5L7XH

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
205
Chain Sequence
b'EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain
molecule tags Immune system
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
total genus 39
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xH02
4G6JH 1BZ7B 1GC1H 1HSBB 5FOJA 1RUAL 2GI7A 3MV01 3TWCH 3OPZL 5HGAB 2HKHH 2HVKA 5C0DA 4Z76A 4FQQB 1FVCB 4NFDA 5L0QC 3LB6D 2J8HA 1DBMH 3QDHA 5HVHB 2R8SH 4NOFA 4HJ0C 5C0ND 1DSFL 2QLVB 3P0VL 2WLYA 1MF2L 2IQ9L 2E9JA 2VZVA 3E6FB 1Q9OA 2OL3A 2IH1B 4UAOC 4WV1C 5TQ2L 1Q9WA 4JFPA 4MQXC 4NKDA 3CXHJ 3CVHB 2F74B 3ARDA 5CP3A 2FB4L 3CFJA 3EYOB 2W60A 2G60L 2WSKA 4HF5L 4PRDA 4BQ8A 3AY4C 1WWCA 4Y16C 3BT2L 4HIJB 2R2BA 2VAJA 4JQXC 1G7IA 3DMMD 4HMEA 5KANG 3RVUC 4MCYA 4XNQA 4ZQKB 3ZSSA 5HYJA 3RDTC 1VACA 1CE1H 5GRVL 5ADOL 1DVFD 4NBYB 2NY6D 1ORSA 5BVJA 1KCRH 3LKQA 2OTUA 1NCAH 3N1MC 3PL6B 1J18A 3BAEH 1CFTA 3GKWL 1ZLWK 1XZ0A 3KYKL 4NNXA 2ADJB 3L3HA 2BY2A 2NXZB 2X4PB 2XV6B 3Q48A 3UTQB 2XRAL 5D6CB 1LMKA 1I7ZA 3I75A 4YHKH 5K33A 3H9SE 1CGSL 3MBXL 3MNZA 3BZEA 5L2KE 4G8FB 3PF2A 2BERA 3NIDF 1WJ3A 1OQXA 3Q6FA 5ENWA 5GIRA 4DJMA 2P24B 3QCTH 1NGWB 2FYYB 5H35A 5A16B 4Z5RB 3CSYA 2NX5A 4X8JB 1J5OL 4R90L 2HP4A 4AIXA 4I5BA 4ZAKB 2M2DA 3MR9A 4G6JL 3GMNB 5IFJA 3BYYA 3O0RH 1U0QA 4WCYL 3STBA 5I1GL 4P48A 4Q6IA 1UWEH 1QO3A 5ETUB 2AERT 2DQUH 3MRMB 3TJEH 1I7ZB 3I75B 1J86A 8FABB 5D9SA 4JFDE 3MBEB 1HK6A 2BVQA 4PRBB 1MIMH 1DE4A 1FYTA 2VR5A 4AQ1B 5HHQB 3CFBB 5EU5A 4XMPL 3GZKA 1FFRA 2GSIB 1GZQB 4X6DA 3N85H 5CWSB 5EFIB 3TVMC 3DGCR 2PN5A 2Y06H 1HEZA 3MRLA 2OJZH 5D6DC 2XZAH 4I5BB 4TUOB 4CNIB 3O6KH 3RIAF 2NY6B 1ZVYA 1UQSB 3VXOA 1AO7A 4JO3L 3UEZA 3MCKA 4QRPA 3IDUA 2YD7A 3ECBA 1BFOB 4CMMA 4NRZA 3MOAH 2B8OT 5D1QD 2AJXL 3VFVA 4ESKA 5SX5H 3HE7C 1DVFC 1H5BB 1RZIA 5CUSH 4ORGA 4MZ2A 4PP2A 5A40E 1JHTA 2UZIH 3S35L 4WCYH 4NOBA 1O0VA 3MROB 1F11A 4DTGH 5CSBA 3HTLX 3O3EB 2ZNWA 1QA9B 3T4AB 3D3VB 4FXLA 1A1OA 2VZTA 3VWJB 3HPLA 1JGLH 4K8RL 4XI5D 3OF6A 4U1JB 3ABZA 4WFGE 3ZKND 3BZ4A 5DA4A 1MQKH 4R26L 2FJHA 3WDJA 3TN0C 3GSRB 3P4OA 5DJDA 3RFZC 3T0XA 4MXWH 2HFTA 2VXVL 2VDNL 3LRHA 3C60C 3OKKA 4JFOB 1GGTA 5I8EA 3HI5L 3SCMD 3EDJA 1CD0A 3FO2A 2NW3B 4HWBH 2W1NA 5JUEL 1Q0XH 4JQXA 1MI5D 1CGXA 4P2QA 1YEEH 2MMXA 4WW1B 2ZOLB 1ZXQA 1LEGB 3QG6A 4G3YH 4X6EB 4Z9KB 2IANE 4GKOA 1AFVL 3K46A 3WCYA 5C0RH 4I3SH 1VFOA 2PYEA 5F7FA 4WNQB 5H94B 5LJYH 1G9NC 1BVZA 1IAIL 3TCXA 2CJUL 1FNAA 1XR9A 4LEOB 5LQBH 5JMOC 2PW2B 1SMOA 5GSRA 2HVJB 1INQA 3PQYA 3WLBA 1CICD 1DQML 2BDNL 4GKZB 3SDAA 3ZT7A 4OKDA 4JR9H 4HPOL 4Z7WB 2NW3A 5EU6E 3T4YB 2YN5A 5IB1B 4TSCL 5DMGC 3TYFB 5KVEL 2R1XB 1ZGLP 3MFFB 5D7LB 3CNKA 1RZGA 4EI5D 2DWEB 5HPMB 3ILPA 4RRPA 2IMMA 3QUKB 5FHBL 1IM9B 3BKJL 1YJDL 3NFPA 2R69H 3BIKA 3T0DA 4N0FB 1Q72L 5F72S 4GG6E 4CDHA 1QHOA 1HINL 1FSKC 3MRJA 2XFXA 4UTAL 4P57A 3T0WA 5DK2A 3IKCA 2G75B 4M02A 3BPLB 1CTNA 4OSUH 3TPUA 4N1HB 1CXIA 4EBQL 1U95B 3RVVD 1IEBA 5EU4A 3L3KA 2PR4L 3ZE1F 2O5ZH 3FN9A 4L4VD 3DWTA 3NFNB 5I8CA 5LQBL 2EIBA 2OZ4L 1G7LA 4BZYA 3LB6C 2CIIB 32C2A 1V8HA 3ARDB 5EPMA 4YLQT 3TO4C 4GUPB 4PJXB 2W60B 3QUKA 1KTLA 5F1NB 5TQ0L 4U1NA 1K6QL 3GMOB 2P43B 4Y4FB 5FUOH 6CGTA 1DL7H 3CFEB 4QWWD 5FUCC 1FL3A 3MRKB 3G04B 1MREL 2HRLA 4PJ9B 4X4XA 2P49B 4MA1C 3FFCD 4M3JA 3PUCA 2HA1A 1UB5A 4KQ3H 1YEHL 4XP4H 2YC1A 2JCCF 1DBBL 3B4NA 3KR3H 1E4JA 4AJ0A 4Y2DC 3IFPB 3FT2B 3MJ8B 4QHLA 2AEPH 2C5DC 4AM0A 3VXRA 3ZKNC 1NLBL 2B2XL 5F8QC 5E8EA 1VHPA 3P4NB 4WI2A 5F1NA 5J9PB 5F9OL 4OGAC 5JDJA 2EDRA 2AJVL 5BVPL 3PXJA 3TH3T 1HDMA 4KHTH 1RUKH 2DL9A 4XCFL 5D7JA 4PJBF 2KKQA 1UJ3C 2E27H 1YNTA 3ROOB 2APTA 3CSYB 3U7YL 2CQVA 3H9SA 4YIQA 2O93L 4R0LA 2AGJL 4G43B 1N64H 1UZ6E 1VFAA 4PIRF 5EOQL 3NCFB 3D9AL 1ES0A 5MEND 3LKPB 1I9EA 2MQCA 4LF3A 1F90H 3ZYZA 4L3ED 2MHAB 1D5MB 4X6BB 4ZYKB 3IAQA 1BM3H 1INEL 1BQHA 1MHEA 4HLJA 3PXHA 1V7NH 1QOKA 3CSBA 4M4PA 3PP3H 1A7RL 4NPYA 1FLRH 4U1MA 1FFNA 1HHJB 2W07A 2HT2C 3MLRH 3OKEA 1WZ1L 5IK3B 4DUXA 1BMGA 4NQSA 4YIQB 2J88H 2XWJA 5I30H 2VLKD 3H2WA 1LO3L 2W92A 1J8KA 2XTLA 5ICZA 4YXKH 2ITDB 5EUKA 4EN3A 3NA9H 2K3TA 2I60H 1UQSA 3VXOB 4LQFL 5BRZB 2UV3A 3NN8A 43CAB 5ICXA 2P5EE 4NJAL 5IKCA 1KCVH 2AABH 5IB4B 4GRWE 4MXVF 4Z77B 1R5WB 3QQNA 3ARGB 3FB7A 5DD6A 1UH4A 3BVNB 1S9YA 4WJ5B 2VXSH 1QSFB 3SDCA 4OQ1A 4U1MB 5JHLH 1R3IH 2XKNB 3PGFL 3DV6A 2CUIA 1YEKL 1C5DB 2GJZA 1HHKA 2OZ4A 2OYPA 1GPOH 1CXKA 2EYRB 2NY2B 3DROB 1Q9LB 2AKRB 4YFLF 3L5JA 1VKXA 4HGMA 2ADFL 5EC2B 2FDBP 1FFPB 1N0LA 4OB5L 5F7MC 4GRMB 4L8SA 2WMPA 1RZ8A 2FJHB 3UBXA 1QFOA 1JZ2A 2X4UA 5GRVK 3ZDZF 4ODTH 4ZO7A 1S9VB 1SJEB 2YZ1A 4W4OA 2NY6C 1Z9LA 2AK1H 4POUB 4EUPG 2GT9B 5F8RC 4E0RA 2OZ4H 2VE6B 4NQEB 4RBPK 1A6WH 3TIDB 1DBAH 3MLZL 1FYTE 5DR5H 4X83A 4L3CB 1DUZB 4MSWB 4P9MH 4MWFB 1NMAL 2HH0H 4HPYL 3W82A 4Z95L 1MFCH 1U8JB 1NDMB 5EDXA 4BSVA 3LHPH 1NCTA 4JQIH 3U30C 2BVYA 3RX8A 4FQJH 4XNZC 2XG5A 1N5YL 4XMKH 2WIIB 1UH2A 2HVJA 4JDVA 5ACZB 2H3NA 4QEGA 3JV4B 4O51B 1NJ9A 4YHYC 5DLMH 2BSSB 5JLZB 5EBLB 4JY5H 3MCG1 3Q1SH 1S7VB 3T4YA 4E0RB 3V6FB 1A1NA 4U6YA 4RNRB 1MH5B 5HHXH 3KPSD 1CT8B 1Y18A 3GSVB 4YXLH 4OUOA 1SYVA 3GJFK 1DQJA 1HQ4A 1D6VH 5C0IB 5TGBB 1A6AB 4NNYA 2OI9C 5JW5B 5KVDH 2BXZA 5CD3A 4UINH 2IPUK 4R3SB 1ZAGA 2WP3O 3IETB 3IXTA 5I74C 1BX2A 4BH8B 3UTSE 3P73A 4BH7B 3OXSA 4J8RB 4AEHL 1KLFA 1MJ7L 3VXRE 4DK6A 1KCKA 3BZDA 5E4EB 2YKLH 2AXGB 4PRNA 4GFTB 2IPUG 4TNVK 3PL6C 1U9KA 5GQBA 4RMSA 3PWVB 4PJ8B 3DGGB 4B7IA 1U91A 4JVUA 4YDLC 5EUOA 1NGZB 1VPOL 4I3RH 3HKFA 4K94H 3K80A 4WRLA 2MPAH 1K5NB 1NFDF 3H8NA 4LLAA 4I2XB 4HGWB 3ARBB 4AYFA 1WFTA 1LO3H 1GC1C 5LXGH 3ARGD 3KPPA 1FZKB 1NGYB 2D7PA 4ZO9A 2CLZB 1DVFA 3QULA 5C0EA 2L0DA 3MC0A 2N7BA 3ETBF 1T22B 1OB1A 3VGGA 2E6JA 3GMRA 3IU3B 5I6XB 2VTFA 2QQNL 1OCWL 5F88A 4PJ9A 2F5BH 1F4YL 4N90E 5CLWA 3MUZ1 2J3SA 4POZD 1F6FB 3HC3H 4XCCL 2R0LH 1RUQL 1VACB 4KI1A 3CU7A 2AJZA 1CLYL 4HWZB 5TPWH 3WNMA 1VADA 2FHFA 4GO6B 3KGRA 1DUYA 4HX1A 4PJIA 5B4MD 1HZHL 5E24E 3MLYH 4JFEA 1X6LA 2Z8VC 1IE5A 4G9DB 3C60D 5BW7C 4PJAE 5GS0H 2ZZUT 5DI8B 4D2NA 2H1PL 2P45B 4UDTB 5HGBB 2DIJA 4CW1A 2EO9A 3I50L 1A0QL 2BOCB 3QEQA 4DN3H 4KHXL 1MFBH 3VXME 1C7SA 1FNSL 5FM8A 1YEJH 1U93A 4OTXL 1A4KA 5DMKA 1HHHB 4Y89A 2NLJA 2UUDH 1YQVH 5H35B 2LU7A 2QQNH 3TYGH 2W0FA 3L1OH 4GW1A 3VFRA 1OTSC 4LCYA 3KAAA 3S3PA 4J6RH 5BO1H 2P8LB 3CXDL 3CX2A 4I48B 4PTUA 2FECL 2Y07L 5DO2D 3IGAA 3VRJB 1KJVA 1U41A 4RBPH 2OMBA 1FFNB 1HHJA 3BT2H 3S34H 1OTUC 1AD9A 3QEQB 2CXKA 2AQ1A 1IAKA 1XF3A 4G8GB 2WWMC 4AENB 3F6LA 3ZKQD 1FFOA 4YBLB 3T09A 1YEFL 1I1YB 5K9QI 1KCLA 4NM8L 4HK3N 1EFXA 1B2WH 1G7PB 4JQVA 2EDFA 2EDTA 4FRWA 2BFVL 3JTTB 4JPVH 3G5XA 3L95A 2CDEA 2BY1A 1CR9L 4LCYB 5IKCB 4LK4A 2ICEB 4RDQF 2IQ9H 3O9WD 1EFQA 2I26N 1X5JA 4F3FB 1OSZB 2OK0H 1BZ9B 1HXYA 5F7YC 4AG4H 4NRZB 1LO2H 3MV8A 3ULVD 5T1LB 4MQXD 5KSAD 4R4NC 4WW2C 5DD1L 1C5DA 1BWWA 1JPTH 4GW5A 5CINL 4GKNB 3FONB 1QLRA 2P5WE 1CFNB 3H42H 4RAHA 1WTLA 5DMGD 4MA7L 3I02A 3LH2H 4LSSH 4MNQD 3HLAA 3SCMA 3HZMB 1FVDB 2XN9E 5ABDE 1H8SA 1L6XA 5LGJA 1E4WL 5D2NB 3CJJA 1EHLH 5EN2A 1R5VB 3N9GH 4F3FA 3WFHB 3QJFA 4JO2H 1MCKA 4JN1H 5AZ2H 5I17A 4ZUVB 1QBBA 3REVA 4C83A 4LVNC 2ZUQB 5E2UL 2X1OA 4L9LB 2UVFA 4Q9QL 1IKNA 4HBCH 4P59L 4IMKA 1L0XA 5ADOH 1YPZA 4PJEA 5AYUL 4RAVA 2P4AB 3TJHC 4UILH 1CE6B 4G8GD 3VFSA 4DGVH 1T1ZB 4F9PA 1NDMA 3MBED 4OFPA 2X7LB 4LPVA 4WHYH 4YE4H 1A7QH 1P5VA 3KYMB 1Y6MR 1NAMB 4N5ED 1PGRB 2ZSWA 3I2CL 3KLHD 5GZOD 2X4RA 4XCYB 5ID0B 4PLKD 1CDYA 1AQKL 1TNMA 4PJDE 1Z3GL 1CGVA 3W11C 1WC7B 2DLFH 3KYNA 4BFIA 4PRPA 3VWKB 1GYAA 1VFBB 4HWUA 1YEHH 4XP4L 1YEKH 2I07B 3GIVB 5GRYA 1P7KA 4F58L 5J0BA 4JQVC 5ESVA 1NUGA 4KUZH 4IOFD 3FOLA 3W5NA 1URLA 5GGRB 4EI6B 3P30L 4NKMB 1FJ1B 3ZE2F 3VG9C 4AG4L 5FDWB 4BH8A 2ICWA 1T1WA 2XKSA 3NFSL 4XNXL 2IGFH 1VFMA 4NCDA 1IC7L 4OD3H 5BXFB 5T3ZL 4UB0L 3SEPA 1OLZA 4K7FA 1OTUD 5ESQA 3QB7C 2X44D 1NUDA 1T83A 2V17H 5FYJD 3GJFA 2LE9A 3TPKA 1HZHH 5DJXB 4MDIA 1PYWB 2VL4A 1WCBB 1QEWA 4RGMC 2PO6B 1NBYB 2A1WL 4X9HA 2F19L 3VG9B 3ZL4H 3FTGA 4S1DD 3M17B 2YRZA 5C09E 5IMLB 4P2OB 1Q72H 4HKZB 1A3QA 1QR1B 1FZKA 3KPQB 4N0YL 4L3EB 4FABL 5IEHA 2NY1B 2V2XA 2Q8AH 4H26A 3BP6B 2G9HB 2OJEA 3SQOH 1GSMA 2FD6L 4HHAA 3QFDA 4PY8I 4NCC2 5I71B 4Q9BA 1DQDL 3EHBD 3RQ3A 1QR4A 4PBWD 3WFZA 4CGTA 5HGHB 1UCBL 1A7BA 2HT3C 5C92A 4N8VG 3M17A 5I9QB 5E4IA 3P9MA 2DN7A 5L2JB 1FAIL 1U42A 3QQ4A 2FECI 4N9GB 4XBEH 5ICYA 4YHLL 4UDTA 3SOBL 4CW1B 5HGBA 3RNKA 1U8OB 4OD2A 5CSZA 5DO2C 1AE6H 3T1FB 3LDBB 5A43C 1W72A 1A14L 2W9DH 4GBXB 1PG7X 3V0AC 5CJ5A 2GSGA 3ARGC 4V1DB 3NCMA 4BYHA 3MRCA 5HHVL 4APQD 3TBWA 3OB0H 4I0PD 1FLTX 1OAKL 2AXFB 2JIXA 3EIFA 1Z0NA 5L2KA 1A7OL 3QEUB 3REWA 5A2FA 3TIEA 1CU4H 4JAMB 4LGSB 3T1WA 4QRTA 2A0LC 1AD9B 1OLLA 4GBXC 1IGFL 1GGUA 2DQJL 1NDGA 3FQTA 2F54B 4WI7A 1WIPA 3A6BL 5FHAH 4XCCH 3KS0J 4LNVA 2XTJD 1MFCL 3BDYH 3T0EC 1CN4A 1KB9K 1LE5A 5DHYB 3SGJA 3DX7B 5IM7B 5D1XC 4NO0D 4DOHE 4PR5B 4S11A 5EUKB 4EN3B 2WK2A 4DZBB 4JHZA 2O5XH 1DP0A 1P4IH 2FATH 3BHBA 4PRIE 1NEUA 5DFVC 3FCTB 1JN6B 2DQCH 3RVTD 1U8MA 3W9EB 5AD0A 4Z77A 1DLHA 3VDAA 4LLYB 3DNKA 1ZHNA 1LVEA 4GW5B 1UJTA 3LCYA 3L5WB 4N0UB 2F54A 1CFSA 3MRPB 3O41B 4JFED 3STZA 4UV7H 1AY1H 5FUCE 4LDLB 2VC2H 4KAQH 3CLEL 1MIML 4CVZA 3JBG7 2VLJD 2NXYB 1WSST 5SWZE 4GRLD 1BP3B 4G42B 5I75C 1U6AL 1QSFE 2B4CC 4XXDA 5T1KA 3UBXG 3PWNB 4QHNB 3CXDH 4GRMA 4XXCA 1R3IL 4ZDHB 5J6HA 2VLRD 1NL0L 4UTBH 4NQDD 4KKLC 4QHMA 3BQUB 4LSPL 4Y19A 5D7LE 4NC0B 1KT2B 5D5MF 3MRBA 1G0YR 1YEEL 5GRXG 2DQEH 4M7ZC 3WFBH 3QHFH 3STZB 4PGDB 1AGCB 3O8XB 5F9WB 2R56L 3TO4D 4J3TA 4Z7WE 3DX8B 3RVTC 3VD9A 2UZIL 4YXHH 1G7IB 4S2SA 5EZIH 4QXTB 4S1RH 4APQB 5JO5B 3BGAA 1L7IL 1G0DA 2FIKB 1MJUL 4BZ2H 1ZT1B 1MJ8L 3PWNA 4QHNA 2HLAA 1XF4B 4HIXL 3UO1H 4HIEA 4OCYL 1A3RL 3SDXF 2BRRL 3BKML 3V8OA 2XG4A 1N8ZA 1MELA 4QHMB 5FHAL 4KC3B 1JZ3A 5C6WH 4NM4H 4YQXH 4MS8C 4XP6L 3ARXA 1P4BL 2Y07H 2VDLH 4OCWH 1UKTA 1S7SA 1Q8MA 3RZCB 5FK9A 1UM5H 2VXQL 3C09B 3EO1B 5SWSA 1YEIL 1MVUB 3ALWA 2FLBT 3W2DH 2A6KA 3MOAL 1G6RH 3AAZB 1MCDA 4JGMA 4LKCB 2DQGL 1NGWA 2FYYA 3MBEC 3PDDA 4A2MA 1GGIL 2A6IA 5IQ7L 2CPCA 4OZ4A 3TJHD 4IM8A 3ZKMC 3V52L 3MR9B 3K2UH 4N0UE 2OMNA 1XFPA 2W0KA 3T0AA 2IEPA 5L2KD 2R2EA 4RA0C 1WISA 4KVNL 3HG1B 4I0PA 1NBYA 5FF6A 5D9SB 1DEEB 3C6LB 1TITA 1JZ6A 3RWFB 1I1FB 3NABL 4YQXL 4P2RD 1F2QA 2GKIA 3LSOA 3LRSA 4R2GD 3VXMB 2Z8WC 5IJKC 5F89A 4YDKH 4WEUD 2HTLC 1KN4L 2V2XB 2O5YL 4ALAL 1NCCH 3QIWA 3WXVL 3W39B 2VYRE 3F7RA 3R8QA 1OB1B 5J57B 2WANA 1NBZB 5D7IF 1R0AH 4FG6D 3DLQR 1WBXB 2LVEA 3I3DA 2A83A 2JF1A 4YHOH 2R2EB 5DQDH 2JTDA 4JPKH 2WBJA 1DTUA 3S35X 1WZKA 3S3SA 4XWGL 1XIWD 4PP2B 5KW9L 2BP3A 4X4MA 1CTOA 5DK3A 5F7WC 2HT2D 2VIRB 3UTPD 2EH7H 4FQXA 5C8JB 1BBDL 3MRNB 3CFCH 3MLTB 3ULUE 2ED9A 2R0ZL 4MNGA 4P9ML 2H6PB 3RBGA 4OZIB 4G9FE 5TQ0H 4QWWC 1JTOA 3OQ3B 3QCTL 1A02N 1JWSB 4FFVC 3S97C 2WINA 3JWDL 2ORBL 3MLVL 4OZHA 5KTEH 4ZFGH 3CSGA 4RAUB 1IZJA 3F7PC 3G6DH 3DECA 2V7NA 3U46A 3CC5A 4OZFA 5I18H 2J8UE 1A4JA 2MSPA 1YMMB 3WUWG 8FABA 5L2KB 2V2TB 1HH6A 2DM2A 4K3EH 3JTSB 4M43H 2IPTL 4P5TA 2FGWL 5EU7C 4OV5A 2BSRB 1OTSD 3TWCL 2DMBA 2EC8A 4W4NA 1U8HB 3LKOA 3HPJB 1D9KC 2E7LC 2RFXB 2H6PA 1CL7L 5IJVB 2VQ1A 4KTEH 4P46C 4XNYH 1N3NA 3VE0A 1IC4L 4DKAA 1S9XA 5FYLH 3ESUF 4U1IA 4M7KL 4UQ3B 1RJZA 3EO0A 1XGRB 4YC2B 1BFOA 3V5DA 3CDYA 4LAQL 3IDXH 1MEXL 4ORGB 4JZOB 3PQYE 3GMQB 1YY9D 1JHTB 1FCCA 1G6RA 5EULV 1JHLH 4NP4H 4LCWA 3FMGL 4N0CD 4AEHH 3THMH 2H1PH 3G5YB 3D3VA 2PYEE 3VXPA 1ROWA 3TCLA 2VITB 1G6VK 2MCG1 2H45A 1FG9C 2HLFC 5E8DH 4OSUL 1T89C 1EXUB 4JFDB 4PGEB 5DC4B 2KUTA 3AS2A 3GSRA 3KYOB 3GB7A 1LHZA 2UYLB 1U58A 1AHWA 5AWNH 2B1AL 5IMKB 3FQNA 4U2YA 3QUYA 4FQ1H 3VFMB 5HGDA 5CP7B 1WFUA 2YBRB 4LHUG 3RTQD 4XT1C 2AV1A 5FM4A 1KIRB 4OGAD 3ZTNL 4NCC1 5ISZE 1KTLB 2OR9L 3OB8A 4GG8B 1QFPA 1CXLA 4NWTH 3LPFA 1INDH 1GXEA 1XR8B 4RIRA 2Z91B 3C6SA 3RPIB 2HJFB 4UUJB 3L6FB 1MLBA 3GHBL 1CE6A 2N56A 3HI5H 4U3HA 4L3AA 4LSPH 1AHWB 4J4PD 4DW2H 3VWKD 2V5YA 1YMMD 1B0RA 1Q0YL 4AH2B 5GGSB 2DOCA 1IQDB 5DZNA 5SX5K 2DF3A 4UAOB 2YA1A 5FA3A 4Q9RH 1GGBL 3VRIB 2XPGA 4I9WE 3MRIB 3L5XH 1AFVH 2R1XA 1UWGH 4LKXB 4LSDA 1T2QL 2YBRA 4EKXA 1ZANL 4O2CA 3VWJD 3WUWA 5EOCJ 3RWGA 4Z7OF 4MNGE 4F8QA 3TBVB 1EEQA 5DJZA 5JQ6H 1QSEB 1EFXD 1HDMB 5D7SH 2F8OA 3FFCE 4Z8FH 25C8L 3GMPA 3UXFA 1IGTA 3D69B 3QFJA 5GGRA 3RUGF 5IR1A 3H9SB 3Q2CA 3QRGH 4YZFE 4GG6B 2XIDA 2WIMA 1CICA 3F5WA 4JFZH 3OR7B 4S1QH 1JGDA 3VGAB 5C0CA 2R9HC 1NGPL 2ADJA 2VMFA 3L3HB 3SDCC 4K7PY 4WIQA 2X41A 4JM2C 3NIDE 1BD2D 3AC0A 2DRUA 2A6DB 1NCWL 2ZG1A 3NAAL 2HAZA 1GAFL 4U1NB 4H88H 3BPNC 3VXTA 4G8FA 2J88L 1RJLA 4I13B 4HK0B 5C2BH 3TN0A 3CFEA 4IRZL 2X4QA 2R1WB 3GRWL 3HCVA 1D5BA 2GJ6A 3RNQA 1HKLL 2A9NH 5FGRA 5MI0C 1JI2A 2QQLL 3SKNA 1EJOH 1Q1JL 4JE4B 4O5LL 5BRZD 1MREH 3T3PF 2JJVA 4RX4D 1EGJA 3DYPA 4P99A 2QADC 1K85A 2JB5L 1JNHB 4AT6B 43CAA 4IRJA 1NMAH 2HH0L 4HV8A 3ARED 1K6QH 5D7KE 1QFUL 5KVFL 1A9EB 5DVMA 1UA6L 2EE6A 4FQHA 4XPFH 3NZHH 3UZEA 4NIKB 5HGHA 5JPNB 4IMLA 2XKNA 1MFAL 2OSLB 5C8JA 2EYTB 3GBML 4RWYH 3DV4B 5DUBA 4S0SD 3RDTD 4YHIA 3T2QA 5T1DH 2IANA 4D94A 4XP1L 5D8JH 1N6QL 5ICYB 1AO7E 4XC1H 4Y4HA 4U0RC 3C5ZD 3LZFL 1JNNL 3G9AB 1HOCB 3D25A 3Q3GB 3ARYA 2CR3A 4BUGA 1X6NA 3O4LB 4FFWD 1YPZF 4PJEF 4CMMB 1YJDC 1ADQA 2W9EL 1D6EB 3PIQA 4GS7C 1M05B 4KJYA 1LWRA 3V5KB 4NWUL 3OAYH 4TVPL 4M48H 3ZKXB 2YMXH 3I6GB 2C3HA 3QCUH 2X05A 5DUMH 1BLNB 4S1DC 5T1LD 3D0LB 2O5YH 5CJQH 5DYOA 3FT4A 1HQRA 2MTPA 4U1JA 4YX2L 1FPTL 1EEYB 5I15H 3MV7D 5D1QC 4DAGL 1WZMA 4CVXB 3JVGA 2YD4A 5I30L 3P4OB 1CLZH 2DKMA 1CLOL 3DX9B 5C08A 1R5WA 4TULL 5BV7B 4JDVB 1GGCL 3O6FC 1D6EA 1TENA 3HAEH 4Z78B 1XCQA 5FDYA 4UQ2A 5C1MB 3MUHL 4R8WL 1VFUA 3HZVA 4LCWB 2DIAA 4G9FA 3IF1A 1NUNB 1Z0MA 2F8XC 3QWRD 5E70A 2IMNA 3QNZB 4D9RD 5AD0B 4U6HA 3U6RB 1VKXB 1YY9C 2ZSVA 5C0BA 4PJHE 4K3JH 3LN4B 2PYFA 2BSTA 1MCLA 5IIEA 2VLME 5J11B 3NCCB 2AGJH 1KBGL 5C0JA 3QT2A 2YA0A 5DMJB 2X4NA 5JPMB 1EK3A 2BNRB 4JO4L 2UYLA 1XGTA 2CKBA 1HHIB 5CJ8A 4Z78A 4PJ8D 5JW3L 3SKMA 1UACH 3PHSA 3S96B 4X9FA 5BV7L 4GAJH 1XIWB 4OCXH 1JNNH 1TZHA 1TJHH 4G9FB 4HW6A 3V4UL 4Y19E 4M93B 5CJXA 5TDPB 3FZUC 3C5SA 1A3LH 3CVHL 3NIFE 2EC9U 5J89A 4JFQB 2DJ4A 1S7QA 3PV6B 4GG8A 3MRGB 4UILL 5E2VH 4ZD3H 5C0EB 2XWBA 1CG9B 4YK4B 4UUJA 1LD9A 4KY1L 4BUHA 3GI8H 2EH8H 2EYSB 5E94A 3MRFB 1CL7I 2ED8A 1F4HA 5HJ3B 4ZS7H 3OZ9L 2Z4QA 3EOAB 1IGMH 3BP5B 4PTTA 4WFHE 1NH6A 1SQ2N 1A7NH 3UYRH 3UZQA 1FZOA 1L6ZA 3E6FA 1MH5A 3V0WH 2GITB 4IS6B 3NMEA 2DI7A 1T1YB 4IOIA 1CXFA 4OM1H 3BI9X 3RWJA 3RWGB 4Y5XB 1X5FA 4HLZH 4NFBA 3IT8D 4MS8D 3MJ7A 1MVFA 3R0MA 2ATKB 2XWBB 2Y23A 2VC2L 3SKOB 4MX7A 5I1LB 3HFMH 4BQCA 5C9JA 3RY4A 5IGXL 4OLXH 1D9KD 5D8JL 3FL7A 5E8NB 1CICB 3L3DB 4KZEH 3GHEL 4WUUE 4ZUWA 3LKQB 3MO1A 4PJXF 1FHGA 5L9DH 2A6JB 1QLEL 3JWDH 4P4KC 4XPFL 1I8IB 3PV7A 3DYMA 2VDPH 4PJBE 4NC1C 2R2HB 4KJPD 3UPAA 3VXMD 3WJJC 5E99L 3VG0L 4NWTL 3P9LA 5E9DD 4U2ZA 2X09A 2GFBB 3QPQC 1P7QB 4M43L 4ONHB 3BH9A 1PG7L 4AENA 4G6AC 2A74B 1ZK9A 1I1FA 4X6FA 3H9HA 1P69B 3SKNB 4KJWC 4JG1L 4Y4FD 3B2UD 5CEXB 4I4WA 2XXCB 3QDGA 4Y1AD 2CRMA 5IB3A 2B1AH 3MNVB 4J3XA 5C2BL 4R26H 3QUML 1R3JA 1GOHA 4X6BA 3BPOC 4FG6C 3DVNA 3MV9A 3O6FD 5EB9A 5CEZD 4G6ML 4APQC 3O6LL 4UV4L 4Q6IB 5C6PB 4TUJA 4EXPX 3D39A 2DQDH 4ETQB 1U8QA 5F7EH 4DGYL 4L4TE 1EUUA 3OKMA 4ONHA 4X7EC 3UZVB 1BQLL 4X7SH 5FV2A 5EO1B 3TA3B 1XF5A 5CBAB 2BVQB 3THML 4ELMA 3AS3A 4YDVA 1H3PH 2R56H 2O26U 4LLUA 1MUJB 1IAIM 3DO7A 2F54D 4L8CA 3MLTA 2ITDA 3PDOB 3ORJA 1M7IB 3UJTH 4JO3H 1UWXK 1A7RH 1YEDA 3O4LE 3V4UH 3WYRA 5IVXA 4LSTH 3SKUD 1J0YA 1NC2D 4LVOC 5D2LA 3QUZA 1YECL 1MPAL 3IGAB 1I3GL 1WZLA 3MACL 4XH2B 2QADB 2AVGA 5I76A 4U3XA 1SM3L 4GH7B 2P5WD 1ZANH 4D3CH 3D2UB 5BJTB 5LWYL 1T0MB 7FABH 1BF2A 4MQSB 1OGAD 1BLNA 4AZ8A 3AU1A 3D39E 3ALXA 3PJSA 4PFEA 1TJGL 3W9DA 4OAWB 4ZO6A 4KROD 2X7LA 1TQBB 3PL6D 4MQ7A 4LHUA 2ESVE 1INDL 3P40A 5ERWB 4WU7A 1ZSDB 5GGVH 1G7QA 4ZAKD 3VA2C 4MNHB 3BPCA 1S9VA 1JCKA 1SJEA 1AP2B 4YR6A 3CH1A 3LKSA 4BFIB 2XA3A 7CGTA 2AEPL 2BX5A 1KNOA 3MLYL 2DWDA 1HXMA 1NC4B 2DYPA 5SWZB 4G5ZH 5JW4R 4LL9A 4JM4L 4JKKA 5I1JL 1OAUH 1IC1A 5GJSH 3GO1H 3IXAB 1HHGB 1R3KB 1F45A 2EKSB 2AK4B 3BQUC 4X6EA 3G5YA 2P8PB 1QYGL 5TF1L 5KN5B 1FG2B 4MMXC 3ZZ1A 3QCVH 1J10A 3QI9C 2XNAB 2MFNA 4PUBH 3DOSA 1G7QB 4PLNC 1X5GA 1U8IB 4HCRL 4H1LG 4LSSL 4TVPH 3KWWB 4K9EH 4XC3L 4WHYG 4ENEC 4QCIB 3T2PA 3BN9D 4FFWC 1DQTA 1KN4H 2EXWD 1WCBA 5HGDB 3GBNL 5TDPA 2V9QA 1JPGB 5I1KL 3VFSB 3QZWA 1YDPB 3GSUB 2LAAA 3T2OA 1P2CB 2VDOH 5DS8A 2UWEE 3EYQD 5MEOB 1F6LL 2AV1B 3SJVE 2L4OA 4TUKH 2EE9A 1CG9A 2VUOA 3LQAL 3MGTB 2ZSWB 3QEHB 5DD5H 5IROC 4E41E 4J2XA 5KSBB 2VR4A 4WV1A 3HC0B 2CRIA 1FIGH 5C0AD 4ELKB 4Q9QH 1F02I 3QFJE 1RUMH 4Y4KC 5KVDL 3CVIH 4R2GB 5F44A 1OVZA 3HAEG 4NN7C 1KG0A 3L3GA 4YPJA 1CDGA 2E7CA 2F5AH 1JNLH 3KLSA 3QCUL 4M1CC 1P2CA 5DS8B 32C2B 1BEYH 4Q0XH 4PY8J 3FQWB 4C56A 5KTEL 2B1HL 2DQHH 3MREB 1WBYB 5C0CD 2AJYL 4U4BA 3DJ9A 3HUJB 4XNUH 3G04A 5DJ8B 1I7TB 4EIZC 4ODSH 4Z0XB 3B9KB 4PREB 3UJTL 5CBEA 4QYOA 4L8SC 3CPLA 4Q97A 1UB5B 3VH8G 1E27B 2H26B 2NCMA 1A7PH 1G9MC 1JE6A 4GAFB 5E0QA 3T77B 1IGFH 5JIHA 4JVPA 4JGUA 4G9DA 4R96B 2P46B 1O7SA 5I16A 1IM3A 2ERJC 2P5EA 3N0PB 3V4VH 3LQZB 3K8LA 2EDNA 4OZGB 4OZFH 3GNMH 1I1RA 3B9EA 2VDLL 4PGCB 1ZS8A 3N9GL 4FS0A 1TIUA 4PP1D 4F7TA 4N68A 3KXFE 1AR1D 1T20B 3GI9L 5DJ2A 2FZ3A 1AGBB 4NQCE 5EH1A 3HMWL 1AXSA 3TH4T 3QG7L 2NR6D 4LBEB 1DJSA 1IAOA 3DX7A 4J3OC 1E27A 2H26A 1VFAB 1UWGL 3SE3A 4K23H 4K9EC 5GGTL 1JUFA 1X5LA 3EJZD 4NQXA 5DDHA 3KPNB 4CAGA 4JRXD 3G6JB 4I3SL 5KVMC 4M00A 3AB0C 5T3XE 3WXWL 5BMFH 4J1UB 4W6YB 5HGGS 5CKGA 2XWTB 1BQHB 2EDJA 1RFDL 1MI5B 3O41A 3VRLE 4H0GA 3TBYA 4U7KA 3SGDH 4PLKC 4CN4A 1G7PA 3ZT5A 3D18B 2C3WA 5KSUA 2FR4A 2YKLL 1Q9KB 1YEDB 1B0GA 5D71H 3GEWB 3MV8D 4KDTC 5B4MC 4YFDB 1T5XB 3ARDD 4GT7A 5E6ID 3ULUL 5L6YL 2NR6C 1W0VA 2JE8A 1RHHB 1RMFH 2BNUA 4JFEE 5CEYB 2J6EH 4KI5D 4I0KA 3JV0A 1QVOA 1OP5K 1U8PB 3R06B 1RZKH 4GKNA 1I1AD 4PGDA 3K4AA 2RB8A 4WUUA 5DZOA 5HYIA 5HHQA 5EO0A 1B90A 2HG5B 5KSBE 2V17L 4WY7H 1JZ5A 3V0VB 2D7QA 5FYLD 3KPOA 3H6JA 1T3FB 2UWEF 4PY7B 4CKVX 3HZMA 1RIVH 4R7DA 4MJ4A 1A5FL 2V7HB 2IPKB 4FA8A 5LWYH 3MBXH 2GQHA 4OD3L 3KJ6L 1UH3A 3GSQB 4LGRB 4XCFH 4XWOD 2QKIB 1FNGB 3EYQC 4C56D 2YPVH 1TTGA 5I17B 4X6DE 4NQVA 3IDXL 5B22A 1FL6B 4XVJH 3LEVL 3RWHB 1PDKA 3WFDL 4HUVB 4UQ2B 1FO0B 2R0WL 2VL5B 4LSVH 2Z31D 3RZCA 2HG5A 3O3EA 2HTLD 1OAZH 2NY7H 1ZA6A 4KMQA 5DQDL 5I1GH 2BNRD 4HQQH 1RZKL 1SJHB 1NAMA 2R23B 3B5HA 4ZFFB 4B50A 1QSEE 2BNQE 2RCSH 3ZDYF 5JORA 5F9OH 2HN7A 3JWOL 4WEBL 2KPNA 1F2XK 4QCIA 3P11L 5B38A 4U1KA 3TT1H 3MRBB 3VJ6A 3SE8L 5LVEA 2GTWA 4F7PB 1ZGLA 3LY6A 4LCUA 4K3JL 2Y7QA 4OIIL 1A1NB 1QD0A 1XIWA 1UA6H 2PXYA 4PJFA 3DX8A 1A9BB 5E6IC 1E6OH 1G7MA 4XBEL 5C7XL 4ONGL 4UT6L 3AB0B 5EUOE 4BSWB 4TQEL 1QBLH 3DUSB 1SYSA 5DRNB 1E4WH 3NCBB 4QXUL 4RSVA 4P5TC 3ZKXC 4CMHB 1QRNE 4BFBD 5JORB 4Y5YB 4PJAA 4UIMB 1ZEAH 1OTTD 1XR9B 3LRGA 1TJIH 2WM0A 2XA8H 3DTXB 2VABB 2FJFB 4OLEA 3BGFC 1A2YA 4O9HH 15C8L 5C3TA 3GJFH 1J1XH 2QHRL 1EUTA 1OSPH 5DD3H 1WIOA 3VXSD 5CAYB 1L9MA 4MXQD 1FZOB 4RGNC 1CBVL 3MX0A 1P53A 3QUYC 1KEGL 4RQQA 4TVPE 5GRJL 3WN5A 5E9DB 4F15B 2WWKT 4PJAF 3F7YA 4LLDA 1WT5A 3QDMD 4X6DB 5EFIA 3MYZA 2IALA 4EZMA 4X7CC 4OZIA 1UYWH 4S0TD 5TJWK 2Y36H 4ODVH 2D0FA 2IAMC 1ZMYA 5FKPB 4RZCA 4WI3A 4K94L 4PBXA 1CF8H 1A22B 4PB9H 5FM5O 5I73C 1TJHL 3CC5B 4OZFB 1MFEL 1IEBB 4OLYH 5EU4B 5I1KH 3NFNA 3IDGA 4UU9B 4HWZA 4UDUA 5IG7A 1RQ5A 4N0CC 5DEGA 1CQYA 3F58H 2DQEL 1AI1L 3RHWK 2E5EA 3KPMA 4HMDA 3BKYH 1I8IA 3B83A 3F7YB 3IU4H 3GGWB 3QISA 3I50H 1CGUA 1K4CA 3HNTH 2MKLC 1C16A 4CRPA 2G2RA 3RTQB 3W39A 4AIZA 4TSCH 1T20A 1CFQA 2IAMA 1D6VL 3RL2A 4ZFZB 3C5ZB 4JO1L 4ALAH 4PJGA 3MRHA 3H9HB 4JR9L 1AQKH 5HYJB 4RISL 4O02L 4QOKE 4PLOB 1RMFL 4UU9A 3TO4A 1KACB 1Z6JT 4GXVH 1AKJA 3QIBD 1N4XL 2BMKB 4QTHA 2D4DA 3OKNB 1ULVA 5ALCL 3IKKA 4YUEH 4WW1A 5IROA 1FO0H 4QRTB 1VERA 4CADB 3P4NA 2DMKA 4OF5A 1K4CB 5DGRA 4P4KD 4DKFH 1AD0A 3VRJA 2EIDA 3HE6C 4KRPC 4P23D 5CJBA 2YN3A 4PV8B 3ZDXE 3HC4H 4XPAH 2CD0A 3UTQA 2EIZA 4PGJA 4XPHH 4NQEE 4XRCA 4AIZB 3IU4L 3TBYB 5DMYA 2Z31C 4YHZL 4IIQA 1EDQA 4RGND 5I1IL 1YNTB 3ROOA 2ID5A 4L1HA 1HILB 2R4RH 2ZUXA 2DIBA 4H0HB 1CFVL 2V7NB 4N5UA 3U46B 3W0WE 4G8EA 4L8CB 3OJMB 4HT1H 4JY6B 1RPQA 3G5XB 1YEIH 3PWJB 3TNMA 2R1YA 4X4YB 3IVKA 3BKJH 5AEAA 2R15A 5C9KA 5JOFA 5E5UB 4X80L 1U8PA 3R06A 4KZDL 3VA6A 5I1EL 2YPLA 1UXWB 4EN3D 3VMOA 4N90D 2C4FT 4Z7OE 4YDKL 5EIVA 3GI9H 1LK3L 2FSEB 3IFLL 2BY3A 5C86A 4FQIH 3X12A 1T3FA 1IGYA 5DXWA 1F3JA 5CZXC 3V6OC 1DBKH 1OSPL 2GSIA 1T80A 4OCSH 4LSQH 3TPUB 3IYLW 1KELH 5LXGL 5B39A 5IV2B 2C3GA 5F1IB 5I66B 3GHEH 4Y19B 3WE6A 4MB4A 4MNHA 4NJAH 3RWHA 5IW6B 5KAQF 5F7DB 2Q3ZA 2FEDD 3LDBC 4RGOL 5DRWA 4WJ5A 3X11B 3K3QA 3GUTA 2OCFD 3QJHA 5LBSL 1A5FH 3LV3A 3O8XA 5DJYB 4U1LA 4V1DD 3S3JA 3ZDYE 1S5HA 4PJGF 1SJHA 3AUVA 1K2DB 1X5IA 1IL1A 3EYFB 1T1ZA 1ZHLB 4NYLB 4O2EB 1W2KT 1C5CH 4HIEB 1VESA 4EI5C 3Q6GL 4GG6A 2Z93A 4MB5A 1RZ7H 3C5ZC 3BH8A 3NCYS 2WNGA 3MLWH 4I3GA 4M6MH 4X99A 4PRHE 1T04B 5J11C 2FGWH 4IRSB 4WO4B 1CBVH 3X11A 4NUGH 2A73A 3QDJD 1RZFL 1L7IH 3SKJH 3FFCA 3VW3L 2YPKA 4U6XB 2A9NL 4XMLH 1IEHA 2ENSA 4RIRB 4JG1H 5T3XH 4NNPH 2HJFA 2ORBH 3MLVH 4WU5B 5C2UB 1BQLH 3RI5K 3WSQL 2UZXB 1QFWL 1BZQK 4LOUD 4M93C 4R0LC 3SDDD 4EI6A 1TCMA 3ULVL 1S7XA 2NY1D 5DD1H 3O2WL 3BDYL 4Y5YA 2IJ0C 1BGXL 5FA3B 3FQRA 1X5KA 2VABA 3S34L 4XBPA 3CH8A 1Q0XL 3PHOA 1FGNH 1E6OL 1KGCE 3EFFB 2MHAA 5DFTA 2DLHA 3V6FA 3QXAA 1MCHA 2EDOA 5D93B 4LSQL 1IRAY 1NCBL 1JL8A 1IBGL 1KG0B 2OS7A 3QSKB 4D8PB 1Z5LB 3SY0A 2ZNXA 3NGBC 2Y1VA 3OG6B 7FABL 1L9NA 2EYTA 1IGTB 3SE3C 2XN9D 4GQ9L 3TYFA 5DUBB 3MUY1 1MJJA 4HKZA 3IETA 2NX5B 3IXTB 5EU3B 2V5RA 1KCVL 2AABL 4HH8A 2GAZB 2E6PA 3BP7A 4TSBH 2ARJA 5KS9F 1MY5A 1U92B 5MERA 5FA4B 2ZP0T 5DJ0A 3G5VA 4NZTH 2APFA 4HK3J 2E6QA 2XN9B 4DZ8A 4EUPH 5IB4A 5DJ8A 3MRJB 1AXTL 1A64A 2WBJB 4LMQE 5DJ6B 4U0RB 5FGBC 4U1SA 2VB5A 1TETL 1A6UH 1WBZA 1J1PH 3V7AG 1FAIH 5HYJE 4QKXB 4KRLB 2A38A 1KULA 4YJZL 3RWEB 5DK0B 2KL6A 4YX2H 4UNVA 2IQAA 4N8CH 1WF5A 2I5YL 2X9WA 1BHGA 2VR9A 3QQ4B 4L29B 2CLZA 3S36H 3TF7C 4KHXH 5D1XD 3EYUH 5BS0A 1HYRC 4TUOA 3S37H 2B1HH 2DQHL 3RL1A 3C8KB 3TFKC 3EOTL 2VZ1A 4L4VB 1RV6X 4PRPE 4BZ2L 1RZ8B 3HZKA 3C5ZA 2CDFB 4Y4HD 15C8H 1EMTH 4YWGH 1LQSR 2V5SA 5GSVA 4F57L 3RDTA 2D7TL 2X9XA 3RVXC 3MOBH 4OLZL 3VFNA 5C70A 1AGDB 1OTTC 5CCKH 4TTGA 3DO3A 4ODUA 1SEQL 5GGSY 3V6ZB 1XGQB 5IEKB 3QRFM 1G9NH 2WW8A 3DV4A 3FT2A 4F9LC 1A14H 1J9CT 1J5OH 2EEDA 5TH2A 1QLFA 1KTDB 4K71B 3UPRA 35C8H 2C1PB 3SOBH 2MJWA 2IF7A 3DBXB 4KFZC 4LEXL 4U1IB 5DJCA 2CLRA 3OB0K 1W72L 1N4XH 4KQ3L 4HKJB 1LK2A 4OCXL 3OKOA 4KMLB 3BEWB 3G6JF 5IBLD 3GBNH 5BOPA 1ZWIA 1NJ9B 4YK4C 3ELAT 3R0NA 1DZBA 5A2KH 1HIMH 5KSUB 2Y5EA 2NY4D 1YN7B 4KJQD 3GSVA 5E8OB 1RSFA 3T2NH 5AYQA 3RWCB 4PJDA 5D5ME 3VXPB 2YPLB 4BQ9A 1HWGB 5FGCE 4ZYKA 3VXNA 3KLAA 5F1KC 5H37H 3O9WA 4KU1A 3EHBC 4MQTB 4J4PC 4J8RA 3KYOA 5LKNA 9CGTA 1HNFA 3TV3L 5H8DA 5L6YH 4JY4B 4OUUA 2L7UA 4PY7A 3IAPA 2X4OB 5DUML 4XI5C 5F6IB 5B39B 2J8UA 5D71L 4XZUB 4NT6B 4U3CA 1KPVA 4JPKL 5KSAB 4E42B 4WHCA 3GSOA 4MAUL 1RUPH 4WWKB 1QHPA 1FNGA 5JHDB 5ICXB 3HE6A 1CL7H 4ZNCD 4XMLL 3QQ3B 2N7AA 4K2UH 2BHYA 4QRRA 3WEXB 4R4FL 2YSSB 4M6OL 1RFDH 1PFCA 4XCNB 5TE7L 5IBLC 1KXVC 3NTCH 2JB5H 5C0JB 3DV6B 3WO3B 1T22A 4OD1H 1IL1B 5FUZL 4H20L 2SEBA 1VGKB 1NLDL 4S2SB 1C08A 4RFOL 3V2AR 1K3IA 5K9JL 1IQDA 1KC5H 3S96A 4ZFGL 3ULUH 1U6AH 4LLMA 2D0HA 1NKOA 1S7RB 4NO2B 3GSOB 1HCFX 3WFHA 2CIIA 3K81A 4MHHG 5JHLL 2YOCA 3OKLB 3LEYL 3CZFA 3LS5L 1ZLSL 4PJXA 3QNXB 4P0DA 3KYAA 5HVFB 1KIUA 4GRLC 1ZLUH 4XCNA 3RVXD 2J4WL 3INUH 5E7BA 4WI9A 1FNHA 2PXYB 1IZKA 3D69A 1KLGA 4AEIL 1QFWM 1J8HA 4Q74A 3KPRE 2LVCA 1W0WB 5HHPA 3AAZA 3S8WA 5KOMC 3UTZB 3CFIC 3O6FA 4PRID 4F9PC 3OR7A 4XB7A 3ARQA 3MUGB 1SYSB 4B5EA 3EJYD 5JXED 4NO2A 3QI9A 2DBLH 4AM0B 4IMKC 4P5KA 1CFTB 4KMTH 3SJVB 2NY1C 2CGRL 2UWEB 2V6HA 1E6JH 2DS4A 4B0MM 5MP6L 5BZWA 2A1WH 1BQUA 4D9LL 1TZIA 5CMAB 5TFSH 2VLJE 4TUJB 4I0PB 3HG1A 1I3RA 1R5IB 2ZPKL 3FOLB 2F58L 2VKXA 2KQNA 2LABA 2FNBA 3UTTA 5I1LA 1ACZA 3O45A 1WFOA 1KLGB 5CIPB 5HDOA 1MJJB 4NN7B 5FYKD 2JLLA 5CD5D 1MFDH 5CJXC 3RIFF 2K7PA 3VXMA 4GMSH 4Y4KB 4MAYD 1NCWH 3PHQB 3V7AE 3FRUB 1T03L 2AS5M 1U92A 5MERB 3MACH 1I3GH 4PRHA 1M7XA 4AT6A 5T3ZD 1BX2B 2H32H 3CUPB 4GRWF 3WL9B 2VLLB 1ETZA 1S7TA 3GM0A 5HHOB 1FVEB 4X9IA 2ZUSA 2EXWC 4PRNB 2B2XH 3BZFA 3JWOC 3L3JA 5IVXF 5D5MA 4NJ9L 3QXTA 5L8KB 1P4LA 4X5XB 3OGCB 1BIHA 1P7QA 1T0MA 1LP9E 2NY2D 3X3GL 3DSFL 2GIYA 2Y36L 1WWBX 3B2VL 1BAFH 3VFOB 4NQSB 3PJSB 3QUXD 4KK5D 4A2LA 5D7JC 3BGFB 5KVEH 3U2SA 1EEZB 3WV0A 4FTVD 4EQ3A 5J1AB 2NY0C 5IVZA 2G2RB 4QGYA 3L7FA 3E8UL 5IFHL 2Z0BA 5SX4I 4HUXA 5CILL 1FC1A 1CD1A 2BCKB 4JY5L 3MRHB 4ZUVA 4QT5B 2P42B 4YXHL 3D39B 4DQOH 1G7JA 4P46A 4FQ1L 1MRDL 1MQ8A 4XPTH 3MRRB 4H20H 3WNKA 4NJ9H 1I7UA 5INDA 3FT4B 3BD4A 3IXAA 3I2CH 4EN3C 4KMTL 3VI3E 4IDLA 3DI3B 5AG9A 4K3DH 3RNKB 5E2JA 1SVCP 1U3HD 5E2WL 3T4AA 4ONGH 4UT6H 5FCUH 1E28B 3KNBB 4XHJC 1RURL 1H3PL 1UFUA 3UYOD 1U8IA 4ZOEA 4QRRE 1RY7B 3EO0B 1EAJA 2H32B 4X7SL 2R4SH 1H3XA 3HMWH 3QPQD 1NANI 2M26A 4RISH 4G6KL 2Q86A 3LKRB 4WI5A 5HYSA 2XICA 4ZPVA 5B21A 5EBMA 4MA3A 2IPTH 3WHXA 5TE7H 1EHLL 3IVKB 3QNZA 2PTTB 1FRGL 2YXMA 1YNKL 4PTUB 5HDQH 3KLAB 2ZG2A 4D0CA 3OAUH 5DC0A 3WMSA 3IRPX 2B4CH 4ZS6C 1EA9C 2D4FA 3AMKA 5K9JH 4KTDH 1JVKA 5IHUH 3SE4A 1NAKL 2MCPH 3PE9A 5CZVL 4X7DC 4OUUB 4JFFA 2DM4A 1S7VA 1JV5B 3GJFB 2DWDB 4LAQH 1TCRB 1U8NA 3RVWC 4PB9L 1X7QA 1YNLL 5I1DB 4ZPTA 1R24A 2XT1B 5MHSD 4LDEB 1MAKA 5FO9A 5GZOC 2VDPL 4HEPG 3NGBB 1HHGA 2RBLA 4DUVA 4P2OA 4JO4H 5B3NA 1PX3A 4D0CB 4XPAL 3O3AB 5DHXB 1OAXL 1B4JL 2X89A 3KHQA 1AE6L 2DWEA 1EO8H 5DC9B 1ZHBB 3RHWF 2X70A 4JKPL 1MCPH 2YEZA 1Y0LA 4X6CA 1ORQA 2NW2A 4MD0A 1FV1A 2PO6D 4X6DF 4YXLL 1HIML 1R3HB 4EVNA 5IESL 4G42A 1YYMH 4KXZH 3H9SD 1PD6A 5CZKA 3X13B 1NBQA 1G9ML 5C09D 1I8KB 1S7RA 4K8RD 3JV6B 4LSUH 4P5MB 4ZSOA 5C0GB 2XPGB 4I2XA 3HR5B 3T0ED 3M8OL 2BVOB 1CDCA 4N9GA 5ALCH 5AAMA 2KBGA 1IM3B 1U3JA 4MJ6B 1MWAB 5DJAB 1LNUB 4F7CA 1MHHB 3WFCH 4K07A 1YMHB 1W72B 3WFBL 4N8CL 4RAVB 1R3HA 4EVNB 4QXTA 3QUXC 3UTZA 2C7UA 4D9QD 1I1AB 1PSKH 43C9A 5IOPB 2FEEL 4PJ5B 3GFUA 4ZUSA 1JNJA 1O7VA 2N4IA 2BFVH 3MO1B 5EZOH 1MAMH 2EDYA 4GLRH 4DKFL 3G9VA 4Y88A 4O2FA 4ZSOB 4I18B 5C0GA 2Q8AL 1N8ZB 2QQKL 4XPGH 5ESAA 2ZG3A 3NPSC 1PEWA 5J1SC 4LU5L 1U8KB 5DI8A 3ULSB 2Y6SC 4C56B 2RGSA 3EYOA 1IT9L 3O6MH 1R5IA 1QPPA 2R0LL 1LGVA 2JCCE 4OD1L 4GKSB 3VXTB 4M1GL 5I1EH 3FQTB 2CK0L 2VDKL 3FJTA 2GJ6E 5LGHL 3EW3B 4Y4KA 3CFKA 4D0BB 4ZUSB 3DUUB 3TO2B 5IM7A 1IC5H 4LEXH 3CUPA 2VZUA 1EPFA 3MXWH 3T77A 3UROR 5IW3A 5ANMA 4OIBA 5MEPA 5HHOA 5ESAB 5ISZD 2LQRA 1WWWX 4PPTA 1YEJL 4IRJB 4JFYA 2WUBL 2BNUB 1KUMA 1JYNA 2DLGA 1KFAH 1OAYH 4WDIA 5DJXA 1CZ8L 1PKQB 3MNZB 3BZEB 4FTVB 4XVTL 3ARPA 3WS6C 4HSQA 1HN1A 1YMME 4PV9A 1Z9OA 4HAGA 4JCLA 1ZLWH 5DSCA 4S1RL 3SDAD 1MSPA 4X6CF 4Z5RA 4DVRH 5E7FA 3A0OA 4YHIB 4XP6H 3MLXL 3ZTJG 1BWMA 4L8DB 1MNUL 5K9QG 1MCFA 2WQ8A 2BZDA 2FWOB 2JKXA 4XXDB 4IBLT 1G84A 1Q94A 4OI9A 2FHCA 3GMNA 5IFJB 1MCSA 4YNYA 3U82B 2YD2A 3IJYA 4DFHA 5GSVB 2I5YH 4L1DA 3VFNB 3FAXA 1IBGH 1ZA3A 1CLCA 4Y1AB 1NCAL 4S1QL 4OV6F 2VAAB 1WEJL 5IW1A 1J1PL 3OBAA 2JJSA 2XA8L 5EO9A 4XAWH 4LCWE 4EXKA 2Y5TB 3P9MB 3T08A 1VPOH 5M95B 5CWSA 5E1AA 1Q9LA 2AKRA 5I19L 3TBSA 2E7HA 1FYHB 3S37X 4C56E 2E9BA 2OXGA 4WFED 5F6IC 4M8VA 4NQDE 3WXWH 3OAYK 2EDBA 1B0WA 2AI0L 2EEBA 4XPTL 1TPXC 4ZSOE 2X4SA 5F6HJ 3GK8L 5HYFA 4N8VB 3TT3H 2CUHA 4P4KA 4YDJB 2D7TH 1EVUA 1VEMA 5HY9B 5KVGH 2Q86B 3LN9A 1ZKAA 2GTWB 3QHZL 1KCUL 5I8KL 5IW1B 5CP3H 3ULVC 4LLVA 1JPTL 5CINH 3ZDZE 2VE6A 4NQEA 1VGEL 3HZVB 2ZUVA 1U8LB 5DHVB 4HH9B 2BNQD 4N0YH 1JWMB 5FKAA 3TBSB 3O11B 4OTXH 2D7OA 1ERNA 3V4PL 2DJSA 4BSVB 2ADFH 2P44B 3IAGC 3GSQA 4JDZA 3L7EA 4FZEH 3HMXH 3GSWA 4KV5E 4ODWA 4YDIL 3KWWA 2X4SB 3HE7D 4GAYA 3BX7C 1FGVL 3DUHA 3P3YA 4P2QE 4R7NB 1A7OH 5DHYA 5C09A 2H41A 4XX1G 1YQVL 2NTFB 5I1AB 4LLVB 4TRPL 4U6YB 1KCSL 3CMGA 1CFBA 3RIAK 1RI8A 4TSBL 2VUYA 4A6YH 1XF2A 2HRPL 3BHBB 3DARA 3V8CA 2DM3A 3M1BB 3N85L 2WAHA 3SO3C 2ILLA 4XXCC 4X80H 2X70B 4KY1H 3DMMC 4S10A 4IOFC 3O3BB 1OT1A 5HXMA 4YHOL 4NSKA 4WV1B 4M7LT 4NHCL 4PJHB 4U1HB 4HKXB 5EZOL 5IBUG 1C5CL 4ELKA 4DW2L 4RZCB 4K7PL 3X13A 5A2IH 4YAQA 3KPSE 1L0YA 2W65B 4MCZB 4JREB 1JRHH 4LCUB 4P5MA 3KLHC 3HR5A 2J6EA 3P9WB 3LZFH 3NTCL 4ZMAT 4IOIB 4ZXBA 3VH8B 4S1SL 5D96C 2JK5B 5MENE 4MJ6A 4KTDL 3RWDA 2BC4B 1FCGA 1I8MB 3C5JB 2WZPD 1CFQB 3KVQA 1RAMA 1JF5A 4P57B 1RUQH 3LD8C 4IEFB 4V2CB 4J7RA 4FP8L 3MPCA 1FVCA 4AH2A 1DL7L 1T89A 3IFLH 3VDBA 4KKBC 1G7LB 2CO6B 1G6RL 1VADB 2NY5L 4ZXBB 4QOKA 3L5IA 1B4JH 4PJIB 5L8LB 3VD3A 2UWEA 3EZ8A 4P2RA 5F21B 3NCEB 1VEOA 1MCBA 1N3NB 3VE0B 5EZJA 1EERB 4FQLH 4M3KB 5DJ2B 1KCSH 2YXFA 4R8WH 4HIJA 3WN5C 1RJZB 3DHJA 1NCUA 4LNRA 1JTPA 4JM2D 1HHHA 1SBBA 1F4WL 2NLJB 4OGYL 5KOVC 4ERSH 1UKSA 1JUFB 1I9IL 1NGXB 3IRZA 2OLDA 5FOBA 4UDUB 3RZCD 1M6OA 4JY6A 4DEPC 5L9DL 4JFYB 5FFLA 2P8LA 2Q20A 5INCA 1XZ0B 5HI4D 4ZNEA 3HB3D 2D3VA 4ZOCA 4FTVA 4P2RB 3TCLB 5GS1A 5J7CC 1C5BH 5J12B 1U8QB 3IDMA 3MCLH 4OLWH 5T1DL 1M7DA 1EXUA 3GSNH 3KHOA 3VFTA 2QSTA 4PD4K 3ZE0E 1MUJA 2FWOA 4QTIL 4H5SA 1NC2A 4Z7UF 2ZOKA 3UTTD 4Q9RL 4DZBA 2OM5A 1OY3B 3BO8B 4QGTA 3OKNA 4HV8B 2ICEA 2H2PD 3MA9L 4IRJC 2P48B 2BCKA 1ZHNB 3QNYB 4HXBH 1K9TA 1PEZA 3PGCA 2QSQA 1G7HA 2BNQA 2EIZB 4JHAH 4LFHG 3QJHB 2DQFB 1RD6A 4TOYH 1U2CA 5D4QA 4GMSL 4PRIA 5ADPH 1NKRA 2O5XL 3C6LD 2XWJB 2NXZC 3BRFA 1MRFH 1IMHC 5CILH 1M71A 4H5SB 5B38G 5CIPH 2JB6A 1VSCA 5J3HD 1I8LA 3DETC 1I1CA 1E28A 1H3UA 2DLEA 3G6AA 5HHMD 3ARGA 4LCCB 5EN2B 1T5WB 4GG6F 3VXUA 4GRLA 4N0RA 3MLUH 5A3ID 5HD8C 1IC4H 3MGAA 1ZLVH 4HFUL 5HYSG 3I6LE 3DRQB 1NAML 4J6RL 3FB5B 2NY2C 1ZVSB 1F97A 1N59B 1F3DH 2MQ0A 3ZE1E 3U7YH 3HE7B 5K93A 1MCCA 4PUBL 5F3HA 3TT3L 4EDWL 3MMEA 4ELMF 2EDDA 3GDBA 3F6IA 4KDWA 4L8SB 1JHLL 1F58L 3LPGA 5CEZE 3MTRA 2ZWLT 4MJ2A 4CN1A 4NC2B 5I18L 4Y8AA 1JGDB 4GAYB 1T03H 2ZUYA 3QXDB 5ID0A 1OAUL 1T5WA 2CSPA 1XGPB 5IVNA 4XP1H 2FRGP 1HH9B 3WJJA 5DD0H 1TQBC 2JELL 3EAKA 3QH3A 3U0TB 4C58B 1CS6A 1TCRA 3HUJE 5DJYA 3Q5YA 1Q0YH 2JJSC 1MFAH 4G6AD 3TIDA 4OCMC 5CGMA 2HJLA 4FZEL 3JUZA 3HG1E 1BBDH 1MPAH 1JPGA 4LKCA 3EYFA 4KK8D 4P4RA 5JNYA 1YNKH 3MMEB 5EIIA 5D72L 2Y06L 1FJ1A 4OFVA 3FQXA 4HXBL 5IIEB 3NA9L 5K9OB 5F9AC 4OZ4B 4J3VA 3VI4E 1A8JH 2VDNH 4UT9L 4Z7QE 4OCYH 2PYEB 3MV7B 3HB3C 2EDKA 2R4SL 2AK4D 1HSAB 3EGSA 4XB8A 3QHZH 1JYXA 3SDXB 4EQ2A 1INQB 3PQYB 3WLBB 2GHWB 5T5FH 4RNRA 4F15C 2MPAL 3GHBH 4JM2A 1YNLH 2Q6WB 1SYVB 3VFMA 3T3PE 4MNQE 5ENWB 5GIRB 1UJ3B 3LRSB 3LSOB 2D03H 2ESVD 5BRZE 5L7XH 3PWLA 5D7LA 2OX5A 3UCRA 2H2PC 3DXAE 1SBSH 4JG0L 4G5ZL 5K9OA 2AEWA 5FECA 3BGMA 1LD9B 1M1SA 1KCRL 4GRWH 4F7CB 1CLOH 3HRPA 3NFPB 2AXGA 3U9UB 5KZCD 5HVGB 4GXUN 4C57C 4PJ8A 3RDTB 1WAAA 5ILTH 5DK2B 1FNFA 3D0VB 5IG7B 4Z8FL 5I1CL 4MB3A 1JWUB 3MGOA 5CJQL 4PD4J 2DAVA 1F4YH 1II4E 4H8WC 3WXVH 1BVLB 4FQIL 1QNZH 2AJSH 3QPXH 2Q7YB 3RWJB 1PJ9A 5DTFB 3V4VL 2X6MA 4LLQA 4WFGD 3FN3A 1NGQH 3BRGC 3TVMD 3QWRA 1HQRB 3QXWA 4LOUC 4Z7VE 2H8PB 3T1FA 3HNVH 5FXCH 3LS4H 3NACL 3W0WB 4PGCA 3U7AA 4K55A 1UXSB 5BS0D 4ZG1A 3SPVA 4PJGB 1FL3B 2D9CA 3DX9A 1D5ZB 2AJ3A 5K59E 1JPSH 4XAKD 5IGXH 4NO3B 1RUAH 5FO8B 4KPHH 1AXSB 1Q9OB 2OL3B 2IFFL 2NXYD 4MD4A 2N1KA 2BSRA 3CDFA 2NZ9C 4G80B 3OXRA 1DFBH 1HCVA 3ARFD 4LP5A 1QLEH 1XCTB 1ZLVK 1QA9A 2QSVA 4E41D 5IJVA 4O58H 5HHNA 3EKCA 1KENH 4KRNA 1MQKL 4P2OD 1RJYA 3ARFA 4JB9H 1R6VA 3BE1H 3F8UB 4QHKI 4ODHH 4E5XB 4WFFE 3S36L 3MODL 1EBAA 4L4JA 4TSAL 1F8TH 4OZFG 2ZCLL 4KUZL 3O2DL 4NKOB 4Q2ZA 1OWRM 5BVJB 5CSGA 4I4WB 1ADQH 5D7IB 1GRWA 1T21A 4G43A 3CMOL 3OSKA 4Z7NF 4PJ9C 3AXLB 3V6ZA 4NQDB 3A6OA 1OCWH 5GPRA 4I48A 4OM1L 4NT6A 5IMOB 3VD5A 5C0IA 3GSNL 5DD0L 4P9HL 3R1GH 1UEMA 1B9ZA 4ZXBC 1IAKB 1XF3B 4G8GA 1A7PL 4JCMA 4FQHB 3OZ9H 1ZT4A 2HT4D 2XTJE 2P8MB 4YHYB 3MYJA 4MD5A 2PETA 3GMLA 1F58H 4EOWL 5FIEA 3WSQH 2DM7A 4GW4A 5EO0B 1M71B 2HTKD 3BEWA 1FAKT 1EFXB 1V5JA 1IC5L 1OF2B 1ZE3C 1OGTB 2WP3T 4QF1A 2EDXA 3F65A 4RGNB 1FO0L 4PGZA 1DN0B 1OP5H 3WE6B 4LCCA 5BRZA 2ARJQ 3QDJA 1T1YA 3LEVH 3WD5H 1FLRL 3RWCA 3DPBA 5KJRL 4MNQA 3G5ZB 4P4KB 1PQZA 4X7FC 4IIQC 3O9WB 1ZTXL 4AEFA 2QJDA 1QLRB 1X44A 1OP3H 5E8DL 5CD5C 3S5LA 2P7TB 3BJLA 1ZHKA 3ES6B 5EU5B 1MJUH 4JN2A 1HHKB 2X1QA 2XQYK 5C9JB 2VDMH 4HH9A 3ARSA 4JY4A 4LLWB 3OJ2C 2FLRT 4YO0A 1OF2A 1NPUA 4PJBB 2FIKA 2W9EH 3FB8A 2NY0D 4XZUA 3L7EB 2AI0H 5A1AA 3HE6B 5JZ7C 4MNQB 3U36A 4G6MH 4JQIL 1BFVL 1V7ML 2YD6A 3QH3B 4LRNL 1KB5H 1KIQB 3SGEH 4UTAH 3QEGH 1XCQB 3DVFA 1GVIA 1KCUH 3LS4L 5I8KH 5JW4M 1LDPH 5F71A 5I9QC 4GBXD 2J7LA 1JJUA 3QFJB 5GISH 1MI5E 1PG7W 3ZT6A 4FQCH 1S7XB 4ISVB 4YO0B 4DGIH 4Q6YA 1A6VH 3O8XD 4N5EC 4ZQKA 5HI3C 3TT1L 4F7MB 1FC2D 3N1FC 3BZ4B 3O6LH 3MJ8A 4QHLB 3MV11 5D70H 4OJFL 3WHE0 1GCFA 4PJAB 5FUOL 4RRPG 4TVSa 5HHOD 5ISZA 3WL9A 1O5DT 1EV2E 3VWKA 1CK0H 5EUOF 4BK4A 5J9PA 3ZHKA 3KPRA 4PP1C 1J8HE 3AVEA 3NA4A 1OD9A 5ESVB 1Z5LA 1NCDH 4Y4KD 3OKMB 3H42L 1H0DA 1LEGA 1XF1A 3WIHH 3WN5B 4Q7DA 4Y16A 3O3UN 1OQOA 1DQJB 2QBWA 1FH5L 1HQ4B 5TGBA 2GAZA 2B39A 4JRYB 1WAAF 2APBA 4KUCF 4NNYB 3O6FB 4DKEL 4DKDC 3ZL4L 3TEUA 3GRWA 2VKWA 3K0WA 1KN2L 4WNQA 2FIRT 3LEYH 1KB5A 3OKYA 3QIWB 4NBXB 4M62H 3QUYD 3DI2B 4P23A 2NNAB 3PWPD 4UNTA 1OWWA 3MV9E 3F7VB 1ADQL 2A83B 4F80A 1AR2A 5I76B 3QXUA 4WY7L 1W8OA 3EOAA 1JGEA 3U4EB 3SHSA 3L1OL 5DK0A 1MCQA 2DQIL 3VD4A 5F96L 3O8XC 8CGTA 4IS6A 4HFUH 4FQ2H 5IMLA 4Z7WF 3U9PH 3K74B 2VIRA 5BV7C 1XAUA 1JK8B 3IDJA 4QRPD 2VDRH 3C8KA 2FEEI 2PXYC 4W6XB 3S98A 2QQLH 4N1EA 4WGVB 3STLB 3T0BA 4Y8DC 3M07A 4CUCA 1NBVL 3H7BA 3QR2A 3O4LA 1UKQA 1XH3B 2VZOA 1ZSDA 12E8H 3GMRB 5GS0L 5HBBA 3C8DA 4NO3A 2GY5A 3MCKB 4I3RL 4QRPB 3BZFB 1YEFH 3L3JB 3QIBA 1FYTD 3CIQA 4OGXL 3PP4H 1OM3L 3VMNA 5C0DB 1AR1C 3TLRA 4BSJA 1IC7H 4M4RA 1C8PA 2E8YA 4C4KO 3JTSA 4OT1H 2YZ8A 5ALBH 4MLSA 1JTTA 5MEQA 5J06A 2I27N 2R0KL 3NOIA 3K7UA 3AMLA 1G1YA 1R3LA 1ZV5A 3HRZA 5E6ZA 5TQ2H 4CADA 2O61A 1EEZA 2R2HA 5E8PA 4QRRD 4ZD3L 3TGXA 4P3CH 3UBXB 1I9IH 2NY3B 3MRDA 1I85C 5D2NC 2BOCA 4IIQB 1M7DB 1MRCL 3H0TA 3QWQB 2XYCA 3EJJX 4P3WA 3DVIA 4X6FB 3V5DB 2BJML 2OR8A 1RVFH 1IAOB 2KQMA 5T5NF 1PW3A 1JFQH 2CGRH 1YN7A 4L4TB 2GTZA 4OZGE 4HIHB 1TFHA 2F19H 1MCEA 2RIKA 3QDGB 5E8OA 3K4DA 3QEUA 2J2ZA 3LOWA 4ZPTB 1TXKA 3S7GA 4HJJH 1MCOL 4QRUB 3RAJH 4J1UA 3DSNA 4IRZH 1ZEAL 3RGVB 3LN4A 4R9HA 3TFKD 3BWAA 1I9RL 1N2RA 3QWOB 4L8BB 4S1SH 2P8MA 1IQWL 1RIUL 3QDMA 4MD5B 4AMKL 5DVOA 2YEZB 5D6CA 2BVUA 4P59H 5D7JB 5JPMA 1IJ9A 1T1XB 2BOBA 2H3NB 2XRAH 1GJIA 1FFOB 3DRTB 2AJVH 2FO4B 5BVPH 2ICWI 3FHQA 4ELMB 2X4OA 4XVSL 4YDVB 1KEGH 1FE8L 2GUOA 2HMIC 2VXVH 5A16A 4FQXC 2IH3A 5FYJH 3LKPA 5E2TL 1MIEH 4OLVH 3WHXB 3QIWD 4KRPB 4QRUA 2CKBL 4XHQA 4RFEA 5KVGL 5IB1A 2PTTA 5C08E 3NBNA 5FHBH 1OOAA 5DQJB 4PJCF 5IW6A 2AEQL 3MV8B 1OP9A 4IRJD 2CDGA 3WKML 5DJAA 3ZO0A 3BD5A 4KK9D 3LQMA 1MHHA 3LN5B 2G60H 4U1LB 3ES6A 1RIHH 1CFNA 3IDIB 5HJ3A 1FL5B 1DANT 1FH5H 3I9GH 4OCRH 3TZVB 4BK5A 1L4IA 4ZUTA 4P46D 1JV5A 3W9DB 4QLRA 2HTKC 3FB8B 2C4FU 1GZQA 2J8UF 3CLFL 4XNYL 5SWSE 3HLAB 4NKIL 3SCMB 3C2AH 3NN8B 5ERWA 3OKLA 5I2IA 2GCYA 2J1KA 1KIQA 1DSFH 3P0VH 2XZAL 2YPVL 1H8OA 5DD6B 1BF8A 3ARTA 4RCAA 3WS3A 5F9WC 3OX8B 2EC9T 5EOCH 3VFVB 3KPSB 4DKEH 3H3KA 1QSEA 4Z7UB 3O2VH 1PX4A 4ZTOL 4HD9A 2EYRA 3DROA 1P9MC 3ROLB 1J1OL 4JFDD 2ZUWA 2B5IB 3UC0L 1Z9SA 1N5YH 1WGOA 1W8NA 4KGLA 3UTSB 2WLZA 4P5KB 3V0WL 5IFHH 3KPNA 4TPRH 1WCQA 5I19H 1GHFH 4F7PA 2Z35B 4HUWA 1ZGLB 3MNWB 4QRQA 1BJ1H 4PS4L 3KJ6H 4OGZA 2EH8L 5B3JF 4WDIB 3WIIH 1FZMB 3NIGE 1FIGL 3MLXH 4PJFE 1A9BA 1IAIH 3VMPA 3SE9H 2BHZA 1DUZA 2X4QB 4OBSA 5DQ9B 4KKNA 2HFFB 3N50A 4GW1B 4YHNA 5IHZB 1IGJA 4FHBD 2FB4H 2QADD 4C55A 2OTWA 1BM3L 4PRAA 5K59F 4NNXB 1FVEA 4GMTH 2ATPA 1RJCA 3D3VE 4LEOA 2Z35A 4HUWB 3Q6GH 4XAWL 3SDDA 2YD1A 4ETQA 4Q9CA 4PJ7A 3B9VA 2RHEA 3D0VA 4U1SB 3IDYB 1GGBH 5FF6B 2Q7NA 4FFYH 1F00I 4LPCA 4Q58C 3T2NL 4LIQL 2DKUA 1FRGH 1A6AA 5C0AB 1EEUA 4LLDB 5JW5A 4OQTH 5GGUA 1S8DB 5HYQA 3FQUB 4GQPH 2E27L 4LLQB 3GIZH 4Y5YC 3QA3B 1S9WB 3K2UL 3IB4A 3V0VA 4M1GH 3ILQD 4H8WL 3TO2A 1JZ7A 4EUPB 4BH7A 5E08H 1EJOL 1Q1JH 5J12C 1IM9A 1BIIA 3Q5TA 2YD3A 4L4VA 4IRSD 4H26B 4WO4D 4KI5E 2CRZA 2OJEB 5JXAH 3JZ7A 2FH8A 1T6VN 2Z9TA 1CQKA 5ITBL 3T3ME 4NQVB 5LAXB 1N6UA 3B3IA 1WVZA 1I7TA 1AXTH 4NM8H 3DVGB 4LCWD 1U91B 1AGDA 1FNEB 4JRYE 1S5IH 4M1DL 2NY4B 4HWEH 2RJMA 2Q76B 1NBVH 5L7XL 4XP5H 1IGML 4PV9B 4G80A 3QG7H 4FQXB 1DBJL 4D0DA 3INUL 1T66D 3BYTA 3D85B 1GH7A 2YPLE 3FZUD 4PGBB 5FV1L 4WUKL 4OZHE 5EC2A 1LO4H 3BQUD 3JUYA 4MJIE 2HT3D 1JWSA 3VGAC 5LCVH 3BUYB 1K3ZA 1AO7B 3H3PH 3C60B 3WIFA 3CH1B 4AQOA 5F3BA 4O9HL 5LAXA 4GBXA 2RAMA 4HC1H 2FZ3B 1T66C 4WW2A 4P2YA 3OKDA 1ND0A 4K94C 1YUHA 5D7IA 4X5WA 4OF8A 3TBTA 1WT5C 3X14A 4HXAH 4OFKA 2Y5TA 1S78C 3LKOB 2WBKA 3SDXE 2ZUQC 1AXIB 5GS1C 3W11D 1FG2A 1QKZL 4YPGB 1TETH 3L3IB 4L5FL 1FNLA 1NFDB 4HS8L 1KENL 35C8L 4MYWB 2AP2A 1I9JL 5M7QA 4LRIC 1QRKA 1FP5A 2NY3C 4XPBH 2GJJA 1T0PB 1U93B 4P2QD 4DAGH 5DMKB 3CFDB 3CDGA 1V3JA 2E9IA 2W59A 1RUKL 1F8TL 1HHIA 3V6OA 4FZ8H 2JCCB 4KKBD 3U4BL 1P7KB 5D70L 1DDHB 5KS9A 4K71C 4HC1L 1BQHG 2XKUA 1T5XA 1CT8A 4O5LH 1H8NA 5KANI 1NAKH 1WWAX 3QQ3A 1VEPA 3MGTA 1NUFA 2COQA 1PQZB 4R3SA 3LN5A 1AIFB 1J11A 3RWDB 4JDZB 1FV1B 4NPYB 1NLDH 1INEH 4FQJL 5DEFA 3ULVF 1GIGH 2C3VA 3B5GA 5IBUB 5HI3D 4JN2B 1MY7A 5L0QB 1OT2A 4JM4H 5I1JH 2Z4QB 1ZGLM 1P6FA 2CDEB 3BP5A 4KQ4H 2PO6A 3V6OE 4JKPH 1FFQA 5F1IA 5TDNA 3PNWA 2DYPD 1YY8A 5IP4A 4JPVL 5E6IB 2LTQC 2NX5E 1MLCA 5SV3A 5CKAA 1MCRA 3JXAA 4YHML 1LNUA 2DD8H 1NGYA 4FFZH 4KPHL 1T6WA 2Z91A 3C6SB 1N7ML 2YRLA 3QFDB 4HXAL 1HSBA 4ZFZA 1I1AC 4Z0XA 1ZA6B 2JJWA 3BRDA 4U6VL 2B0SH 1C7TA 1IFHL 3EBAA 4U7MA 3ULUF 5TDNB 2OI9B 1OGAA 4JHBA 3D9AH 5D2NA 4E41A 5AAWA 4JPIB 5D2LE 1KJ2H 3EOYG 3VFPB 2DLFL 4YHLH 2R0WH 1DUYB 4R96A 3VWJC 3WUWB 3RBSA 4H88L 4QXUH 1JHKL 4ZUUB 3CU1A 1C1EL 3REVB 2WQRA 2A73B 3RVVC 3K2MC 5CSZB 5C71A 1BJMA 2ZUUA 1LP9F 3BEVB 2R4RL 2Y7QB 4KGJA 2QV2A 1CYGA 3QUXB 3AROA 1J7VR 4H25A 4X4XB 1MOEA 1MCWW 3DUUA 4OCSL 1CGSH 1HYSC 1IGIH 4MA8L 3F5WB 1BJ8A 1U8JA 1CDUA 3P11H 5CFHA 1NC2B 5GRUH 1DBML 1EGJH 3IFNH 3QUZD 1P4BH 3PWJA 2NNAA 1LK3H 1X4ZA 2A6DA 4OM0L 2IWGA 4Z7VB 3QXAB 3JV4A 4O51A 3WDIA 3QNYA 4RA3A 2NZIA 3VGDA 3S88H 3DXAA 4R2GC 4X5XA 4M1CD 4XP9L 3BKCL 3U4EA 5CUSL 1Y18B 4O00A 1QBML 4F58H 2D31A 4NKMA 5BQ7A 3BN3B 1MAML 3EOBB 5LCVL 4Y5VB 1F3JB 1B0GB 1QFHA 4FXGA 1JMXA 3SGDI 1B4RA 4ZNEE 5BXFA 1PKQE 4RGOH 1M7IA 3CX5K 5D7LD 5DJ0B 3T0EB 3EO9H 2IG2H 2G5RA 1RHHA 3AFLA 3X17A 3J8F7 4OQTL 3NH7L 3BW9A 1OSZA 4N0UA 3DXAB 4OZIF 4CJ1A 4WWKC 1EVTC 3FO1A 2VDML 3ARFC 3MRMA 4XBGB 1EAPB 3OHXA 4L5FH 5HDBE 5IK3A 2ENYA 1QUNA 2CXGA 3FB5A 5EUOB 2F54E 1ACYH 4J3SA 1P7QD 1LP9B 1QR1A 1CXEA 3S88L 5MP6H 2F53D 3FT3A 1S78D 4MDJB 2GK0A 4RDQG 5GS2H 2IPKA 5ICZB 4O2EA 3WKMH 2LU4A 5E8PB 2CIKA 1C16B 3LVEA 2R9HD 1JZ8A 3BMVA 4MQ7B 4PJXE 5JOPE 4Z7QF 3MSPA 1NLBH 2X40A 1E4KA 3OKDB 1ND0B 4Y2DA 5DLML 3TZVD 3FO1B 5GISL 2Y9RT 2VXUH 3MQIA 5BCAA 1HXMB 4JJ5B 2BHUA 1KLUA 3QEQD 3ARZA 1AKJB 3JV5A 5FCUL 4PJ5E 2R8SL 1LP9A 1YPZB 3D0LA 4PJEB 4KV5F 1AY1L 4NDMB 4Y1AE 5TH2B 4APQA 1X4XA 1NFDE 1FFPA 4PRHD 1EEYA 3ZTNH 4JGJA 1N2RB 3TZVC 5DJCB 4JB9L 4MAYA 5EA0L 4FNLL 2V2WB 4HKJA 1MRFL 1LK2B 1NFKA 2AV7A 1UZ8B 2BOBB 1MCOH 4UQ3A 2J5LB 4XBPB 4BJLA 5DWUH 1WC7A 3TNNB 3V6BR 4TOYL 5IB5B 3HG1D 5IMMA 5B8CC 4YEFA 1S7SB 1JYWA 1JFQL 3T04D 2YK1H 5FK9B 3VXUD 4M5ZL 5I8OH 2IADA 4Y4HC 1LEIA 2NZ9D 3S6CA 4MWFA 1JPSL 2DQIH 2ZSVB 5C0BB 3QUMH 5J6GB 5DRNA 4M48L 1U3HB 1J05B 3L9RB 2VITA 3GJEB 4M7LL 1T1WB 4WI4A 1OD7A 1DFBL 4JRXA 4KDTA 2O5ZL 2FJFA 3T8XB 4YFLI 2EDEA 3OMZA 5C0BD 4PGEA 4FQPA 1HH9A 3RGVC 1SEBB 2J8UB 1C5BL 3MJ9A 4CDGC 1DEEA 1SY6L 4OGXH 4E42A 4G7YH 4HIIB 3JV6A 4RQQB 1QSFD 2K1MA 4HWBL 3RWEA 5JUEH 3SJVD 3MLPA 4TULH 1MLCB 1D5IH 1H3TA 4HC1A 4P4RB 4JFQA 1CR9H 3FOMB 2YSSA 1XT5A 1TVHA 3VGBA 2ZKHH 4LLYA 3PWPB 4CVUA 2BC4A 3NIGF 1X5ZA 1DCLA 4PJFF 1MWAA 4FFYL 1DBKL 2ADIA 3KPSA 1WBYA 3MV7A 5T1MA 2EYSA 5ACLA 3PWUA 3EDKA 5EU6A 3FONA 4JO2L 4QXWA 1F3RB 3NCYP 4N0FA 3U4BH 3W5MA 3K1DA 5GZND 4DUWA 2E9WA 1PZUB 5GS0C 5EZLB 5KSAC 3KJ4B 3VXQA 4LVHC 1OGAB 2QHRH 3BN9C 1FN4B 5KZCB 2X5PA 4DK3A 4FFZL 3KPMB 4RWHA 4LVNB 4NZUH 3HI6H 4U7SA 3GGWA 5BO1L 5CLTA 3MA7B 4Y5XA 1QSVA 1K8DB 4DVBA 3O2VL 4NQTA 3BEVA 1X5HA 1MAJA 4QRSB 4HS6B 4M9OA 5BS0E 1NFIB 1KXTB 1J0KA 4C59B 2VSDA 4FXKA 5AG8A 3DBXA 2HKFL 1NCCL 2YPKB 5C07E 5DUPL 5DRZA 4E5XA 2HVKB 1BFSA 4RWYL 3P30H 1PZ5A 3BP4A 3N1GC 5FAAA 5DQ9A 3R8BB 2VXUL 1HINH 1U3YA 3F62A 1NMBL 4P5TB 5E95B 5FGCB 1I4FB 4NGHL 2PTVA 2VOTA 5DDHB 1U8HA 3HNSL 2BVTA 3C2SA 2XZCL 3OV6A 3TIEB 4RFOH 5BZWB 5EC1A 5GRWA 1TZIB 5CMAA 3CFJB 2HRPH 5E8EB 3RPKA 4XGZA 1TVDA 1V3KA 5EG6C 1QQDA 5IF0A 4PJ7B 2ICCA 4FOMA 4OKVB 3TVMA 5CIPA 2W0PA 3MYJB 2D31B 3MRQB 4KKCC 4MCYB 1P1ZB 1PZ5B 3BP4B 4G6FB 3QXVA 5B8CA 2GJ6B 3SO5A 2FR4B 3BO8A 3NVQA 5K9KB 1JZ4A 3EFDH 1BPVA 3RTQC 3NAAH 2VLLA 4LPYA 5CGTA 1AGEB 1LILA 5DRXA 3VRLF 4IHOA 5KSAA 4ZXBD 1JNHA 5C0CE 5EC1B 1T7XA 4JN1L 4RX4A 5AZ2L 1U8MB 3W9EA 1IKFH 3KYKH 4GQ9H 1QQDB 5F9DC 3VD7A 1FDLH 3ARWA 5FYKU 3HC4L 4NUJA 3E1F1 2YUVA 4P9HC 1DBAL