5L7XH

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
205
Chain Sequence
EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH02
3DRTA 3EUUA 3O11B 2ZCLH 1I1YA 3IT8D 2VC2L 1C16B 4AM0A 1TZGL 1XF2B 1BVLA 1ZLUK 1KLFA 3F6IA 2FO4B 4WI7A 4KI5D 2O5ZH 1DQJA 4WHTB 1CLOL 1OSPH 4G6MH 1HHKA 2XRAH 4CU8A 2CLRA 3NFNB 3SKNA 4Z8FH 4LBEB 5JUEL 5CJQL 4PBXA 4RA0C 4OZFB 2V2TA 3VFNB 1F90L 1YY8A 3MFGB 1NGYB 2DL2A 3BP4B 4Y4KC 5ISZA 5IGXH 1KCRL 4JFEA 5D7KD 4YLQT 1CQKA 3MQIA 3VGEA 1J88A 4X98A 5EO1B 1XEDA 4XCFL 1W72B 1ZLVK 1CK0L 3WE6A 4JFZH 5FF6B 3OSKA 3TO2B 1HNFA 1CE6A 2FX7L 2C1OA 2DLHA 1I1AA 2EO1A 4H8WH 3SGEH 5FECB 2GFBA 4O9HH 2WBJC 4JQXC 3DRTB 1WWWX 1DSFL 3PQYA 2YA2A 3MJ9L 1I1YB 3UC0H 3Q5OA 5J6HA 3UTPD 4AM0B 4OLVH 3TYGH 4RGND 3WD5H 4FQ2H 5FM8A 5IVZB 5K9OA 4RFNC 3RVVD 5FV1L 4JGUA 3B5HA 4XBGA 5CEZE 3DI3B 3LKNB 3ZHDA 5JHDD 1BX2A 2CLRB 3LEXA 3SQBA 2R0KL 3PWLA 1YNLH 2JKXA 4N0UE 3BT2L 3CC5A 4M1GL 2HLFD 2VXTH 4YWGL 1RURH 1YY8B 4V2CB 2WAHA 5J1SC 3ARRA 2YD2A 3SCMC 2ORBL 5ISZB 1XR8A 3IJHA 3MV9E 1MUJA 5E2JA 1BQHB 3KPQA 3DSFL 4LDEB 2HMID 1W72L 3GEWB 3RWDA 3CSYB 1OD9A 2DYPD 5FXCH 3BPNB 5KVFL 1HH6A 4ZFOL 2EH8H 4X98B 1QP1A 4HUUA 2V2XA 4OZIA 5I1GH 3MLZH 3WE6B 2H1PH 4UILH 2C3HA 2X40A 5CILH 2C1OB 4QNPE 4NO0D 3IDMB 4H26A 5GISL 2F5AH 2LTQC 2GFBB 1ZSDB 3SKUD 3PQYB 1YYLL 2XZAL 5J6HB 3OF6A 5TFSH 4IDLA 4BQBA 1A7RL 2ICWA 2FBOJ 1S7TA 1CICA 2EYTA 3RWGA 2FL5A 2IGFH 4PRPA 5TDNA 2OJZH 1IT9H 5DD0L 5GHWH 4XBGB 5F7EH 4QRTA 1Y6NR 3PWLB 3IVKA 5DMGC 4NN6C 1JP5A 4JY4B 1WK0A 5T1MB 5EO9B 4U1KA 4NRZA 5D71H 2R23A 2VRAA 1XR8B 4MNGE 1MUJB 2OK0H 2FX8H 3KPQB 4G7VH 2VIRA 4WW2F 4TNWK 5DUPH 4HZLB 5BV7H 2HN7A 3RWDB 2R2BA 2QV2A 3FT4A 2R0LH 3MRFB 2ESVD 4HUUB 2EYRA 2V2XB 4OZIB 4K8RL 4P9HH 4KAQL 3AY4A 2P8LA 1W2KT 1A0QH 3QO1A 1DJSA 4HCRA 1F11A 4H26B 3STLA 3QPQD 3A0OA 4MAYC 4M5ZH 1VFMA 4BZ1H 5IWLA 5A2IH 4FG6D 3U0TA 2A0LD 3QG7H 1HHHB 2ICWB 1S7TB 1S7XB 1CICB 2C4XA 2EYTB 35C8L 3RWGB 2FL5B 2PXYC 4I18C 1AO7D 1B4JL 1OTSC 1A5FL 4C56A 1T0MA 3GMLA 3BZFA 1IAOA 4CU6A 4UT7H 5C9JA 5FYJE 1KCVL 3IVKB 1R5WA 5K9QG 1MWAH 4IRSC 3WBDA 2HRPL 5E08L 3VXSD 1LP9F 2HH0L 4NRZB 3MUY1 3BPOC 3EYFA 1OF2A 2YMXL 4QRUB 4FQJL 3D0VA 4JRYE 1T3FA 1LP9A 1QNZH 2HN7B 2R2BB 2ADIA 3SOBL 3X11B 3FT4B 2JCCB 1H0DA 4Z0BH 5J12C 1WT5A 1MHPL 4WU5A 4PD4K 5LXGL 2EYRB 4GKOA 2ADFH 3TVMA 1K6QH 1CFNA 1ED3B 4YDVA 1CCZA 4IHOA 2P8LB 4PY8J 5DJDA 5E6IB 3STLB 3HZVB 3MJ6A 3HG1A 4R4FH 3WS6A 2PETA 3U0TB 1I9RL 5I1AA 5IEHA 2HT2C 3EJYD 2WANA 3BOVA 3VFUB 5I1JH 2XZCL 3TJEH 4GBXD 4L8BA 3LZFH 5L6YH 4P99A 4WTZG 3TA3B 1OGAE 5KVMC 1M1SA 1T0MB 1S8DB 3GMLB 3W0WA 5JR1H 3BZFB 3NCBB 1IAOB 5IESL 1XF5A 1UJ3C 1VFAA 3S34H 3ULUL 1T5XB 1R5WB 2VAAA 3QDGA 5EU3B 5DVMA 1ZVSA 2EECA 4ODSL 3LRSA 3MBXL 4JPKL 3B2VH 4NO3A 3SDDA 4LVNB 3EYFB 4JR9L 4G5ZL 3RVXD 3D0VB 3GI9H 1QZ1A 3NZ8A 3KHQA 1T3FB 4KMLB 1F00I 3UZVB 3ZDZE 3ZKXB 2XTJE 5EZJB 1F4YH 3GSOA 3WL9A 4ONGH 5CWSA 5D7JC 3LS5L 5MHSD 2EKSA 2IMMA 3KPSD 3TVMB 3U7WL 1CFNB 4IHOB 5IVOA 4CUCA 1E4WL 1SBSH 5GSRA 4JO1H 5CP3H 3RVWC 1CL7L 3AREA 3B43A 4V2BA 1V7NH 4G42A 1YY9C 3B2UD 4MA1B 3HG1B 5KVGH 2VO5A 5IEHB 5I1AB 4PJ8A 1JGVL 2AQ1A 4LPUA 3OR6A 3X3GL 3N85H 2K9UA 1MJ8H 2BJML 1NJ9A 1DQQA 4PG2A 1V8HA 5GRJH 3C2SA 2VDMH 3W0WB 1XF5B 1I75A 4IRJD 5D1QA 1ZGLP 4KPHL 4OM1L 3RTQB 2X4OA 4KROC 1ZVSB 2AK4A 3LRSB 4HLZH 4V1DB 4NO3B 3SDDB 1IQWH 4LLYA 1U8NA 3VJ6A 1ZKAA 4PJHF 3NZ8B 4O02H 2ZUQB 3ARYA 4FQHB 1UYWL 3OR7B 2ZCHL 3QNYA 4D2NA 4DAGL 3WL9B 4NHCH 4AK1A 2Q7NA 5I74C 3B9DA 5CWSB 4CMMA 2FHFA 1YPZF 2EKSB 2NX5E 4Q7DA 4HWEH 3MTRA 3MRPB 4H1LH 4Q6IA 2X89A 2JELL 3BE1L 3AREB 2ZOLA 1R3IH 4G42B 4F7CA 5ANMB 4QCIA 4G9FD 5IMOA 3HE6D 2E9BA 3OR6B 4M3JA 2XN9D 2CDFA 1GGYA 1B2WL 3D9AH 5E2UH 4RDQG 1NJ9B 2AV7A 1DQQB 1E4KC 2VISA 1JZ5A 2VLJA 1ZT4B 4PP1D 1JIBA 2OXGA 5I71C 1U3HA 3T09A 1GGTA 3X14A 2ZG3A 1MIML 5JXAH 1YYMH 5ETUA 1OP9A 5D1QB 1RIUH 4RA3A 3GHBL 4M7ZC 1NFKA 1XF4B 2AK4B 2FATH 4F37K 3HAEH 1H15A 4YPJA 5L2KD 4PPTA 2PTUA 5DJXA 5D1ZD 4G8GD 1U8NB 3VJ6B 5DMJB 4HEME 4HF5L 1J5OL 3MV11 1G7MB 4BK5A 3RU8H 1IBGL 1G6VK 3M17A 3QNYB 4ODWA 3D39B 1F6LL 4WI6A 1KN4H 2DICA 1I3UA 4JFFE 4I2XE 4KK6C 4CMMB 5FKAA 3QBTB 3OKLA 5EWIH 5JORA 5I16B 4Q6IB 4LSQL 1TJIL 3QDJD 2ZOLB 1HWGB 2D7NA 1RVFH 4NC1C 4F7CB 3IDXL 5CJBA 1X5JA 4QCIB 4ZSOE 3VXPB 4DJMA 4F58L 5IMOB 4TTDD 5E2WH 3ARUA 4JPWL 3MRCA 2CDFB 2VC2H 2B2XH 4UNVA 1TZGH 4PJDF 2AV7B 3PXHA 3V7MA 3AS1A 4M7JL 2DAVA 2VLJB 1CLOH 4U6VL 3SN6N 4PGDA 1U3HB 3IS0X 3X14B 2SEBA 5ETUB 4LLUA 4XTRC 2FD6L 5JUEH 5CJQH 1GC1L 1H15B 1YECH 4LSPL 1BF8A 1MJUH 1YMMA 1F90H 4N68A 5DJ2A 1A7OL 3K8MA 4XCEA 5IOPA 4S0SD 1A6VL 2IQ9L 1NC2A 3O9WC 3R8BB 4PUBH 3PL6C 3B9KA 1FVEA 3F12A 3M17B 3ZE2F 4ODWB 1T04B 5D96B 32C2A 3CAFA 5FKAB 3EDDA 3OKLB 1A1OA 2QKIA 4HMDA 4XCFH 3T3MF 5JORB 1CK0H 2DMBA 1A47A 3OAUL 1GGCL 4YIQB 1IJ9A 2VZ3A 2FX7H 4J3TA 5C0AE 4N1EA 2XZQH 2DQIL 1DSFH 4G6JH 3MRCB 3MJ9H 4HUVA 5MEQA 2GITA 4KKCC 4Z9KB 2J1KA 3MPCA 4W81A 1KB9K 1XGYL 2CGRL 1AXSA 3U1SL 4J4PA 4JG0L 4OCSL 4RAHA 2SEBB 5EOTA 3FT3A 4OZFH 1MCBA 4IJ3C 3KXFD 2R0KH 1UKTA 4XPTH 5I19L 3BT2H 3OHXA 3QPXL 4M1GH 5T1LA 4A6YA 4HUXA 2Y36L 3JWOH 3MJ7A 4PJ7F 3JUYA 2HFTA 3HZYA 4R0LC 1YMMB 4YWGH 4I4WA 3F8UB 4NQXB 5DJ2B 5MI0B 4XCEB 5IOPB 3MOAL 2G5RA 2ORBH 3ARGD 3NN8B 3PHQA 3QEUB 1NC2B 4OSUH 1BJ1H 2ICWI 4MQTB 2CIKB 3VXRA 1BZ7A 3QXTA 4PJ7A 3F12B 3B9KB 1FVEB 3DSFH 4NM4L 1A7BA 5ECJE 1JGDA 1W72H 5KVFH 5ACLA 2QKIB 2XQBL 3FO9B 2IBZX 3LCYA 2VLME 3FFCE 5ALCL 5KSBF 2P5EE 1RK0A 1AXTL 2VDRL 4CRPA 4PR5B 4JO4L 2XPGA 5MENA 1D9KA 1JVKA 3AMKA 5GISH 4TVSa 4GXUN 4LLAA 4NQCE 4UU9B 5F7DA 1YYLH 2XZAH 5MEQB 2GITB 2NZIA 1A7RH 1RUPH 3WYRA 4L29A 5BRZB 3HUJF 5E2TL 1EFQA 3THML 1P84K 4MNQE 4HWZB 5F97E 3SDXE 3F5WB 5EOTB 2YN5A 3FT3B 4HG4J 1JMXA 1DTUA 1QSEE 3OHXB 1KCUL 4A6YB 5JPNB 3REWA 3MJ7B 3X13A 1HEZA 2IQAA 3IS1X 4PJAF 3LH2L 4F3FA 3DARA 4I4WB 2NXYB 3AB0C 9CGTA 3HI6L 1CL7I 3PHQB 3VXRB 5FO7A 1BZ7B 3STBA 4ALAL 4PJAA 4YGAB 4U7SA 3ET9F 3WN5C 1JGDB 2XV6B 4ODUB 1BECA 1CDYA 4Z7NE 4CDHA 5SWSB 4ZUUA 2VOTA 1U8JB 1AQKL 4KAQH 2W59A 3QDHA 1I1AC 2XPGB 5MENB 2FZ3B 4WEMB 4PJEE 4I1NB 5LCVL 2FWOA 4P48A 1U95B 3RGVD 2BRRL 4NZRL 3ECBA 1DN0A 3ILQD 4GLRI 4UV4L 4POZC 3QO0A 4OM0L 35C8H 4L29B 3K4AA 3TT1L 3D18A 1B4JH 1VEMA 1A5FH 5HHOD 3O6LH 3U9UA 5DJCA 3KJ4C 5E7FA 4ZG1A 1JWMA 3QR2A 4L4VB 2EDTA 4PJIF 1KCVH 1KJ3H 4QRQA 5JOFA 4O00A 1HEZB 3QUXA 1NCWL 1JYNA 4LKXB 2HRPH 3KHOA 5JZ7D 2DI8A 4F3FB 5GS1A 3GGWA 3HPJA 2Q3AA 4FZ8L 5I8CA 4MVBC 5EU7E 4I3RL 2X41A 2YR3A 2X4PA 2YMXH 4FQJH 1I7TA 4HKXA 5E9DB 4PJAB 1LO4H 4OGYL 4KK5D 4MA7L 3ZKMD 2VXSL 4WFFD 3PWVA 3SOBH 3U4BL 2X6MA 1MREL 5DZLA 3SE3A 2BFVL 3TBYB 2GCYA 5EZOL 4HJ0D 1MHPH 1H5BB 5LXGH 4ZUUB 2IAMB 2VLRD 1MI5D 5DD6A 1JHKH 5LJYH 5EDXA 4EOWL 3JV6B 4OCNC 2HTKC 2WMPA 3MV7E 2DI7A 1NEZG 4LVOC 2VDOL 2Z92B 4X8XA 3TIDB 1I9RH 2NY0D 2VE6A 5DFVC 3UPCA 2P24A 2H9GA 1MIEL 1E0OB 4CKVX 1DUYA 3BKYL 2E7MA 3GSWA 5F3HA 1UACL 1AC0A 5HI4C 1JWSA 3ULUH 4QRQB 2DQEL 1YN6B 5JOFB 1OAYL 3LEVL 2XWJA 5CCKL 2EO9A 3UTSD 3QUXB 4M93B 4WI8A 4ODSH 2CKBL 3FFDA 3GGWB 3HPJB 5EZIH 4JPKH 3TNNB 2GQHA 4JR9H 2X4PB 5CKAA 4G5ZH 5E03A 1I7TB 4HKXB 5L0QB 4DN3L 5CJOL 5I30H 3BPCB 3C60D 3PWVB 4WW2C 3MLXL 2PYED 1MVUA 3E3QE 5IMMA 4LDOB 2GCYB 5CEXB 1MQ8A 2J2ZA 1RZKL 3LS5H 3U7WH 1Q1JL 3C6LA 2BSTA 1AHWC 1EHAA 1E4WH 2VN4A 1PAMA 3MGAA 1CL7H 1CFVL 4JHAH 4WUUD 3F7QA 3B4NA 2BSRB 2VE6B 5D5ME 1JGVH 1XZ0B 2P24B 4Y4FD 3X3GH 2H9GB 1MFCL 2WQ8A 1DUYB 2BJMH 5AUMA 1FNGA 3O6FD 3VD5A 4KUCD 1QA9B 4F9LC 1EUUA 1EGJA 1EBPA 3TYFA 5BZDA 2F9BT 3GSWB 3PABB 4Q58C 3RY6A 3DVNA 1JWSB 5D2LF 4NT6A 5DQJA 4EI5A 4MB3A 4OM1H 4NCC1 4GLRH 5KSUA 3FFDB 5D7SL 1X5YA 4HZAA 2ZG2A 1LK3L 2NY6D 3I2CL 1OTTC 4D9RE 3NACL 4LQ1A 4L8SB 5FA4A 3GIZH 2VR9A 5E24E 5HHPB 3EZJB 1UYWH 2GJ6A 4DAGH 1T7WA 1WT5C 2A38A 1J7VR 5CD5D 3HNVH 2BZDA 4QYOB 5D4QA 4U49A 1Z9MA 2NW2A 1W0WA 1UKQA 4TRPL 2OJEA 1PKOA 2BSTB 3T8XA 3TF7C 4MS8D 3L5JA 2JELH 3BE1H 5B4MD 5AYQA 1N7ML 5TH2A 1F58H 5DD1H 1IGFL 2AAVA 3V0VA 4MJID 1B2WH 5AUMB 2ARJQ 5F6HJ 4PRHD 4LLWB 4QHNA 1TJGH 3TYFB 3OWEA 4XGZB 3V4UL 5FHBL 4MXWL 4J6RL 4DW2L 1G9NC 4EI5B 3RHWK 2XIDA 5IVXF 3GHBH 4JM4L 4PGCA 1EJOL 3IFPA 1KPRB 1A7PL 4HF5H 5DRXA 2AJSL 1PBYA 4ODBD 4FQXC 3C2AL 1IBGH 2GJ6B 1XF3A 5DHXB 4G43A 3QNZB 3SPVB 3ULVL 4L4TA 5ID1A 5GS0D 2VQUA 2OJEB 4HIJA 3T8XB 5JTWA 2JCCE 3BISA 4LSQH 4NQEA 1R3KB 4YHKL 2WNGA 3IDXH 1RUQL 4KGJA 4PJ8C 2LU4A 1U9KA 4F58H 1FNSL 5TH2B 5EOQL 4EZMA 1U41A 4QGTA 4JPWH 3V0VB 3L3DB 4PG2C 3HC4H 1RZJC 2CLZB 3NCFB 3QUMA 2VERN 4QHNB 3AS2A 4M7JH 3JV4A 3B5TA 4U6VH 1I3GL 3HI5L 4IIQA 3IDNA 4PLJD 3BQUC 4R97B 1FNAA 1WBXA 1Q9WA 2ICEB 2DD8L 5DDHA 1AD0A 1IGTA 2FD6H 4Z0XA 1SMAA 4GAJL 4PGCB 4QHUA 3S35X 4PYGA 4LSPH 4MQ7A 1KB9J 3EAKA 5E8EB 2HT4D 4DVRL 2MTPA 1A7OH 1RK1A 2QADD 5FK9A 3W39A 3IYLW 5JQ6L 3VG9B 3HPLA 5I1LB 1XF3B 2RHEA 3SO3C 4MA3A 4G43B 4O51B 2AXFA 5DFTA 3DPBA 5HI3D 1PX3A 4L4TB 1OARL 5D2NE 4PBWD 1JE6A 3Q1SL 1GH7A 1T1ZA 3OAUH 1GGCH 5F7WC 1ZV5A 4NQEB 4D0DB 3WHE0 1INEL 5BZWA 1A6UL 1WCBA 1NFDF 2H41A 4Z5RB 3ARXA 4PRAA 3KLHD 5I6XB 1ZS8A 3CZFA 2DQIH 2J6EA 1L0QA 3G6JF 1MJ7L 1OAQL 5I1CL 1JZ7A 4LOUD 4OJFL 5C3LD 1RJYA 1C5BH 3ZYJA 1WWCA 1C08B 3GJFK 3QUMB 2F8OA 3T0BA 2VQ1A 1XGYH 3JV4B 4JG0H 4OCSH 4IIQB 3QRGL 3TT3H 2W60B 1WBXB 3DUSA 3IFOA 1Q9WB 4HS8L 1OAUL 3H3PH 3QDMB 4MX7A 1FNFA 1IGTB 5I19H 3QPXH 4P23D 2A6JA 4QHUB 3EYQD 1T1XA 4MQ7B 2RAMA 1IM3A 3DGCR 4KKBC 3RNQB 1RK1B 3MOAH 4K3GA 1RZIA 4HK3J 5FK9B 5FFLA 3NPSC 3HPLB 2XNAB 4NM4H 4V1DE 1EBAA 3P9MA 4MA3B 4R6UA 3T1WA 1FN4A 2AXFB 5EIQA 4CMHC 5JHDA 4Y4HD 1BFOA 3L1OL 4D0CA 3DWTA 2XQBH 4FQIH 3RDTC 4TPRH 5ALCH 1T1ZB 1PZUB 1KYOJ 1HOCA 1AXTH 4JO4H 2VL5B 5BZWB 1PG7W 1WCBB 3LQMA 4WEUD 5DA4A 2QBWA 4ZUWA 5HYQA 1ZS8B 3CZFB 4K23L 1ZVHA 3QUML 3EHBD 4Q9BA 1CT8A 2DYPA 4HW6A 2J8UB 5ANME 2OMBA 5ELIA 5EZLA 5T3ZL 2VQ1B 5HVWA 5ADPL 3RWEA 1QVOA 1BHGA 3IFOB 1MF2L 3EYOA 4OQTA 5A2FA 3WNMA 4NO0A 3DETD 4Z7UF 3QHZL 1KCUH 2FEEI 2A6JB 2W07A 5JNYB 3DI2B 1T1XB 4R4NC 1IM3B 3LH2H 4BKLB 3LEYL 5DC4B 5HYSA 2BHUA 1WC7A 4BFBD 5F9OL 3HI6H 3B9KC 4RGNB 5E1HB 2NXZC 3LKOB 4G6FD 1LO5A 4YH6A 4DEPB 3JTTA 5IHUH 2B1AL 3RX7A 4JKKA 4RDQF 1BFOB 1RMFL 4D0CB 1NBYA 3GSNL 5C09B 2DQJL 3QQ9C 2DBLL 1RUAL 1AQKH 3D39E 4WW1A 1A02N 2W9EL 3BEVA 4LEOA 2EZ0C 5HYQB 4K7FA 5LCVH 1F97A 1QBBA 3MLRL 4NZRH 2RFXB 3RL2A 1DEEA 4UV4H 3MR9B 1Z3GL 4OV5A 5EZLB 1OP3H 2ESVA 3TT1H 2C1PA 2H2PC 3ARFC 1DBML 1Q94B 4A6YH 4XP5L 3RWEB 1QVOB 3H7BA 3EYOB 2RGSA 1TDQA 4NO0B 5I1IL 5T1KD 1ZGLA 1GHFL 4ELKA 2PO6D 1HILA 4PJ5E 4M03A 2OQJA 1LO2L 1QPXA 5HYSB 4JZOB 3KDMA 1UWGL 2AXJA 1AO7A 2BNRE 4PJCA 1LO5B 1UXSA 2ZPKL 3S5LG 4OGYH 3JTTB 1P7KA 4MA7H 5J1AA 1LD9A 3U4BH 3ARBC 4NZUL 3DMMC 1G7HA 2X4UA 5FGBA 1M7IA 5AZ2H 1NBYB 1QFHA 4RMTA 2FBJL 4OBRA 1WUNT 4XWGL 4WW1B 1D9KC 3UJIL 1FNEA 3VXSA 4WCYL 3BEVB 5GRYA 4OFKA 3T0ED 3VXNA 4EOWH 3GKWL 3N1QC 5CINL 3HE7D 4RQQA 1KB5A 4K7FB 4ONOA 2VDOH 1DEEB 4RMQA 4OZGF 3QULA 3W5MA 5DMKA 3HZMA 1MIEH 4OV5B 5F7FA 3ES6A 1AGEB 2YWYA 2Z9TA 4OZGA 4RSVA 1VENA 1X5HA 4PJXF 1GZPB 1UACH 3H7BB 1FL6B 1VFUA 2IJ0C 4GRWB 4YDKL 2BHYA 2L7JA 2DQEH 1ZGLB 5ENWB 2BY3A 3IAPA 4DZ8B 1OAYH 3IDJA 3LEVH 5CCKH 4X6BA 4KRLB 4LCUA 4KJQC 1EH9A 4JGMA 3TBWB 1EO7A 3VWJC 3KDMB 4X6CF 1AO7B 4PJCB 4GBXA 3O3DA 1UXSB 4KMQA 4JFXA 3RIAF 1CBVL 5CJOH 5IQ9A 1NEUA 3ESVF 5J1AB 3MLXH 1LD9B 4ZD3L 4X6CA 2QSVA 1G7HB 2X4UB 1M7IB 4I77L 1RZKH 5C2BL 1Q1JH 4JAMB 3BH8A 1FNEB 1YEJL 5D70H 3VXSB 5GGTL 2N7AA 2X4RA 3VXNB 1L7TL 2ZG1A 1CFVH 4RQQB 1KB5B 4HKZA 4RBPK 1KGCE 4FABL 1GXEA 3V95A 2NCMA 5CGYC 1G9EA 1MFCH 2OTPA 3RWFA 3HZMB 5CHNA 5TGBB 2YPVL 4G8FA 4YK4C 3SEPA 4ETQB 4DVBA 5GSVA 3ES6B 4OZGB 4UQ3B 3KPSA 4JHBA 1ITBB 1K5NA 1UADC 3EDJA 3WXWL 1NCCL 1WIPA 3PNWA 1KXQE 1PY4A 5BRZE 4M3KB 1LDPL 2Q8BL 4ESKA 3IDJB 5IFJA 5GS1C 5D7IF 4LCUB 1JNLL 1IAMA 3TN0C 4JFOA 3FN3A 5D7SH 5JO5A 1MELA 4Y1AE 1LK3H 2ITDA 4GBXB 3O3DB 3I2CH 1HZHH 4M48L 3N06B 4U6XA 4AQOA 1DLFL 3WJLC 4WI4A 4RMUA 1GCFA 4IRJA 2WUBL 3AFLA 2VJXA 3SDAD 3TCLB 2YOCA 1OAZL 3S35L 2AJYL 3MRQA 1S5IL 5J57B 4JFHE 3TO4D 1VGKA 2X4RB 4TNVK 5SWSE 2R9HD 1N7MH 4HKZB 3T4YA 1G6RL 1A6ZA 2AJUL 2FEDC 4MHHI 4UT9L 5EBLA 2CUMA 1A3QA 4D3CH 5CHNB 3UJJL 5L9DL 1JHTA 5TPWL 3KJ6L 1D5MB 2DMCA 5GGRY 1U8QA 5GSVB 2E9IA 3WFBH 4X7EC 1ADQA 5T5FL 3PNWB 3MV9D 4K94C 3V4UH 3KAAA 4MXWH 3VI4E 4J6RH 4DW2H 5IFJB 4G9FA 4AT6B 4B7LA 3HE6A 3MLUL 3WHE1 2PTTA 4JM4H 4L4VE 4WTXA 2XN9A 3CK0H 2BY1A 2ITDB 1EJOH 1HSAA 2ZOKA 1FYTE 1A7PH 5DJ8A 1CE1H 1KLGB 4U6XB 3C2AH 4MD5A 3U48A 4RFOH 4APQD 5E9DE 3C6LC 4KK8D 3ULVH 5IB5A 2V7HB 2FB4L 1K4CA 2YUZA 1X9QA 3MRQB 5L2KA 2VWEC 3QXAA 3GM8A 1VGKB 3P9LA 4L8CB 5D1ZA 3ARZA 1IL1B 4G8GA 3IU3A 4EEEA 5D6DA 1RUQH 3L7EB 5EUOA 4H88L 1A6WL 3VG0H 2UY7A 3T4YB 4KTYA 4D94A 1A6ZB 5DJAA 4ZFGL 1FNSH 2CKNA 4U0RB 3GHEL 1EGJH 4WHDA 5A16A 4GJTB 1FC2D 1IZJA 5FHAL 3REVA 3SE9L 5HVHC 1W0VB 4NSKA 3UPAA 4EBQL 1UFUA 1E4XL 3DUHA 2O61B 1EJ6A 1J8HE 5AZEL 1I3GH 1DCLA 2EDRA 3HI5H 3HI1A 4EUPG 1DQLL 4XP1L 3QDJA 2D0GA 2DD8H 1X5GA 1IC5L 2ADJB 4G9FB 2IG2L 2A9NL 3HE6B 4DOHE 1X7QA 4GAJH 2CRZA 2WP3T 2F8XC 2XN9B 1CQYA 4WWKD 4N90E 3B9EA 3DBXB 3F7VA 4N9OB 4DVRH 2ZOKB 1HSAB 5DJ8B 3RUGF 4MD5B 2IANE 4P5TD 3EOAA 3DUUA 1NEZA 1RI8A 2FHCA 4JPVL 1CXLA 43CAA 3RUGA 1QBLL 5IB5B 1OARH 1ZVYA 3ABZA 4TSBL 4YQXL 3QXAB 5DJYA 4F7MB 5D1ZB 1RHHA 4A2MA 1INEH 1FORL 3IU3B 1A6UH 2HKFL 5EUOB 5GZND 3OGOE 4B53A 2VB5A 1U8HB 1T6VN 2R1XA 2E27H 1MJ7H 1OAQH 5FYJD 5I1CH 5A16B 1FP5A 2WWKT 4OJFH 1B0GA 4NSKB 4MDIA 5E8NB 2APFA 3ROLA 3KS0H 4NQDA 3EJZC 1EPFA 3HI1B 1PSKH 3QRGH 4JRYD 2C4FU 1UA6L 4HS8H 4Z7VA 3MRMA 2QR0A 4HUKB 1GOGA 3VGBA 4GW4A 1X7QB 4OUUB 1QLRA 2YRZA 2VSCA 3B8YA 3F7VB 3L3JA 3O4LE 3ZYZA 3FN0H 1FNLA 4X5WA 1QFWL 4ZYKA 4KV5F 3UAJD 4RMVA 3WFHA 3T4AA 1A22B 1IVLA 1NEZB 3ARQA 4MD0B 3O0RL 5AYUL 3KXFA 3LVEA 3VGAC 1VA9A 3L1OH 1MAJA 4DTGH 3ZTJH 1IZKA 2PUQT 4AH2B 1OTUD 1TVDA 4AEHL 5DJYB 1RHHB 5CJ8A 4P59L 1OGAD 4XRCA 1NC4D 4UT6H 1NCTA 3ARGA 2V9TA 1IKNA 5K9JL 1HINL 3QUMH 2R1XB 2HVKA 5HDLA 3S6CA 4AJ0A 4M9PA 4BQCA 1B0GB 1RSFA 1AR2A 4OFDA 1ND0A 3RVTC 4MDIB 1OY3B 4IIQC 1H3WM 1FFOB 2BNQB 4OF5A 3ROLB 4FQLH 4MB4A 5ADPH 4ELMF 1J9CT 4Z18A 4W6YB 1MF2H 4Z7VB 2AXGA 3MRMB 1OAXL 2QR0B 5IB2A 3U46A 4ELMA 1WZLA 4GW4B 2XTJD 2IBBA 6FABL 1QLRB 5E4IA 4LLMA 1G0YR 4F8QA 4D9LL 2O5YL 3MRDB 3LEYH 2AEQL 5C0GB 5LWYH 2NY1D 4D8PB 4ZYKB 2B1AH 3T4AB 3V7AE 3EFFA 1IEBB 1LK2B 1DDHA 2O26U 3KXFB 3D0LA 3T2OA 1RMFH 3GSNH 1JPST 1A9BB 2J5LC 1RUAH 2BCKA 1JN6A 1JUFB 1QYGL 5JA9A 3MCLL 3QUZD 3AU1A 1SYSB 1WFUA 4N8PA 4XRCB 1S7RA 5A2LH 3ARGB 3T08A 3S7GA 5F7HA 5IFHL 5MERA 3RZCD 1R24B 2CJUH 4YHYC 3L7FA 3MLRH 1PLGL 5DO2C 1WEJL 1BFSA 4RNRB 4U1SB 2AJ3A 5FUCC 1ND0B 1F3RB 4NO5A 2HJLA 4C59B 2F53E 5ALBL 4ZUTA 1NCAL 3MLTA 1DBMH 1I9EA 3EJJX 4ODXB 4XP5H 5C8JA 4X7SH 1A4KB 1SBBA 1UM5L 2E9JA 1YDPA 1MOEA 5IB2B 3U46B 2BX5A 1GHFH 3CFJB 4K7PH 3RGVA 3G5XA 4LLMB 1SJHA 1LO2H 2M2DA 4Z7WA 4M4PA 2NX5D 2FJGB 2P4AB 1H9VA 1C5DA 2YUWA 1MCPH 5HHOA 4CU7A 1L7IL 3EFFB 4KXZI 4YC2B 2AEWA 3P30L 4NZUH 1I1RA 2OXHA 3D0LB 3L9RA 1ZHKA 3KNBA 4DGIH 4QXWA 2Q20A 3JBG7 2FBJH 1PGRB 4XWGH 1P6AB 1JN6B 5FEBA 1AGCA 3VXME 4WCYH 1QEWA 3AU1B 1DN2A 3ZKQD 1S7RB 3GKWH 5CINH 4U6TA 5MERB 3LPWA 4N0FA 4PRDA 1JZ2A 4OCMC 1U91B 4GS7B 2NR6D 3VD4A 4IEFB 4M1DH 2AJ3B 2OP4H 3ZKND 3C9NA 3VXQA 2HJLB 1UC6A 4OQTH 4ZUTB 2MPAL 3MLTB 3VFOA 1MI5A 4CVXA 1MH5A 1T0NB 4Y5XB 5C8JB 1GPOH 2R2HA 2X4SA 5SWZE 1YDPB 4HHAA 2CDEB 4YDKH 1G7QA 3RGVB 3GB7B 3G5XB 4OLXH 4ONHA 1QBMH 3VA2C 2R29L 4JFFD 4XHQA 5T3ZE 1CDHA 4AEEA 2OI9C 3QDME 2DLGA 4Z7WB 2BVQB 2ENSA 5C0IA 1C5DB 5HHOB 2LAGB 4NHUA 2CUIA 2VDKH 4EDXB 5C0RL 4ZD3H 1GAFH 2XA3A 3VD9A 3E8UH 2FJHA 3L9RB 4I77H 4XAKE 4OCRH 4HV8A 3UTSA 1KIRA 1NGZA 4DKFL 1AGCB 4DK3A 1NGPL 1DANU 1QEWB 5GGTH 3I85A 2B1HL 1L7TH 4XPFL 1LO3L 3WFZA 1PVHA 4N0FB 1FE8L 2GKIA 1T2QL 1ACYL 5DVKA 4MXQD 1FZOB 4FABH 1HHJB 5EFIA 4IDJL 3C60A 1J0HA 4PYHA 1TENA 2PYEA 3C9NB 2LU7A 1VFOA 4NRXA 4NP4L 4GRWH 3VFOB 2VLRB 1MI5B 2Z93A 4JDVA 4CVXB 1MH5B 2XQYG 4Y16B 3WXWH 2R2HB 2J8UE 3QPQC 4NPYA 4FG6C 3EIFA 1Y6MR 2DB8A 4WUUA 4Y5YC 1WZMA 2Q8AL 5HDBE 3KVQA 1RJCA 4Y4FA 5J11C 5D72L 4LSRL 3KPRE 4K3HA 4NZTL 3O6FA 4P4RA 1NPUA 4LSUL 4NBXB 2JK5A 1QOKA 1F13A 5C0AD 2QSTA 1SVCP 1DLFH 4IMLB 5I15L 1MEXL 3OQ3B 4P4KC 2FJHB 2B0SL 3FQNA 5CZXC 4JGJA 3WEXB 2NTSP 2WUBH 1U3ZA 1KB5H 1EZVY 2UWEB 3OZ9L 3RY5A 3UTSB 1OAZH 1KIRB 1NGZB 2AJYH 1S5IH 5MEPA 1OT1A 1QR4A 1LEKA 1DLHA 5DQDL 5C09E 2UV3A 2AJUH 4UT9H 1CD1A 3H3BC 5EFIB 2I9LB 3UTZA 3C60B 4KXZH 3IDYC 1JPFA 3MBEC 1TCMA 1OM3H 2YD6A 1X5LA 3UJJH 4XBEL 4NRXB 5L9DH 5TPWH 3KJ6H 2NNAA 3AXLA 1Q9LA 3VH8G 5IEKA 4NCDA 2KBGA 5T5FH 3A6CH 1J87A 4DGVL 4XXDB 2ZWLT 1FO0A 4WUUB 3EJYC 4U1GC 1U6AL 1HDMA 5D6CA 4CADA 5F9AC 3MLUH 4QRPB 3FOMB 4WY7L 1HHGA 2G75B 2EDQA 4MJIA 5HI5D 5J8OA 1CWVA 4TULL 4P4RB 1JMZA 3O6FB 3FFCD 3MCG1 4PRHA 2P5ED 1T7XA 2JK5B 2YKLH 1WCQA 4HWBL 1G7LA 5LVEA 5DJ0A 5IBUB 3CFDB 1MPAL 3FQNB 4NQCD 3F62A 3QQ4A 5C3TA 4RGOH 1BPVA 2QHRH 4OZHB 1T6WA 2FB4H 2LU3A 1FRGL 4UQ2A 4FQQA 3RVXC 3EOYG 3FN9A 1EK3A 1GL4B 3FRUA 2V17H 2NY6B 1BREA 5JXED 4MNQD 1A6WH 1KEMH 2EE6A 5FDYA 4ZFGH 4GUPB 3UTZB 3QHFL 1QSED 1JPTL 3BP5B 4WHYH 3T3PF 1FFPA 1Q0XL 1A1NA 3LN4A 5FHAH 3ARWA 1FG9C 4JCMA 4EBQH 3AXLB 4KTDL 1E4XH 1Q9LB 3JZ7A 5HVFB 1BJ1J 2OS7A 5F7KC 4H20L 4XNQA 1BF2A 2YD4A 3B2UC 1DQLH 4XP1H 4M6NL 3S5LA 4UAOB 1FO0B 4OFYD 2EDNA 1K4DA 5EH1A 1IC5H 2IG2H 1EXUA 4F37F 5FA3A 4M7KL 2D9CA 1I8IA 3VRLE 2GTZA 3WNLA 3QJHB 2JF1A 4PRHB 3QXDB 2PW2A 3CFCL 3O3AA 3CFEA 4FXLA 1G7LB 4G3YL 1DBBL 4IRJC 1FG2A 4M6OL 2ATPB 4PV9A 5CSGA 3VFMA 1FZMA 5DRZA 4I0PC 3GI8L 4JPVH 3QQ4B 4AIZA 1FIGL 1QBLH 5H94A 4TSBH 4YQXH 1TQBB 4UQ2B 4FQQB 4UV7L 5CFHA 3FRUB 1HIMH 1FORH 1A2YA 1FH5L 2HKFH 4U0RC 2EDOA 5KOVC 1BM3L 1JTOA 3JWDL 1H3PL 1ADQH 4FFYL 3LN4B 1A1NB 5CMAB 1FO0L 2Z8WC 4XPGL 5ICZA 2LVEA 4C57C 1BWMA 5KG9A 5FCUL 5CUSH 2G5BB 2PNDA 4R96B 1UA6H 5HHME 4DFIA 1K4DB 1KTDA 5JW3L 1EXUB 5FA3B 5MP6L 1I8IB 1WGOA 3CU1A 4KRPD 2E6PA 3DVFA 4X6FA 1PYWB 3QEHA 2PW2B 3O3AB 3CFEB 2UY6A 1MFEH 3UX9B 3MV7D 1N5YL 4PV9B 1FCCA 1FZMB 5DRZB 3HN3A 5AYUH 4AIZB 4HLJA 3MLWL 3G6DL 4P23A 3VFVB 3TH4T 3VFWA 3CLEH 3IFNL 1LILA 1QR1A 5D6DC 3WFDL 3T0DA 4P59H 5IB4B 1FGNL 2QADB 4PJFA 4ETYA 1KIPA 5GGQL 2C3WA 1EFXD 3KWWB 4R2GD 1JWUB 2QQLL 3RI5K 1UEMA 3FONA 1CGSL 4XNMB 3IAGC 4Y4HA 5ICZB 2M8XA 4HLZG 4I48A 1E27A 3TLRA 1CU4L 3ARDD 3OJ2C 5IW3A 1OAXH 1JNNL 5CJXC 3WNKA 5MHSE 3U0PA 4OF3A 1KTDB 3ZSTA 6FABH 1ETZA 5EB9A 4D9LH 2O5YH 1OD7A 1QLEL 1U93A 1FV1A 5A1AA 5LGHL 4JQIH 4X6FB 2WBKA 1CZ8L 3QEHB 5LG1A 2ICWJ 4FP8H 4J1UA 4H1LG 4NNPL 5CBEA 2EC8A 2EXWD 3D6GA 3EYUH 2ERJB 3GMQA 3IDUA 4K94L 4RAUB 4YHNA 5HGDA 1JL8A 5DHVA 3DVGA 4ZNCD 1HE7A 4XP6L 3VFWB 4GMSL 4WNQA 5DHYB 4QKXB 1QR1B 4L3CB 4K8RD 1QYGH 1PQZB 2VLKB 3MCLH 5DA0B 3D3VE 1D7FA 5K59E 4PJFB 5IFHH 1KIPB 3VWKC 1FAIL 3FONB 3LOWA 3B9AA 1ZLUH 7CGTA 5ALBH 3TH2T 4HFWA 2A74A 1NCAH 3HAEG 3WUZA 4I3SH 4K71C 1T1YA 4D9RD 1UJTA 1UM5H 4XHJC 4RMSA 4YDLC 4NGHH 4OAWA 3FHAA 1ETZB 5I1HH 1V7MH 1EIBA 3OKKA 4PRBA 2MMXA 4MNHA 3OAYK 5C0JA 3BPLC 2DLEA 3CFIC 5KANI 4U1JA 4Y8DC 1OQXA 3GMQB 3CPLA 1TLKA 1L7IH 1B88A 4Z6AT 1GJIA 1L6ZA 5DHVB 3P30H 3DVGB 1NGQH 3VCLA 1VGEL 2IADA 5T1KA 1ZLVH 1CFBA 3VE0B 4AG4H 4KQ4H 2PO6A 2XG4A 3B83A 4N9GA 4QXUH 4U3HA 4CNIB 3O6KL 1JI2A 4LSVH 3PGCA 4NQUA 2NYYC 4XVUD 5HHNA 3FT2A 4EUPA 4G6FB 1B0WA 4L1HA 1W0YT 1PG7H 1Q9KB 4F80A 1HSBA 2APBA 3BGMA 5EUOE 1I8MB 4HFWB 2A74B 4E41E 5JOPE 3ULSA 4MQXD 2H6PA 1FSKC 5BQ7A 1JHLL 3V6OA 3T0EA 1J18A 4P46C 1GSMA 3RWIA 3HE7A 3DV4B 3GMPA 4OAWB 3CDGA 4HQQL 1DQTA 4EKXA 3OKKB 4NKDB 5C0BB 5FKPA 5C0EA 1UH2A 3ARPA 3QNXA 5C0JB 3L3KA 5CLTA 4QHKI 4YC2C 3HB3D 4U1JB 1G9MC 3K1DA 5ERWB 1OQOA 4DZBA 2H3NA 5C0RH 1MCLA 4FN0A 1MCKA 3KPPA 3VCLB 1MFDL 4XP9L 5T1KB 5I75B 2PO6B 2R0ZH 5EBMA 4N9GB 5E6ID 1N2RA 4DKFH 2DLFL 4JVUA 2OSLB 1NGPH 4XPFH 5HHNB 5HJ3A 3FT2B 5GZOC 1FE8H 5F1NA 5FYKU 1T2QH 2GIYA 4GAGL 4YHLH 4IDJH 1HSBB 3DX6A 1YJDC 2B5IC 1CN4A 3TA3D 4JN2B 3BGMB 3DIFA 1AXIB 4ISVA 3SBWC 3ULSB 3MNWA 2H6PB 2WBWB 1NGXA 5BQ7B 3UXFA 1V3LA 1QRKA 3T0EB 2Y5EA 3VMPA 3RWIB 2BNQE 3GMPB 2Q8AH 4JFPA 1I9JL 3BGAA 1BZ9A 2DQCL 4O58H 4N8VB 4YHPA 1BQUA 5D72H 5BW7C 1YN7A 3QNXB 4LSRH 4NZTH 3L3KB 2PW1A 1G7PA 2JJWA 1NDGA 4G8IA 4WU7A 4ODTH 1VHPA 4DZBB 5JW4M 1MEXH 1BBJA 3KPPB 2B0SH 1HKFA 3NA9L 4YE4H 4PGBA 3IKCA 1IFHL 5M95B 1N2RB 4OIIH 1ITCA 1HHIB 3MOBL 4JDZB 3Q6FA 4ZFZB 5I0ZA 1I3RA 4HGMA 5DQDH 2NZ9D 1HK6A 5F1NB 3EFDL 4OCYL 3DX6B 3KR3H 4HUWB 2HP4A 2WM0A 4XBEH 1T03H 4X4ME 4ISVB 4OCLC 3EO9L 1BQHG 5CLWA 3UYOD 3FB8A 1NGXB 3SDAA 1VACA 4OB5L 4LHQB 1QUNA 5C71A 3TO4A 4DGVH 4GG6E 1J11A 3FB7A 3MRLA 4PJHE 3K1KC 3RTQD 4KZDL 3ZLQC 3S8WA 2D03H 2NY0C 4V1DD 2AJVH 1U6AH 5EIIA 5F6IB 4JFPB 4LPTA 5DD5L 4YHPB 1QQDA 4WY7H 4N0UA 3BN9D 5DT1L 4UNUA 1YN7B 4FFWD 1YPZE 4TULH 3TBVA 2B4CC 1G7PB 2NLJB 3C5JA 4G8IB 2ADGA 2HFEA 3DTXA 3GSQB 5J6GA 2P7TA 5C0CE 3H7LA 3MLVL 3MV9A 1I4FB 4FXGA 1BBJB 5GIRB 1MPAH 4FFVD 1DBAL 4PGBB 4LPXA 3IKCB 2KZWA 3LKSA 3GFUA 1FRGH 4F15B 4RISH 4QNPF 4HK3N 1I3RB 1NMCB 3UDWA 4U0QB 4ZAKC 5T5NG 1GGUA 4GMTL 2HVJB 4HH8A 1IC7H 3CXHK 4H5SA 3QHFH 1JPTH 1Y0LA 3OPZL 1L0XA 3ZHKA 4APQA 1U8KA 1FVDA 1MCFA 3FB8B 4S2SA 3SDAB 1VACB 3C5SA 3TO4B 4Z76A 3MRLB 4M6NH 3FOLB 3WJJA 1T83A 2AV1A 3EKCA 4MJ2A 3RHWF 1NCBL 4Y4FC 1BZQK 1ACZA 3G6AA 4EXKA 5EPMA 2RIKA 4YDIL 4M7KH 1QQDB 4N0UB 1VCAA 3QIWD 5FYJU 3TBVB 5HPOA 4KHXH 1NKRA 3D39D 3Q6GH 3VXOB 3CFCH 2ADGB 3DTXB 4G3YH 2KL6A 4HAFA 1DBBH 4M6OH 1EEZA 3MV9B 4MNGA 4RAVA 2APVA 4P57A 4WJ5A 2J88L 3WNPA 5EC2B 1FIGH 2W9DL 5FYKL 4KVNL 4LCWB 4ODVL 4UIMA 3E6FA 4JM2F 3LKSB 2MWCA 1SEQL 3L3GA 4OI8A 1WAAE 4PJDE 4WWKA 3SO5A 3VGHA 4ONFL 3TP4A 1P4BL 1FH5H 3IDIA 1BM3H 4H5SB 2J8HA 3O4OB 3RJQB 3NBNA 3V0AC 3JWDH 4P5TA 1H3PH 4LVEA 2NW3B 3O2VL 3ZTNL 4FFYH 4QRSA 4APQB 1N6QL 1U8KB 4Q9QL 3O8XD 4NC2B 1FVDB 4PJ5D 1FO0H 5E8DL 4AZ8A 4GAFB 3VGFA 5F9WB 3MREA 1FPTL 3ZZ1A 3QWQB 5B4MC 1K8IA 5FCUH 4Z76B 4NNYA 1VKXB 2BNRD 2VLRE 3ZE2E 5SWQA 4P3DA 3WIHA 3G6AB 1H3XA 4FXKA 4OTXL 2XY2A 4D0BA 4MWFA 5KVDL 4XC1L 1K8DA 2FGWL 5FUOH 1DL7L 2ZUXA 4S11A 1EEZB 4MNGB 1N5YH 4RAVB 1JYVA 4JRYA 4P57B 1GZQB 3RFZC 4WJ5B 4NM8L 3P4MA 1AFVH 2Y5TB 1RJLA 3G6DH 3MLWH 3E6FB 3OG6B 3L3GB 4WWKB 5JHLL 4IM8A 3WFDH 2YRLA 2WW8A 3VRIB 1I3VA 4ACPA 1ZHLA 2X44D 2UWEE 4K55A 2Y7QA 4BQ8A 5GGQH 5INDA 4ZO6A 1DVFC 2JB6B 4Q2ZA 2KUTA 4P5TB 1ZA6A 5GS0H 1S7QA 4YXHL 4QRSB 4ZPTB 3X12A 1W8OA 1CGSH 4RGMB 3MREB 3HR5A 4J3UA 1X3DA 3WUWA 4NNYB 1CR9L 3GJFA 1U8OA 4HIEA 3GSXA 1OGAA 4I5BA 1NC4A 2FH6A 4G6KL 1G1CA 5SWQB 4P3DB 1U92B 3UTQA 5TF1L 4HPYL 3VRJB 1WBZA 4PGEB 3CXDL 1QLEH 4FQCH 3PG2A 5ESVA 4D0BB 5LGHH 4FTVB 3S97C 5ABDE 1K8DB 4JREC 4CL7A 5T3XL 3UO1L 1G84A 5KSBE 1FLRL 4QRPE 4PLJC 5KN5B 4NNPH 4D9QE 1BAFL 3SKJL 3BH9B 4JRYB 4HKJA 1KGCD 3P4MB 1FYHB 1RJLB 4XP6H 4GMSH 2HT4C 4HJGA 1JGLL 2BOCA 3HZKA 5HHQA 1LDSA 3GBLA 5E5UB 1AE6H 3HUJE 1Q72L 4OCWH 3ZDYE 3O2DA 1ZHLB 4OZHE 2Y7QB 3LHPL 1FAIH 2W0FA 4Q2ZB 1ZA6B 4LRIA 4X99B 2DTML 2WUCH 1PJ9A 3MXWL 2BVUA 5H2BA 5CD3A 2Z31C 4NKQB 5AWNL 3HR5B 1CGVA 3E6HA 3WUWB 4Y1AD 4HS3A 3GJFB 2WQRA 5FYJL 4GAYA 1U8OB 3QUZA 2W0PA 3GSXB 4Z78A 4ZOCA 3KLHC 1OGAB 4I5BB 1NC4B 4U6YB 4XVJL 3MRBA 2NY3D 3LY6A 3RZCA 3UTQB 1ONQB 1Y18A 5I8OL 4G7YL 4LGRB 2RCSH 2DM4A 3PXJA 5E2VL 5J13B 1D3CA 5L88L 4P5MA 4BYHA 5DWUL 2ERJC 1TVHA 4N8CL 4JFHD 4O4YL 3LQAC 1HNGA 5SWSD 2I07B 4P23C 2NY5L 4IOFC 2YRPA 1YEKL 1VGEH 5DTFA 5CSBA 2XTJB 4HJGB 3W9EA 1VFBA 3M1BA 4EVNA 3O6KH 3BZ4A 4KJWD 4RCAA 2BY0A 2NX5A 4OFPA 4Y4KD 5KSAD 2WZPD 2NY1B 4M5YL 1LEGA 2W0FB 1XIWC 3PDOB 4PJIE 4JHWH 4Y4HC 1F5WA 5H2BB 3G9AB 3I9GL 5I73C 5CD3B 4L4VD 2A9ML 3P2TA 3E6HB 1CDUA 1NMBL 3K8KA 2B39A 1FYTD 3PV6A 3QUZB 4Z78B 4X4XA 2VDNL 2CDGB 4NQSB 3SKMA 3FAWA 5E99L 3RZCB 3WO4B 4HQQH 3TH3T 4OI7A 2WLZA 2AKRA 5C92A 5E9DD 1MAML 5DD3L 2V5SA 2YSSA 4P5MB 1UXWA 1CDCA 1TVHB 3U7AA 5F71A 1UQSA 4YEFA 3Q2CA 1H3UA 3GSRA 2IAMD 2J8OA 4KI1A 3NVQA 3Q3GA 3FZUC 4HD9A 2KKQA 3O2DL 4UBDC 1II4E 3TBSB 1VFBB 2LABA 3M1BB 3G9VA 4EDWH 3BZ4B 4JFFA 2AGJL 4I2XA 2CQVA 4DCQA 4NRYB 3SCMD 1J8HD 5IM7B 4KJYA 4F9PA 1LEGB 1JF1A 4FS0A 4WGVB 1YEDB 4WI5A 1LWRA 4BSVA 4HT1L 4L9LA 2FIKA 4U2ZA 1IC4L 1JV5B 5IBLC 2EDXA 3D48R 4HXBL 4QXTA 1X4ZA 1MCDA 5BMFL 4N90D 4YHZL 3NTCL 4WO4B 3DRQA 4MXVF 5DFWH 3NFSL 4X4XB 1N4XL 3SKMB 2IAND 4WV1A 4QTIL 1I9JH 1XCQA 2AKRB 3SDCD 2YSSB 3QCVL 3A6BL 1UXWB 5CZVL 1UZ6F 2VWEE 1UWEL 2V5RA 1B6UA 4K3EH 3UPRA 3QHTC 5EOCL 1KXTB 3MROA 4NQVA 4PB0L 1RV6X 25C8L 3GSRB 2C3XA 4J7RA 5DMGD 3NA9H 2R39A 4HSQA 1UM4L 2E6JA 2G9HB 1KJVA 4PIRF 1TZHA 1QACA 4JFFB 4I2XB 3TCXA 5H37H 8FABB 3MOBH 1V5JA 5IMKA 4HH9A 1NCDL 1O0VA 2Y07L 3P77A 5C0AA 3O3BA 2Y1VA 2VLKE 4BSVB 4L9LB 2FIKB 1D5ZA 3QJFA 5D2LE 3L5HA 4Y2OA 3S4SG 1N8ZB 1QTYT 3G04A 4YFDB 3S37L 3DROA 4OB5H 2BXZA 3DRQB 3LV3B 5ACZA 3HE7C 4LSSL 3MYJA 3O4LD 3VFGL 3C8HA 3CXHJ 3SQOH 1BBDL 5D1XB 4PJBF 4S1QL 4MAYD 5IK3A 1BIHA 4WV1B 1XCQB 4KTEL 5AEAA 4JO3L 1WISA 4K2UL 5DD5H 5DT1H 4K7PY 3K8LA 2PXYD 5HYFA 3RKDD 3UPRB 2V2WA 1KTRL 4NQVB 5F3BA 2YEZA 2DQHL 2WK2A 3KPOA 1I7RB 4URTB 1DBAH 1F3DH 4LFHG 1J1XH 3KS0J 1IM9D 4TNVF 5K9KA 5IMKB 2P44B 1T89C 3FFCA 4GMTH 2P5EA 8CGTA 4OUOA 1T7VA 4U3CA 3MMEA 1XT5A 4FZEL 5C0AB 3O3BB 1T2XA 5IW1A 3U0WH 1D5ZB 3QJFB 4QXGL 5D93B 5DZNA 4EI6A 5IVXE 4NQCA 2WWMD 3QI9C 4GQPH 3MGOA 3DECA 2XYCA 3WLWC 1VADA 3DROB 1CFQA 2IALA 2P1YA 1FZKA 5ACZB 1AP2B 3R4DA 3K0WA 3MYJB 3OKNB 4HUNB 4OLYL 3ZE0E 5JXEA 4MNQA 2X9YA 1NCBH 3SDXA 1C1EL 2IH1A 3CMGA 4YDIH 1QSEA 4R7DA 3V4VL 4A2LA 4MJ6A 3R1GL 4P2OC 1NUNB 1QG3A 5EUKA 2R15A 5F3BB 3GJEA 2H2SC 4EN3C 4X6DA 3OB8A 1U8LA 2DMKA 2DQDH 5C0BE 1T66C 1OOAA 1NL0H 3KPOB 2X4TB 5KW9L 2J88H 3SGKC 4L3EB 2W9DH 4OFYA 4KVNH 1NAKL 2I5YL 3ISWA 1I8KA 1E6OL 1SEQH 2F53D 1MSPA 4HGWB 4J3SA 5C0NC 1TTFA 4ONFH 5F70A 3ZYIA 4PJEF 1TITA 4PJ9C 2P5EB 1G9ML 5LQBL 3MMEB 3HC3L 3HMXL 2IF7A 5I8EB 5IW1B 1N0XL 4KH2A 3K81A 1SHMA 4PJEA 2Q7YA 3ZTNH 1N6QH 4EI6B 4R26L 3U30C 4NQCB 4Q9QH 3V5KA 1KPVA 2JLLA 5IT2L 3MGOB 5E8DH 1VADB 2B20A 2MKLC 3BUYB 1CFQB 2IALB 1FPTH 1FZKB 2R56H 3ZHLA 3RVWD 5ITBH 5I8EA 3FQWA 1YY9D 4MNQB 1S9VA 3SDXB 2GI7A 1C16A 3RAJL 1XF2A 2HYMA 1QSEB 3OKYA 5B8CC 5I1KL 4OTXH 4NIKB 2GK0A 4MJ6B 3MJ9A 3A6OA 3WFCH 3N1PC 5EUKB 2FGWH 3VXMD 3GJEB 4X6DB 2EXYC 3NFNA 1U8LB 2X05A 1RZ7H 1DL7H 1NFDE 1S7UB 4FFZL 1D6VL 2K7QA 4NM8H 5FUCE 3VI3F 1UEYA 3G6JE 5H8DA 3PP4H 4M62L 3HNSL 1I8KB 4KROD 3OGCA 2W65A 4JKPL 4OD3H 2WSKA 5JLZA 1XGQB 3K7UA 5SWZD 3MV7A 4PJEB 4KZEL 2W0KA 4KK8C 2Q7YB 4YXHH 3VDCA 1FFRA 1P5VA 4XWOD 1ZT1A 3V5KB 3I3EA 4R3SA 4ZFOA 4I0CC 5T3ZD 2AEPL 2YUVA 3QDMD 4JPIB 3WJJC 2NY4C 1EVTC 4OLEA 2LFGA 1CR9H 3FQWB 2HJFB 1S9VB 2UYLA 4G6KH 3UTTD 5FYLL 4IMKA 1EO5A 5TF1H 3Q5YA 5C2UB 5IVZA 2GK0B 3OKMA 4XAKD 5EO0A 1U3YA 3JXAA 3CX2A 5DEZA 4IS6A 1FLRH 1OT2A 3LKNA 3PWJA 4ODHL 2ARWA 3SKJH 3IJSA 3GBNL 5EULV 4TTGA 1RZFL 4M7LH 1JGLH 3OGCB 2W65B 3D85D 1A6TA 5IROC 4JM2C 5F7LB 5JLZB 1BQHA 4I8DA 4Y8AA 2B4CL 4KRPB 3CSYA 3FTGB 4KJPC 4X9FA 3MV7B 5F96L 2DTMH 1VESA 3BMVA 5FYKE 4K3DL 4Z7UE 3ZO0A 2CH8A 1ZT1B 4R3SB 4KK6D 4ZFOB 5D5MA 12E8H 3QB7C 4RFEA 3WIFA 3VXUE 4DKDC 1GOHA 3IDMA 3WIHH 1QBAA 3KPRD 5GZNC 1CXFA 5FYJH 3DHJA 1ZGLM 1BD2E 1S7VA 5DRWA 1ZSDA 4HFUL 4XVJH 2UYLB 1DE4B 4H8WC 1YEGH 5J3HC 1N5AA 1EFXB 4JZJB 4PLOB 1BIIA 4R2GB 1JGEB 3OKMB 5EO0B 5T5NF 1FBIL 3QWRD 5L88H 5BJTA 5DWUH 4IS6B 4N8CH 3PWJB 1RFDL 5J89A 1Z9OA 5C09D 3ARDB 2NY5H 3SE8H 5AG8A 4JY4A 3IU4H 1MQKH 3IJSB 1X5IA 5T1MA 4XTRD 5C1MB 1YEKH 5EO9A 3H6JA 3U2SA 1MCNA 3WIIL 4YBLB 1A6TB 1OWWA 4LKCA 3E2HC 3EYSL 4UDTA 4POYA 4G8EB 4HZLA 4QO1A 1DR9A 2XT1B 4LCWE 4OZIF 4MQSB 2V7NB 4M5YH 1Z5LA 1E6JL 1TTGA 1IAIL 3KPTA 3QUYC 3MRFA 5A3ID 1GGIL 2CUHA 3ALWA 3PHOB 3GJFH 1CGWA 2VYRE 5D5MB 1MAKA 5IKCA 1MHEA 3WIFB 4RFEB 2A9MH 4HULB 3NCEB 1IGJA 3EO1A 4KVCL 4J3VA 1NMBH 5IB1B 1S7VB 5DRWB 2H26A 2VDNH 3NIDF 4MA8L 1HHHA 4H0IA 5E99H 1KTLB 1N5AB 1S7XA 4GRLB 5C6WH 1RAMA 1EHLH 1BIIB 1MAMH 4N0CD 1W8NA 4KKCD 5DD3H 5BJTB 2UZIL 4WFEE 4YHML 4JQVA 3HNTL 3ULUF 1CG9A 1UT9A 2NY2C 4TSCL 3U2SB 3O2DH 4JDTL 5GJTH 4LKCB 1P5UA 1XGUB 4UDTB 4QRUA 2JCCF 3QP3A 1TNMA 2AGJH 5T3XE 1QLFA 3GRWL 3IETA 3PV7A 3X11A 5BV7C 1I8LA 4ZS7L 2JCCA 1Z5LB 2VZSA 1IAKB 4PY7B 4OKDA 3MACH 2CK0L 4HT1H 1U3JA 3LKQA 4MHHG 1ED3A 2Y4SA 3QAZC 5JDJA 4HXBH 3N1MC 1CVRA 5IKCB 1MHEB 5IG7B 3TV3L 3GMOA 4P9HC 2BSED 1J0YA 1IGJB 3EO1B 5E6IA 3NTCH 3HZVA 5DVLA 5CZKA 2H26B 3NFSH 1N4XH 1G7IB 3VFUA 1CTNA 4QTIH 2HRLA 3V6ZA 4K9EL 1XCTA 5C07E 3TA3A 3ZTJG 3A6BH 5CZVH 1S8DA 1U8PB 5EOCH 1M05A 5KJRL 1T5XA 25C8H 4OLUH 1A7NL 3FRPA 4FTVE 2DWEA 3NGBC 5EU3A 2FR4B 1CG9B 2I9TB 4HKBA 3IXTB 2XWTB 3M8OH 5C6TL 4HUMB 1AKJD 4PTUB 4LCCC 3TJHC 4XCCL 1QLFB 4OLWL 5D2NA 2DS4A 4LP4A 3O2WH 5E56A 3IETB 2YPLB 2YK1L 5KVEH 2Y07H 5EZJA 2HJKB 2IFGA 2E7CA 1FL3A 4R90L 5HHMD 4QEGA 3LKQB 3QUKA 1JTTA 1XMWA 4DKAA 1M4KA 5F1OB 5D7IE 1BOGA 4WDIA 3GMOB 3S37H 4M9OA 2E7BA 1ROWA 2R1YA 3VFGH 3BGFC 2CSPA 1BBDH 2P5WB 4S1QH 1CLCA 3V6ZB 1P4IL 1XCTB 4K2UH 1IKFL 2Q6WA 2VUYA 3F65A 3X3FL 1M05B 1RD6A 3QCUL 3LSOA 4QF1B 2DQHH 1LNUA 2DWEB 1BLNA 4S1DD 4GW1B 4BJLA 1IGCL 3RTQA 4HKBB 3WFEL 1QFWM 1FNHA 4XXCA 5GXBB 4XNZB 3PDGA 1KACB 4S1SL 4TQEH 4V1DA 5E00A 3SE4C 4ZXBB 2X70A 5D2NB 3MRIA 4FQHA 1T4KA 4F9PC 3BAEH 4MVBD 4XNXL 3RWCA 3OR7A 3LPGA 4UINL 2FLBT 2YD3A 1FL3B 4QXGH 3QUKB 3SDYL 4ZNEE 2QQNH 4Z95L 1A1MB 1BOGB 3PIQA 4WDIB 2CXGA 2HWZH 3MRPA 1NGWA 1IQDB 3P40A 4HEPG 4ZQKB 2R1YB 5ANMA 2JJVA 4U1IB 4ZPVA 4OLYH 1KBGL 4KKLD 4LL9A 3UYPA 4FA8A 1WICA 3QG6A 1C1EH 1VPOL 5DFVD 1XGRA 1INDL 1ZT4A 3R1GH 2Q6WB 5I17A 3MRNA 4Z77A 3WLBB 1TQCC 3LSOB 2FX9L 1EEQA 3D3VD 4XI5C 5I2IA 1LNUB 4KUZL 1BLNB 1XF4A 5J0BA 5FUZL 5KW9H 3C08L 5E00B 3EBAA 1ZK9A 5KS9B 1NAKH 2I5YH 2X70B 1E6OH 3IF1A 3BZDA 1QSFE 1G7MA 3MRIB 1NFIA 1T4KB 2I24N 3RWCB 2VAJA 4RBPH 3D39A 3A67L 5LQBH 4E42B 43C9A 4NBYB 5D93C 3HC3H 4YBHA 3HS0A 1N0XH 4JB9H 5HYSG 4LMQE 4R26H 2B8OT 3LRGA 3T0VA 3PIQB 4TUJB 5I16A 1IEHA 5IT2H 3QA3A 1NGWB 2YD9A 4YZFE 1ZMYA 1X4YA 4ZPVB 4QLRA 3VXPA 2UVFA 2A6DA 2MQ0A 1S9KC 1OW0A 1L4IA 3QG6B 1HQ4A 3RAJH 1XGRB 5I1KH 1Q8MA 3W9DA 4C56D 4LVHB 4YEEA 5I17B 3MRNB 3O8XA 4PJ5A 4Z77B 5I1DA 2D4FA 1YA5A 4OD1L 2V5TA 3I50L 2ZSVA 5I2IB 4WGWB 1KLUB 2VDPL 1IAII 3V8OA 1UKSA 2BNRA 1QRNB 4FFZH 1D6VH 1WFOA 2OZ4L 3HNSH 3O45B 4R7NB 4JKPH 3IF1B 4XMLL 3QIWB 1NFIB 4E41D 5JOPD 5LKNA 3C87A 2VTFA 4NN5C 4W4OA 5FOJA 1OTTD 43C9B 1T04A 3T65A 4YFLI 3HS0B 1B6DA 4OT1H 4KZEH 2EDYA 3D5OF 5ID0A 5F89B 3ETBF 2YPKA 5F9DC 4YIQA 3QA3B 2ATKA 1AGFA 4Z7OE 2A6DB 1DUZA 1EEYA 4BM7A 4Q9RL 5GS2H 4KY1L 3LMJL 4NN7C 5E0QA 4RX4D 5FYLH 4KV5E 1HQ4B 3UJTL 4PG9B 2YXFA 1A21A 1CDIA 3HA0A 2EIBA 3BFOA 3W9DB 4UB0L 3O8XB 4PJ5B 5I1DB 2JJSA 4S10A 1O7VA 1FVCB 2ZSVB 4ODHH 3F7YA 4BZ2L 2E7LC 2BNRB 1HN1A 1SM3L 2HG5B 1BOYA 4Y5VA 3U36A 3GBNH 1NBZB 1QHPA 2K7PA 4NQXA 3G5YA 5ACMA 3S4SA 2V6HA 2D2OA 3NN8A 3QEUA 1KCRH 2CIKA 3CSBA 4LHUD 3I6LE 1F6FB 4JRWA 3AC0A 5E4EB 5I9QB 3BRGC 4FQXD 3T65B 2ZKHL 4AY0A 2BNQD 3BRFA 3FO9A 5ID0B 4K3DH 1XGPA 2YPKB 2HLAA 3ZT6A 2HFGL 4PFEA 2EKJA 4PR5A 1P9MC 1TIUA 4AENB 2ATKB 1AGFB 3LKRA 4NKOA 2VKWA 1IGML 1DUZB 2KH2B 1EEYB 4LSTL 4UU9A 4BUGA 5IF0A 3DO7A 4PJ8D 2DQGL 3QQ3A 3VGDA 5BRZA 5TQ2L 2B7DT 5D8JL 1G0XA 1FBIH 4HWZA 3F5WA 3F7PC 1MRDL 3T0WA 3OTTA 1RFDH 3DV6A 3F7YB 3PGFL 2OR9L 4Y1AA 3S96A 2L0DA 4QRRE 3BQUD 5JPNA 4UDUA 4Y5VB 3U36B 4Y89A 3MLYL 3JWOC 3G5YB 1QFPA 3QWOA 3S4SB 4HPOL 4WHYG 3LRHA 3EYSH 3LD8B 3SJVB 4L3EE 3QIUB 4ODUA 3UZQA 4Y19B 2CRIA 1NDMA 2D7PA 1E6JH 1IAIH 5SWSA 1IMHC 1U8JA 1XGPB 2HLAB 5JW5B 5C08B 2FZ3A 3LKRB 2DKSA 4KKNA 2FHBA 4NKOB 1U95A 4IMKC 5IF0B 3DXAE 3DO7B 4LF3B 4Y4KA 5BS0E 5KSAA 2DL9A 3QQ3B 4OKVA 4AMKL 5C0CD 4YXLL 1S5HB 1QKZL 4GRMA 4Y2DD 4JN1L 1KIQA 4EXPX 4ZDHB 3M07A 2UZIH 5DD0H 1S9XA 4N5ED 4YHMH 5JW4N 2R4RL 4NJAL 4L4VA 3HNTH 1S7WA 3AS0A 3DV6B 4Y1AB 3S96B 3OBAA 1FYTA 3W11C 4UDUB 4ZS6D 1X6NA 5FYLE 1MCWW 2Q3ZA 3E3QC 4LKXA 5IIEA 4TSCH 2NY3B 1OPGL 4U1HA 3OX8B 3QWOB 4HC1A 4X6DE 1A6AA 1JZ8A 2CR3A 4JQXA 2QLVB 5E9DA 5JIPA 3STZA 1C5CL 4KKBD 2CKBA 3BPNC 5I76B 3EOBA 2EXWC 1EV2E 4ZS7H 1NDMB 4PGZA 3TBYA 4OGZA 1H5BA 5BVPL 1UZ8A 4I13B 2IAMA 1EHNA 4K8RH 5IQ7L 2AQ3A 5KAQG 1KIUA 1INQB 1U8MA 1RU9L 5DK2B 3RDTD 5FGCE 3JV6A 1VEOA 3MA7B 3KYNA 2Z92A 3TIDA 1J1OL 3Q5TA 1J8HA 3UMTA 4Y4KB 4PD4J 1JTPA 5J9PA 5KSAB 4OKVB 5IW6B 1Z0NA 3WHXA 4GRMB 1KIQB 4K9EH 2VLLB 1OLLA 2ED9A 1S9XB 4QHKJ 5TQ0L 4LIQL 3QT2A 4M1CD 5KJRH 5I18L 3OAZH 1S7WB 3QFJE 4F33B 4XC3L 4ORGB 2D9QB 1A7NH 1K3ZA 1YN6A 4LLDB 3IRZA 1FYTB 3P11L 3V5HA 3QEQE 1GRWA 5IIEB 3FJTA 5E08H 2LV4A 2IANA 3BKML 2HH0H 4U1HB 2ZCLL 1A6AB 5C6TH 2MCG1 3TNNA 2EDDA 1RUKL 3H9HA 4R4ND 1FCGA 4XCCH 3SDCA 3STZB 1U42A 4OLWH 2CKBB 3BPCA 3EOBB 5BVJA 1EMTL 2NXZD 2YK1H 4RFNB 3UCRA 2XRAL 5CEXA 4R90H 2PCPA 1UZ8B 2Z4QA 1G1YA 2X10A 4Y16D 1WZKA 1U8MB 4C83B 3O3EB 3TC9A 4XVUC 1F4HA 1LE5A 3KYNB 1T7YA 4JRXE 2BSRA 4CJ0A 1CICC 2EZ0D 3SCMB 1J8HB 5J9PB 1XZ0A 1NANI 2A6KB 2Y6SD 2XZCH 3WHXB 1RIVL 4OQ1A 1QA9A 3PABA 4DOHB 2FH8A 2WIMA 5IESH 4O5LL 2W1NA 3ARFD 3ZE1F 2G60L 3QCUH 4HC1L 1TMCB 3MRKA 4BSWA 3O4LA 3V5HB 1IGCH 1RY7B 3WFEH 3ULUC 4NUJB 4S1SH 3MBXH 1KJ2B 1PKQB 2IANB 4MAYA 1JNJA 2LTQB 4G6AC 2WINB 4YHIB 5E5MA 3H9HB 3WD5L 3SDCB 4HWNA 4L8SA 5HHPA 3QXUA 5BVJB 2FRGP 1ZHNA 2PXYA 4GKNA 3WDHA 5DEGA 5SV3A 4UINH 5HHVL 2O5XL 4XCNB 1T2JA 3H3KA 4QYOA 3AY4C 2PCPB 1HWHB 3ULVF 3ARBD 3SDYH 5DJ6B 2Z4QB 4MAUL 3EGSA 3H9SD 3N9GL 4Z95H 3DMMD 5C0DA 3UBXA 2X09A 5E6IC 4NN6B 1ZHBB 3M45A 5IWLC 4DQOL 7FABL 1IM9A 3HLAA 1D9KD 1LE5B 4OF8A 2ENYA 3JWNC 4QRPD 3BZEA 3S88L 4D9QD 3GMRA 3QXVA 1MCSA 3TA3C 3KLAB 2EH8L 1Q38A 4LLWA 1INDH 4MLSA 2BC4B 4XGZA 5I1GL 3MLZL 4TUOA 1ORSB 5C70A 1A9EA 1O5DT 2DTSA 1KJ2L 3CVHA 2FX9H 3MRKB 4UUJA 2CXKA 5HY9A 4BSWB 4KUZH 4KPHH 3O4LB 2F5AL 4J12A 4LVNC 2AJZA 4LASL 3C08H 4MAYB 4CN6A 3SHSA 5E5MB 4AL8L 4KJQD 1KPRA 3ZKXC 3VWJD 2IGFL 3NCJL 1CFSA 3T77A 5GGRB 2ZCHH 1ZHNB 2PXYB 4GKNB 4I18B 5DF0A 5DEGB 3A67H 1OGTB 3MV8B 1KCLA 3QNZA 4KK9C 3TVMC 3SPVA 2ITCA 3NZHL 3UBXB 1HCFX 3EGSB 5C0DB 1KEGL 1UJ3A 5B38A 1LEIA 4X8JB 4MA1C 3V4PL 4IRSB 3WS6C 1R3KA 1IM9B 3HLAB 2BNUA 1SJEA 2F53A 3MA9L 2IWGA 1F8TL 2NZ9C 3QSKB 2P42B 2OK0L 2FX8L 3BZEB 5BV7L 3BPOB 2GEEA 4X5XA 3GMRB 1O7SA 2XICA 3L3DA 2CR6A 2GUOA 3K80A 2CLZA 2GT9A 3ROOA 2EDBA 5CGYD 3K74B 4PJGB 4HIIA 4JJHA 5J12B 1CIUA 1FAKT 4P9HL 4TUOB 1MIMH 1A9EB 4MCZA 1A0QL 4OD1H 3CVHB 3RTQC 2ICEA 4UUJB 3C6SB 5HY9B 3BO8A 1ZANL 2VDPH 3SDDC 1NANH 2AJZB 3VFTB 2XG5A 3K4DA 5E8EA 5B39B 3QG7L 3OL2A 2OZ4H 1IGYB 2O93L 3BN9C 2ZUQC 3T04D 3PF2A 3PWUA 4PV8B 4F2MB 4QHLA 3ME0A 2EDFA 3TN0D 1P1ZA 2GAZA 1J5OH 4XMLH 2XKNB 4WWID 2Q86B 5JMRA 5F7MC 1CFSB 3T77B 2F74A 6CGTA 1FFNA 5I1LA 4H0GA 1MCCA 4O51A 3VXMA 4XT1C 3MOQA 4ORZC 2ITCB 1DQML 4OIAA 4OFIA 3JTSB 4MDJB 3RJDA 3TGXA 2YPLE 3AREC 1UJ3B 5B38B 1LEIB 4D0DA 1TJIH 3OKEA 1MCJA 2BNUB 1SJEB 2F53B 4Z5RA 4J3WA 4F7PB 4X5XB 4Q9RH 2GUOB 3BP7A 2GT9B 2YD5A 3KPLA 3ROOB 1MFAL 2QTEA 3AM8A 2OL3B 1C08A 3CVHL 5SWZA 2IC2A 1CDJA 2CO7B 3ARVA 1A8JH 2P5WE 1F2XK 4HIIB 2XWBA 2AK1L 3NIFF 5D1QC 5B3JF 4MCZB 2W60A 5D7JB 4C58B 5GPRA 3QDMA 3BO8B 4B41A 2DWDA 4BZ2H 3RNKA 3QQNA 5FO9A 1SM3H 4R4FL 1DQDL 5KANG 1GC1H 3VFPA 4KI5F 2UVEA 4JEGB 3RNQA 2VKXA 3PWUB 1A6VH 1M6OA 4QHLB 2IQ9H 1P1ZB 2GAZB 3B9VA 2XNAA 4HBQA 4K3JL 3S3SA 2F74B 1FFNB 1E4KA 3VXMB 1EZVX 2ZKHH 2IH3B 4Q6IC 4XAWL 3PDDA 2HFGH 3C6LD 5LAXB 4JJ5A 3OKEB 2VL5A 4KROB 2F15A 3D85A 3GSNA 2DKMA 2BMKA 3CSGA 2J8UF 1IGMH 1OW0C 2OL3L 4LSTH 3VDBA 4X4YB 1R5VA 4HIXL 3BDXA 5HDBF 3BP7B 2J8UA 3KPLB 5DSCA 5SWZB 2AW2A 2Z91B 1U3HC 4P9ML 5TQ2H 4ONGL 2CGRH 5D8JH 2E5EA 3U1SH 2XWBB 5JPMA 2M1KA 5I74B 3L3IA 5CIPB 1TJHL 1SBSL 4NYLB 1MRDH 2DWDB 3PGFH 3RNKB 2OR9H 3KPRA 3OJDA 4P5KA 5DVOA 5FO9B 2Y36H 5JNYA 3VFPB 3UTTB 3MLYH 2VLKD 4BKLA 1L9NA 1P84J 4HPOH 1M6OB 1MJ8L 5JMOC 3LKOA 4W4OC 2BVPA 5FGSA 1KT2A 2F19L 3RIFF 3QWRA 5D96C 3ILPA 4ZTOL 2VDML 4U05A 2LAAA 5KS9E 5TJWK 1MJJA 2F54B 1JRHL 2KDGA 5I71B 4JLRB 3KLSA 5C09A 2VDQL 4KHTL 1J1PL 2VH5L 3BN3B 2VDRH 4JJ5B 4M7ZB 1F2QA 3BIKA 2AJXL 4UMGA 3D85B 3GSNB 5D7LB 5IBUG 2BMKB 1WBYB 5E70A 2CO6B 2GJZA 3ALPA 2RFXA 1R5VB 2XTLA 5HYJB 2OR8A 3MR9A 4AMKH 1F4WL 4YXLH 5DZOA 1QKZH 5DSCB 4U7KA 1F45A 4JN1H 1XGTA 5E2TH 1Q94A 1UB5A 5JPMB 3THMH 3L3IB 1ZLWH 3EJZD 1NUFA 3KPRB 3OJDB 4P5KB 3HRZB 1IILE 2YA0A 3PWPB 1F3JB 2OTUB 5MI0C 3LDBB 1Z9LA 3X17A 5CS7A 4PRIE 1S9YB 4JZOA 5E2UL 1QRNE 2BVPB 4ALAH 1KT2B 4QY8A 3ILPB 3FO0L 1BJ8A 1MJJB 4BFEA 2KPNA 4CVZA 2WV3A 5BVPH 3RGHA 5IQ7H 5IJVA 1RQ5A 4CGTA 4P2RE 1RU9H 1CF8L 3BIKB 4P2QB 4LPYA 2GJZB 2ED8A 4MJ4A 2BRRH 4QOKB 1J1OH 2A73A 5GGTA 2E8YA 5C0BD 1F3DJ 3O9WB 4OM0H 1J0JA 3PL6B 4J4PC 1XGTB 1JZ3A 4NOBA 4GRWF 4HBCL 1AGEA 1UB5B 5EWIL 3RVTD 3H42L 5GRZA 1GZPA 1BEYL 1FL6A 4LIQH 2XXCB 5DC0A 4DUVA 5I18H 1EVUA 2YN3A 5ENWA 1P4LB 3I6GA 2ZCKL 4DZ8A 1SY6A 2NXYC 4PJCF 1NCWH 5HXMA 3TBWA 3BKMH 4FZ8H 5F44A 1DEDA 4Q6YA 3IGAA 4I3RH 2B2XL 3IRPX 1RUKH 3KPMA 4QY8B 2VXSH 1UCTA 1EMTH 1MREH 3MC0A 4FMFA 2BFVH 1PY9A 2GHWB 3MRJB 4XBPA 5EZOH 4CVZB 2BK8A 4JFDE 4IJ3B 3N50A 4JAMA 2D7QA 5IJVB 1YUHA 1Q9OA 1T21B 1YECL 1MJUL 4KJWC 2VXVL 5HGHA 4L8DA 1AKJA 3U4EA 4R0LB 5KSAC 1ZE3C 1AIFB 2A73B 4PUBL 3GSUA 5TGBA 1RIVH 5GGVL 1QFUL 5DO2D 3WN5A 1G6RA 4ETQA 3EDKA 2OMNA 3OAYH 3BKYH 2X4NA 3K4ZA 3L5XL 2APWA 4UQ3A 5FIEA 3IXAA 1CXKA 4POUB 3UBXI 4O5LH 2G60H 4M4RA 4HC1H 1MLCA 5ICXB 3I6GB 4IOIA 2XZQL 3MFFA 1UVQA 2CKBH 1XR9B 2VR4A 4G6JL 4XPAL 3BKJL 3IGAB 4JE4B 1BVLB 3DSNA 3KPMB 4DN3H 3IKKA 4WUKL 1DQJB 1H5BC 4DUXA 5HHVH 2IAMC 2O5XH 1HHKB 4XBPB 2X42A 4W70A 4XPTL 3SKNB 3SJVE 5E6YA 3TCLA 4MAUH 3N9GH 4Y19E 1YUHB 1Q9OB 1MY5A 3JWOL 1RZKC 2BVOA 2V2TB 5HGHB 4DQOH 4L8DB 1AKJB 7FABH 2ZUSA 4UOW1 1JF5A 3U4EB 2VXQL 3U6RA 4OSUL 3WKML 3AB0B 3S88H 3RVUD 3GSUB 4JFEB 1ZXQA 5C08E 3WN5B 1G6RB 1D5MA 5HHMB 3GIVA 5E8PA 5TDPA 2X4NB 2QQQA 4NFDA 1GGBL 1SY6L 3IXAB 4TVPE 3SGJA 2EE2A 3P9WB 4F7TA 1CE6B 1KJ2H 4PLKD 1MLCB 3QUXC 4M93C 4IOIB 1I1AB 3MFFB 4AT6A 1UVQB 3OJVC 4LASH 2ED7A 5L0QC 3SDCC 5FYKD 1RUPL 4AL8H 1DP0A 1JBJA 2VZOA 1S7SA 3NACH 1KLGA 2QHLA 3SE3C 4LIQE 3NCJH 5K9OB 3RZWA 3VXUD 5K59F 1V3KA 1QHOA 2JJTA 3CU7A 2BSSA 1BD2D 5DVNA 3I02A 3D3VA 3JVGA 1B3JA 1BX2B 2BRQA 3KJ4B 3LEXB 3NZHH 4FNLL 3CC5B 2V7HA 5HGBA 1HXMA 4TRPH 1KEGH 4XH2A 3AAZA 5FM5M 3V4PH 2BVOB 4L8CA 1IL1A 4WTWA 1RUML 3L7EA 3U6RB 3MA9H 1F8TH 3IJHB 1EA9C 1IGFH 3PP3H 1EHXA 3TPKA 4RWHA 2D7MA 1W0VA 1HH6B 3GIVB 4WW2A 5E8PB 5TDPB 2O61A 2BVYA 2Y9RT 5FHBH 2MFNA 4F7TB 3PUCA 2DIJA 2ICES 4OCXL 1JRHI 1RPQA 1AHWA 1ZANH 4LCWD 2ADJA 1JFQL 5KAQF 4HG4K 3R06A 3DBXA 4LVOB 4U7MA 4L8SC 1U2CA 1ZEAL 2D7OA 2AJSH 1S7SB 4LAQL 3RKDC 1KELL 4PRPB 1EEUA 3O6LL 5TDNB 2Z0BA 3B3IA 2FGZA 5HDQL 1OWRM 4F9LA 4QRTB 2BSSB 2ID5A 3I02B 3D3VB 1DQMH 1KJ3L 5HGBB 4P4KD 1HXMB 5EUOF 4ZOAA 3TM6A 3TPUA 3O6ML 3ULVC 5CZXD 4XH2B 3AAZB 4HJJL 3WNOA 4F7MA 4YHKH 3DJ9A 4U1KB 2C5DC 2X1WL 1UWXH 2R23B 4WFED 1U8HA 3BEWA 4E41A 5EOQH 1LO4L 2VIRB 4QT5A 4DK6A 3BI9X 3UTOA 1MFAH 1Z6JT 2APXA 5E8NA 3CVHH 4WW2B 2WWMC 4X0KA 2IEPA 3MBED 3RY6C 1WIUA 2AK1H 5I8KL 3VFSA 1JHKL 1I1FA 2P48B 3QO1B 4EI5C 5T3XD 3DNKA 5H37G 1F11B 1V05A 1AHWB 1FQ9C 4OUUA 1DQDH 1LMKA 4G80A 1UCBL 1VDGA 3R06B 4RX4A 2RBLA 2NQCA 5FOBA 4NFCA 3DOSA 1J10A 2X1OA 5JQ6H 2RR3A 4YHOL 4K3JH 4C56B 4LSDA 4UTBL 3B3IB 1PKQE 1C7SA 1MCQA 4MD0A 5CAYB 1CFTA 5C9JB 3W81A 4N8VG 3CX5K 1D6EA 4AH2A 3TPUB 3Q1SH 4XAWH 4I9WE 2IPKA 3RX5A 1PW3A 3KYKL 3D1MC 1LGVA 2VABA 4HK0A 5EZIL 5C07D 2AABL 4OGAD 1OF2B 3BEWB 4E41B 2OL3H 1LP9B 4LHUA 4ENEC 2HTLC 4QT5B 5I30L 2ADIB 4HIXH 4FTVD 5E1AA 1H0DB 5A40E 4FQXA 2E7HA 2VZ1A 4ZO8A 4X0KB 4E5XA 4Z7VF 2BNQA 1FFOA 3IB4A 4HCRL 4P9MH 3PHSA 4WU5B 4R97C 3WDIA 3VFSB 4YDVB 1MY7A 1I1FB 1TJHH 1ERNA 4UNTA 1KSRA 3NIGE 3BWAA 1OAUH 5DJDB 1JZ4A 5F8RC 4JHAL 3TBTA 4G80B 2VL4A 3N0PB 2R4SL 3MRDA 3VG9C 5EN2A 5FOBB 5M94B 4FOMA 3EDEA 5C0GA 4NWUL 4L8BB 4D8PA 2GSIA 5GGSY 5B3NA 1JZ6A 2F19H 4U1NA 3PWNA 5CJ5A 4ZTOH 1IEBA 1LK2A 4DKEL 1CFTB 1JRHH 4R9HA 1VFAB 4LGSB 1D6EB 2VAAB 3BQUA 1A9BA 3QDGB 2VDQH 5DK3A 4KHTH 4I0PD 1J1PH 2IPKB 2VH5H 1KXVC 1JUFA 3MV8E 4HK0B 2VABB 1SYSA 2D0FA 5EOCJ 5I6XC 2AJXH 1OVZA 4X4MA 4IRZL 4P3WA 1R24A 4GG6F 4K23H 1XAUA 4LHUB 5F9JA 3KYMA 3GIZL 4YO0A 5L8KB 4RNRA 3AM8C 4U1SA 4WEBL 5CIPH 5E1AB 1F4WH 3QCTL 4GG6A 4FQXB 4PJHA 3GSOB 1YQ2A 3HNVL 4XWOC 1R0AL 4E5XB 5T3ZH 1YEFL 3BJLA 2FSEA 4ODXA 4YBQD 4CN4A 4Z7QE 1A4KA 1ODAA 2P47B 3BWAB 5GSRB 3QRFM 1BJMA 5DRNA 1YPZA 3QHZH 3TBTB 3CFJA 4PJGE 1BWWA 1F58L 5DD1L 4PJ8B 1RIHL 1I7ZA 5C0CA 5EN2B 4KI5C 5F9OH 4R4BA 4Y2DA 4KC3B 2FJGA 4N5UA 2GSIB 3BYYA 4U1NB 1TJGL 1X5AA 2GY5A 3OAZK 3PWNB 3FO0H 1G9NL 4YUEL 3BQUB 2DQJH 3GUTA 2DBLH 5E6ZA 1DFBL 2X4OB 5DMIL 4GG8A 2W9EH 3N1GC 1CF8H 4MD4A 1CTOA 4LLYB 1U91A 5F9JB 3KYMB 3EOTL 4YO0B 3NOIA 4HX1A 5AG9A 1Z3GH 2EE3A 4GG6B 4PJHB 1HYSD 2C3VA 5DQ9A 4X9GA 3SO3B 3F7RA 4HBCH 3QYCA 4XP4L 1CGTA 2FSEB 3H42H 1T0NA 4Y5XA 3K2UL 1AR1D 1BEYH 4KDTA 1QSFD 3RDTA 3V0WL 5DRNB 5I1IH 2CDEA 1YPZB