5L7XH

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
205
Chain Sequence
b'EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH02
3WNNA 2NYYC 1MVUA 5ALCL 1YEJH 3SKJH 4MAYB 2VLLB 1KPUA 5F7DA 4K3HA 1J8HB 4K8RH 2ZSVB 1AGDB 4LBEB 2FRGP 1AIFB 3MRNB 2G9HB 4JE4B 3OAZK 3G5YB 1IL1B 1DANU 3HRPA 3VRLE 4G9FB 3BZEB 1MCBA 4Z7UB 3VFOB 2BOBB 3BKCH 1NANH 1JF6A 2XFXA 4JFEA 3HRZA 5DJ6A 5FA3A 5TFSL 1ES0A 3QXUA 5D2NC 2X1PA 1CFSA 3D48R 4U6XB 1FFNA 3JWOC 2UWEF 5DK2B 1UEYA 5A2JH 5AWNL 3O41B 3KGRA 4WI6A 2ORBL 2WWKO 2ESVD 5DD5L 5EA0H 4OM1L 4XBGA 3TBYB 2A6KB 3EJZD 4XPGL 3AY4C 5TGBB 2YD8A 4WFHE 2Z31D 3GRWA 3ZDZF 1NFIA 3QEQB 1WLHA 3G5VB 1X5JA 3OKKB 4EDWH 4FQXA 2VXVH 3OKMB 3TH3T 5BOPA 3RL1B 3HB3C 4NQUA 4Y5YA 4MJIA 3QO0A 4KTEH 4AIOA 5B3NA 4J8RA 5C0BE 1ETZB 2DDQH 4LCYA 1UB5B 2UWEA 5I1JL 1P9MA 1QACA 5HDQH 4NJ9H 3O4LD 5FYJL 1X5KA 1MQ8A 3CMOH 32C2B 4OCLC 5DO2D 1AXTL 3EO1B 4OZHF 3GIZL 4NHUA 2VDPL 3KLHD 4LCCA 5DC0A 3I6LD 5D5ME 5IVXB 3MV9A 4GMTH 1YYMH 2GQHA 4ZTOH 1Q8MA 5HYSG 4YHOH 2HT3D 1G6VK 3NA4A 1BD2E 1BLNB 1QRND 1BZ7B 3IXAB 1RVFL 5IIEB 3DTXA 4HH9A 5H8DA 3IJHA 3MRJA 4L4VD 5EU4B 4XWOC 5JQ6H 1A9BA 3QNZB 2JF1A 1T20B 3OKNB 4L9LB 4DW2H 4KZEH 3FB5A 5KVGL 4Z0BH 4N5ED 4WFED 1KCRL 2WWMD 5IHZA 5IBTH 5JPNA 3UC0L 4OZHA 1U8JA 3RL2A 4P9ML 4JO4L 4HIHA 3GJFH 1X6LA 4LQFH 2ZOLB 4Y2OA 3ESVF 3K4AA 5J1SC 3DMMC 5CJ8A 2Y5TA 5E1AB 3UCRA 3Q1SL 4AYFA 1EHXA 4Y5YC 3PWUB 5HI5D 1F45A 2A6JB 3V5KB 1DUYB 3TZVC 4PGBB 2X4NB 2D4FA 4HKBB 3OSKA 1P9MC 5GGVH 4TYUA 1NBZB 1KACB 1OY3B 4JN1L 2DQJH 2NY6B 5IV2A 3IAGC 3MBEC 4NPYB 4Y19A 5ANME 2C4FT 4LCCC 2DKMA 1QFWH 2FJFB 4K2UH 2I27N 4F80A 5B8CB 5JIPA 1G7JA 3P0VL 1S7TA 4HKZB 4HDIA 3QPQC 3O0RH 2FCBA 1G7PB 1EJOL 4KKAD 3ZHLA 3LEYH 2IH3A 4G6AD 3C5ZD 4X80H 4RIRA 1BBJA 4U6HB 4KKCD 3KG5A 5FYKD 1FVEB 2GFBA 2VDKL 1P6FA 1A6UH 2PW1A 4M6ML 4PY7A 5KS9E 3R1GL 2X4QA 2JB5H 1JPGB 1AGEA 1JI2A 2A1WL 3D69A 3DGGB 5TQ2L 5IMOB 2DLFH 1N7MH 4GKSB 5CEXB 4WFHD 4GUPB 3SGKC 1WFTA 3KPLB 4AEIH 5CJXA 3F58H 1DUZB 4GG8B 3DGCR 1DANT 1KN2H 4UINH 3AREB 1PDKA 2O5ZH 1S9WB 1BEYH 3MV7A 1D9KC 2XNAB 4HIJB 4NCC1 1DZBA 35C8H 5C0BD 3E1F1 4MXWL 1SJHB 3H8NA 2X9YA 4KDTA 1CD8A 4KUZH 2FIRT 2ADGA 4BZ2H 2ZG1A 1U8MB 4Y8AA 1DVFA 3CLEH 4E0RA 4LVNC 4FQ1L 1JNHA 3AAZB 3CSBA 2P8PA 1DEEB 5FCUH 2DQGH 4XRCB 1PVHA 5IF0A 1F58H 2W59A 4XI5D 1WT5C 1QFUH 1DLFL 3OX8A 1XH3A 1EFQA 5GSRB 1SVCP 1OLZA 1JHKL 1LWRA 3MV8E 3V4VH 1CR9H 5E6IA 1ZMYA 1BD2D 4PJHB 1LEIA 4HULB 3U9UA 4HS8L 5EU5B 2X4PB 5IMLA 3VE0B 1QSFE 4XP4L 2B5IC 3DVNB 4LFHD 4YDJA 2Q76B 3BKJH 4LL9A 3R8QA 4GMSH 3BJ91 3UMTA 4M4RA 1CS6A 1AR2A 3T2NL 1UM5H 2EH7H 3TNNA 2H26B 1A7RL 4Y1AA 4LRIA 3FQUA 5CIPB 1LD9A 3IAQA 4OZIE 1I9IH 1ONQA 1W72H 3CCHA 2MSPA 3E2HB 3WD5H 4JGJA 2FD6H 1OL0A 2FHBA 3GJEA 4KMQA 4KK8C 3H7BB 3S98A 1J1PH 5L7XH 1I7TA 2FSEB 4YHZL 1AR1C 3OB0H 5C09A 2IANB 5FB8A 3TBSA 4JRXB 2R0WH 4DN3H 4Z9KB 2NY3C 3LIZH 3I75A 1RIHL 2P46B 1J1OH 4X4ME 1J10A 5IM7B 3PP3K 2B0SL 4HXAH 4YDIL 5D7JD 1BVLA 4E41A 5F1NA 3MGTA 5HSFA 4OTXL 4PJ5B 5DGRA 2PTVA 1NGYB 5E2TL 3GSUB 3I2CH 5HGDB 2OQJB 3RWFA 3LPWA 4POYA 1J0IA 1Q0YL 1F4YL 4PG9B 3FQWA 5JXAH 3FRUA 4KROC 3U79A 2R1YA 5DEZA 1R3LA 4LIQL 1JPSH 4AT6A 1KCSL 3T3PE 3W39A 2DLHA 6CGTA 3U0WL 4M7LL 3KXFA 2COQA 1CLYH 2AI0L 1PSKH 1GJIA 1Z6JT 2Z93A 1R3IH 1HDMB 3V5HB 2WQ8A 3DYOA 2HTKD 3KLAB 3GRWL 4LSDA 5IJKA 5JOFA 5F7KC 2ATPA 2R0ZL 5DUPL 5IG7B 2AGJH 4AEEA 3REWB 5F7DB 4BK5A 3H7LA 5KG9B 3MRPA 3GMLA 1TZHB 5FM4A 2BY1A 3RWGA 3WHE1 5FO8A 4WCYH 1BQLH 1Q9WA 4GLRH 3MQIA 4UZGA 3RJQB 2C3XA 4MB3A 2E7LC 4JY5H 4GRLA 4M8QA 3P4NA 5HPOA 2EIBA 1EMTH 4EDXA 2NY2C 3OXRA 4LU5L 5ENWB 1CICA 1P7QA 4I3RL 3TN0C 1OAKH 3AM8A 1BX2B 1OGAB 1CFSB 2YBRB 5ESAA 3DETD 4X83A 4AL8L 1JZ5A 3MODH 1L9MA 4ZNEA 3MV8D 1YEIH 2NZ9C 2PYEA 3GI8H 4L3CB 4XCFL 5GZND 5ID1A 4CU7A 2V17L 1Q9LA 3FHAA 2QQLL 3QRGL 2FB4L 2JJTA 3CLFL 1UH2A 1VFOA 1JMXA 4LLDA 3H3PH 3VXMA 1AP2A 2R2EB 4JQXC 4XCNB 1QSFD 4B7LA 2O5YH 4JN2B 2ITDA 3JV0A 3VRJB 2K1MA 4FXKA 1BZ9A 3DPBA 4HKJB 1DBAL 4FQXB 5BQ7A 3SY0B 3QH3B 4L8DA 2X1XR 3MLYL 3FFDA 3D9AH 1BFOA 3G6JB 5CLTA 4J8RB 5GS0H 3F5WA 1ZV5A 5KW9H 2FIKA 5IW1A 15C8H 1IBGH 3HAEB 3S88H 3T8XB 3QCTH 4U0RB 2NY0C 2P42B 5BVJA 1CLOL 5I1CH 2VR4A 4I2XA 1RI8A 2BFVL 1R5WB 4W6XB 1MCHA 1FIEA 2EICA 3C08H 4R6UA 1F4WH 4MDIB 4JFDD 1A6VH 2ICWA 5IFHH 4GAGL 4ODBD 3RNQA 2I60L 5DD0H 1H3WM 1UC6A 4GRWH 2AK4E 3ALXA 1CDHA 1UH3A 1TLKA 5DD1L 2NW2B 2BMKB 3T0BA 3ZE2E 4YHPB 1IRAY 2D0FA 4H25B 4R3SB 1FPTH 2LVEA 4AM0A 4XCYB 1PLGL 1XEDA 1LDPL 2NCMA 1CWVA 3QUXB 4F37F 1A7QL 3ZT5A 5J6HB 1TJIH 4KXZH 4CNIA 3L9RB 2Y5TB 4PV9B 5I75B 5EWIL 3FQTA 2FGWH 1GOHA 1GPOL 2GITA 4IRSD 5KJRL 5IB3A 2VLKB 3VXSB 1A1NA 5MENA 4QRTA 5MEQA 4OCRH 3MV11 3CXDH 4OLYH 3U4AA 5I8EA 4J4PA 1A1OA 4YHKL 1X5LA 3VXUE 4K07A 2QEJA 1Z9MA 2XG5A 4DKDC 4HD9A 3S7GA 1TQCB 5I1KL 4U1NB 1WZ1L 4NWTH 3L3DB 1FO0H 2VSDA 5C70A 3MLUH 4YGVB 1P4LA 1V5JA 3GHBH 5C07A 3T2OA 3TJEL 1GGCL 3ZKQD 1A21A 1FG2A 3ZE1E 1BBJB 5JA9A 2QQQA 4N0RA 3PQYB 1CFQA 5TF0A 1RZJH 1IM9B 1G9ML 3RQ3A 1PQZA 2FECL 4TOYH 4RZCA 3P9LB 3RVVD 5IMKA 1NC2A 5C7XH 5DJDB 1AGEB 5HHOA 5CSBA 5DJZB 5FK9A 1B0GA 4NKMB 3U4BL 4JM2B 3DX9B 1ZTXL 2P5EA 4JFPA 5LVEA 3U30B 2ZKHH 3QZWG 4QHUB 4HS3A 4WENB 3ZDXF 4JVWA 2EECA 3P77A 3A6BL 3QUMH 5DZOA 4K7FA 3BEVA 4KRPC 1FLRH 1K9TA 4TPRL 5GGSB 4Y4KA 2IQ9H 1G9NL 2CD0A 5GRZA 3BH8B 5EBWA 4RMRA 4YK4C 1DN2A 1DVFB 5C9KA 2R56L 4AMKL 5C2BL 3IJYB 3GMQA 5IJVB 5IF0B 4ZFZB 4GW1B 1EK3A 4J4PC 4U6YA 4OSUH 3OX8B 2X44D 4MNGE 3T0EE 3L7EB 3HG1B 1E6OH 2BVEA 4MJ2A 1LEIB 5GS1A 1EAPA 3QQ4A 1MIMH 2HRLA 1B88A 2ZCKL 3GI9L 3BIBX 4LCWA 4JFFE 3W11D 4G8FB 2AK4D 1B6UA 1JP5A 1L9NA 1BJMA 4GKNA 1CXFA 2EO1A 5DT1H 5H2BA 2GIYA 4JZNA 4RX4D 5FV1L 3CSGA 5JIIA 1H5BB 3QJFA 4NO3B 4JFXA 1XF5B 5F8RC 1QYGL 4IDLA 1RZ7H 1DLHA 3DNKA 1ONQB 5GGVY 3L5HA 1FFRA 3KYKH 3O6FB 3CCHB 2CKNA 4M7KL 4PJ9A 4P46A 4XHJC 5FHAH 3ARBC 4FQJL 4GS7C 1YN7A 1NBVL 5CD5D 1KC5H 3I75B 4XXCC 2QQNL 1NEZA 1JGVL 3WJLC 4F8TA 4MVBD 2P48B 1YQVH 4RFEA 2MJWA 4HUWB 5F96H 1DJSA 4L1HA 3K8MA 4M3JA 5C0DB 4KFZC 1UADC 4K7PH 3FO1B 4R4FH 4NZTH 4BELD 1NGPH 4JQIH 3OAYH 4G9DB 1G84A 4ZS6D 4RNRA 4Q6IB 5I8CB 3KJ4C 3O9WD 3FZUC 1XF1A 3U1SH 3FRUB 5F1IB 5JTWA 1M05B 3CSYB 4FQ2L 1CTNA 4K3EH 1F11B 2I9TA 1I1CA 3UTPE 1XGYL 4X9HA 1SQ2N 2MOVA 3BKYL 3MRBA 5JR1L 3S36H 3MRLA 4H1LG 4JHAL 4F7TB 4ZUVA 2G60H 3FQRB 4NM8L 4OM0H 1IGTA 2VXUL 2H8PA 2VITB 4APQD 1FORH 4RISL 3MXWL 4MLIA 3JV5A 1BWWA 3EYVB 3AU1B 4NM4H 3MJ8B 3MRCA 4JREB 4P4RA 4AQOA 3ILPB 2YPLE 3DARA 3UEZA 5M95B 5MEPA 5A2FA 1I1YB 5DVNA 3LSOB 3X14B 4D9RE 5JA8B 3BKML 4TVSa 4LNRA 1CU4L 1QBML 4OCYH 3UJTH 5KSBF 3G5XB 2AJYL 3O2DA 3T0ED 5TE6L 5FYKU 2A38A 1HILA 2HKFL 5LBSL 1F90L 1Q9LB 4WV1C 2F8OA 3HLAB 1EFXB 4FG6D 1R3HA 4OGXH 3L95A 1CGSH 1C08A 1KJVA 3RVTC 3MLWL 2PYFA 3FQXA 4LEXL 1H3XA 2OXHA 3BPCB 3V6FA 1HQRB 3IDNA 3BESR 3MBXH 2MQ0A 4NFCA 1KLGB 1M6OB 5EB9A 1D5MA 3CC5A 3GM0A 2KUTA 1A4JB 2C5DC 1JZ8A 3F6LA 5INDA 3FCTB 3C09C 5D7SL 4MS8D 2MQ3A 1AE6H 2OBGA 1S3KL 2VLJE 3GJFA 5KSBA 4ZS7L 2EDQA 1KLUB 2HFGL 1C5DA 4G7VH 1AHWA 4NQDA 3VH8G 2FH6A 4UU9A 4HF5L 4ZAKB 3G9AB 3SDXE 3KHOA 1P4BH 1JZ3A 3GZKA 5SWZA 1T89C 4JR9H 3ZYIA 2DWDA 4M93B 4HJJL 4XP5H 4XGZA 3GK8L 1JYWA 3L3GA 2ICWB 4EBQL 3C5SA 1DQDL 3RNQB 3RPIA 3QUKB 1MH5B 1LGVA 3LKQA 1D7FA 3QXTA 5DUMH 1K6QH 2AV7B 1JYXA 2CDFB 4ZXBD 5D70L 1FNFA 4K9EC 3NA9H 4JGMA 5BS0E 4HMEA 3BP6A 4G8EA 3UTPD 2ADJB 5FGBA 3OKDB 2AQ1A 4RMTA 3T4YB 1V3LA 1UWEH 4TN9A 1FFPB 3QXDB 3V0WL 2W0PA 2ZP0T 5EO1B 1N4XH 1OWWA 5CWSB 3LOWA 1OP5H 4IRJD 4Z76B 1T2QH 3U36B 3SDAA 1CDCA 4DGIL 1LMKA 2DQFB 1CFTB 4XMKH 2GITB 4U1JB 5DMIH 2PW2B 5MENB 2R2HA 2BY0A 4NC1E 1VEOA 4ZQKA 3ET9F 1NGQH 2R1XB 2A83A 3JWDL 2R39A 1RU9L 2YPLD 3VFSA 4JY4B 4DFIA 2PXYA 1IGIH 3L3OB 3OG4B 2CLZA 4XXDA 4JPKH 2CR3A 4D9RD 4YFLI 5ACMA 1NGWB 4JKPL 3X17A 4BFEA 3SDDA 4PJ8C 5EORH 2ZJSH 3CPLA 3QIUB 4JDTH 1NL0L 1P4LB 4KI5E 5T1LB 4GW5A 3ZKSD 5IBLD 3K8KA 1HYRC 4NHCL 2Y7QB 1KIRB 3NTCL 4HUMB 4K23L 5F3HB 3I9GL 1AO7A 3RWEA 5C0EA 4HWEL 2YD2A 5HYQB 5JO5A 5JW5A 1CIDA 5HHOB 2FR4B 5I73C 1LEKB 3V4PL 1UZ6E 4G8IA 12E8L 3BP4B 4HSQA 3NIDE 4PRBB 1BJ8A 1N8ZA 3QJHB 2W92A 5HHPB 4NKQB 5JDJA 3BI9X 5F6IB 5BZDA 1F8TH 3QEUB 2IAMB 5C6WH 4K7FB 1YEJL 3JV6B 1W72A 3DVIA 5T1MB 4K3JL 2VLJD 4QY8A 1CT8A 1XGPA 3ZZ1A 4UV4H 4ALAL 4L4VA 2GSGA 5FHBL 4XC1H 3RA7H 3GMQB 4PJXE 3GGWB 2OMBA 1KTRL 3QEGL 1YEGH 2FHCA 5D1ZD 1NUDA 2CO6B 2CGRH 1NMAH 2ZUSA 3EJZC 5TDOB 4AIZA 4NRZB 4ZTPH 3BKCL 4BSWA 3EOAA 2F5BL 2CIKB 1YY8B 2Z31C 4EI6A 2VKXA 3SDDC 1U3HB 2W0KA 4YUEL 1UWGH 1TCMA 1EAPB 2YKLH 3BH9B 3RKDC 5L9DH 3E6FA 1YEKH 2JK5B 3FB6A 4OLXH 3EZJB 3BDXA 3IDMB 1MCLA 4G6KL 4LVEA 2GK0A 3QAZB 4DGYH 3VD5A 1OVZA 5BS0D 1HHHB 1AXSB 2YD9A 3JV4A 1J12A 2OJZH 4GBXD 5LJYH 5BJTB 5DO2C 5IR1A 2XT1B 4WVRA 1OF2A 4L5FL 4NQCE 4GSDH 4Z7NF 3BAEH 3KLHC 3GMMA 4XNZB 2XWTB 4LLVA 5ECJE 4PJ9B 2C3VA 4OI7A 4I48B 5F7EH 2VZ1A 1NCCL 4EDWL 3TYFB 1CQYA 1BQHB 1XGTA 1KSRA 2HT3C 4LDEB 4WWKA 5CEZE 2J8UF 4I4WB 2M1KA 1F00I 1DN0A 4MSWB 3RDTA 3L3IA 2ENYA 2GJ6B 2Y6SD 5HDQL 2R15A 1I4FA 2FECI 3CMOL 1MCKA 2AV1A 1LE9B 3QIBA 2P1YA 1RJYA 3QR2A 4HW6A 4LPVA 3RNKA 4JZJC 4ETQB 1YMME 5TDPB 3WUZA 3DUHA 4N5EC 1NCAH 4JDVA 2WWMC 3FONA 4KI5D 2BERA 1YYML 4ZTOL 1QG3A 4QYOB 4A2LA 4FFVD 2DYPB 3C60D 4KUCF 4TSCH 2D4DA 1I3RA 1IAIH 4EVNB 1T0MA 1VGKA 5HI5C 3SDCD 1DL7H 2J8UA 3DUUA 5HVWA 3Q6GL 3U2SB 1S7RA 5DGQA 4Z0XB 5ETUB 3L3HA 1A4KB 4WHYG 2FATH 3HE7B 5CHNB 4TTGA 4DW2L 4KZEL 3VMOA 5E6ZA 4F57H 3B9EA 3RZCD 5IBTL 3BYTA 3WSQH 4HIIB 3RU8H 5J7CC 3HS0A 3A67H 2DF3A 3O11B 2EE3A 1U8KB 3F8UB 4H88H 4KKAC 4YAQB 5D1XD 2AJXH 3CFJA 3MNZA 4G6AC 3C5ZC 3OZ9H 1T1XB 4FMFA 1UWXH 1CGVA 5ICXA 4Y5XA 5HJ3A 4S1DD 1T6WA 3X3FH 4LHUG 1F6FB 4KTDH 5EPMA 1MI5E 4KKCC 2AAVA 1KTDB 4Y2DD 2GI7A 1RK1B 5E2WH 3EJJX 4LNRB 5EU7E 1BGXL 1ERNA 4HPOH 3VWKD 3QIBC 1S7VA 3QXAB 1HHGA 3TO2B 2VUYA 1QFWL 4QCIA 3PWJA 1CYGA 5EUOB 5D8JH 5C92A 3O0RL 5E1HB 3QDGA 3LEYL 5HY9B 4XB8A 4X80L 1W0VA 2WP3T 4UBDD 3EFFA 2C3WA 4F7CB 2GJZA 2WBKA 2BHYA 3WL9A 3LKOB 4UTBH 4YZFE 4Y4HA 2FBOJ 1A6UL 1LO2H 3O3EB 1EVUA 4HUXA 1JWMA 1DE4A 1IEAA 1YMHB 4X98B 2JB5L 1WCBA 3WNMA 3O3DB 1E28A 5HHME 4NQCD 2DLFL 5HD8D 4OCMC 4PRPA 3HR6A 5FO7B 1N7ML 4S2SA 4XI5C 4HUUB 2NY1D 3UROR 4AEIL 3U9PH 4Y4FA 3F58L 1YECH 1KN2L 4F3FB 4UINL 1MRCH 4NO5A 1E4WH 2BVPA 1BEYL 2DD8H 4AH2A 1YPZF 1MQKL 35C8L 3EO0A 3S37X 1R5VA 1AGFA 4GG6B 4KUZL 4HWBH 4U0QB 4BZ2L 4P2QD 1R5IA 1RPQA 5KVFH 1D5ZA 2CK2A 2A74A 5FCUL 5ADOL 1BJ1J 3S35X 1F58L 1YMMD 1LEGA 4NSKA 4LDOB 2VISA 1QFUL 1FO0A 5DRNB 4OF3A 2VL4A 1CG9B 3K46A 1ORSB 3V4VL 4QHNB 3V7MA 3HI1A 4H26B 4G8EB 1TJGH 5DK3A 5E8PA 4HWZA 1K3ZA 2JIXB 4GAJL 2I25N 1ZE3C 4B0MM 4PJGB 3BKJL 3T65A 1J1XH 4JPWH 3D39B 1WBZB 1YPZA 4OZ4B 4X6EA 4Q9CA 4GMSL 5E94A 4LASH 3QO1B 4TUOA 1IEHA 1FFOA 4IHOB 4M61B 4P3CH 3CXHJ 5D7JC 3TIEB 2EH7L 4GRMB 4XP6L 2RHEA 5JHDE 3UTTA 3BUYB 3VDBA 2YSSA 2JCCF 5LGKA 4QXUH 4DWHA 4DOHB 1RULL 4NQEA 1CDIA 1JN6B 2XQYG 4WRLA 4QRQA 5E8OB 5JUEL 3K3QA 1Z5LB 2ICWI 1PZ5A 2X1OA 3WD5L 4U2ZA 4ZQKB 2FD6L 4DKEL 3ETBF 4HXBH 4GOSA 5DFVD 3QUMA 1RZKL 5DR5L 3VFSB 4YDVA 1J1PL 5L7XL 4ZYKB 4LCIH 1JYNA 1YJDC 2EDDA 1CFNA 4CVUA 4G43B 1MI5D 4DKAA 2R0WL 4DN3L 3LIZL 4B53A 2QBWA 4YPJA 4H20H 3S5LA 3MLVH 5I76B 3SKUD 2J8HA 3L7FB 1U8HA 4M1DL 2Z8RA 4BJLA 4MLSA 3K8LA 5D72H 2HTKC 4RAUB 4TRPH 3B5GA 3E8UH 3EDJA 2PTTB 2MCG1 2YA1A 3I2CL 5I1DA 2JCCA 2ICEA 1XR9A 3RWEB 3CXHK 1GC1C 3LPGA 5GIRA 5JO5B 5JXAL 4GQ9H 4JKLA 3PL6A 2Q86A 5BXFA 1P69B 3ECBB 1JPSL 1M71B 3GBMH 3PP4L 5IHBA 1ZWIA 4HHAA 3GNMH 4MJ5A 1CLYL 2OTUB 3WIHH 4W68A 4PGJA 2X89D 5BZDB 5BVPH 4RFNB 1F3DJ 2AGJL 3DETC 3CX2A 4MA1B 4PJDE 3VJ6B 1ZT1B 3BEWA 1GZQB 3CVHH 5GZNC 1MCPH 1MHEA 1CDBA 4WCYL 3PDGA 5CILH 2IGFH 5E2UH 3B9KD 4XBEH 2VZVA 1ADQH 4D0BA 5ISZB 3NPZB 3C6LA 4JY5L 4PGEB 2EYRA 1EXUA 1JTPA 1KJ2B 1EMTL 3AMKA 1FN4A 1FL3A 5DRWA 3H3KA 2VMFA 3QNXA 3VFMB 3B3IA 3C8KA 3A6CH 1T5XB 2X1WL 1OAKL 4JANB 3GSNH 1TVBB 4WNQA 2IPKA 3O6LH 4X9BA 5FYLL 1GIGH 1RZFH 3MREB 4LPTA 3VFGH 3MODL 1CD0A 3DXAA 4PREB 3R06B 4AEHH 5DVKA 4CL7A 4HMDA 2BX5A 1S7XA 3QWOB 3O2WH 4KZDH 1B2WL 4ODWA 4G7YH 1KN4L 4JKMA 3RWCA 5HGAA 3ZYOA 2OI9B 2B1HH 1ZANL 5D9SB 3RHWK 4XMPH 5AZ2H 1EO7A 3HI5L 5JHDD 3S96B 3IETA 3GSOB 4XNQB 2E27H 2WSKA 3D9AL 3P0YH 4XAKE 1LE5A 1M7DA 3QFJE 5GS0L 4UDUB 5H94B 2A9NL 4MB5A 1OM3H 4G6ML 1D6EB 1VFUA 3VXRA 4TVPH 2BJML 4QTHB 4HWUA 1KYOJ 15C8L 1IBGL 1T66C 1NC4B 3S88L 2CLRB 1D5XA 3BX7C 4JPVL 3MACL 3MLTA 2X7LB 5GQBA 1I7UA 3ME0A 1RZIA 3MR9B 4PJEF 2G5BA 4NO0A 1FRGL 5E08H 1HINL 3MO1B 3DO3A 3NCJH 3C08L 1A6VL 2F53A 4X7TB 5IFHL 4R8WH 3JWOL 1NUNB 5DD0L 3HNSH 3QIWA 2CDGA 1T03H 3DBXA 1NFDE 2IFGA 2WIIB 5E4EB 3DWTA 2J8UB 4IRSC 1TZIA 4P2OD 1OOAA 5DMJB 1BOGA 4HFWA 2VUOA 1U6AH 4HZAA 3BO8A 4ZOAA 4F15C 1FPTL 4I18A 3QNYB 2XWBA 3QUZA 1MNUL 2UVFA 5CJBA 3ULVF 1KYOK 2VAAB 4PRIE 43CAB 1N59A 1NANI 4R4BB 3MRRA 2X5PA 1Z3GH 1IILE 1U58B 4ZFOA 5FEBA 3FAWA 1TJIL 4PJEA 2BNRA 3CIQA 3IYLW 2NY5C 2FGWL 5EPMB 3DV4A 3JWNC 3TBVB 3QUYB 4P57A 3J8F7 5IHLB 4HGWB 1MAKA 4Q9QL 3RVVC 4P3DA 4BK4A 3H42H 5HPMA 3ZLQC 2CRMA 4QRSA 1M7XA 3BW9A 5TJWK 4FABH 5I1AB 4NP4H 3WEXB 5D2NB 1JPFA 4NWTL 1TMCB 1FO0L 5D6DC 3GHBL 1N64H 1CXEA 4J1UA 4HIXH 1RJCA 4GRWB 4QRPB 2GJZB 1NAML 4XH2B 3PE9A 5CJQH 1RZJL 4HUXB 4I0KA 5DQ9A 3W0WE 2RQ8A 1IEBA 5EIVA 4WTZG 1JHTB 3C8HA 4F9PA 5J57B 5C7XL 5I8KH 5J11B 4AJ0A 4FXGA 1HN1A 1G6RH 4LLWA 1JGUH 5HDLA 2DQEH 3IKKA 3FOLA 4YBLC 3EZ8A 1GGBH 3LQZA 4ZSOB 2ZKHL 4LVHB 2DB8A 4X6DB 5DJ2B 2CH8A 3ZKXC 1W0WB 1O7VA 4XAKD 3DO7A 3QUML 1S7QB 4JJHA 1FLRL 1I1RA 3SO5A 3M1BA 4H5SA 3W11C 1ZS8B 2ADIA 2H3NB 4ZG1A 1GGIH 5DRZB 1JFQH 4PJFF 3BP7A 1Q0XH 4O02H 1F4XH 4OKVB 3LKSA 3VWJA 1NJ9A 4OSUL 1FO0B 5IQ7L 2P5WE 4J6RH 5TDNA 1BBDH 1E6OL 5FM8A 2N7AA 1UJ3A 4UUJB 4O2EB 4GW4A 4TSBH 4WI3A 3VFWB 3WLBA 3PDOA 1NAMB 1P4IH 3ULVC 4PGDB 1MIML 4GAYB 4ORGA 1SEBB 3VDCA 4NC0B 5CSGA 4LQ1A 2O93L 3TPUA 3PWPE 3CDGA 1TCRB 5DT1L 4TUOB 3MYJB 2BRQA 4MVBC 1NBYA 1KEGH 5GS3A 1T2XA 2Y36L 4HCRL 3TO4A 4PJFA 4KV5F 2YOCA 1FYHB 2H6PA 4HX1B 1RZ7L 2P47B 4PRID 4QRQB 2NW3B 3GO1H 3KYKL 3MRQB 4U49A 1QFWI 3JVGC 3GSQA 4ZS6C 4CGTA 1H0DA 5DVOA 3DX8B 4PJBB 3IJSA 3BQUD 3RGVD 3O9WC 1FIGH 3DMMB 4KQ3H 3S4SA 5FHAL 3NACL 4OUOA 5CBEA 1HHIB 3TFKD 3TZVB 4MCZA 4S1RH 1KC5L 3H9ZA 2JB6B 1FSKC 4X6CE 3VXQB 3SE9H 1BQUA 1YQVL 3MOAH 5F96L 2CJUL 2E6PA 3MRKA 3MBEB 1PKOA 1CE6A 1WSST 4L8CB 4K7PL 2A9MH 4R4FL 4DZ8B 4NZTL 4HG4J 1NGPL 4JQIL 4HZLA 4APQC 2PETA 1EO8H 3I50H 5T1KD 2DM4A 2PO6D 3IDXH 3SBWC 3SE3C 5SWSA 4BH7B 4FTVA 5GIRB 5TPWH 4X7CC 1E4JA 3U1SL 4G8GB 4I3GA 4ODUB 4PB9L 2APXA 1YN6B 3NH7H 2VE6A 3CFEA 4X6FB 1NLBL 4L1DA 1IE5A 1FDLH 3D0LA 1U8OA 1HKFA 4PRHB 3W0WD 4M62H 4V2CB 5L88L 4MNHB 3T1FA 1DR9A 1A3QA 3N1MC 5IQ9A 3K2UL 1IGCH 4U6VL 4OM0L 1TVHA 3TO4C 1RK0A 1FORL 3QI9D 5TE4H 1MRDH 1VFBA 3T0EC 5DJ8A 1HHJB 1MCRA 4B50A 5BZWB 1MHEB 4DCQA 1ZA3B 4N0FA 1SYVA 4NM4L 4P2YA 1D9KB 4HG4K 4FG6C 4X5WA 3NPSC 1Q72H 5DJAA 4M7ZC 3CZFA 3F7YB 1MY7A 2BVQA 1FGNH 3IDJA 2AJ3B 1JGEB 4LVNB 3OKOA 4EZMA 5DVMA 2OJEA 3WCYA 4QHMB 5F88A 2X6MA 3WN5C 4P9HH 2YWZA 4OCYL 2O61B 2KQMA 4QWWD 3UJTL 4P2RE 5LGJA 4WEUD 4ZFGH 3LEVH 1B9ZA 1MHPL 1S7XB 4QKXB 3H0TB 3OR6B 2XRAH 3HFMH 1DBKH 4OZFB 3BE1H 2NXZD 2YC1A 4PJAF 3QHFH 1B0WA 4OGXL 1CGSL 3U4EA 3UTZA 3P4MA 2YUWA 2B5IB 1DCLA 3PWPD 1S5HB 4U1IA 3RIFF 2A77H 1ZHKB 4YHLH 1UEMA 3MBXL 3MNWB 3FQNA 2CK0H 3HMXH 2VLRD 3PDDA 5K9JH 4KK6D 1HHKA 3FTGA 5I9QC 3RGHA 5E9DE 1RJZB 5C0GA 5CJOH 1FNLA 3IGAA 4PJ7E 4EI5D 4HBQA 5CEYA 4XWGL 3FB7B 2HLAA 1JVKA 4YXHH 5KSVA 4OT1H 1ZEAH 4ZXBC 2VL5A 4QHKJ 2XPGB 5HYFA 4LLYA 4PJAA 1WBYB 3MLTB 3V7AE 2NY3B 5TH2B 4MWFA 4G5ZH 2YPKA 1P4BL 1IM3A 5D1QD 3GMRB 3KPTA 2PN5A 5FIEA 3ARFB 4FFWD 2GT9B 1T7VA 5BW7C 3V5DB 4PYHA 1LO5A 5EBMA 1MCQA 5DUML 4P5MA 1K6QL 3LRSA 3BN9D 4KROB 4M5YH 3RPKA 3HUJB 1X4ZA 2YMXL 5DYOA 1MFBL 2W9DH 5C0CA 3NA9L 5GGQH 4ELKA 1C5CH 1A64A 4GLRI 1SJVA 3QULB 3QUZB 2PR4H 3SKNB 4KVCH 1QVOB 5BRZE 4C56A 3SGEH 2FLBT 3KPRA 5C0JB 1N4XL 3OWEA 5C6PB 3FT3A 1JGDB 1IC1A 4PJEB 4R96A 3PJSA 2VXQH 5IBLC 1FNAA 4A6YL 2MQCA 3AS0A 3B83A 5CUSH 3IDGA 4XMKL 3UYRH 2R23B 1U8NB 1UKQA 2WV3A 3D3VB 1NGQL 2YR3A 3OJDB 1QFOA 2B4CC 1IGIL 3V52H 1BVZA 3SKOA 4QRSB 3VXTA 4UMGA 1UM6L 1I8LC 4RMSA 3HAEG 3TN0B 3K74B 2BXYA 5EORL 2ZJSL 4JDTL 1ROWA 4GT7A 4P2RD 2OLDA 3WNLA 2LAAA 3T0VA 4XAWH 4KPHL 4OUUA 4C4KO 2ZUVA 5FM5O 2LQRA 3FMGH 1MCFA 3IFOB 2DBLH 3STLA 1IC4H 4JPIB 3GSVA 3P4OB 3T2QA 2UY7A 3BVNA 3X12B 4FXGB 1ZLUK 5FXCH 2V5YA 3U7AA 1MCEA 5D1ZC 1H3PL 2B7DT 4R26H 3NFSH 1T1ZA 1R3JA 1N3NA 2BNQB 3NAAH 4LHQB 5E9DD 4A6YB 5KSUA 1DBML 1F8TL 2HA1A 4KAQH 3X11B 2GAZA 2IWGA 2MCPH 1I1AA 1R24A 3GKWH 4H5SB 3JTTA 5KTEH 4U7MA 1LNUB 2X4UB 4YNYA 5B38A 1IKFH 1KB5L 4RBPH 4NCDA 4XC1L 3RA7L 1JZ6A 3DYPA 4ZUUA 3ZSSA 4F58H 2GUOA 2NY0B 5EZOL 1YEGL 4PTTA 1NCWH 3QDME 5DHVB 2AABH 1I85C 3QCVL 4FNLH 3KYOA 4GBXC 4YHIA 1M7IA 3PHSA 3LRHA 1OGTA 1XIWA 1HZHH 4ZTPL 4P23D 2XN9A 5ESQB 4JFOA 4GW4B 3TIDB 3BRFA 1FCGA 2CR6A 1UWGL 2YKLL 1KOAA 1BOYA 5L9DL 1YEKL 2ZPKH 5C0AB 4OLXL 2A6IB 3EW3B 1K5NB 4KXZI 4FQLH 3NFPA 5F89B 3TPUB 4BZ1H 3H9YA 4NC1C 5AYUH 1UCBH 4WUUA 5C0IA 2Y6SC 3ARRA 5DJ0A 5D7LE 4Z95L 2V2TB 3QT2A 3QDJE 1IKNC 1LO3H 3WIHA 1WFNA 1N0XH 4GSDL 3WO3B 4KJPD 3BAEL 1FL6A 1OT2A 5BRZD 4HIEA 4BH8A 3VFPA 5EFIA 2DI7A 4KI5C 4G80A 5F7EL 4AZ8A 3ARDA 1U36A 2GTWB 5SV3A 3KPSA 2ADFL 1A1MA 3MMEA 4FFVC 3UBXB 3C60C 5I15H 4XCCH 3CVHA 3ARZA 1EEZA 1KB5B 3ULUF 2R0LH 1ZLWH 3RX7A 3DVFA 2ED9A 4BZYA 1G7LB 4FFYH 1W0YT 2AS5M 1U91B 4EN3D 1AD0B 1KNOA 4I13B 2GK2A 5I1HH 2E7MA 1NCAL 3RZCC 8FABB 1FV1B 5DUBA 4XB7A 3GSNA 2YEZA 3T08A 4M8VA 3P9MB 2GSIB 4YO0A 1X7QA 3QHZL 4HKXB 2HJKB 5D2LB 2CKBH 1HH9A 5D1XC 4LMQE 3L5IA 4S1DC 2CMRL 1DL7L 2EIDA 3MLZH 1JUFB 4OIBA 5KANI 2G2RA 4Y2DC 4R7NB 4MQTB 3HZYA 3T1FB 4FHBD 2NX5A 4JFEE 2FATL 3D2UB 3VWKC 1F02I 4F57L 3RTQA 3RY6C 2KL6A 3WSQL 3RU8L 4QRRA 5HYJA 1A9EB 4POUB 5GRVL 4DCQB 3BZ4A 3A67L 4N0UA 1ED3A 1K2DB 4KRPB 3IDIA 4WU7A 3WNPA 2AJXL 1H3VA 3OZ9L 4UBDC 5CGMA 3X3FL 5I8OH 1K4DB 4KTDL 1JNLH 1A7PH 3DROB 4HJGB 5LAXB 4PR5A 5DQJB 5KN5B 4JKKA 5I1LA 4IJ3C 4K3DH 5LGJB 5K9KA 1CXHA 2DQUL 4N0YL 3ALPA 4MJIE 3B5TA 4OZGF 4U3XA 5E00B 3UTQA 4LP4A 4TNVF 2NY1C 5AWNH 5D8JL 4BQ6A 3Q6FA 4Q74A 4MCYB 1E4KA 2UWEE 3U0TB 4FA8A 3RWHA 3P4MB 4XNUL 1IZKA 3OAZH 1GRWA 1U8PB 2HLFD 4OIAA 3EYSH 3KPNA 4UTBL 5DTFA 2CUIA 4GJTB 1T5WA 5C0FA 1LO2L 5JW4M 5FDYA 3FTGB 3MV9E 5IB1B 1HEZA 2R2BB 1QLRA 1HWHB 3QDJD 2R8SL 4DVBA 2A6DA 3QWRA 3U7YH 4X4XA 2FO4A 3TA3D 3ZDZE 4JRYB 1A6ZA 3L5WA 4P4KA 4R0LA 2R2CA 1FAIH 2HLAB 4ISVB 4EKXA 3IRZA 4O51A 5DHYB 1T1YB 4IIQC 1T4KB 5AUMA 4Y16D 1YECL 1DFBL 3FB8B 2VL5B 4RGNE 3ARBB 5JZ7D 1I3UA 5T3XL 4OZGA 1E4WL 2HJFB 7FABH 5FYJH 2DD8L 5FA4A 4L4JA 1KXTB 1Y18A 2NLJA 2ZNXA 1S7SA 5A3ID 5IESH 2VDPH 1MLCA 4HWBL 4Z7QF 1VEMA 5LQBH 4ODHH 4CMHC 5CP7B 4OZHE 1AKJD 2VKWA 5KVFL 4ELMB 1ZVYA 3MRDA 1WZMA 4ZFFA 5DMKA 1LO5B 4YXKL 3LN4B 2HAZA 3MCLH 4UQ2A 2V7HB 4Q2ZA 5K93A 3LRSB 3KJ4B 2E9JA 5D7IB 2FYYA 4YR6B 5KSAA 4UAOB 4OJFL 2D9QB 5EIIA 4J23A 4MXVE 3T77B 5DYOB 2C1OA 3GMNA 1R6VA 4WJ5B 1O0VA 4HPYH 2B8OT 4PRAB 3O3AA 3N85H 4Z7WE 2B2XL 1WK0A 5KZCD 5C08A 4EUPB 1J1XL 4Y19E 4JPWL 2IC2A 5F9DC 5ACZB 2E7CA 1G6RA 4JFED 1IC7H 3CFBA 2E9IA 2UY6A 1BFSA 4JO4H 4P3CL 3OPZH 3MRIB 1OGAD 1CI5A 1HXYA 4QXUL 3UYOD 1EEYB 4X5XB 5JMRA 2HG5B 4R0LC 1FGVL 1H3UA 2JKXA 2IH1B 2H2PD 5DURD 1QSEE 4U1MB 1T21B 1SBBA 3VCLA 4XVSL 4FQQB 1R3KA 1ZKAA 1VDGA 2XTJC 3QDHA 3VXTB 3LKRA 4EXKA 1KFAH 4JFYB 4CVZA 4Z7OF 1FZOA 3O8XA 4H20L 3MLVL 2SEBA 3NN8B 4QXTA 3U6RB 4PJCF 4KGJA 4LF3A 4ODSH 4EXPX 5D72L 1S7WB 4IRZH 2YHGA 4FQXD 1WV7T 1H8SA 3Q3GA 5A16B 1FZMB 5KOVC 1ZVSA 3PWNB 4MJID 1DEDA 3PWLB 4KJWD 2AP2A 3MV7E 5ESVA 2NNAA 4WV1B 4LCUA 5J13C 3E6HA 1PD6A 4RDQF 3STLB 1FVCB 2XIDA 3GJFK 4GQ9L 4O4YH 3GSVB 3G6AB 1QLEL 3B9KC 5TQ2H 4PJIB 5T3ZE 2E5EA 4W6WB 1S9VB 4PBVC 1N3NB 3GNML 4QT5B 3WIHL 2ENSA 2VO5A 3QPXH 1P7KA 1FYTB 3D1MC 3BD3A 2UVEA 4JFHE 4L9DA 1CF8H 5EUKA 4KK5D 4LKCA 5TF1H 3LKPB 5BVPL 4PJCA 4Z5RA 3C09B 3CNKA 1HQ4A 5KVEH 4Y5VA 3NFNB 2P45B 4MXWH 1INQA 4RGND 3CVHL 1HCVA 1IVLA 4ZO6A 2RFXA 2GUOB 2IGFL 5E2UL 5CZXC 4XP9H 5INCA 5HHQA 1ZGLA 1ADQL 2BVYA 4YHIB 1T3FA 3QB7C 3TCLA 4Y1AE 1WITA 2C3HA 2YD1A 3A6CL 4WWID 3SCMA 1F2QA 2EE2A 3RIAF 3U0PA 2HFFB 4O2CB 3GSNL 4YH6A 5EH1A 1PYWA 5FM5M 2L7UA 1IC5H 1I8MA 3HMWH 3O6LL 2FNBA 1RZFL 2APWA 1IGJA 5FAAA 4JQVA 4JO1L 4XBPA 4G6FD 5FOBA 4AEHL 4MD4A 5C09E 3HZMA 2Q3AA 3D85B 3EOBA 3PABB 4KZDL 1XR8A 3NCMA 3T2NH 4G7YL 2EDRA 4E41E 4Y19D 1FJ1B 3REVB 2MMXA 3FO9A 4LPCA 3DURB 3FFCB 4XMPL 4F7PA 1JMZA 5AZ2L 1JE6A 2OL3H 2Q8BH 1WBXB 3VXNA 4LHUA 3SJVA 5DEGA 1D5IH 4QOKA 4Y5VC 4D0DB 2LFGA 4CKVX 2WMPA 4Z7VF 5J56B 1UKSA 1VCAA 4P2OC 2ERJC 3KXFE 5L6YH 4KTYA 2B0SH 1JTOA 3BXNB 4E5XB 3MV01 3C9NA 1X5AA 2VXSL 4QO1A 5E2TH 4OFKA 4PJ8B 3GSNB 3QQ3A 5FGCE 5HDBF 3SCMC 5E08L 2E7BA 3NCJL 2DWEA 2VIRB 5JORB 1LK2B 3F7QA 3MV7D 3I6KB 3SHSA 4V1DA 1S9YA 3W2DL 1T03L 1Q38A 3HZVB 3RRQA 5IB4B 2HMID 3OKEB 5IW6A 1K8IA 4M7LH 3EAKA 1E4XL 1DVFD 4MQ7A 3PP3H 4D8PA 4Z7VA 2Y5EA 5A2KH 3OB0K 2CUMA 2DTSA 3CK0H 2R0ZH 4KJQD 3HMXA 4U05A 1FNEB 3BPLC 3IFPA 5SWQA 4HH8A 5HGBA 1MFDH 4JFHD 5CD3A 4ZNEE 1ED3B 2PYEE 5F9WC 4ORZC 5E6ID 4WU7B 3PHOA 2V9QA 5IP4A 3TNMB 5MHSE 3VXME 3WE6B 4I0PA 2HVJA 5F6HI 5GS2H 2BNUA 2F5AH 3AB0C 1YC8A 4LU5H 1EX0A 4RGOH 1OD9A 4IMLA 2ESVB 1EJ6A 3LKNA 3OR7A 3S3JA 1NEZG 4Z77B 4WU5A 3W5MA 3O6MH 5GJSH 2M8XA 4Y1AD 4AL8H 4FABL 5IEKB 1OTUD 5EO9B 4NP4L 3D18B 4XCFH 3RWHB 2LTQC 4BFBD 3QRGH 4HIXL 3M07A 2H9GA 4NT6A 3EYUL 4LGRB 1UH4A 4U1LB 3STZB 2EDFA 2HJLB 5C09D 5CJQL 3RUGB 1HSBA 1AGCB 1FE8H 4I2XE 4IS6B 4JDZA 4XX1G 3MRMB 3O4LB 1UACH 3OKLA 4BFIA 4E41D 5F7HA 2Q7YB 4NNXB 3V0VB 2FO4B 2DQEL 3VG9B 1XZ0A 4GKZB 5F9JA 1AQKH 2QADD 1GGBL 2NZ9D 3WBDA 1CTOA 4YDKH 2Y06H 4NN6B 1UXSA 1PX4A 1A8JH 1P2CA 4OZGB 1WIPA 3WUWB 3EYOA 1QRNB 3MROA 4X6BB 3NABH 2EKSA 1BVKB 1MLCB 5HYIA 4DGVH 4MJ6A 4PP1D 5JW3L 4P0DA 3KXFD 4MNQE 5ABDE 1G7QB 1OD7A 1GGIL 4BQCA 1JFQL 1SMAA 3VFTB 3O4OC 5B3JF 1VESA 2ZG2A 1V3MA 1F4XL 4JZJB 2UYLA 1OQOA 2N1KA 1KJ3L 4X9IA 4AIXA 4Q2ZB 2I60H 4U6TA 4J6RL 2J7LA 4MD0A 5E7FA 1WAAE 1BBDL 4HLZH 4YIQA 5L2KA 3VGAC 1A3LL 1SJEB 3ZHKA 1P4IL 3BQUC 3RGVC 2VXTL 5MENE 2WZPD 4KRMB 5CEZH 3W82A 3FOMB 4GRLD 3SPVA 3TFKC 3P40A 4OI8A 4HJ0D 5IK3A 1A7BA 1LDPH 2PUQT 1RUKL 1CICD 1P7QD 3KYNA 4CJ1A 3EDKA 4HUNB 4JHZA 1JK8A 3D87B 4EJ1C 1KEGL 1A7QH 2DQIH 5C07E 4L8SC 1AD9A 4WUKL 3SDYH 4UQ3B 5IEHA 3GO1L 3MGOA 5EWIH 4DAGL 2OMNA 3T3ME 2AXHA 2W60B 2PYED 3MRGB 4MXQD 4P2CG 1CDGA 1FIGL 3L6FB 4KQ3L 5EU6A 1UQSA 3VXMD 5SV4A 4S1RL 4KHTH 4YHKH 4QXTB 1UM4L 3RX5A 2WBJA 1KPRA 1IJ9A 4J3OC 2EDKA 3HC0B 4LF3B 2VLRA 2P5EE 1V3JA 3H9SE 3FN9A 4LRNH 2WQRA 2V7NB 1JF1B 5EBGA 2DI9A 2A9ML 3TESA 3T4AA 2YUZA 1I8KB 4U1KB 5ESVB 3SE4A 3I50L 1EO8L 3QI9C 3IDXL 3V9FA 1CCZA 3KNBA 3PWVA 5TPWL 3QCUH 4NQVA 3V8CA 5GGRB 3ZSTA 2MKWA 3GDBA 3H9HA 4TQEL 3NH7L 3ZTNH 1ZHBB 1Q94B 2EKJA 1F6LL 2XKSA 4Z7UF 5C0BB 2IQAA 4JVUA 3U4BH 5F9OL 4M62L 4ODXA 4LSTH 1ZTXH 1UJTA 1IAMA 3B6SB 3KLSA 1CDJA 5EBLA 2EIZA 1IGCL 4YEFA 3LV3B 5D5MB 4QWWC 3K4DA 5EOQH 5TE4L 1U41A 4TPRH 5I1EH 4MAYA 4LCWE 1ZA6B 2VLLA 4L4TE 1QBLH 1J8HA 3ZDXE 1C12A 1U93B 4FP8H 2VR5A 2EO9A 4R97C 1BD2B 4PG2A 1AGDA 4AMKH 4LBEA 2Z92A 1S7UB 5C2BH 3VA2C 1Q72L 1AIFA 3MRNA 2G9HA 1T83A 3BGFB 1YJDL 3G5YA 3W9DB 1IL1A 2V5RA 5GRUH 3NBNA 1FGNL 4U1SB 4G9FA 1BP3B 1VKXB 3BZEA 4Z7UA 3GMOB 4LSVL 2WBJC 3VFOA 4WFFE 2ZCHH 1EEQA 4KK6C 4W4OC 4P9HL 2W0FA 2WP3O 4EEEA 1YNKH 5IB5B 4U6XA 5H35B 4WY7H 4ZFGL 3LEVL 4EI5C 5DK2A 3LB6D 1CFVH 2XRAL 1GC1L 3HFML 1DBKL 3BE1L 5MEND 2V9TA 3PXJA 3QHFL 3O41A 3F7RA 3QISA 1MELA 1Y0LB 1GL4B 4J4PD 2F8VA 5IVXF 3TBYA 2DTMH 2A6KA 4M9PA 2A77L 2WK2A 1MOEA 3GB7B 4YHLL 2QV2A 3WJJC 2CK0L 3HMXL 3DSNA 2PCPB 5D7JB 5TGBA 5K9JL 2OK0H 4OF8A 4P3WA 1NCDH 5D1QC 4G42B 3QEQA 5C07D 1GVIA 1C7TA 2DI8A 5CJOL 5ANMB 3VXUA 3G5VA 3OKKA 5I17A 2EYTB 4XX1E 3BDYH 5ICZB 1WIUA 2QL1A 4YXHL 4OT1L 1KT2B 3BN9C 1ZEAL 4KK9D 1ETZA 1UB5A 2BSSB 3BIAX 3WLWD 2R1WB 1NC2D 2VABB 1RUMH 3ARVA 5HHOD 32C2A 2ICES 5KS9B 3EO1A 1KCLA 2P5ED 5IVXA 3PF2A 1NMBH 1PJ9A 2IADB 4TUJB 3F7VB 4PV8B 1OSPH 2EYSB 5F7MC 4QF1B 1BLNA 4Y4KD 5IHUL 1NGZB 1BZ7A 3BDBA 1MWAL 3IXAA 3M8OL 3T2PA 5IUSA 4NFDA 4M5YL 5IW6B 3BKYH 5IIEA 2YA0A 4NRYB 5I30H 2W9DL 1YEDB 3G08A 4JHAH 3BPOC 5EU4A 1C5CL 2XKUA 3MTRA 4ERSH 3AS3A 4JLRB 1JHLL 1T20A 3OKNA 4NM8H 4F9LC 4L9LA 3ZDYF 3L1OH 4KVCL 1EO5A 1I7RB 4OCWH 3ALWA 5IVZA 1TETH 4P48A 8CGTA 4H8WH 3NIFF 5E03A 3PHOB 3X13A 3OB8A 5GXBB 1QD0A 1WC7B 3RI5F 4LLQB 3R8BB 5T33L 3OAYK 4LCWD 2W9LA 4HT1H 3MV8B 5E1AA 1QA9B 3PWUA 2A6JA 3V5KA 3UYRL 1ORQB 2DQHH 3HZKB 3JUZA 3WS6A 4PGBA 2X4NA 2QKIB 3IDUA 4PRNB 5LKNA 4HKBA 3PHQB 4JFFA 3V52L 3MOQA 1NBZA 1QSFB 2F58L 1J11A 5FUZH 1S5IH 4OB5H 4IM8A 4NPYA 5HVHB 3D0VB 4WFFD 5CCKH 3OKYA 4L29B 2FJFA 3BGMB 5KSBE 4PJ9D 3PXHA 4P46D 4HKZA 4UIKH 5IOPB 1G7PA 1AGBA 2R69H 4OZIB 1MWAB 4XAWL 4NQDE 2W65B 4MA3B 4K8RD 4LEXH 4KDVA 3FMGL 5DZLA 4U6HA 2EDTA 1FVEA 4U33A 4YFDB 2XWJB 1I9RL 4BFIB 2BCKB 5SWZE 1TIUA 2VZUA 1BHGA 1RHHB 2D9CA 2F8XC 1JPGA 3L5XL 5ERWB 1NCNA 4R26L 3DGGA 3NFSL 4L9LC 5MERB 1CGXA 5ITFB 3VGBA 4GKSA 5CEXA 1JGLH 4GUPA 4P23C 3NAAL 3KPLA 4PJHF 4RAHA 5JDSA 4NO2B 5F3BB 1DUZA 4GG8A 4KAQL 5EC1B 5EN2B 2OX5A 3MOBL 3AREA 3MROB 1FZKB 1S9WA 1NMCC 1GOFA 1MCCA 2XNAA 4HIJA 4IBLT 3S6CA 2MCPL 3GKWL 3MPCA 5CBAB 1MHHA 1SJHA 5D93C 1AJ7H 3QRFM 1U8MA 4F58L 1E4XI 4OCXH 2VN4A 2VZOA 4MQXD 4JG1L 4HJJH 4TSAL 3GK8H 1NCWL 2AABL 3AAZA 3HE7D 4HMCA 4FNLL 1DEEA 1E6JH 4EBQH 4XRCA 5HYSB 1DQDH 4WEMB 1HZHL 2NY6C 5SX4H 4M6NH 4KJPC 5GSRA 3A0OA 4K55A 4WFGE 3WIIH 5AYQA 5B8CC 3HPJB 2ZPKL 5LCVH 4PJHA 3F65A 1KLFA 1X5FA 5EU5A 5KVMC 2X4PA 4FQLL 3GSWB 4IRSB 2EXYC 2JELH 3VE0A 1Q9KB 3BMVA 3DVNA 1YEHL 2Q76A 1UCBL 4Q6YA 3QEHB 2ZUUA 4F15B 2OCFD 4B7IA 4EN3C 4DFHA 2X70B 1LP9F 4KVNH 4KI1A 2H26A 5AG8A 4DGIH 5CIPA 3ESUF 2OR7A 1AO7E 1QQDB 5CZVH 1MFNA 3H7BA 4XCCL 2FSEA 3AFLA 4D3CL 2R0LL 2IANA 3HR5B 4JRXA 4OD2B 4AQ1B 1V7NH 3HTLX 2IALB 1NL0H 3ARXA 5IM7A 3PGCB 4PJ5A 4NHCH 4XMLH 4BYHA 3I3EA 4YWGH 1NGYA 1JYVA 3LRGA 3GSUA 1KCVH 4K23H 1LP9A 2OQJA 3LQAC 3NGBC 4FQPA 4PG9A 1J0ZA 2XY1A 4YBQD 4L4VE 4NQDD 2CKBL 4XNMB 4X7FC 1KXVC 2EDYA 3EKCA 3MFFB 5C3TA 4WI2A 3MLZL 3ARQA 1QFHA 5SWZD 3SO3C 1HDMA 3V5HA 1QO3B 2X9WA 4YQXL 2FGZA 3DIFB 1GOGA 3LH2L 4YBLB 5IG7A 5J6GB 5DI8A 1VPOH 4K3JH 3REWA 4J2XA 5KG9A 1I1FB 1C12B 4NNYA 3ZKXB 4ALAH 2PKDA 1TZHA 4U1HB 2Z92B 1GHFH 3E2HC 5FHBH 1YEEH 4MD5B 1PG7X 5F1KC 3QEGH 2HLFC 2AK4B 1RIUH 1OAQH 5I8OL 4CJ0A 5C9JB 1JNLL 2H45A 1A7PL 1GCFA 1ACYL 4DQOH 2F5BH 5KANG 5ENWA 2W0FB 4YUEH 1JV5B 3S5LG 4K3DL 4YHNB 1BX2A 1OGAA 2YBRA 3Q0HA 3IU3B 3G6JF 4L8BB 1MJ7H 4BSVB 5C2UB 3SDAD 3TA3C 2DQCH 1PZUB 4WFGD 5MP6L 4G6KH 5IWLA 2J4WL 3OGCB 4L3CA 5F7FA 3DI3B 2CKBB 4KDWA 5FYKE 4ZO7A 2VAJA 2BSRA 3N50A 4Y16C 1C16B 2H32B 5JZ7C 2PXYD 3EYSL 2IBBA 2R2EA 3FAXA 4ONOA 1ZSDB 4XCNA 1T0NA 1UZ6F 6FABL 5J89A 4L5FH 3IS0X 4JN2A 4OV5B 1G1YA 5A3IC 3RWIA 1XF3A 3SDDD 3VRJA 2D7TH 4OKDA 1C8PA 2MNUA 3RKDD 3MJ7B 4Z7NE 3VXUB 1NCCH 4HKJA 3U7YL 3SY0A 2WAHA 5I17B 1GGYA 3QH3A 1W2KT 4JM4H 3UZVB 1FAIL 1XGQB 1AO7D 3IXTB 4NBXB 3G6JA 4LEOB 1PX3A 3O9WB 2Y25A 3QXWA 5LXGH 4YFLF 7FABL 5FV2A 2HTLD 4MA8H 5C3LD 1OAZH 1CIUA 1MHCB 1FSKB 2FH8A 3HAEA 3T8XA 4HGKC 4XZUB 1RQ5A 5IESL 1ZHLB 5K9OB 5LQBL 3MFGB 4ODHL 3UDWA 1R5WA 4C83B 1AQDB 2WANA 3WFEH 1BIHA 3OXSB 2V5TA 2XKNB 1JCKA 3HCVB 4MDIA 3MCLL 2G75B 1HWGB 1KELH 2MHAB 1AFVH 3EFDH 4W4NA 4P99A 2P44B 5AAMA 4OLWH 2H2PC 4HQQH 4PUBL 3Q6GH 3KHQA 3G08B 1P1ZB 4HPYL 1HH6B 5DSCB 2AXGB 3GIVB 4MQSB 3N85L 4K94C 3O81A 2ICCA 2NW2A 2BMKA 1RIVH 3K1KC 4YHPA 4H25A 4R3SA 5CP3H 1UZ8B 4XCYA 5IVZB 1IC7L 3X13B 3QUXA 5H37H 3OPZL 5J6HA 3QDGE 4FQXC 5EOCJ 5IVOA 4MNGB 3SQBA 3L9RA 4MDJB 3IFNH 4PV9A 1UYWH 1MLBA 4KJWC 2CDEA 4MAUH 2VRAA 1Z9SA 4NGHL 2VLKA 3VXSA 3NPSB 1F13A 4UT9H 3X3GH 4OLVH 5JLZB 1IZJA 4JFFB 2AEIT 1BGXH 1KFAL 2CXKA 4JM2F 3CDCA 1OB1A 3L3KB 4PRPE 4M48H 2AW2A 3TT3H 5FKPB 3V6OA 3UDWC 3WN5B 4ODSL 4U1NA 4I3SH 3L3DA 4IRZL 1AGBB 4KK5C 4YGVA 3BWAB 4UT7H 4WWKD 3FN0H 5GZOD 1WZKA 1MUJB 3PQYA 3RDTD 2HH0H 4RGNC 4O4YL 1IM9A 4F2MB 5E5UB 4RQQB 1OT1A 3P9LA 2L0DA 3QIBD 1UWXK 5DJDA 2R0KL 3UAJD 5LWYH 5DJZA 3WFDH 4NKMA 4JM2A 3DX9A 1QR1B 2FZ3B 1N2RB 3QPXL 3C8DA 5JDSB 5TF1L 2CRIA 1CF8L 1C1EH 4QHUA 43C9B 4QRUB 3BYYA 4XVUD 5DJYB 4XPBH 1MQKH 5KVEL 4ZPVB 4QNPF 1F6AB 1MIEH 5GGSA 2DL2A 4ZXBB 5BV7H 1MHHB 3GSRA 3BH8A 1YPZE 3LS5H 3UZQA 2J6EH 2DJUA 2VTFA 4XP9L 4DZBB 1YQ2A 3IJYA 5IJVA 1HSAB 5ADOH 5I71C 4ZFZA 3UTTE 3WXVH 4GW1A 4NQEE 4ZO8A 1RZGB 1YY9D 1DQQB 1XF4B 3L7EA 3EDFA 3HG1A 3SGEI 3VGHA 4IRJB 1IC5L 3HMWL 5GS0D 2A73B 4KUCD 1SEQL 2PNDA 4Z18A 4GAJH 3BT2L 1T7XA 2GCYB 4G8FA 2HT2D 3VFRB 1ZOXA 5F7LB 2YPLB 2DS4A 1CVRA 4E42A 3PGFL 3C6SB 5I19L 4R2GD 4XP6H 1H5BA 4NO3A 2YZ1A 1CD9B 1XF5A 3EGSB 1VENA 1RULH 1Y6NR 1RUPH 5JUEH 2JCCE 3CH8A 2OL3L 2C9AA 2Q8BL 3O6FA 5CJXC 5T5FH 4DKEH 3QDGD 2OM5A 1RZKH 5DR5H 1D5IL 2ZWLT 3Q2CA 2D0HA 3CUPB 4Y4HD 2Y9RT 1RURH 1A14H 2KBGA 2HMIC 4KDTC 1KJ2H 2Z35B 4HV8A 4M1DH 4ODVH 5L6YL 1DVFC 1OPGL 1S78D 5F21B 3TWCL 4HUWA 4OCSH 3UPCA 2UUDK 5DDHB 4PRPD 5C0DA 4G3YH 4KJQC 1L4IA 4JFDE 3FO1A 4NNPL 1LP9B 4G9DA 2I07B 1OP3K 1NAKL 5EU3B 4N8VA 4Y4FD 3O3BB 4Q6IA 5I8CA 4O9HH 1YDPA 5F1IA 1M05A 3CSYA 5E6IC 3VG0H 2AJVH 2C4XA 2VLJB 1A3RL 4NQSB 1L0XA 1F11A 1UENA 3PP4H 2F54A 3N1QC 4C4KT 1G9MC 5CAYB 2Q8AH 4D9QE 1ZGLP 3NZ8B 5D1ZB 2WBWB 4ZUSB 4F7TA 3FHQA 3O3UN 3CK0L 3QZWB 4JO3H 3SDXB 3FQRA 1CXIA 3HPLB 4NOBA 1WTGT 5DFTA 5DI8B 2OL3B 2VITA 4LRIC 1MFDL 2I9LB 4NNYB 1OTUC 1RUAL 3DXAE 3TP4A 2AXFB 2ZUQB 3O6FC 3EYVA 3AU1A 5IFAH 5FF6B 5D71H 3MJ8A 2EDEA 2EDHA 4K7PX 3ILPA 1G9NC 5ACLA 3S4SG 2ITCA 4XVJH 1I1YA 4PGCB 5AAWA 4RMUA 2F5AL 3LSOA 5DJCB 3X14A 5BS0B 4RGOL 5D96C 4YFEA 3IRPX 4PD4J 4GBXB 3MCG1 3UTTD 3ISWA 3OAUH 4O2FB 3EO9H 1AY1H 3O6ML 5GJSL 5IROA 5FYLH 4NQED 3WS3B 3G5XA 2ZG3A 5JHLH 2QADC 5E56A 5EZJB 1KENL 3KR3H 3S36X 3L3JB 3LQMA 5HHXH 2Q6WB 2BSRB 4Q6IC 3VXRE 3B8SA 3HLAA 4X99B 1EFXA 4FXLA 1B2WH 1MAJA 1KN4H 1P6AB 4F7EB 1T0NB 3BPCA 1FE8L 4QHLB 3RWIB 1HQRA 1ZANH 1XF3B 5AZEH 4PP1C 1WWCA 4XHQA 1UXWB 2DQDH 1UACL 4UILH 1KLGA 1M6OA 3UO1L 3HI5H 3WIFB 1A4JA 3WFBL 5IJKC 3KPPB 1JWSB 2IPTH 4L3EA 2F53E 3FCTA 1AQKL 3QA3A 3AMLA 1U9KA 4YDKL 2Y06L 4PD4K 1YUHB 2A9NH 4G6MH 1F3DH 2FL5B 1KLUA 3AXLB 2BJMH 4OF7A 3PL6D 4HS6B 5J1AB 2YA2A 3TBTB 4JPVH 3NABL 4ZAKA 3MACH 2AEQH 4GRLC 3SDCB 4WI5A 4DGVL 2OTWB 4HJ0C 4QTIL 2BC4B 4PFEA 3V6ZB 2RBLA 1CICC 1FRGH 1IQDA 1HINH 1Q1JH 3AM8C 2ATKB 2Y1VA 1U95B 5DRXB 3RZCB 3T09A 4CU8A 4RSVA 5IROC 3QUKA 3JWOH 2BNRE 4TULL 1MH5A 3QXVA 4OBRA 2AV7A 5CS7A 3VI3F 4D0CB 2CDFA 4HAGA 3VXOB 1J0HA 1B6DA 4MXQC 1T66D 5D1XB 5HHNB 2JJTC 3CMGA 4WDIB 4XT1C 2E3VA 5CEZL 4H1LB 4CVWA 3C6LD 1JWUB 1J5OH 3B9VA 2ADJA 5E8DH 3OKDA 5IT2L 2XZZA 4D9QD 1QPPA 1MNUH 5SX5K 3T4YA 4PJXB 5M94B 1QPXA 1TPXC 1FFPA 1F97A 3QXDA 4X9FA 4U7SA 2YPVH 5EO1A 4M6AA 2DQIL 3ULVE 5CWSA 1EHAA 4F8QA 3SDYL 4Z76A 4W81A 3U36A 1MLBB 3DXAD 2CDEB 4GFTB 2DQFA 1CFTA 4U1JA 2FX8H 4URTB 2PW2A 2R1XA 4Q9QH 4JY4A 2IPUG 3PG2A 4NKOB 2NTFB 4KHTL 3VRIB 3L3OA 1OB1B 2H41A 1ZT4B 3BP5B 1XMWA 1NGWA 1U2HA 4IJ3B 4LRNL 5DC9B 3QIUA 5T1LA 3D25B 4M93C 4NQCB 2VDLL 4XPHH 1H15B 5I74C 5TE7H 1NAMH 1CVSC 2Y7QA 1KIRA 1K85A 5F3HA 1REIA 3QCUL 3VXRD 4JJ5B 2X4SA 4OFYA 5EO0B 5HYQA 3ZTNL 1TDQA 3QFJA 2FR4A 1LEKA 3BP4A 4P5TA 1KTLB 5EOTB 4LSTL 4RA0C 4PB0L 4PRBA 2WIMA 3QJHA 1WQVT 5JW4N 5HHPA 4NO0D 9CGTA 5GPRA 1A0QH 4QGTA 1YMMB 1I75A 2F53D 4NZJA 3QEUA 1FP5A 3EYFB 5EOQL 2IAMA 4ZOEA 4IIQB 3QIWD 3JV6A 5I1EL 5T1MA 3VH8B 3ROOB 1QBLL 2C7UB 3GSRB 1J05B 4FP8L 3ULSB 3LB6C 4FZEH 2WUCH 3TBWB 3RFZC 3GGWA 1C7SA 2YN5A 5GRUL 3QUZD 4XVTH 4PJFE 4HFUH 5TDOA 3IKCB 5IQ7H 4N0CD 4NRZA 5IMMA 2HRPH 1OQXA 2ZCHL 2FEEL 4ACPA 2CIKA 1YY8A 1IAIM 1U3HA 3QIUC 2XA3A 3BH9A 1J0YA 4LLMB 1YNKL 2VQ1B 1UB6B 3QG7H 2JK5A 3S37L 2BNRD 4WY7L 2K7QA 5HGHB 1FNHA 3IDMA 3MRHB 1CFVL 1FNGB 4KK9C 3W81A 5K9QG 4RWYH 4E42B 3RWDB 3WLWC 1HHHA 4S1SH 1AXSA 1MI5B 1GZPB 4IMKA 2Y36H 3TT1H 4HCRH 2DTML 5BJTA 2P8LB 2W9EH 1GGUA 3DV6A 2XWTA 2OK0L 1VFAB 1NCDL 4KV5E 3K2MC 5SWSE 4FTVE 5F7WC 3ULVD 4I48A 4WW2F 1A7NH 3NACH 3TYFA 2AJSH 3GHEH 1BQHA 4FN0A 1U92A 3M45A 5JXEA 3BDYL 4OLZL 4Y4KC 5A1AA 4I4WA 4MSWA 2WINB 5GSVB 3JWDC 2NR6D 4HV8B 2GJ6A 1ND0B 2X4RB 1RUML 1UFUA 2CJUH 3WFHB 2EEBA 1LE9A 5B38G 5I2IB 4ETQA 2WM0A 3CAFA 5TDPA 5HHVH 4N8VB 1T22B 3B2UD 1NMBL 5HHMB 4M3KB 1YDPB 3LEXB 4QYOA 4QLRA 5KAQF 4PB9H 4XC3L 2DYPA 3CU1A 5GS1C 1OSPL 4OZFH 1NLBH 5J13B 1PY4A 4WW2A 4EVNA 1RZ8B 2F54B 1Z9LA 3J7HA 1EUTA 1KCUL 5L2JB 5F72S 2DKUA 5I30L 1ITCA 2B1AL 3DUSB 5L88H 3U2SA 3B9KB 4N1EA 4Z0XA 1GAFL 5ETUA 1H8NA 4ERSL 1A4KA 4XPTH 2DAVA 3K2UH 4M43H 1JIBA 4UV7L 5J9PB 1KXQE 3HE7A 5CHNA 4U6VH 3VWJD 2HVKB 3L1OL 5MEOB 5EUOF 4HIIA 1FG9C 4OCWL 1TETL 4RRPA 4H8WL 4PJ9C 4P46C 3O11A 1U8KA 3FKUS 5FUOH 3HE6A 3OF6A 4YAQA 1CLZH 4HT1L 3TYGH 3OJVC 1T1XA 4K8RC 2ITCB 3V6BR 1SYSB 2DQHL 1KTDA 1RK1A 3FN3A 3I02B 4M5ZL 5CGYD 5FUZL 3TO4D 1S5IL 4OB5L 2DLGA 4UNTA 4DKFH 4ENED 3QXAA 1Z0NA 5T3ZH 5CCKL 3ARPA 3EHBD 3TO2A 2YK1L 1G7HB 3N1FC 1MHPH 2J5LC 5JHDB 5EUOA 3I3BA 4UIKL 2M2DA 3C5JB 2R69L 3QQ9D 5HY9A 1TJHH 4GG6F 4F7CA 4J3VA 3SGJA 4PJAE 3GMPB 3HC3H 2BRRH 3LKOA 4NQXB 1UCTA 3O3EA 3GUTB 1W8OA 1YMHA 4X98A 2AEPL 4MQXC 1RMFL 1KPVB 2XZQH 1XGRB 1HE7A 5EZLA 4L3EB 3O3DA 3HE7C 1I9EA 2CO7B 3QA3B 4HGMA 3DX6B 5FO7A 1PGRB 2W07A 4X8XA 1JGLL 4XWGH 4HUUA 5SWSD 3MRFB 4FTVD 5HYEA 5C6TH 1L0QA 3GKZA 2OSLA 4F3FA 4B41A 3KDMB 5C0CE 4PJGF 2V2WB 5C86A 2XV6B 1CGWA 4AENB 1YNTB 1MVFA 2FJGB 3LS4L 3KS0H 2ERJB 3CH1B 4P2OB 4GG6A 1LO4L 3ZTJH 1AJ7L 3RZWA 4OCXL 4C56E 4L3AA 1IQDB 3KPRE 4LSRL 2OS7A 1E6JL 4YPGB 2P24B 5C71A 1G7IB 3THML 4M6NL 3LN9A 3BSZH 1I7ZB 1WF5A 3WIIL 4KQ4H 5DRNA 2IF7A 4JY6B 1BMGA 1CG9A 4LSSL 4CN1A 1ORSA 4QHNA 4PJDB 2YMXH 5LCVL 1MFBH 3CDYA 4H26A 1PFCA 2RCSL 3MUHL 2JIXA 2JELL 5DF0A 4PJGA 2X40A 4WI7A 3D39A 1WBZA 3FO0H 4OZ4A 3SE8H 1SY6H 3QO1A 3RBGA 1QSVA 1DQML 3IDYC 3D6GA 4IHOA 4M61A 5KVDH 2NY4D 3TIEA 1NPUA 4GRMA 1DDHA 4KVNL 3BUYA 4A6YH 3LD8C 3KJ6H 2DJ4A 4UNUA 4NDMB 1JN6A 3MA9L 2NY7H 5F9WB 5E8OA 1Z5LA 2J1KA 5CZVL 2MPAH 1QFPA 3CFDB 4YBQC 1AHWC 5I16A 4BKLB 4NWUL 4ZYKA 5DLMH 3ARSA 1UM6H 4NKDB 3WUWG 4G43A 3AB0B 5DHVH 1BM3H 1CN4A 1CXLA 2M26A 1QRKA 5I76A 3CZJA 3L7FA 1V7NL 5C8JB 5DK0B 4ZUTB 4LAQH 1EVTC 3BIKB 2XQYK 4RAUA 4XMLL 4YWGL 2PTTA 4KPHH 5FECB 1KCVL 4KGLA 3IU4H 2LTQB 3TVMA 2X4SB 1IAOB 5D4QA 1INDL 3QFJB 1BAFH 1MCOL 4P5TB 3S34L 4POZD 3K4ZA 3ECBA 5FGBC 1H3PH 1M71A 5AD0B 4KJYB 1JPST 3N06B 3MSPA 4RAVB 2XN9E 2OTUA 2X41A 2YD7A 1S9XB 1DBMH 5HI3D 1V3KA 4OQTH 3WDIA 1WGOA 3SDAC 3VJ6A 1VPOL 4P5KB 1ZT1A 2NQCA 4WTXA 1GZQA 2F74B 3TJHD 4HAFA 5E4IA 1GHFL 1KB5H 2XQBH 5C0CD 4WUUE 1VACB 1YEEL 2VB5A 1ZLUH 5EZOH 1NFDB 2PXYC 3CVIL 3Q5OA 1RIUL 1OAQL 5ISZA 1PKQE 3QCVH 4PGEA 4CW1B 1DQJB 1KJ2A 1VEPA 5DD3H 5IMMB 3O4OB 1J0JA 4C56D 4DQOL 3VFMA 3KPRD 4JAMB 1B0RB 1T5XA 3RWJB 5JPMB 4JANA 3ARGA 1RSFA 3HKFA 1MJ7L 3KPSE 4PRIB 1TVBA 1XAUA 2DQCL 3MREA 4JCLA 4MB4A 3DRTB 3VGAB 2CUHA 2NXYD 4PREA 3R06A 3BQUB 4PRDB 3QWOA 2AEWA 5JNYB 2CLVB 3INUH 4DUXA 2HTLC 2OZ4L 4Z95H 3DV6B 1OLLA 5D9SA 4RBPK 4X0KB 2AVGA 1Y6KR 2D7TL 1B90A 4L8SB 1GGTA 5D7KE 1IARB 4XCEB 3S96A 2ADFH 3GSOA 4XNQA 1U92B 4JM4L 3H2WA 2LU4A 1OW0A 2DRUA 5T1KB 3P30H 2PO6B 2VDQL 3OMZA 4UDUA 5H94A 2KQNA 1D6EA 3DRQA 1HXMB 2FDBP 4QTHA 5LXGL 1OWRM 1OTTC 4MA8L 3ULUE 4P2QE 1KUMA 1U8QB 1OAZL 4UOW0 2FBJH 1N5AB 2NX5E 1NC4A 2P49B 2CLRA 3MA7B 3A6OA 4LARH 3W0WB 1XGUB 1G0XA 5DXWA 2DN7A 3JTSB 4PIRF 4RDQG 2X7LA 1DTUA 1N6VA 2V5SA 4QRRE 3MR9A 5HYJE 4CRPA 3MUZ1 4LFHG 1UVQA 3WHXB 2E6JA 4N0UE 3MO1A 3WFEL 5DMYA 3QHZH 1P84J 3F12B 3QI9B 4X7TA 3E3QE 4WW2B 5A43C 2V2XB 1KIQB 1I1AD 3M17B 1KELL 1AFVL 3EFDL 3MUGB 2CMRH 4TVPE 3TH2T 3ZMRA 3EOTH 2WIIA 2P7TB 4OLWL 4HQQL 1WTLA 2F15A 5E99H 2APTA 4PTUB 4HK3J 4WW1B 3RHWF 2XTLA 2Z0BA 1RIVL 3AS1A 1XIWD 2WLZA 3QNYA 3MJ6A 2LVCA 4RMQA 2XN9D 4NCC2 2OI9C 2Z4QB 43CAA 2VAAA 4NUJB 3QDMA 4GRWF 4R4BA 2FEEI 1FNSL 4W70A 5B39A 1U58A 3HE6B 5FKAB 2P5WB 3PIQB 1A6AB 4H0HB 2APBA 4N5UA 4WWKC 3V2AR 3IFNL 1UYWL 5GZOC 4Y0GA 4JFQB 4MAUL 5CLWA 3TBVA 2NXZB 3BUTA 3RDTC 3QUYA 4WUUD 1P84K 4UT9L 3X3GL 4OLVL 2VNCA 5E5MB 4HGWA 4BA8A 3NMEA 3PWPB 4S1QH 1RJLB 1SJXA 3N9GH 3UAJC 4M48L 3TT3L 2DQUH 4BUHA 4N0YH 1VADB 5I1AA 4X6DF 5D7LA 1UA6L 3WEXA 5D2NA 3LHPH 4I3SL 4OLEA 4WO4B 3ARDD 3KPSD 4XNUH 4O5LH 4UT7L 1JPTH 3FN0L 4XVUC 2XTJE 3UYPA 4F33B 3Q5TA 4QRPA 1TNMA 4XH2A 4UT6H 2HH0L 5L8KB 5E4EC 1B4RA 2LABA 4EUPH 1WICA 1JHTA 3BPNC 4X6CB 2R8SH 5EZLB 1NUGA 3AY4A 1LILA 5LWYL 3WFDL 1B4JH 1Q9OA 5D1QB 2JJUA 1IGML 3SN6N 3MCKA 1YY9C 5D7KD 1C1EL 4ZSOA 4N68A 1DFBH 2OSLB 4K7PY 1X5GA 4MMXC 5T3XH 4X6DA 5DJ2A 3QHTC 4I77H 1ZGLM 1W0WA 4U2YA 2H2SD 4XPBL 1S7QA 5GS0C 1DP0A 1MIEL 4Y5XC 3FJTA 5BV7L 2KZWA 1MJUH 1L7TL 5C08E 4GXUM 1ZLSH 1ZS8A 2HT2C 2H3NA 2X1QA 3LS5L 3QUYC 3ULUD 3FT2B 2J6EL 1S8DA 5DRZA 2NX5D 5GGUB 1EHLL 2FJHB 2OR9L 4Z7QE 3WXVL 3RTQD 4R2GC 4UIMB 4OKVA 4YXKH 4UTAH 3ROLA 4PJBF 1A2YB 3DX7A 4QRRD 5HYJD 4OJFH 4JEGB 5IKCB 4UUJA 1I9JH 4O2EA 2D03H 4WHTA 3VFWA 2X4OB 1X4XA 1NAMA 4PGDA 4GAYA 4M9OA 2B2XH 1SEBA 4ZODA 4TVPD 1HYSD 5DEFB 1JNJA 2RJMA 2ILLA 4Y4HC 3BPOB 2BVOB 5GGTL 1TCRA 1CXKA 3MYJA 3JBG7 1S78C 5J11C 1NDMB 1BIIB 1DDHB 3KYMB 1K8DB 4YJZL 4HX1A 1T1WA 1FGVH 1RUPL 2NW3A 4MX7B 2F19H 3MRQA 5T5FL 4N1CA 4Y4FC 4DJMA 3DX8A 4PJBA 4WHDA 4P2RB 2XZAH 2X9XA 4LVHC 4XVSH 3DMMA 1MJJB 5I16B 5BV7B 4N8CL 4ZPTA 1HHIA 1QBBA 2KZ1B 3TZVA 2JB6A 1RURL 1A14L 2CXGA 5ID0A 3VXQA 2QHRL 3RI5K 2B39A 1KJ2L 3RKPA 4Z7OE 4ODVL 2Q87A 1JNNH 1F4AA 2GKIA 5CJ5A 4OCSL 3QWRD 3C2SA 3MBEA 4PJCE 4G3YL 4P4KD 5E8EB 5ELIA 4L8CA 1F3JB 4CMMB 2N56A 4DZ8A 3JXAA 3O2DH 3TVMB 5E9DB 4BH7A 4O9HL 3R4DA 4PJ7B 4LDLB 3TM6A 2VWEE 3BHBA 4G8GA 4YC2B 4ODUA 2XTJD 1QLEH 1YN6A 3NCFB 2AJVL 3VG0L 4K9EH 4NJAH 4NUGH 5A40E 3MJGX 4MXVF 3RVXD 4X6FA 4EQ3A 2BSTA 1RZJC 4PRHA 4Z7WF 5F97E 2Q8AL 4N8PA 4JVPA 1J87A 3S97C 4X4YB 4OFIA 4TNWF 1CD1B 4HCRA 4MNHA 3GBNH 2VZSA 4JO3L 4P23B 1ZLVK 3SGKA 1ZAGA 5FO9B 3GBLA 2XZCH 5KSAD 1WEJH 5SX4I 1HHJA 1U8IA 5BZWA 4OGAD 4G6JH 5KBNC 4PLNC 4HWNA 4KMLB 1ZA3A 5IFAL 1NKOA 5JW4Q 1NMCB 1IMHC 5D71L 1D9KA 2HKHL 1U8LB 2BDNH 1YZZA 2Y4SA 3OJMB 2NTSP 3F7YA 5C08D 1WISA 4XVJL 1F3RB 5D93B 1I8IB 5CMAB 2AJ3A 5E5RB 3KPOB 1JGEA 1MPAH 3ZE0F 1NDGB 4Z7WA 3ARGB 5IGXL 4QHMA 3OAUL 3EO9L 4GO6B 1AY1L 1TENA 4OGYH 2O61A 1WT5A 3SJVE 1ZT7B 3W9EB 2YD5A 5BRZB 5JHLL 5GRJL 3DJ9A 4JO1H 1TTFA 4QOKE 1EBAA 3KR3L 3LQAL 3ZL4H 5HHXL 3H0TA 3OR6A 4OZFA 5CZXD 3PL6C 4E9LA 3FO2B 4FQHB 4KY1L 2GTZB 3LN5B 3O8XD 2NPLX 3ZT7A 1QSEA 3QDAA 1S5HA 4DUWA 5AZEL 5F44A 4CVXA 1ZHKA 2DQDL 3VFNB 4Z78B 1LVEA 3IVKB 3MNWA 4EN3B 4UILL 5GRXG 1K4CA 2FWOB 3RY5A 3ZHDA 2FO1A 3O6KL 1RJZA 1OAXH 2IPTL 5C0ND 3I84A 4EOWH 3QG6B 3UTSA 4V1DE 3VD9A 3HUJF 3FB7A 2Y07H 1Z9OA 2BK8A 3DRQB 1U0QA 3P9WB 1EGJL 4ONHA 3I3DA 1L7IL 1NCBH 3KPMB 2YZ8A 4OF0A 4Z7VE 1YYLH 2XPGA 3CSPA 1XCQB 3C6LC 2AEQL 1WBYA 4S0SD 5TH2A 2VXSH 4JZOB 4JCMA 3PUCA 1F5WA 1UVQB 2Z8WC 3MLRH 1Q1JL 3VFUB 4LHJB 3GMRA 4U4BA 3ARFA 3C87A 4OAWB 2GT9A 3NGBB 5HDBE 2DM7A 3V5DA 3W2DH 4WGVB 2YD3A 3MJ9H 4C57C 5CKAA 2BHZA 1E4XH 3HUJA 3MGAA 1J5OL 5E8DL 3QULA 2DIJA 2FX7H 2C1PB 3AS2A 3SO3B 2EC9U 3SKNA 3IF1B 3N1GC 4HK0B 3JZ7A 3SCMD 1QVOA 3QDMB 2YPVL 5B39B 5DMGD 5C0JA 2OP4H 4OI9A 2UZIH 2QSCH 1JGDA 1N6QH 4IOFD 1KBGH 2O26U 1O7SA 3ES6B 2QJDA 1BECA 3KWWB 1NGXB 2FX8L 2R23A 1U8NA 3SGDH 4LLUB 3D3VA 4J3SA 4HUVB 1II4E 2E7LA 3OJDA 1QR4A 4I5BA 1CL7H 1T04B 2XXCB 4R7DB 3U46B 4EIZC 3RY4A 5D7LB 1D5BA 4KHXH 5DJXB 3TN0A 2E8YA 5JOPE 4AG4H 1AI1H 3QDJB 3SOBH 4LHUD 3SJVD 1PG7H 4LOUD 3TA3B 4XPHL 2ZNWA 2D7MA 5TE7L 3EYUH 1MAMH 3ARFC 2GHWB 5F9AC 4QOKD 1EZVY 3QIWC 2ARJB 4Y16B 3IFOA 2QR0B 2DL9A 4JPIA 1J7VR 3KPQB 3P4OA 4JQXA 3X12A 4N9GB 2EDXA 2X10A 2ARWA 4K94L 3PNWB 1Q9OB 4QEGA 4I18C 1SY6A 1NH6A 3QUZC 2Z8VC 1AKJB 4IOIB 4N0CC 2CIIB 3MCKB 3ZKND 2BNQA 1F2XK 1C5BL 1SVZA 5L2KE 2D7NA 1A0QL 4A6YA 1MVUB 5ILTL 4MZ2A 2J88L 1KPUB 4V1DD 3X11A 5FFLA 3HNVL 4U7KA 1J9CT 5JW3H 1LNUA 4FZEL 2WUCL 3VMPA 1KEMH 1S8DB 2X4UA 5DQDL 5FYKH 3BRGC 1CE1L 5KZCB 5DHVA 4XVTL 1KJ3H 3ROLB 3NOIA 4HFUL 5B3JE 3DX7B 1M1SA 2AK1H 2DMCA 2XFXB 2HRPL 2VDRL 4JFEB 3HRZB 5DJ6B 5FA3B 1ES0B 5ESQA 3TIDA 4WHTB 3W5NA 1A3LH 4FZ8H 4J3TA 2VXTH 1FFNB 2DQTH 3QG7L 2C3GA 5CSZA 5EU6E 5C0AA 2A6IA 1HIMH 1K5NA 3CFIC 3HNTH 4I0PD 3K0WA 5DURB 5F89A 1WFUA 4MZ3A 4RWYL 1RUKH 2NR6C 4NRXA 4F9PC 2VLRE 5I18H 4S1SL 4XBGB 5JIKA 4M6OL 2AKRA 1OAUH 3TT1L 2V2TA 1INEH 4WUKH 1T1WB 2W9EL 2KPNA 3CD4A 4DAGH 1NFIB 4R4ND 3VGEA 2JJVA 3B2UC 5D2LF 1BWMA 1TQBC 4OQTA 1ZXQA 1A7NL 2GTWA 4Y5YB 2AJSL 4MJIB 3GHEL 4ZPTB 3UBXA 2BSED 4C58B 3MLSL 3QO0B 2VDMH 2YXFA 4LCYB 5ID0B 2UWEB 1KB5A 1UM4H 4JRWA 1FH5L 1G7LA 4O58H 3UP1A 4FFZH 1U91A 3K81A 1AD0A 4C54A 4NHUB 4LCCB 1NLDL 3VWJC 3VW3H 3MV9B 3BFOA 5HHVL 2QQKL 8FABA 5JOPD 2XICA 1FV1A 5JMOC 1J8HE