOA 2AZ5A 3N7MA 1C1LA 1TEIA 3ME2A 4IEQA 2JX9A 4FO9A 1GFF2 1ULEA 4HANA 1AR61 1S2BA 3H1WA 1DYPA 4XIKA 4FAGA 5K0UB 2EXKA 2WT2A 1Q5OA 2EVXA 5IT6A 2MHFA 3RJRA 3TN92 5A32A 4XHXA 3I8TA 4RR3B 3RZZA 1ULDA 2WSVA 3AP7A 3M8LA 3RS6A 4E2SA 1AR91 2TUNA 1PO21 5AVAA 2PHLA 1MS9A 4NHKA 3VBFC 3INAA 2Q30A 5AC93 1X33A 5JCTA 1QJY3 4OHYA 4MXWB 4PLMA 2JG8C 4I0BA 5CNAA 4N43B 1XE7A 4Q2FA 1VBA2 3OBTA 5K8SA 1F5JA 1R091 1RHI3 4LO6B 5GZFA 3VBOC 3WQ1A 2LALA 4URTA 4COUA 1DGRN 1D2SA 4BLJA 5BY5A 4NN0A 3GHNA 4KU7A 3ZXAC 4PLOA 5JOYA 1W6PA 4GB32 2YXSA 1VRH2 4JGYA 4LBOA 4GQ7A 5I0RA 4Q0SA 5CIRA 5I91A 4L11A 5JSOA 1SQ4A 1YFWA 1RUH3 3WDXA 3S30A 4K8FA 2ATFA 4WM7A 5AC92 2NZ9A 1QJY2 1OPMA 5CFCB 3LGRA 4BH9A 3M3QA 1X7NA 2GAUA 2VH9A 1KDMA 1YHFA 2NPIA 4UW6A 3R05A 4LEJA 1LOFC 4XFAA 3TRSB 4N53C 2RJKA 3ALQA 4KWJA 2UURA 4P9LA 4ZU7A 5EXOA 2BFUL 4BQ1A 4PIZA 3MDPA 5SV5A 1LOAA 2C5DA 4LULA 1HKDA 1WBLA 1SLLA 4M3CE 2B46X 2NQYA 4CDWC 5GALA 3E6DA 2CGPA 2VQ0A 1D0HA 4IEXA 3CLPA 5IK4A 2TEPA 4OI0A 4UW5A 2DV9A 4XF9A 4NHLA 3MIHA 2XUMA 1RUH2 2BUKA 3OJBA 4QM8A 4M3CF 1PNGA 4KNCA 4FP2A 4P9JA 4IV1B 4V1PA 4EN6B 5D8AA 3E5QA 1OA4A 1WLTA 5T50A 3B02A 5DUXA 2ZMNA 4CTEA 2DUQA 3JBG2 4Q26A 1ULCA 2RR13 3WOGA 2B8MA 4L8QA 1AL0G 5LEJA 4RA0A 4YM1A 3SCHA 1PGW2 3VHRA 1GICA 5E1RA 1Z0HA 3H7YA 3KS7A 4CDXA 1TMF1 4DZGA 1Q3EA 1V70A 5FDBA 3LA7A 4GH4B 3AMMA 2UWBA 1COV3 1PVXA 1DHKB 2Z69A 2NYYA 1C8M1 1WMEA 1AYN1 2FHRA 2LUWA 4JGZB 4AEMA 4B8EA 2FQPA 1NG0A 2A3WA 1Z7S1 4JV4A 1Q8PA 3ZFFC 2Y26A 3ZIXA 1AXYA 4AGVA 1BMV1 4BIOA 3AP4A 1B35B 1WCKA 3M1HA 2C0ZA 3B69A 1ZRDA 1CAUA 5L73A 4XXAA 1VBB1 1DGRA 1RUJ1 4R52A 5LK7B 1D4M1 2DCZA 3MIFA 4XTMA 1W6OA 3GBWA 4Y1YA 1VBC2 3U07A 4JQRA 3H7JA 3O0XA 4COVA 4A2UA 3ZXFA 3JQWA 2SLIA 2QKDA 1QDCA 2XJQA 4HMZA 4FT8A 2WKKA 4LBQA 5E16A 4K21A 4AK3A 1QMJA 1I5ZA 2A6YA 2CGOA 3GF6A 1COV2 1KS4A 1O4ZA 5EYYA 1QJU1 1N3PA 5ACA3 3FBYA 1DYKA 2D3SA 3ZDSA 3VUOA 3CNAA 5J7MA 2JG9C 2WQZC 1CAXB 1R083 4CDUC 1X8MA 1LEMA 3I2DA 4EROA 1R1A1 4Q1PA 1JBCA 2A70A 1SLAA 5JZGB 4OI1A 3GZTB 4PDWA 3ZMOA 5E89A 2MNGA 3AP6A 1N1VA 3ECQA 2AUYA 3ZMNA 3IDCB 1O4TA 2ZX3A 2BNNA 4FPJA 3RYKA 4XJUA 3VN4A 3WY6A 5JSRA 5KC5A 3ZYJB 4FOWA 4CEYB 5H9RA 2B39A 4FQZA 3GBGA 1PZ7A 3RWNA 1CVNA 4CP2A 2I45A 4Q29A 5ACA2 4XZPA 3ZFGB 3TNPB 2DU0A 1PO13 5FREA 1R082 3R4SA 4Q0QA 3THTA 5JPNB 4MYEA 1H30A 1POV3 3IMNA 4GKYA 3HN1A 1N1SA 3WUCA 4LE3A 3WQ7A 1GSLA 1HRV2 4H7LA 4CEWC 1ND3B 2XBO2 5LRSA 4Y1ZA 5JAXA 3DF0A 1MEC1 1KS5A 4D7YA 3DUIA 1SLCA 3P3NA 2HWB3 2PHFA 3QACA 4LUKA 3OY8B 3V0AB 5KC6A 3Q9OA 1IS3A 4GXLA 4MV2A 5DDJ1 2WNVA 2CY6A 2XGXA 2UYAA 2WIIB 3AMPA 2ZZJA 1RUF1 4DNYA 3AZXA 5JIAA 4Z07A 5DZFA 2BFUS 1XRUA 3KQRA 4LHNA 1AYM2 1QXRA 3SLIA 2GALA 4OULA 4JDMA 2OZ6A 1DGWX 1A8MA 1UN1A 1RUD2 5JPMB 1LOCA 2Z79A 2DFBA 2JEMA 1AX2A 3VBHA 2AENA 2OUJA 3J4UH 5LK5A 1KD7A 3AB0A 1C5IA 2WL1A 3EO6A 1RUE3 1Y3TA 5DUWA 2LM3A 3M3OA 4PBOA 1LHOA 4RD7A 1H4HA 2O8QA 5FCCA 1BXHA 4GKXA 3O0VA 2HWE2 1IS4A 2ZGTA 4YW4A 1ZNPA 1A3KA 3NV3A 2PLV3 3DPRA 1G9FA 4TWTA 1DF0A 1KFUL 5F6LB 4E4SA 1W6MB 1NCRB 1MS8A 2IFRA 3NV4A 1CIWA 1RVF1 3DKWA 2MEV3 5GLTA 1H9PA 2JG8B 2DF7A 1OPOA 4F83A 4Q4V3 4KU8A 4XILA 4FPHA 1BBT3 3MPPG 4P9IA 3NKTA 4JGYC 4Z8BA 4AEDB 5KHIA 4N9IA 4D94A 4CP0A 4N7IA 4YM3A 3MW4A 1GZWA 2WFF1 4META 4WM7C 5HI0A 2Q1ZB 3GALA 4N90A 2BGCA 3WQ0A 4Z2WA 3UK9A 4WZCA 2DTYA 4YLZA 1MQTA 1RJ8A 3TN91 3ZYGA 2X8KA 3GZAA 2ZMLA 1SFYA 3KT4A 2Q8OA 3VBSA 2MEV2 4RS5A 1NLRA 4BMEA 2VG9A 1VBE3 2P34A 4Q4V2 4XE9A 5L7OA 4PF5A 4N53B 3R0RA 4ORFA 3JD73 4I3GA 3RMYA 1G9DA 4B7EA 1FPN3 2ZAHA 4CDQC 3DGTA 1RB8G 1VBA1 2XLFA 4CDWB 4M0NA 1KITA 2XLAA 2VNGA 5ABJA 3ZFEA 3E6BA 2BVBA 2DU1A 4GALA 3PJYA 4XQWA 2XPJA 2VY0A 3QCWA 4HETA 1AVBA 3VBOA 3AYEA 3NSTA 5D8AC 4DOUA 1FMD2 1PIV3 1X36A 2Y38A 4I0AA 4P9YA 2B42B 2G9FA 2XJSA 4JDOA 4COZA 4QQPA 1PK6A 2A6XA 1Y9QA 3WG1A 2QFEA 5FLHA 1VBE2 1D4M3 3MIDA 4YW5A 2FZ2A 3U11A 3W9AA 4D7TA 2P2KA 1DQ1A 1OLQA 3B9IA 3JD72 3TB0A 4Q0UA 2P37A 4CDXC 5AC91 2RHPA 4G3YC 4UW4A 1QJY1 3CJXA 4FOVA 3AXDA 2E7TA 3OPZA 5CU1A 3WCRA 3VGIA 2NP0A 2BYVE 3I59A 1RIRA 3APBA 3FBMA 1RHI1 1DGWA 4Y22B 1O5LA 5B2GB 5H9QA 3WG4A 3MLKA 3WCSA 3VZOA 4LR4A 3AKQA 1CAVA 4RQPA 1ZBE2 2R073 5BNPA 5K7PA 4LO7A 1RUI3 4XOGA 1GZCA 3FFZA 1FATA 5FPZA 4U36A 1VB2A 1RUH1 2GNMA 3OCPA 4I02A 1FNZA 1A78A 4K7JA 4LBMA 1BK1A 4P9WA 4RL7A 4AWDA 1RUNA 2JE7A 4L9BA 1FV3A 1XNKA 1XU1A 4FP3A 4XF4A 1Z78A 1HW5A 3OYWB 1LGCA 4K6BA 2BWAA 3WVJA 4F7ZA 5BPXA 4QPYA 1B09A 2GMPA 2EXHA 1PGW1 4WM8B 4DB5A 2IXJA 2DWRA 3PVOA 2JG9B 2VNRA 1WLWA 2R072 1EAH2 2JXAA 1AHSA 1SMVA 3AFGA 1PGL2 1RUI2 3TBDA 3WW1A 4B7KA 2WFPA 4L99A 3SMHA 4IQPA 4AI8A 1FNYA 5I8YA 3HD8B 1NY72 4L97A 4QPIA 3VL8A 2Y0IA 1HQWA 3VBRB 1JN2P 3ZVXA 3ZFFA 4Q0VA 1NQDA 5J09A 1WCDJ 1URXA 2SBAA 4HKWA 3A0NA 3RMXA 3AYAA 2V73A 2RR11 5FLIA 1LKNA 1U5ZA 5HCFA 5KBFA 4K20A 4Y5Z0 4LA3A 4DY5A 1Q8OA 1ASJ3 4XW3A 4DRVA 1H8TC 3ZYIB 4HVRA 3GBFA 4MGYE 1COV1 1REFA 4N7UA 5J96B 2VVEA 2ET7A 3HIFA 4RHV3 2GH8A 4HLTA 2WNVC 2R063 2E9QA 1O4YA 2ZTNA 2VQAA 1LOBA 2DUPA 1CAWA 3JB4C 1V9U3 1OKQA 2QE3A 2VOKA 4QM9A 4AEJA 4GA9A 5A33B 4Y1UA 4M3CA 1QXPA 1S55A 1FT9A 1KJLA 3RSJA 1ZX5A 4FQ4A 1RGSA 3BOPA 5IK5A 2ET1A 5CFDA 4AVTA 3VBHC 1ASJ2 2XJTA 3E5XA 3MF6A 5C6CA 2DCYA 1WLCA 5ACA1 4RHV2 3THPA 1QY4A 4QPGA 5FAXA 2VVFA 4OI4A 5A32B 2A6WA 1ENSA 3IN9A 3VBUA 2A73B 2QJVA 1R081 2R062 2VW0A 1X8EA 2HWD3 3PNAA 5T5OA 2I2SA 4GULA 3DPRC 4Y1XA 1D4VB 1BVVA 1V9U2 1HRV1 3SCGA 1UIJA 1X82A 3J26N 4D69A 1LHVA 4Y20A 2WQ4A 5FOBB 2WT1A 2IC1A 1NA1A 3KCCA 1KRIA 3QD6A 5BV6A 2PHTA 4PCRA 1ZM1A 1H1MA 4ES8A 3N36A 3PMSA 3U10A 4R9BA 3DL3A 2E7QA 4LBJA 4UBHA 3GZUC 3VZMA 1C57A 1W6PB 1S0DA 1BEV3 2ZA9A 1PO11 3QLQA 3LZZA 1H1IA 4XQ4A 2QQPA 1POV1 2HWD2 2H0VA 1UL9A 3D82A 4ASMB 4BIFA 3AP9A 3VKOA 1V6IA 1MQTC 2R16A 1YYNA 2HWB1 3VBSC 1UZYA 4RS5C 3LKJA 2IXKA 1MZ6A 4GB33 3HT1A 1VRH3 4QQHA 1LOEA 1ZZ7A 5BNNB 5L7OC 1LCLA 2PFWA 1C8NA 5EV7A 4YVWA 3MLJA 2ETEA 2JICA 4I0WB 1HLCA 2HWC3 2OIIA 2D6PA 4ZXKA 2TNFA 4QGLA 2CYFA 4F8AA 5DXDA 4YFZA 5DZEA 5C4WA 3D4KA 3AZZA 2VGDA 1BEV2 1K5MB 1LHUA 1RC6A 2CWMA 2ZGSA 3USUA 3ZFEC 5ABJC 1QGLA 4P5HA 2D40A 4TZDA 1ALYA 1W39A 1D2QA 1YI7A 4XF3A 2ZGUA 1RUG3 4BLIA 1NXD1 3SISA 3UKNA 1JXNA 1ZBA2 1DZQA 4LBQD 2RS32 3HQXA 5BNOA 3JU9A 2BVVA 2P3IA 3N35A 2CAUA 1CR7A 3B7MA 1AXKA 1PK6C 3EQEA 3GNEA 4HVQA 1RUE1 2PAMA 2VMIA 4XDQA 4AW7A 1V6MA 1QH7A 5HBAA 1YIPA 2PYTA 1MS3A 2EAAA 2W68A 2O8OA 2W08A 2DVDA 3AYCA 2HWC2 1MVQA 2ZGPA 3H1MA 3WDUA 2ES3A 3GHMA 2PLV1 2P3JA 3ZXLA 4GMP3 4C91A 4CDXB 4NWWA 5GJ6A 1CJDA 3ZN6A 1CPMA 4OI2A 1NCQA 4IV3A 3KD4A 2G4IA 5IK7A 2MEV1 3S7IA 1OHFA 4XIOA 4AI1A 3JBG3 4QGMA 3UJOA 4Q4V1 1UU4A 4AFDA 1RUG2 2A71A 3ZSJA 2WA4A 4RQPC 1BBT1 5CA6A 2VOVA 1AR82 1FXZA 5BNPC 1LHWA 2YYOA 4ONUA 1N1TA 2DCJA 1LECA 4RR3A 4CDQA 4XJWA 1DQ2A 4DFSA 5FMOS 1H2MA 3H1YA 1AZDA 1RTVA 4WV8A 1REEA 1OOPB 3CJIA 4LA2A 4BPZA 3AZVA 1RJ7A 5JLVA 1FI2A 3FLRA 3NW4A 1LODA 3SXWA 4DXZA 1ZREA 4LBQB 4MXWA 3G6JB 2ZGLA 2HKXA 3N4MA 1VAVA 1V6KA 3OD0A 5GZDA 4AHZA 2ZHNA 1VBE1 2GZWA 2WS93 4QQOA 5FO7B 5DUVA 3JD71 1VBC3 5JI9A 4WVMA 1LULA 3R4UA 2DVFA 5C9AB 4HZFA 1QOTA 1MR5A 5EZWA 4DY3A 3LB9A 3MICA 1FPN1 2C1FA 4DQAA 2YDEA 3B01A 4E4ZA 3NL1A 2D3RA 4UXAA 1OFNA 3FUOA 4LUMA 4PDWB 4QPIC 4AVSA 1SBFA 4HVOA 2X5IA 3E97A 3C2UA 4QGNA 2OVUA 2WA3A 5KWRA 4XJAA 2WLPA 4IESA 4XBQA 1UD1A 1O7FA 1PIV1 4JC1A 1QJX3 3NVCA 4X8NA 3W58A 3B00A 3KMHA 2IXIA 1N3QA 5CFCA 3B9CA 3J8F3 1AL22 1LHNA 2GMEA 5DG2A 2VUAA 3PMEA 3PTYA 1YIFA 2WS92 4MLOA 5I8TA 4FPFA 4QT6A 3WINE 2OA2A 4Y26A 1UKRA 4YGCA 2EXIA 4LO5B 4YZ1A 1MS5A 3FX3A 2ZBJA 4O9EA 3AYDA 4KGQA 1SLBA 3TNQA 1CPNA 4YSFA 3RNSA 1T6GC 2K0GA 2ZMKA 4B4RA 1EV13 2O0OA 3ES1A 4XBLA 5JOZA 2JJ6A 4QQ2A 4XMIA 3KGZA 1QJX2 1SBDA 2VMGA 4BA6A 2R071 1OD5A 2IZWA 2WNVB 4K40A 1VBD3 3J8F2 4IV1A 3ZSKA 2EA7A 1W6QA 2YUEA 5FO8B 2BBVA 2ZX2A 3S7EA 1RUI1 1HRV3 1C28A 1TNFA 2MPFA 2XBO3 3H8UA 1JHNA 1VP6A 4JRAA 1NY71 1ZZ6A 2B7YA 4ZU4A 1ENXA 3RQ0A 5CFDC 1O5UA 4IEYA 4LHKA 1H1AA 2XB6C 4XPVA 3BCWA 1J59A 4NR1A 3O14A 5EYXA 1CJPA 3QOPA 4AFBA 5F5QA 2AH2A 3JCIA 2GH2A 4HN1A 3NAPA 3OF1A 4QPGC 1EV12 4C1XA 1WBFA 3VBUC 4JGZA 3ZSMA 4A7YA 1AYM3 4XJ8A 1SLIA 2YGMA 1UW8A 3WP3A 1LEDA 2ZHKA 1XYNA 2AGSA 3LAGA 3LOIA 2WNUA 4AE2A 1U5XA 1RUD3 2D43A 1VBD2 1UX6A 1WMFA 3WW4A 4FPEA 5KHGA 2R0HA 1MZFA 5C8CB 3M3IA 2CL2A 4PIXA 1S0JA 3WDYA 1O3RA 1QNWA 1H8TA 2A6VA 3DPRB 4CYDA 4D3WA 1LGNA 3BIWE 4W65A 1LOGA 1ND2B 5BXXA 1FV2A 2YY1A 2OYZA 1YJKA 1NA1C 4COWA 5CB7A 2B45X 1LGBA 2YV8A 4X8PA 4LO4B 2WLQA 5HXVA 1DQ6A 2IWGB 2HWE3 4HN0A 1CESA 4EN0A 1GYKA 1WA4A 4KQ7A 2JECA 3LSEA 1GQHA 1JUHA 1LU2A 3V65A 1QNYA 2F4PA 4BMBA 1U0AA 4MVTA 3UL2A 2R30A 1RUOA 4JTNA 3H3ZA 4I30A 3V0BB 3KM5A 1ASJ1 2ZACA 4K1ZA 3VKFC 1Q56A 4YG0A 1TME2 3IDEA 5E88A 1F8VA 3ENRA 5J37A 1UZZA 4JCKA 5JZGA 4RHV1 1MQTB 2O1QA 1J3PA 2XVGA 2VUJA 4YW2A 2CV6A 3VBSB 1YUDA 4YVWC 1SACA 3WP5A 2R061 5FRAA 4IL7A 2OPKA 4LBKA 2A3XA 1AF9A 4JRLA 3WDTA 4Z1VA 1V9U1 4P14A 1DFQA 4Z92B 4YYOA 4IERA 3VBFB 4CEYA 1UKGA 5C4WC 2LTNA 4QXKA 4Z82A 1BKZA 4YG3A 1IOAA 3ZO0B 4R9CA 4Q1RA 4S2GA 2YC0A 2IXCA 4G4FA 1HXS3 3FZ3A 5ABJB 3ZFEB 4B4QA 3PLQA 5BNOC 1OFSA 1PO22 2D6LX 4LHLA 2WC2A 1KDKA 1VIWB 2Q1MA 1LB2A 3VBOB 2DTWA 1LESA 4KL1A 2GSYA 1PNFA 3TOJA 1O3TA 1WMDA 3MIGA 3ATGA 1PK6B 3WV6A 4IETA 5J3UA 4P9XA 4FPLA 4OFGA 4MXVA 3ACLA 4LBNA 2RS13 2GMMA 2HWD1 4JVAA 3WG3A 2D3PA 3IPVA 2ZX4A 3UKTA 1R092 3K51A 4HSLA 1KFXL 1FMD3 3FHIB 4R4XA 1PGSA 1NCQC 4IV3C 1QQP3 5FBZA 4RFT0 1G9BA 4DRRA 3I59B 1QKQA 3FLTA 3WXPA 4WZFA 3WHTA 1HXS2 3ELNA 4OHWA 4WBBA 3B94A 1C3HA 2QUOA 1NE6A 5K0UC 2QDNA 1XXNA 3FFQA <