5L7XL

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form ii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIVLTQTPAIMSASLGERVTMTCTANSSVSSNYFHWYQQKPGSSPKLWIYSTSNLASGVPTRFSGSGSGTSYSLTLSSMEAEDAATYYCHQYHRSPPTFGSGTKLKMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Mouse Antibody Fab Fragment, IgG1-kappa Heavy Chain
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l7xL01
3SKJL 2A9NH 4WNQB 1NC4D 3S7GA 1D5MA 2V5TA 3VXQB 2IALA 4UTBH 1Q9KA 2NY4B 1OT1A 3MBEC 1MLBA 3ZT6A 4F37F 2XG5A 3C5ZD 3MOQA 1KEGH 1AC0A 4G9FB 1HI6B 3UTTE 3GRWA 5EO0B 4LLVB 4DUVA 2RCSL 3IXTB 1ZLVK 2YC1B 3L95B 3ZHDA 4LRIC 3BKYH 4PJHA 4NFDA 4B7IA 5DRZB 3IKKA 5JW3L 1QSFD 2OX5A 1KNOB 3AC0A 4FZEL 1YEDB 4WWKC 1K4DA 4IMKA 4UNUA 5DD6B 2A77H 5DHYA 1A7PH 1VFUA 1MWAH 2EZ0C 1HINH 4CRPA 4IDJL 2KDGA 3MO1B 3A67H 3WBDA 5C08B 4Y1AA 4R26H 2QR0B 3MJ8A 1PYWA 1ETZB 4BM7A 5EU7C 1KGCE 1UQSB 2MKLC 5GISL 1GVIA 1P7QD 5DF0A 1ZGLB 3QIWB 4NN5C 1DVFB 1RJZB 5EA0H 4P2RD 1UM5H 4Y5YA 3BSZL 3BMWA 4QRRA 3BPCB 5AWNL 3RKDD 5IJKC 5EBGA 1RZ7H 1N3NB 3T09A 2FWOA 2YD2A 4TSAH 2E27H 3KGRA 5J13C 1DLFL 3LQAH 3LCYA 3SY0B 1OP3K 2J2ZA 4NWUL 2B20A 3K74B 5J11C 1R5VB 4EEEA 3MXWH 1XF5B 1GHFL 5ISZD 4MCYA 2ZPKH 4M1DH 1XF2A 2XZCH 3F5WA 1A4JA 3LKNB 1G7LB 5DI8A 3T4YA 2GJ6D 2UZIH 4UTAL 2PTTB 3LIZH 4YX2H 1EZVX 3IJSA 2JB5H 3O8XA 3RIAK 2L0DA 4JRYA 3LN4A 4J3XA 3ARBC 1BJ1J 1XCTA 2GFBA 1QRND 1EHLH 5HXMA 5F7UA 4KWUA 3SCMC 3CCHB 3F7QA 3T0EB 4LASH 4OGYH 1VFAB 4P9HH 5HVFB 4OZGA 4HPOL 5T1MB 2PW1B 4GW1B 3SDAC 3HE7A 4N0FB 1NCWL 3CD4A 1RUQL 3KLDA 4OLWL 3BAEH 1V8HA 5IMOA 4H1LH 4UINH 1IBGL 2PYFB 4LSDA 3MV8E 5INCB 2VDMH 2NTSP 4KVNH 5L7XL 1M4KA 4HK0B 3MUGA 1TIUA 3SCMA 1NCWH 3VFGL 2Y23A 2I07A 1GGBL 4P9HL 5C0GB 4KMLB 4TUKH 2DL2A 4AMKH 4B0MM 3U0PA 2YMXL 4XVUC 4G6FB 2X89D 5IHZA 1ZLUH 2O93L 3WL9A 2K3TA 1W72H 5DHVH 1WISA 3R0NA 3MROA 4M9PA 4NC1C 4D3CL 2CKNA 4H8WL 4OFYD 1H3UA 2VAAA 1RJLB 3P73B 3WDHA 5I76A 1YEKH 1F58H 1JGLH 4MSWB 1GGCH 3MREA 4TTGA 4JFFE 4P4KA 3L3DB 5EBWB 3N85L 3HMXL 4AH2B 2ZSVB 5JDSB 2R56L 5DUPL 2Z35B 4HG4K 5KAQG 4Z7VF 3KPTA 1YNKL 2OS7A 2CUHA 2BCKA 3DURB 3TVMB 1K3ZA 1QFHA 3MJ7B 1EAPA 4K55A 1BF2A 3T2NL 5GS2D 3RPKA 2HAZA 3GRWL 5E5UB 5FM5O 4OV5B 1EA9C 1P1ZB 3O6LL 2YPLE 1MRDH 4TPRH 2IAMD 4RWYL 1LO3H 1YUHB 3WFCL 2BRQA 5SWQB 1B0GB 5IB5A 1MY5A 3QIWC 4JRXA 3AS1A 4UNTA 3D18B 5E00B 5IIEB 5FHAH 5CCKL 3QUMB 3CDCA 1L7IH 4OCRH 4CVUA 4MJ6B 3KYOB 4L4TE 2QADD 4JPKL 4UMGA 3B4NA 4QRQA 1FLRL 5T5FH 1SJEB 5DQDH 1B0GA 1SJXA 2VUYA 3W9EB 5DJAB 2AK4E 1FG9C 5C7XL 4WY7L 5EBMA 5I74C 4U6XA 3VXSA 2H1PL 4L9LC 4Q6IA 3LEXA 4OT1H 4HH8A 4TULL 5CHNA 3U7YL 1S9WB 3WHXB 2D9QB 5F88B 5DK0A 1YDPA 3QPQC 1J8HB 5F3BB 5I17B 4JJ5A 5C8JB 3JWDC 3ILQD 1YEDA 1VEOA 1OGAA 3CXHK 2EDLA 1KIRB 3S97C 5C0NC 3HAEG 2OJEB 1DR9A 4L4JA 4X6DA 2HT2C 4NQCD 1JGUL 4LAJH 2DTMH 4DTGL 2A6DB 4HGKC 4YDVA 2A1WH 1F6LL 5DZOA 1DDHB 5GS0H 1JHTB 1NCCH 1TLKA 2J1KA 5I18H 4JDVA 5EG6C 3GSNA 4AL8H 1VDGA 3CMOH 3VXUB 3BW9A 1K8IB 1OAZL 3U0PB 5JHDB 3MRMB 1X5FA 2GHWB 2MFNA 4GKSB 5C71A 5GIRB 1DBKL 2BC4B 4LSRH 1P7KB 3QCUL 2DQCL 2R15A 4P59L 3LKSB 4OM0L 3D87B 3MX0A 4TSBH 1P4IL 3MYZA 3O0RL 2X4SB 4XI5D 1A7QL 1CG9A 4HZAA 5DD1H 3OKDA 4XB8A 1FNLA 1TXKA 5J8OA 3ZKND 1I9JL 1Z3GL 2GCYA 2F15A 4I9WE 2J8UF 3OKNA 4GLRI 1NANH 1L0QA 2IFFH 2QQQA 4ODVH 4PJGE 3JXAA 2NY0B 1UEYA 1FGVL 4EDWH 1X4XA 1ZTXH 1RK1A 4K7PX 4NQSA 1BZ7B 4XCNA 1TJIL 4RRPG 1CE6B 4FTVD 1S7WB 2D7TH 3C6SA 5I1LA 1MI5B 1W72A 5DHVA 1AFVH 4WWKA 5F21B 5C0RL 1W0VB 4JKPL 1Q72H 4PREA 1KBGL 3QI9A 1IAOA 3CPLB 2IG2L 2QKIA 3PQYA 3JWOH 4K3DH 1SVCP 3UO1H 5FFLA 4JY5L 1IT9L 3ZKXC 4PRAB 3HZYB 4JFYB 3B9KC 1CL7I 3FQRB 1XGRA 1XCQB 3QXTA 4IOFC 4NN7C 4OUUB 4GAGH 1Z6JT 5I75B 3MLSL 5C0IA 5EIIB 3QDMD 2Q8AH 4YPGB 2DI9A 4M7LT 3V5KB 2BMKB 1RJCA 1MVUA 2UYLA 2P4AB 2K9UA 3S36L 4ZOBA 3M17A 4YHOH 4UILH 5GGSB 5DUBA 5I1GH 4DN4H 4GUPA 2D31B 3SKOB 4QXUL 5IB3A 2GSGA 2Z93A 4HFUH 1OT2A 15C8L 1RVFL 3G9AB 1MPAL 3OB8A 3V52L 2CMRL 1O7VA 7FABH 1KB9J 1E0OB 3V8CA 4HWBL 1NMCB 5GJTH 5FOBB 1HH6A 4U3CA 4ONHB 3VRLE 4FMFA 5IWLA 4FQQA 4PBWD 4NDMB 5FYJH 4TUJB 3LN5B 3UBXB 3RKDC 5JOFA 4FTVB 4LPTA 4CDHA 4KC3B 1UB6A 5TE4H 1A7BA 2M8XA 1MRCL 1MCDA 1T1XA 1S9XA 1MRFL 3G6DL 5D7SL 2YK1L 2HKHH 4QRPA 4N0CD 5D6CA 5AZEH 4JHWH 4OCWH 3MRHB 3BIKA 4X6DE 3STLA 4DCQB 4D9LL 4E41A 2XI9A 5F93C 4YR6A 3GMOB 2QQLH 4GQ9L 1MLCA 5T3XL 5E1AB 1JI2A 4JY4A 4G6MH 2XY1A 1N7MH 3V7MA 2W59A 4KKBC 3K7UA 3UTSD 1R3KB 3PGDB 5EU5B 5JZ7C 1IEAA 3LEVL 4JPVL 4GMTL 5F1SA 2P8MB 1S5HB 2WLZA 2WUBH 1ZV5A 3CLEL 3QCTL 3QAZC 3QHFL 3SOBH 2A9ML 3D3VB 4JN2B 1M6OB 4U1KB 2AKRB 1B4JH 5DRXA 1T0PB 3SOBL 1INEH 5ENWA 2B0SH 5L2KB 4KJPD 4LEOA 1DQJB 2JF1A 3MV7B 7FABL 3W5NA 5EWIH 4M03A 5TPWL 3QAZB 2X4UB 3RY4A 2R23B 1TVHB 3BKJL 1A6TA 1BGXL 3MJ7A 1FYHB 4UDUA 1I1YB 3CH1B 2YBRB 2VLJD 4NQDE 4XVUD 3ARGD 2VZ3A 2E9IA 4OGAC 3DIFA 3EJZD 1NMBH 4LSPL 1N5YH 1CIDA 1JZ5A 4WI9A 4G7VH 3O6FB 1PKQA 1WIOA 2XTJB 5D7SH 5TH2A 3C6SB 1A6WL 4E9LA 1MAJA 3GMMB 1Z5LB 1MFCH 4OTXL 4X80H 1A7OH 1J12A 4RWHA 4EVNA 4YBQC 3GSOA 2EEDA 3PNWA 4HX1B 2IPUG 3VXPA 35C8H 5BV7C 4OZGF 5JXAL 4WI3A 3WFDH 1EIBA 1XT5A 1OAKH 3UJJH 3FT3B 1CLZL 1KTLB 3IFLL 4R4FL 3MRIA 2D7TL 2K7PA 5E2TL 3BP7B 1LMKA 5I0DA 2DQGL 4EUPG 1SVZA 2V17L 1TCRB 4FS0A 4J1UB 1U8LA 3T1FA 3ZT5A 2Y25A 4MJ5B 5DD5L 5JOFB 5JXED 1T04B 3MV9A 2EZ0D 1FGVH 5F9AC 3QB7C 2BHZA 3V0WH 3O2WL 4XNUL 2ATPB 1MJ8H 1WEJL 1OF2A 5IT2H 1EVTC 1T83C 2O5ZH 1Z2KA 35C8L 1SYSA 1Y6MR 4POZD 4DZBB 2VXVL 4KV5E 1U3HA 3CU1A 2I25N 1PZUB 4PJGF 1HQ4B 3ZSTA 1G6RL 2CIIA 3RWJA 3QUML 4L8BA 3EOYG 1A9BB 3UPRA 1IT9H 4U7SA 1HH6B 3NCBB 3VWJB 3O4OC 4OKDA 2HT3C 3CSGA 1GH7A 3HAEB 4XBGA 5FOBA 1NGZB 3OG4B 2CLZA 1JN6A 3BJ91 4JHBA 4Z95H 3W5MA 3IF1B 4WV1C 3O2WH 1BIHA 4JEGB 4L29A 5EOTB 2FGWL 4XP5L 3TZVB 3H9SD 1H3VA 4OCYH 5IV2B 1IGFL 4JO3H 1S9VB 2VE6A 4IMLA 4MX7B 3O4OB 5TF1H 4O02H 4G9FD 5CGYD 5CSZA 1NBYB 2DQUH 2CGRH 3HI5H 4Y5YB 1T03L 5EBMB 3L3GB 4KJPC 2LV4A 4PJFB 4R4FH 3BH9A 1EFXA 1ZHLA 3WDIA 4GRWH 4PJEA 1KTDB 5D7LA 4IBLT 1CL7H 1V3MA 4XCYB 4U1JB 1S7SB 4XAKD 4BK5A 3ARDB 3IJHB 2HFFB 4GSDH 3QHFH 4ISVA 4R4BB 4PJAA 4ZO8A 1ZA6B 2DL9A 2Y6SD 4JPIA 4Y4HB 4DUWA 2Y5TA 2Z31A 3DIFB 2F53A 1FGNL 2W0LA 3OAUL 2VITB 1NAMH 4ZD3L 3NCYP 3VGDA 1A1NA 4N8PA 3RDTA 3WSQL 4OSUL 1LK2B 2BNQD 1ACZA 3SE8L 3I3EA 4MA8L 3I75A 5H35B 3HHRB 5SX4I 4PJBB 1XIWB 5I76B 4LEOB 1WBZB 3H8NA 2AGJH 3KNBB 3VCLB 2R39A 4KI1A 4YFEA 3ZLQC 3FONB 2OJZL 3B9DA 4FQCL 2FL5A 4EUPA 4FXGB 1RK1B 5HHOD 1HI6A 1L0YA 1TDQA 2Y1VA 3HI1A 3HPJA 3N50A 2HWZH 3L7FB 3AY4A 3MJ9H 5EU5A 1T7ZA 4N1EA 1LE9A 2I07B 2DIAA 1WJ3A 1KXQE 3EAKA 3I84A 3MRQA 3T2NH 1P53A 4XC3L 4ZDHA 4L3EE 5GJTL 5ICZB 4ZUWB 1CDYA 2FHCA 1F5WA 1IMHC 2MCPH 2BVUA 1G7QA 4LSVH 1N4XH 4XPFL 5DJ8A 1E27B 3EYOB 5KSUA 5TFSL 4XNXL 5DYOB 1OLZA 4MA3B 3HMXH 5ESVA 3WHE1 4QXUH 4PJFF 4ZNEE 1F8TH 1QBMH 1N7ML 5IM7B 5EU4B 1RV6X 5I1GL 4KRLB 4M48L 2BRRH 3NFSH 4CN6A 4UOJA 3GKZA 5F3HB 2Q76B 4IJ3B 5FO8B 1TMCB 3QFDB 4R2GC 1IC4L 3JV5A 4JHWL 1JMXA 4JE4B 4JZNA 3LQAC 5BO1H 3RWDB 2J5LC 4LVOC 1XGPB 1PAMA 5BMFL 4U1MB 3U30C 4XCFL 3UX9B 5CGYC 5DK0B 5INDA 4XX1E 4C54A 4OIBA 4NHCL 2VDML 2IPUK 1KIUA 3P9LB 1LEIB 3RX5A 5CWSA 2XWBA 1FVEA 2ZCKH 4H88H 4I4WB 4ELKB 1OM3H 2J6EA 3DYOA 5BCAA 4NUJB 2NXZD 4ZXBA 1W8NA 3TT3H 2BERA 5M94B 3NZ8B 3EDEA 4OGYL 4K8RH 1A9EB 2WINA 1F4YL 3FQXB 1DZBA 3T2OA 5JA9A 1Z0MA 4N8VA 4R4BA 1QKZL 2F19H 3O41B 2F5BH 2VLLB 1MF2L 3TZVA 1MF2H 3BPCA 5EOTA 5IEHA 1WBYA 4UT7H 2EDTA 3WMSA 5ID1B 4Q0XL 4AQ1B 5F7LB 2WAHA 4PP2B 1FZJA 1KT2B 4ZXBB 3IDGB 4NM4H 3LZFL 5D9SB 2W9DL 5I75C 3SKMA 1NBYA 4NM8H 1GGBH 4NKMA 1JGDB 3JV0A 1BQHG 1OAZH 3DYMA 1KFAL 2XA3A 5IJVA 1G6VK 2NY3B 5FM4A 5F96L 3KLSA 5CZXC 3OR7B 2VXQH 1RZIB 3ZTNL 1WTGT 2A1WL 3ISWA 3MLZH 4FG6C 5HHMB 1N2RA 3F7PC 1AGEB 1EDQA 3ARSA 4NKQB 1S7XB 1A14L 1FCCA 3ARRA 4OV6F 1BPVA 1F6AA 1E4XI 2UUDH 4R26L 4JHAH 3BEWB 5C0CE 4RGNE 1GGIH 3MRLB 1H3XA 5DSCA 1OP3H 3AM8A 2I5YL 4QLRA 4AM0B 1GAFH 2IFFL 4WI7A 2PYFA 2X7LA 2BC4A 4F80A 3RGVB 4G80A 2UZIL 2GEEA 4OZIE 4EKXA 2IBGA 3KYAA 5D6DA 3EJZC 4U1NB 1MOEA 3PWUA 3O0RH 1P4IH 3JVGA 4MJ5A 1Q9KB 3MGTB 1KC5H 2E6QA 4NJ9H 1CGSH 1D5BA 2CLRB 2AJVH 5C6PB 3CCHA 5K9JL 5EORL 4AM0A 4LF3A 3T0AA 4XPFH 4Y5YC 3MJ9A 3F7YA 1ZE3C 1FVDA 1V3KA 1F3DJ 4AL8L 3P3YA 5CJXC 1RQ5A 4HT1L 2B39A 4GAYA 5HYJA 2P46B 1G9NH 4U0RB 1T5XB 3W2DH 3IVKB 4NFBA 1KIQB 1L7IL 5EA0L 1QRKA 4ZFFB 2XKNB 3V4PL 4PLJD 1JI1A 3CLFH 4HC1H 5A16B 2A73A 4OLXL 2DLEA 4NJAL 4NZTL 1CD0A 3FO9B 4NJAH 3TH3T 2M1KA 3NCMA 2BVOB 4ZSOE 3V4PH 2NW2B 1ZKAA 5GRYA 1U8PB 3O6FA 3FQTB 3S35L 2NZ9C 1N3NA 3NACH 43CAB 1JFQH 1PG7X 5IHUL 1FDLH 1T7YA 4KROD 4Q6IB 3V4VH 3TBYB 1CDCA 1S8DA 4WFEE 4P5KA 1S3KL 3H0TA 5B3JE 1TPXC 1WVZA 1HSAA 4QNPE 1XIWC 1MEXL 5SX4H 1JJUA 1CGYA 3S5LA 4LBEB 4CAGA 3V0VB 5EORH 3OXRA 2NY0D 3WV0A 2DQTH 3O41A 2HFFA 4GKNA 1B6DA 3QUYD 1CFSA 3MXVL 3OAZK 4P3WA 3S4SG 4X6EB 1MEXH 2F9BT 2PN5A 3PGCB 5ENWB 1KEMH 1QHOA 1V3LA 2CK0H 2V9TA 2EO1A 3H42L 5H37H 1PKQE 3IXAA 4QXTA 3S88H 1HHKA 1NLDH 4MQXD 5CZXD 1S9VA 2VE6B 4JANB 4MYWB 2I27N 4YUEH 1LO3L 3QDGA 4JQXC 5GGRB 3M8OL 5KAQF 4FQJH 2XACC 2NY4D 1I7ZA 5A40E 2X10A 3AU1A 3ET9F 4JM4H 4Z95L 1MCJA 1NGWB 5MI0C 1H3TA 4UBDC 3UBXI 4KY1L 4OLWH 3C9NA 1I7RA 1IKFL 3NH7L 5JLZA 1BLNB 4I77L 2X05A 3O2DA 2YD4A 4U49A 2L7JA 3WNPA 1IE5A 1F3JB 3BE1L 5EO1B 5IMLA 1F58L 2WBJA 1G6RA 1E4WH 4A2LA 5LVEA 3MCKB 2PR4L 4H1LG 3FO0H 1T0MB 4ZO6A 1SBBA 3TA3A 3RY5A 4I3SH 5BXFA 2ZP0T 5HYQB 1NGPH 3MRRA 1JV5A 4M61A 3HNVL 1QSVA 4XBPB 4Y0GA 4WUUA 2DWDA 3MC0A 1OSZA 4ZUTA 5BV7H 5SV3A 3LPWA 1YZZA 3FRPA 4NNPH 1N64L 2ARJQ 3EKCA 1K85A 4Q9BA 1XCQA 3ZTNH 4DW2H 4X7TB 1EO5A 1WZKA 5GPRA 4O2FB 2HMIC 4YXLL 2VLKD 5DEGB 2VR4A 4WFHE 3LEYL 4NQEA 4KDTC 1NEZB 3LKQB 2Z8WC 4P2QB 4PRHE 4CU7A 1A7OL 3QUYB 3FQTA 3MRJB 3NIFE 5K93A 1I3GL 1YEJL 5MI0B 3TVMA 3NFPB 4OIIL 3DPBA 1KENH 4BK4A 2IQ9L 2R4SL 4UIMB 3P0VL 4MAYD 1IAOB 3GBNL 2C4FT 5JA8B 2DLGA 2EYTB 5DDHA 3ZDZF 2AQ3A 5JIPA 4HS6B 4HUNB 3BKJH 1BFSA 1F4YH 2I9TB 5ESAB 2X4QA 3D39A 3TBVB 3ARFA 1C08A 2GK0A 1KN4H 4N8CH 3O3BA 3MGTA 5DT1H 3HZVB 5L6YL 1FFNB 4M8VA 4P46B 1YEFL 5KSBA 3HR5B 5HTSA 4QRUB 4DKFH 3D85B 1UACH 4XPBL 4NBYB 2I9LB 4MXWH 2NLJA 1X5AA 3NFNA 3IF1A 1NBVH 2WIIA 3KPMA 4FQ2H 1WWCA 3ZDXE 2YUZA 3OBAA 2QSQA 3KPPB 4L3CA 1WWBX 5HI3D 1QSFA 5CP3H 4FQQB 4ESKA 2R0KH 3MGOB 4HWZA 1A02N 2M26A 2QQNH 4JN1H 3IGAA 4L5FL 4XPGH 3GIZH 1I8MB 1I1RA 2F5AL 3P0YH 4N5UA 1X6NA 3QJFA 5E2VL 4ENED 1UB6B 3CFBA 5F6IB 4KQ4L 1C16B 1XF1A 5I30L 1HZHL 2A6IB 4GAJH 4JRYB 3GSVB 3H7BA 4KJQD 4LOUD 4NKMB 1FZKB 4YFLF 2RCSH 2Z91B 2AJUH 1JVKA 1NGWA 1A0QH 2CK0L 5K33A 3T08A 4TOYH 3TBWB 2ADFL 3FQNB 5HHME 1CU4L 4BELD 5I1EH 2YN5A 4X6EA 1A7NH 3SGKA 4X99A 4I0CC 3ELAT 1LO5A 2DM7A 4H25A 4EOWL 1GIGL 4KPHH 3TCLA 4HZLA 1KIPB 5L88L 2VDNL 5F1KC 2WWKO 4HGMA 3Q6FB 2OR9L 4QXTB 5C2BH 4JLRB 4TRPH 2P49B 2OJZH 4XC1L 1IFHL 5F72S 4G5ZH 1FO0H 4OIAA 1FO0A 4JO2H 5IGXH 4LDEB 2IANA 4X7SH 3BZFB 4I18C 4L8SA 3QO0A 1RULL 5TQ2L 3OKMB 3VWJC 1NFIA 1XZ0A 4NZTH 4PJEE 1FHGA 2Q8AL 4K2UH 3CLFL 4HC1L 2BDNH 4N0YL 5E9DA 2R1YB 1H15B 1SEBA 3ARXA 3GI9L 4Q2ZA 4ALAL 5F71A 3OKEA 1HQRA 4GKZB 1I1YA 5EZIL 3HC0A 3B8SA 5GSVA 5DRZA 3RNQB 1MJ8L 2XFXA 3RWIA 4WHYH 1CBVH 5L9DH 1NLBH 4HKBB 2PCPB 4H0IA 4KV5F 2VXTH 5IBTL 1FYTE 4DVRH 3BUTA 4J3UA 2XKNA 2EKSA 3LSOA 4G9FA 1V5JA 1YQVL 2P8PB 1MY7A 4L4VE 3U7AA 3AB0C 4LIQH 2FX8L 3RZWA 4DGIL 3LRSB 5DYOA 3CFEB 2Z4QA 3RUGE 3DUSA 2BXYA 1CGXA 4HQQL 2XOTA 3SJVE 1S7TB 3WYRA 4R7NB 5JUEL 2VZVA 3SJVB 2P5WD 2R0WL 4WW2B 2Q86A 2K7QA 2FX9H 2OZ4H 3MBXH 1JHKH 1TENA 1FL5A 1ZGLP 3VI4F 1OP5K 3EZ8A 1HKFA 1MFBH 2LU3A 1KTRL 3UC0L 3ALWA 5BS0D 2AJXH 3VFOB 4BA8A 1FYTB 4PGEA 2VLKA 3ZYZA 2RHEA 5KANG 1SY6L 3RWHB 2EYRB 2OJEA 4L8SC 4DOHB 1BECA 2MSPA 2V17H 2FATH 2WWKT 1KCUL 1Q9WB 3QXAA 5EUOE 5JO5A 5CSGA 1JZ2A 3BRFA 4HIHA 2VDRL 1MAMH 4RBPH 3GMQA 2IQ9H 2ZOKB 2DMBA 3E1F1 1B4JL 2D0GA 5CHNB 3D0VA 1DJSA 1P4LA 1KJ2L 2HTKD 2FHFA 4QF1B 3IAPA 5CD3A 4JKLA 4LARH 4N0RA 1K3IA 4NQEE 2H2SD 2CSPA 2EEBA 4OCMC 4ODSH 1J5OH 3UJTH 4Y8DC 1BZ9A 4K3HA 1D6EA 1KLUA 1IM3A 1P1ZA 1IGTA 2JELH 4JB9H 4Q6IC 4Z78A 4X4ZA 2H32A 4N90E 4X7FC 4M1GL 1NMBL 2JIXD 4X99B 5ITBH 4KKAC 1TPXB 4NKIH 3SE9H 3TA3C 3IDIB 4LLWA 3OJMB 1ZVHA 3CVHH 2HG5B 3HC3H 3J7HA 2WW8A 1AE6L 5KN5A 4CU8A 3TNMA 1BOYA 3PGFH 5TDOA 4V2BA 5GJSL 1LE5A 1S9YA 12E8H 4F8QA 4C57C 3MLRH 3G5XA 2B0SL 1AHWC 2F58H 4FQIH 1CVRA 4ZQKB 5IHBA 4DFHA 4OQTH 4JRYE 4KVCL 4GG8B 3DECA 3TN0C 3V5DA 3RFZC 1PX3A 3MLYH 1UENA 4EBQH 2WUBL 4NO3B 1JZ6A 1DE4A 3ARQA 5F7DA 3GBML 1EMTL 2FRGP 3SE3A 1J0KA 3SDCC 4MSWA 3MLUH 4LLDB 5IW1B 5C0AA 2VAAB 3DXAD 3P73A 5E6ZA 3H3PH 1NFDA 3D5OF 1FRGL 2VLJE 4NQDD 2PYED 2EECA 4X9HA 4H0GA 3VXNA 5C3LD 1ZANH 4KK5D 1AXTH 4UT6L 4HW6A 5CZVH 4PJXE 1FL5B 4MA3A 1CDJA 4ONFL 3NCJH 2GYSA 4FQHA 3UCRA 1U8OB 4DGVL 2EDFA 4ZMAT 1AR1D 5CUSH 2XKSA 3BEVB 2X4RB 3N9GL 3GFUA 4M7JL 1FH5L 2KPNA 1C08B 3EYFA 4KKAD 3TBVA 2YPVL 4WWKD 1TZHA 4XMKH 1OHQA 1RZ8A 4BQCA 4O58L 2G75B 1VHPA 2FEEL 5GSVB 4NQCB 1AO7E 4MCYB 4FRWA 3HC0B 5ALBH 3D0LA 5T5NG 3WUWG 1VFOA 3QNXB 3RGVD 5T3XE 3AXLA 4QKXB 3F7VB 1UXSA 4D0CA 4G8GA 3EOBB 1U8NA 4GBXD 1K9TA 3U36A 4M7KL 5B4MC 3NIDE 3BMVA 2W91A 1KCVL 2ICEB 4PRHA 3L5XH 3C08L 4BSVB 1QR1A 3MV7A 4JQVC 5K9QI 1FC1A 4YNYB 4U6XB 3Q6GL 3VXSB 1IGMH 2ADIB 2XTJE 1INQB 1OTUD 4JM2A 2ZPKL 1PSKH 4M1DL 3DRQB 1DN2A 4PRDA 4NO5A 3QIUD 1P4BL 1WGOA 2XPGA 3U7WL 5I16B 2VLRA 2IQAA 3THML 4NQDB 3DOSA 5FOJA 3B2UC 1UJ3B 5F6HI 1IAIM 1HHJA 3FKUS 2FJHA 5L2JA 3UC0H 4DQOL 2CO7B 1F42A 2DOCA 1KJMA 2GAZA 3TBWA 3MV7E 1KBGH 1CICD 1YPZE 2ICES 4R0LA 3TA3B 5B38B 1DQQA 5MP6H 3BI9X 5C0RH 3VWJA 2IAMB 2A83B 5HI5C 4YHPA 3BIKB 4U1GB 3OX8A 1LO5B 1PSKL 3JTTA 2A6IA 1AHWB 1WEJH 3WNLA 2JK5A 4P2OC 5KVDL 3KHOA 5KVDH 3OPZL 5FHBL 1V7NH 2O61A 4P4RB 2UY7A 1ADQA 1HILB 2WZPD 3SGKC 1EEYB 3CDGB 3QFJE 4JG0H 8CGTA 5E2TH 1XF3B 1P7HL 3Q5TA 4X4YB 2Z8VC 3SPVB 5MHSD 4YHNB 4UZGA 3QULB 5KVFL 2DQCH 1JZ8A 3PABB 1I4FB 4QRSB 1A6UH 4RMUA 2A6KA 2E9BA 1S7RB 4IS6A 3RIFK 5IHZB 1JYVA 5F96H 3VFMA 4ODTH 4J3OC 2B1HL 4BH7A 5F7HA 1KPVA 4OAWA 5DA4A 5DJ8B 1G7QB 3VFNB 1FBIL 5EOQL 5ICZA 4MZ2A 4PJHE 2EE9A 4XP6H 2JJUA 2R4RL 3MRIB 4Q0XH 2XNAA 4WCYL 5C0AB 1T66D 5IW1A 4PUBH 3WFCH 2H2SC 1INDH 1R3LB 1FV1A 2VQTA 3CFEA 3PWPB 3ZSSA 2F5BL 1X7QB 2LAGB 1XGRB 3SO5A 2AXGB 1Y18B 1KCRH 2FGZA 3QUXD 2MWCA 4PJ7B 4PRAA 3PNWB 5BZDA 4LMQI 2X1XR 3QIUB 4MQ7A 5KS9F 4WJ5B 4P3DB 3H6JA 4GRMB 4JFDD 1VFMA 3B2VL 3TC9A 4BSVA 1IILE 2W9EL 1U8QB 1H3WM 1S7WA 3NGBC 4Z7UF 2KH2B 1XF4A 4IIQB 2XZAH 4U3XA 2PKDA 4HKJB 3X11B 4KKCC 1T0NB 3QH3A 4Y16A 4PB9L 4K7PH 4LLYA 5FYLL 1M7IA 2WP3T 2OL3L 1A47A 2C3WA 1WICA 12E8L 4NRZB 1T5XA 1DTUA 3VFTA 4CL7A 5BO1L 1NPUA 1NDGA 4KI5C 1BBDH 1BREA 1K8DA 4ONFH 5I8KL 3GJEB 1E6OH 2BZDA 2P5WB 3PIQB 4MA1B 4HG4J 5FYLH 4U05A 1U8OA 3C8HA 4ELMA 2EDYA 2FBJH 5IKCA 1UQSA 1B0RB 4LLMA 3TIEA 1IM9A 2WWMC 5EO1A 5IQ9B 4NPYB 1P5VA 4ETQB 1S7QA 2F53E 1G1YA 1OAYH 3MCLL 4Y2DD 4CVWA 2AK4D 2GTZA 3MRLA 1MLCB 5C0CB 1II4E 3PWVB 1QACA 1UC6A 4C58B 4HWEH 4E41B 1YEFH 1JPFA 4G8IB 3ECBA 3LS5H 4JKWA 4B41A 5ADPL 3R1GH 1IGJA 3T0EC 4X7CC 1I4FA 3DGGB 4QRSA 5FDYA 3VXUE 4P23B 4HMDA 4YE4L 3UZQA 4P46D 3VH8B 5C09B 3TYFB 4O5LH 5ETUB 5I73B 2NXYB 5DRWA 3BRDA 5IMMB 1ES0A 4RZCA 4PJIF 3ARDD 4ODUB 1QSZA 4JANA 3BD4A 4M5YL 5DRNB 3ZYOA 2O61B 1DN0B 3IDGA 3RVTC 2JELL 3CVHB 5I73C 1JHLL 4U1HA 1CLOH 5LGJB 1NAML 2Z92A 3QWOB 3KYOA 4XI5C 3BVNA 2D7MA 5FYJE 4MAYB 1OY3B 1T7WA 1DEEB 3JWOL 4K3DL 1UWGL 4HV8A 5I74B 3C5ZC 3I02B 5HVWA 2H26A 1BVKB 3S34L 1MCHA 1TJGL 1GC1L 4JGMA 4NUJA 4FHBD 4BQ8A 2GJ6A 5ISZB 5CBEB 2P24A 1U8QA 4Y2DB 1XH3B 5T1LD 4F2MB 4I9WD 1CICB 1YA5A 2CGRL 3V6ZA 1TJIH 2FATL 5GRVL 4YGAB 1B90A 4DK6A 4X4XA 5JW3H 5LCVH 1IGFH 4JO3L 4L4TB 4LVNB 5A16A 3NGBB 1R3JA 1TITA 1FG2B 3EO0A 4X98B 2Y7QA 3LQAL 1F4WL 1A3LL 3WFBH 4U7KA 43CAA 2C3VA 3J8F7 1KEGL 1TZHB 4BZ2H 2GUOA 2YPLB 4HFWB 4OGXL 5I66A 4NQED 2J6EH 1GSMA 3DVFA 4R8WL 1FNSL 1LO0L 3VFWA 2VH5H 2R0WH 1MHCA 3DETC 1QO3B 3UYPA 1OGTA 4OF8A 1M1SA 1T1ZB 2OYPA 5HY9B 4PV9B 1FV1B 2V7NA 3VRJB 1EXUB 1BJMA 3O2VH 1YEHL 4HF5H 1NC2A 3JTSA 4YXKH 3AREB 4DGIH 2IPKB 1C12B 5ANMA 3DX7B 4GRWB 2DM2A 3FHAA 4WVRA 1ZGLM 1U8HA 4EI6B 3JUYA 1T1YA 2DI7A 4XBEL 4J12A 1A7NL 2VZ1A 1MFDL 4NZUH 4V1DA 4LHUD 1SYVA 3AU1B 1ZLVH 3WO3B 2E6PA 4QRTA 1JZ7A 1RUAL 2A74A 2CJUL 3OR7A 4P23A 1OL0A 5GRJH 2X70B 3IDYB 1NCNA 5DJZA 3U79A 1N0XH 4PB0L 1YQ2A 2WBJD 1QNZH 2XIDA 3RVTD 2PTTA 4N8VG 5F7EL 1N8ZA 4JFFA 2IAMA 3MV8B 4MDJA 3JV4A 3VXSD 4UV7L 1LE5B 4JFDB 1EHAA 5EU6D 4BSWA 4OZIA 3PL6D 4OB5L 2BP3A 3F62A 3QXDA 3GMPB 5FUOH 5F9JB 1AO7A 4QOKB 1BOGA 2IH1A 2F53B 1EHXA 4YO0A 4M7LH 1FRGH 3RWEB 5IFAH 4JM2C 3FZUC 3A6BH 2OP4L 4ZPTA 2FWOB 1LD9B 2R29L 2ZNWA 4OF0A 3H2WA 1OGAD 4KH2A 1CF8H 3IKCA 4I3GA 2B2XH 4P9HC 3VA2C 1WFNA 3WFHB 1FPTH 3O2DL 4Y5VC 3RWFA 1DUYB 4PJFE 4QRQB 5HHMD 1RURL 2KBGA 3EDKA 3ZHKA 1A3LH 2F58L 5I2IA 3LV3B 3QEUA 4LKCB 4Y5VB 2R56H 1PG7L 3FQNA 5FO7A 3T8XB 5IVXB 3PGFL 3REWB 2WWMD 3QDJD 1ADQL 1NCBH 4CNIB 3U0WH 3V4UH 1JZ3A 1MCBA 4D0BB 3IDYC 4Z7VA 2PUQT 4L3EA 3GSQA 4AK1A 1I3RA 5BVJA 3OAYH 4UAOB 1Q0XH 5HYSA 1K5NA 3FCTB 1XGPA 4MS8D 2NY1B 5C07E 2X4PB 4PJ7E 3DVNA 4J8RB 3D2UA 5DK2A 1MFEL 3QBTB 3KPQB 1AD9B 2JIXB 3IVKA 3MACL 2IWGA 1CTOA 3DVGA 4LL9A 5CD5D 3GHEL 3IDMB 5AG8A 3PV6A 3IU3A 1JRHL 4IRSB 2IMMA 3T1FB 1RI8A 1MCFA 2IALB 3P30L 4NO0B 1AGCA 4P2OB 3QFDA 5CKAA 3BWAA 4KUZL 2IPTL 1T3FA 5DT1L 1CDIA 1G7MB 2HVJB 1KFAH 3FTGA 5DJCA 3SQBA 1MIEH 3BDBA 1AIFA 5FF6B 2HFEB 3NCEB 4M5YH 4NN5B 3PL6A 3D85A 3IU4H 4Z7OF 1AC6A 1H8SA 2UZXB 3S36X 4WFFD 4HFUL 2CQVA 3O3EB 4PGBA 2IEPA 2JIXA 2FHBA 5BS0E 2J8OA 3EYOA 5KSUB 4HCRA 4JG1L 1OAQH 3TPUA 4JJHA 2O5YL 1ED3A 4L4VA 3SGJC 5KSAA 2EKSB 3LSOB 4UOW0 3MUJA 3FTGB 3PDOB 5ERWA 4G7YH 4MQTB 4Z7WB 4ODXB 2P7TA 5B39G 4S1RL 4PRPA 2NX5B 5SWZD 1MIEL 1A4KA 2FB4L 2XG4A 3CSBA 3TT1H 4OD2A 3ZE2F 4EJ1C 1RUPL 1GHFH 5FV1L 5T1LA 4U0QB 5H37G 1U91B 4GAGL 2ITCA 1BP3B 4D9QD 4L1HA 1TVBB 2NX5D 1KPRA 2FX9L 1N6VA 3IRPX 3MACH 1IGCH 2PXYC 1R5IB 4KY1H 4OFDA 5ID1A 3TNNA 1YDPB 3HB3D 3LN4B 4WEBL 1QUNA 2B4CL 3K2MC 5AWNH 3S3SA 2HJFB 3E0GA 3ARDA 3WIHH 2Q7YB 3STZB 4JZJB 3SDAD 1FZJB 1KT2A 4LSTL 3I02A 2OQJA 3ULVE 2VITA 2MOVA 1DQLH 4XP4H 1HHJB 4PRIA 4MXVE 5E8DL 3CSPA 1J1XH 5L0QB 3DETD 5JQ6H 4Z78B 3FO0L 5JW4Q 3BYYA 2YWYA 4HS8H 2VLRE 3SHSA 2JJSC 2OQJB 5F1IB 1EFXB 2IFGA 4X5XB 2FH6A 1N59A 1RURH 2VIRA 4IHOB 3IKCB 2H41A 3T3MF 3UAJC 3KLAB 2APFA 4DEPC 3RNKA 3DARA 1G6RB 1U6AL 4LSVL 2WUCL 5D7IA 5CFHA 2QV2A 4XWGH 5LBSH 1VGEL 3QUKB 1A2YB 2B4CC 3SDCA 4LFHD 3TFKC 4FP8L 1FQ9C 4JFEE 4KUCF 5BS0B 3L5HA 2APWA 3DSFL 2HN7B 4X0KA 2PW2A 4RIRA 1FDLL 3V4VL 2DQIH 1HHIA 4JO2L 3KS0J 3ZTJG 2PXYD 1MH5A 1EEZB 2DQEL 4FTVE 4PG9A 3RJDA 1T89A 1A6AB 3U1SL 1BFVL 4RGOH 1K4CB 3C8DA 4G6JL 4PRBA 3WKML 2DQEH 1TCRA 1NKRA 3IXTA 1OARL 2VLKB 1FBIH 4ORGA 1RSFA 4PJ9C 4JRYD 4Y4FC 5GS1A 1CE1L 4PB0H 1YECL 1MCQA 5TDPA 4HDIB 1RIHH 3MUHL 4PJXB 5DJ2A 2QHRH 3B5GA 5C07B 2BNRB 4LLUA 2YPKA 1RUMH 1U8KA 4GRLC 4F8TA 2VERN 2YOCA 1HXYA 4FN0A 4U6TA 4YDKL 4PJ8A 3P2TA 1MVUB 1QRNB 3EOTH 1LP9E 1L4IA 4IDLA 3KPMB 1BHGA 3CC5B 3N1GC 4HKBA 4XNMA 1AGCB 3M45A 3FRPG 4NO0A 5HHQB 5IVZB 4JG0L 4XXDA 1IEBB 1H0DA 3L3IB 4NP4H 4L8DA 3SKUD 1EUTA 3QQ4B 4PJ5E 3DTXB 4C55A 4HSQA 4IIQC 5CEZH 3BZDA 1BIIA 2HVKA 3UTTA 1R3JB 1T03H 1SY6A 2XWJB 3ABZA 3CFCH 3VFPA 4UDUB 3WEXB 3RVVC 5D5MB 4WUUD 3LD8C 4U3HA 4TPRL 3LKRB 5B8CA 2DQIL 4NN7B 4HEME 1XF2B 1VFBB 1KTDA 4AIZA 3BH8B 1LEGA 1QLRA 1IRAY 2XWJA 3OKLA 1N0LA 4WW1A 3BH9B 3IDIA 1F3RB 1NFKA 1U8IA 4R0LC 2DKMA 2ICWA 5A2FA 2FJGA 3TN0A 2Y36H 1NGXA 5FGRA 4JFPB 1UM6L 2GITB 4Y4FD 4NM4L 4ISVB 4H25B 1YYLH 4NN6B 1Q94B 5D5MF 3VFSB 4S1DD 1OAUH 1JWMA 1JGLL 4O9HH 5L2KA 1KJ3H 4GRLD 4U1IA 1FC2D 4NIKB 2WBWB 4E0RA 1RFDL 1UFUA 3GMOA 4G7YL 4XNUH 4JLRA 3AAZB 2QADB 5FB8A 2O5YH 5GGVY 3SE3C 5DC9B 4LCWE 1S78D 5KOMC 4JM2D 3VFMB 4KZEL 2ZUYA 4NRYB 5ALCH 3W81A 2EC9T 4K9EH 4KU1A 3G5VB 3EFDH 4P99A 5KSAD 3LEYH 4KK8D 1HWGB 2NY0C 3P4NB 1OAKL 1A7RH 3L3KA 2NY5L 1K4CA 3KJ4C 5I1IL 4JFDA 3MCKA 4PR5A 4PJCE 3ZDZE 1YC7A 1EEYA 3O4LD 4NBZB 4XCEA 4OF7A 4NT6A 4YHMH 4MNQA 5AAWA 3IETB 3NIGE 1FYTD 4WO4A 5CUSL 4XVJL 2PYEA 4ZNEA 4DGVH 2R0LH 5FCUL 4IOIA 1QFUH 1MFAL 2D4DA 1SMOA 5L8LB 5EU4A 1PX4A 3OX8B 3OR6B 3H9ZA 1AXTL 4UT6H 2D31A 4UIKH 5I8EB 3R1GL 3HI6H 5FYLE 4ZFOA 4RGND 4M7ZC 3U0WL 1MCSA 4R7NA 4WHTA 5BJTA 4JZJC 1WV7T 1ROWA 1T7XA 2H6PB 3T2QA 3IU4L 5C0IB 3GBMH 4KHTL 4EQ3A 1RZ7L 4WO4C 1WQVT 5I8CA 3INUL 4PRDB 1MHCB 2UYLB 5MEPA 1NCAH 4JM2B 5JORB 1CYGA 3ULVF 3ARFB 4JFXA 3LB6D 4FQJL 3QJHA 5EU6E 4PREB 2EIBA 1AJ7L 1KB5A 1MFEH 5HHOE 2ZUUA 5JR1H 4U1LB 1OSPH 1NLDL 5D1XD 3V0VA 1GRWA 2XTJC 3DUUA 3KJ6H 4P3CL 1N6QL 5JORA 4NGHH 3FFCE 4HKJA 5HDBE 1FJ1A 2W65B 3IFOB 5CJOL 5BOZG 2GTWB 1MVFA 3HR6A 4S1DC 4U4BA 3QQ4A 2BRRL 4JM2F 1NJ9B 4FZEH 3MLXL 5BV7B 1QBML 3TZVC 1G1CA 4FOMA 4OD2B 1WSST 3QUZD 4G3YL 1I7TB 3CFDA 3OAUH 3V5HA 4I48B 4WJ5A 5LAXB 1NC4B 1I1CA 5EC1B 1OQOA 1UXWA 4ZPVA 5GGUB 3X3FL 4NKDA 5A2LH 5TF0A 2XWTA 1H9VA 3LMJL 1E27A 3TO4A 5EC2B 1I8KA 4I18A 2CMRH 3MUGB 5IB1A 1INDL 1BBJA 4RCAA 5HJ3A 15C8H 3MRGB 1KCUH 1YPZA 5JOEA 2R4RH 4OFPA 4WFED 4E41E 3FB5A 5TQ0L 3T4AB 3K8LA 1CK0L 1Q0YL 4XCEB 3IDNA 1C8PA 2YS4A 4EI5B 2FGWH 3L6FA 4GXUN 5DMKA 1TQBC 4V1DE 4AEFA 5J12B 1Z0NA 4WFGD 3DVNB 4NQVB 3QQ3B 1G0DA 3QYCA 5DSCB 1RZKL 3CFJA 1KJVA 4QCIB 1PD6A 1CGUA 1XEDA 1A3QA 1BQLH 3B2UD 1G7IB 3ARGC 1JGDA 1UZ8A 4FNLH 4HK3J 5IJKA 5FKPA 5CIPH 3WNMA 5CIPA 2P5WE 1HNGA 1MWAB 4ZS7H 3IDNB 1LK2A 1V7ML 5HYSG 3L7EA 3FJTA 4JCLA 4WI4A 1O0VA 5B38A 1RZIA 1JNNH 2PTVA 4HS8L 2P5ED 2HN7A 4V2CB 4NZUL 4ONGL 4LKXA 4HJJH 3DV4B 4RX4A 4ORZC 4PGDB 5D2LF 5GQBA 4GW5A 5D7KE 1TZIB 3JWOC 2IC2A 3P77B 1DP0A 4S10A 1L7TH 2RFXB 3RQ3A 1Z9LA 4PV8A 4JQVA 4WHCA 1D5ZA 3NPZB 3K1DA 1YEIL 4D8PB 2V2WB 3TJEL 4CBPA 4YPJA 3O45B 2FDBP 3HE6A 3IFLH 3MRKA 2ESVD 1GL4B 5IEHB 3FT2B 1OW0A 5E6IA 4GG6A 5JXAH 3P4MB 4PV8B 4HIJA 3G5ZA 4QHUA 1J0IA 1MCRA 5DQJB 4HS6A 1A7QH 1CVSC 2BSTA 2Y07H 1FIEA 1WF5A 4UB0H 4LBEA 1MCPH 3UAJD 5I1DA 1TQBB 1WC7A 5D1QD 2W9DH 2CLZB 2DN7A 2AV1A 4CVXA 1JYXA 4TQEL 2BJML 2I60L 5JMOC 2VXVH 3PUCA 5C0AE 3OHXA 5KSAC 3RAJH 1BEYL 1TTGA 2Z31C 4P2QE 4PRHB 1IEBA 3BXNA 4P5TA 3S37X 5KJRH 2BVOA 3QQNA 5FK9A 4J4PA 4RFNC 3MV9E 4XRCB 3FAWA 1DBML 4PJBF 3AS0A 3BEVA 3HZMA 4LLQB 2HVKB 3UTTB 2YUWA 4G9FE 5GS0D 5TPWH 5JDJA 5BOPA 3QUXC 2FJFA 2V2XB 3C60D 5C07A 3VRLF 2Z9TA 3OKNB 5ADPH 1RZ8B 4R3SA 2WANA 4G80B 5I1EL 1JNLH 1U8LB 4O58H 1QZ1A 4XNMB 1HIML 4K3JL 1JP5A 1XGUA 5F3HA 3D25A 4K23L 3R4DA 1NC2B 2CLRA 3BP6A 3L3JB 1A6ZA 4NZDA 3WN5C 1U2CA 3GI8H 4NQXB 4WY7H 1LO4L 5LGKA 2FBJL 4ZFOL 4HAGA 5CZVL 5E4EB 2VN4A 4JJ5B 2QTEA 3PE9A 4WO4B 4XPGL 1T21B 1FFPA 4LGSB 1JUFB 3NN8B 3GMMA 4W6YB 3RKPA 2A6DA 4PRBB 5DMGC 2MKWA 3LHPL 5EBLB 3PV7A 3UDWA 1A5FH 3SKMB 1JE6A 5IW3A 5GGVH 1MI5D 1VFAA 3RGHA 1D9KB 1I7ZB 4WTZG 1A1NB 5LXGL 3GIVA 2EH8H 4KI5F 1WUNT 4Y5VA 5E2UL 1SM3H 1X9QA 3VCLA 1KGCD 2R23A 4HWNA 5J11B 5C0DA 2H2PC 3SKOA 4Q7DA 3OKMA 3PDDA 1J18A 1A4JB 1SM3L 2APXA 3LKNA 1S9YB 5JW4M 2YPLD 5D7LB 4R90H 4XP9H 5KN5B 2ADJB 4RMTA 3MLTB 4P2CG 2W38A 5F1IA 3QXWA 3RA7H 1GYAA 3PXJA 2BSTB 5CKGA 1L6XA 4Z0BL 4A6YL 4HLJA 2XZQL 3BN3B 3CK0H 1J8HD 3W0WA 1J11A 3FN0H 5SWZA 1L0XA 3TYGH 2BSRA 1AO7B 3CU7A 1I3UA 4QOKA 3KJ6L 1LHZA 5DJDA 2XYCA 2C9AA 3O8XD 3U2SA 1YJDC 3H0TB 5DD3H 4HD9A 4ZD3H 5F9WB 5CEYA 2OTWA 2CPCA 3O4LE 4PJ9D 3RL2B 3QZWB 1WT5C 2QJDA 1OP9A 4OV5A 1DLHA 3TV3L 4JY5H 1EAPB 2R69H 5FO8A 2A73B 1IAII 2F8OA 2QSVA 4JKPH 5ACZA 2W9EH 3GBLA 4QT5A 4ODWB 3QXAB 2GI7A 4FQPA 3TJEH 3DTXA 3L3DA 4FFVD 4XNZB 4Z7WF 2VLJB 3MV8D 1BFTA 3MREB 4L8BB 3CVIH 4LPUA 2BNQE 1A21A 4WW2A 4JZOB 3SDAA 3VMOA 4DKDC 4YXKL 4Y19E 3MRBA 4HCRH 4F9PC 1DANT 3HMWL 5IB1B 3O9WA 3CMGA 4BQ9A 1U92A 3FO2A 2BOBB 4H20L 4JVWA 1LEKB 4DVBA 2AJXL 5IK3A 4X6FB 3H9HB 1EPFA 3TIEB 1ZVYA 3WCYA 3ES6A 2J6EL 5I1HL 2Y5EA 4DUXA 1WBXB 3QQ9D 5DR5L 2F54D 2P43B 3O9WB 3VGEA 1EH9A 1YN6A 2NY6D 4P4KD 2XKUA 1IAIH 5LAXA 3DGCR 1IZJA 2W0FB 3VXRD 5GGTH 1LNUB 2CKBH 5GGTA 4DQOH 2ESVB 2W9LA 4X9IA 1D5XB 3BPLB 2AK1H 3VI3F 4HIEB 2VXSL 3HI1B 3HPJB 4YHLH 4YEEA 4ACPA 4J4PD 4HJGA 5LCVL 5AD0B 5D71L 5EZLB 4LCYA 1EGJA 3PHSA 4XRCA 3V9FA 5TGBA 3NFPA 1DANU 4KZEH 1VFBA 5JPNA 4Y4HA 1WZ1H 4DKEH 2R8SH 4Q9RL 1HK6A 5IVXF 4XCCL 3AVEA 3KLAA 4OZ4B 4KUCD 2EH7H 3WFDL 2BVYA 3QA3B 1F13A 4I5BB 4ZTPH 2PETA 3MSPA 1MREL 4L4TA 2WBKA 5GZND 4OT1L 4X7TA 4M4PA 5IR1A 4OTXH 4P59H 5DGQA 1FZMB 2BY2A 3C60A 4KMTL 2DJ4A 3OKDB 2VYRE 3Q3GA 2LAAA 4KROB 3K46A 1FLRH 2DBJA 3CMOL 3F6IA 4DOHE 1HDMB 4XX1G 5BXFB 5HYQA 2RGSA 4PJ7F 3VW3H 1DEEA 3T3PF 5IGXL 2P5EE 3S35H 3RTQB 4R97C 5I8EA 5FHAL 2CRZA 1T1WA 5JW5A 2G2RA 1T7VA 4UTBL 4HIXH 4UUJA 1ZAGA 2EIZB 3WIFA 3JWDL 1RZGB 3RWEA 3QG7L 1OGAE 4EXPX 5IHLB 2ED8A 1C5CH 3KPSE 3O6LH 3E3QC 5EZOL 3OV6A 4NYLB 4UOW1 6CGTA 2V9QA 1Y6NR 3SDDB 3QEQB 2AV7B 2I26N 3V6FB 3VXRE 4HT1H 1A6VL 5J3HC 5FKPB 2JCCF 1MCCA 4ZS6D 4ERSH 4X9GA 3O81A 4NUGL 1I7UA 3VXQA 2X1PA 1G7JA 1SYSB 1KC5L 4NJ9L 4QRTB 4GAJL 3FO1A 1HKLL 1PG7W 3C87A 4LDOB 5E2VH 3ZTJH 4HK3N 5KZCB 1T1ZA 1UCTA 4P46C 4HHAB 4JN1L 2YD3A 4HUWA 3PL6B 5ICYB 3WS3A 3D9AH 4JO4H 3BP5A 4M8QA 2HKHL 2IAND 3HAEH 5KSBF 3DX7A 5IB2A 3GB7A 3RP1A 5D1XC 4LRNH 2X4QB 1I7TA 2BY0A 3D39B 4RGOL 1EO8L 4OCNC 3U1SH 5IMOB 4R3SB 5DZLA 1JNHA 2QEJA 4NRZA 3LKOB 1JZ4A 4G6AD 4NKDB 4R97B 1FNGB 5KG9B 4TVSa 3RTQD 2DICA 1NMAL 1Z9OA 1VGEH 1KCLA 1INQA 1F2XK 3Q48A 4HWBH 2WUCH 2CDGB 4KQ3H 4OZ4A 2KL6A 1MPAH 1OD7A 3O8XB 5AYQA 2NY4C 4XXCC 3LRHA 2HJLA 5H2BA 1VPOL 2HYMA 1DFBH 4PJ5D 5LWYH 4HGWA 5F89B 1RZJL 5HYFA 2XN9D 3F65A 2FSEA 2EE6A 1Q9OB 3JV6A 5CGTA 1TVHA 4AENB 3G6AB 1NAKL 4LAQL 5DMYA 1J1XL 1KTKE 3C2SA 3NVQA 1MQKH 4PLKD 3QIWD 4UNVA 2DKSA 4XP6L 3FAXA 3MBED 2OL3B 5J57B 4HKZB 4HKXA 4MD0B 1SBSL 5DWUL 3WFHA 3C60C 3SDDD 2ZCKL 4H88L 3D3VA 1N5AA 2CIKA 3HE7C 4DCQA 3TCLB 1YN7B 3S37L 3S98A 4WRLA 1OOAA 5KVFH 2HLFD 1GOGA 5ETUA 2PTUA 1BOGB 2IH1B 2NY3D 1T6WA 5HHPA 1OCWH 4JY4B 4YHNA 5B8CC 4MJ4A 4P2OA 4GMSL 1XGYL 1JPTL 1WT5A 25C8L 5DRNA 5J89A 1AGEA 4PJXA 5DJ2B 1CR9H 3P9MB 3K2UL 3L3KB 2CLVA 2A6KB 4QWWC 4H8WC 2X4NA 3I6LD 3BGMA 1MCLA 5DMGD 1IQDB 1X5JA 4CDGC 3V4UL 3VXOB 4CVZA 1NANI 5C0BA 2XQBL 5GRXG 4BUGA 4YQXL 3G5XB 1PG7H 3GO1L 4M4RA 4OLVH 5LQBH 4AEIH 1MLBB 4ONHA 1N4XL 32C2A 4JFFD 3U6RB 5B4MD 3A6CH 4I0PB 4OCXH 4Q74A 2P44B 4CNIA 5T3ZE 1OPGH 3KYNB 3BP7A 5EZJA 1J0YA 1ZS8A 4PJGA 4ALAH 3MJ9L 1XGQA 3EYQD 3U0TB 5SX5K 3VDAA 4PV9A 3BQUD 5KVEL 1T1WB 5JW5B 3JWDH 3I3DA 4MQSB 4ELMB 4HIXL 1AGFA 4Y89A 1F90H 4JDTL 1IL1B 4C59B 3E3QE 5C2UB 3CXHJ 4I48A 1SJVA 3QUZB 4X4MA 2R1XA 4HMEA 1NGYB 2ZUSA 3WS6A 5C92A 3KG5A 5HHOA 1PYWB 1U8PA 1G7PB 3QXVA 5DA0B 1JWUB 3O8XC 1QLFB 1NBZB 2FEDD 1AGDA 2X89A 5JPNB 4MJIE 1QYGL 1WK0A 5INDB 2LTQB 4NO5B 1QNZL 3PWNB 4YDKH 5KANI 2YKLL 3QDJA 3V7AE 3OJDA 5CILH 3ULUF 1QG3A 1MIML 3IAGC 4OLZH 4WENB 3QO1A 3T0BA 4EI5C 1QFWL 1X3DA 1RK0A 4Y5XB 2V7HB 5EZLA 4LF3B 5LGHH 5I30H 4HJGB 5AD0A 2VQ1B 2PXYB 2JCCE 1BIIB 1YY8A 4UQ3A 2AJ3B 3B6SA 5IFJA 4PRIE 1Q1JH 3C5ZA 3QUXA 4L4TD 2NNAA 4PTTA 2QQNL 5C0GA 3GJFK 2AJYL 5FKAB 3L5JA 2B4CH 2AEPL 4IJ3C 4M6OL 3MLUL 4RGMC 1JF5A 4WV1A 2OI9C 4YHZL 4ZAKB 4UT9H 3GKWL 2LQRA 5DUPH 3BJLA 1UACL 1ZEAH 3GSRA 4LU5L 1GZPB 3L9RA 3VXUA 2GK2A 1SEQL 1HHHA 1G7HB 2YRZA 4LCIH 4DJMA 4QT5B 1OB1A 1LVEA 5D1QA 3TT1L 5MEQB 5I71C 4HUVB 2HFGL 2FEDC 1DBBH 1AXSB 5B39A 1GJIA 1OWWA 1A2YA 5DJYA 1DQML 2ZCLH 2Y6SC 2YD9A 1WCQA 3X3GL 3IJSB 4RAUB 3TO4D 1OAQL 1NBQA 4NC2B 4BSJA 1KIRA 2OTWB 2ZKHL 4P4RA 2D7PA 3MUZ1 1JGEB 4LP5A 3EDDA 3MOAL 5FO9B 4QRRD 1WIPA 4ZOCA 5FUCC 3ME0A 4GG8A 5I1DB 4YDIL 5C09D 3WIHL 1A1MB 3LV3A 2FEEI 5J6HA 3CAFA 4Z7OE 4MJ6A 4DZ8A 4OD3H 3P0GB 4RFOL 3S3JA 4I0KA 4QRRB 2Y4SA 3HUJA 3GMNB 1RJZA 3MRKB 1D6VH 4MA7H 3DYPA 2ZOLA 3MBEB 2E7MA 5E7BA 3X13A 5SWZB 2MHAA 3C09C 1JHLH 5AUMA 5JNYA 2A2QT 2E7LA 4GKNB 4WU5B 2DIJA 3GEWB 5D7JB 1N5YL 4YBLC 3H9SA 4CU6A 3EYVB 1MAKA 4RX4D 4K3EL 4M3KB 4P57A 4G8EA 5ANME 3I6KB 1GGYA 1GPOH 4ODHH 6FABH 4F58L 4YE4H 5F7FA 4XAKE 3TBYA 1NAKH 4LAQH 4EI5D 2YEZA 5EBWA 1KG0B 3UPRB 3UYRH 2OXHA 4D9QE 5CWSB 4R90L 1LQSR 5D5MA 3BZ4A 5F7WC 4ZYKB 1BQHA 4P3DA 5HI5D 3RVWD 1AI1L 3NIDF 5IQ7H 5FA3A 3F7VA 4XH2A 3WLBA 2ZUVA 3RTQC 4YLQT 5DD6A 1PZ5A 4BSWB 4OZIB 1PJ9A 4PGZA 3QDME 2NY6C 4JFHE 5MENE 1H0DB 1T20B 1R0AH 2JJTC 4HLZH 3OZ9L 2DYPB 4KI5E 1NAMA 4M6ML 4DW2L 7CGTA 1LDPL 2A74B 5J9PA 2DD8L 4FFZL 2IH3A 4FXLA 3TO4B 3WL9B 3M8OH 4D9LH 3VXTB 5JHDE 2H32H 4C56A 3PHOA 1T20A 4HXBL 2BVEA 5HY9A 4JPWH 1GZPA 3L9RB 2PW1A 4GW1A 4QXGL 1UEMA 5DK3A 5IFJB 1OLLA 3EYQC 1A64A 1I1AC 4HX1A 3K81A 1CBVL 2KUTA 2XXMB 1QSED 5J9PB 3FB6B 5TFSH 3D48R 5HD8D 3V5HB 2NW3A 4PB9H 4XNZC 5CD5C 2R2HB 3LS5L 3SE4C 3NTCL 2QLVB 1HIMH 3MOBL 4ZOEA 1F11A 4JR9L 1P7QB 2NPLX 4P23C 1N2RB 5TDOB 1FPTL 4IOFD 3S96B 3RWGB 5D93C 4FXGA 2PW2B 2JK5B 4WIQA 3C6LD 1BAFL 3QO1B 3HC4L 3UMTA 4F7MB 5DQJA 3A6BL 2APTA 4HAFA 1KUMA 3O2VL 2OMBA 4M7LL 5DO2D 2BSSB 2D7OA 2NY6B 1IFHH 1HQRB 4C4KO 4U6HB 4R7DA 4D94A 1E6OL 4HIIA 3SGDH 1H3PH 4KTEL 1WIUA 3LKOA 2W60B 5EOQH 5HHXL 5ID0B 2Z0BA 3L3OB 5D4QA 5DD0L 1JPSH 2AXFA 5D7IF 5ADOL 2AABH 3DX8B 1MHHB 3BKCL 1A6UL 5EU7E 1QLEL 5ILTL 1Q38A 4KGLA 2CK2A 3MV11 4Y7MA 3GO1H 4OLVL 3O4LA 2YD7A 2BVTA 2YRLA 1CGSL 3RWCB 3MRFB 1QYGH 3BN9C 4LVNC 2C3GA 1XGQB 3P77A 2Y9RT 2EC9U 4MD4A 4XHJD 4LCCB 4ZTPL 2ZOKA 3HE6C 5C0BB 1GOFA 3BDYH 1TCMA 4B50A 4OCYL 4WW2C 4HF5L 5FDWA 1GAFL 2ZNXA 5LKNA 1CXEA 1I7UB 4I2XE 1QSEA 1KELL 1X6LA 4JFFB 5HYIA 2P1YA 1ZWIA 4YGVA 5E99L 3VXRB 1CXFA 4R8WH 3QPXH 1JMZA 4MAYC 3P4NA 2NXYC 2VXSH 3QUMH 2VDOL 1MJUH 3PDOA 5ERWB 1GCFA 4JAMA 4NQVA 4F7EB 1X5XA 4M43L 3TPUB 5DZNA 4ZUVB 2A83A 4PJAF 4Q6YA 4G8IA 5DURB 1A6ZB 1MJUL 1W2KT 1R24B 3BP6B 5HDOA 5B3JF 5IBUG 5IF0A 3PIQA 3D25B 3VD7A 3K8KA 4Y5XA 4X5WA 3KWWB 2DQGH 3JTSB 1J9CT 3LVEA 3U46B 2BOCA 4YZFF 2G5BB 2J8UB 1JWSA 2HJKB 4Y4HC 1NJ9A 4N0FA 2BY3A 8FABB 1B0RA 3QZWG 4JFPA 3C5ZB 4JFQB 2AVGA 3EDFA 4TUOB 4YXHL 2ICWB 2W1NA 3HG1A 3L5XL 3OGCB 5DMIH 3NBNA 4M7KH 3X11A 3U82B 1EFQA 3B43A 2F54E 1A14H 3KPSD 5JW4N 3QI9B 5EUOF 1EJOH 3C5SA 3LPFA 1F4XL 3ESVF 2X1QA 3BHBB 3GSUA 1HEZA 4F7TA 1VKXB 4CADB 4OD3L 3B9KD 4Z5RA 3BFOA 1MHPL 1X5GA 5E8PB 4UDTB 2VZSA 1AH1A 5BZWA 5T3ZL 3FHQA 1H15A 1U41A 5D7KD 3OGCA 4MD5A 1CGWA 3MOAH 5JTWA 5T1DL 4Q58C 5FXCH 4U1LA 5CEZD 1CCZA 3C2AH 3KJ4B 2H32B 5DD3L 4EN3B 4BFBD 4KTDL 1TZGL 5IMKB 5A2KH 1UM4L 2ERJC 3WXVL 4WI8A 3QUZA 1Y0LA 3TYGL 4U1SA 3QIUA 3O45A 2NXZB 1TTUA 2AQ2A 1MRDL 2XZQH 2C1OB 1HKLH 5IFHH 1C5BL 1RHFA 1DFBL 4DZ8B 5C0FB 3EOAB 1NCUA 5B38G 3VXNB 5E2WH 1OAXH 4JRWA 2H9GA 4IOIB 2PO6C 1JL8A 4LKXB 5EZJB 5KSBE 4XBPA 3TESA 3UTZA 3VG0L 2HKFH 4PJXF 3C6LA 3VWJD 2H2PD 1ZT1B 3N85H 2AEQH 4OBSA 2ZG3A 4F3FB 3W11C 1A9BA 5DURD 3KS0H 2DM4A 2FH8A 2YA0A 5BMFH 3QEQA 4RDQG 1GXEA 4ODWA 1U93B 4F7EA 2G60L 4HUXB 1S9XB 5DFWH 1W72L 3LAFA 4X0KB 2IADA 3EW3B 1TZGH 4KHXL 2YMXH 4ELMF 1QPPA 2CKBB 5T1DH 1FLTX 4GS7B 3LEXB 2VWEE 3W39B 3FFDB 5HPMA 2X41A 3RL1B 3HZVA 4DAGL 3WJLA 4RQQB 3O3UN 1EV2E 3OF6D 3QHZL 2JJWA 5E08H 2ADGB 2NY5C 2XA8H 4IEFB 4CGTA 2YXFA 2XRAH 3UEZA 4WTWA 4EIGB 2NTFB 4DWHA 3ZE2E 1UG9A 3AMKA 5D7JA 1JTPA 2XTLA 1FL6A 3QUMA 4GOSA 4YEFA 3G6AA 4LVHC 1N6UA 2PXYA 5IFHL 2GK0B 4UILL 2VLME 1MAML 4Q9RH 2PO6B 1F90L 4LPXA 3C60B 3QG7H 3X14B 1KJ3L 3E2HC 2IF7A 3QNZA 5D71H 2D0HA 1PBYA 3KPNA 4S2SA 4P5MA 1MCOH 5A2IH 3GIVB 3L1OH 4FFWD 3DWTA 3HG1B 1QFOA 1KIQA 4PY8J 8FABA 3FB8B 4JB9L 5B8CB 3PP4H 3ARTA 2NY7H 2WQ8A 4YK4C 3FRUA 5MERB 2XNAB 2AJVL 5K9JH 1D6VL 4MA7L 1AXSA 1MCPL 5B39B 1DBJH 4OF6A 2X4RA 4EQ2A 1QFPA 5L0QC 2EDEA 1ZHBB 4Q9QH 3Q5YA 3GMRB 4GH7B 5JUEH 3OKOB 4PTUB 5E7FA 1IGML 3MRMA 4LEXL 3I6LE 1N26A 1VEPA 3DX9B 2BNRA 4LLUB 4X8XA 1EHNA 5MENA 2G5BA 2XN9A 4Y4KA 2Z92B 1D9KD 1FVDB 2UWEB 1U3HD 3PABA 3BDYL 5J13B 3X12B 1I9JH 2DQUL 3HI5L 4HS3B 3UBXG 2AAVA 1RIUL 1J87A 2V9RA 3D39D 4D9RE 2DJUA 2NX5E 4KZDH 1F6AB 3KYKL 2R2EA 3MLZL 1ORQA 1ZVSB 1QBAA 1A6AA 2VXQL 2ZCLL 3OR6A 5D70L 1DQDL 3RHWK 3SDDA 3BKCH 4RFEB 5IMMA 2X7LB 5TDPB 2ATKB 5ITFB 1FCGA 4Z8FH 4OFKA 3QULA 1CDHA 3RWIB 4TVPL 5GGRY 1M05A 4MB5A 4X80L 2EDDA 3U9UB 4YZFE 5E1HB 3C5JB 3QPXL 3NCJL 3RIFF 3S9DB 4MJ2A 4L9DA 1HHIB 3U2SB 2R0ZH 1BX2A 2AEPH 3CK0L 3IAQA 1KJMB 1KELH 4ZYKA 4X9BA 2C7UB 3N0PB 4G5ZL 5HDQH 1FAIH 4Z7UE 1KCVH 1T22B 4TRPL 2B5IC 3DRTB 1VPOH 1W0WB 4I13B 5I8OL 4KKNA 4XWGL 5HGBA 4RAVB 4XP9L 1UT9A 4U1IB 2ZUTA 1DVFA 3TM6A 3CH8A 2BMKA 4I3RL 3UZVB 1MI5E 2LVCA 1AGFB 4D8PA 3U4AA 1QR4A 3EYVA 4I4WA 4ELKA 2C3HA 2VZOA 2OXGA 4J3VA 2N7AA 4C83A 3VFVB 1J7VR 3OXRB 2QQKL 2ORBH 2FBOJ 1KLUB 2G5RA 4L29B 1U3JA 1U8NB 1WCBA 3N9GH 2RR3A 4PRID 3EGSB 3HRZA 1UXSB 3T1WA 1CWVA 3AXLB 1C7SA 5A43C 3QXDB 4WW1B 1T0NA 3QH3B 3NZ8A 1MCWM 1YUHA 2A6JB 4Y16B 4MQXC 1DQLL 4HUUA 3D9AL 3HNTL 4POZC 2BSSA 4HXBH 4EIZC 4N5EC 2HJLB 3FN0L 3WJJC 1QR1B 3TVMC 4KJYA 1R3IL 4H5SB 1U0QA 3UJIL 3DXAB 3OB0K 4KRPD 2DQJL 2R2HA 1PY4A 1RZFH 2F54B 1G9NC 3O9WD 2VTFA 4U1MA 5AZEL 4PGEB 4S0SD 3W0WD 4PFEA 3QWRA 3TO4C 1OB1B 2DDQL 4NN6C 4FQ2L 3VG0H 4FFYH 4S1QH 1GIGH 4QOKE 2Q8BL 3MYJA 3P9MA 1P7QA 4OJFH 3ZYIA 5E8NA 2V5MA 3PHOB 3RWHA 5E2WL 4AEHL 4XC3H 4XVSH 1JK8A 1KJ2H 2MPAH 4JFDE 3MLYL 3RPIA 1RIVH 4MXQC 3QIUC 1AI1H 4ZUWA 1OSZB 2QADC 1QSFE 3QCTH 3LOWA 5INCA 3T04D 3OKKB 2YD8A 4MNQE 5LQBL 2XWTB 4CW1A 1OVZA 3GSRB 6FABL 1HWHB 4N9GA 2QQLL 1JF1A 3EHBC 2Q87A 2ITDA 3I9GL 3UJIH 4Y4HD 4NOFA 1A8JH 2BY1A 4JKMA 2DD8H 3UTPE 5IJVB 1CR9L 4ZOAA 1XF3A 4YGVB 3VXRA 4GG6E 1ZT4A 3R06A 1DVFD 1KENL 1NH6A 1HYRC 4GRWE 4PJBA 3CDGA 5IW6A 3DVGB 4V1DD 2JTDA 3LB6C 4HH9A 4GMSH 3OTTA 2V2TB 4XVJH 4FXKA 5DJ6B 2R2BB 3KLHD 4UIMA 2FL5B 4LARL 1MREH 1YNTA 4LVEA 4X6CF 5EB9A 5DFVD 4QHMB 5B21A 1QVOA 1EHLL 2VL4A 4FFWC 1JRHI 3ARBD 4XCCH 5HHOB 5EU6A 2YEZB 3RL2A 2OSLA 2VDRH 3FT2A 9CGTA 4D2NA 4O2CA 3HUJF 3OKEB 4GRLB 4X5XA 5JPMA 3HUJB 4KGJA 5C6WH 4RNRB 1MCEA 4JY6B 3EFFA 2VLLA 2W0KA 3GM8A 4M00A 4HJJL 4X9FA 4NZRL 4NRXB 4W6WB 4OFYA 1I9RL 1NGYA 4QHKI 1UA6L 1YEGH 5BJTB 2R4SH 1AY1H 2APVA 3GDBA 1GGUA 4TSBL 4ZAKD 1K4DB 3AS2A 4YDJA 4FNLL 3EUUA 3QR2A 3ARYA 1HCFX 5L2KD 3QCUH 4I77H 3MNZB 4TVPH 3IFNL 2J3SA 3UTOA 4JZNB 2BDNL 4MNQD 5CZKA 4Y1AB 5E99H 4ODBD 3GSVA 3U36B 1B6UA 3U4EB 3AY4C 3V6BR 1OTSC 4HIHB 3ARGB 1JTTA 1I1AB 4MNQB 1D9KA 1PQZB 2XT1B 4XHQA 3LQZB 2Z91A 5TQ0H 4PJCA 3WIHA 4NNPL 2DB8A 1QSFB 2ZKHH 2ESVA 1RJLA 1CFTA 1HSBA 4Z7NE 3X12A 3G5VA 4UBDD 1BQSA 1DQMH 5D1XA 5CMAB 2PF6A 2P47B 3X3FH 3V8OA 2BHUA 1ORQB 3O3DA 3VXTA 4AIOA 1C1EL 4OM0H 3CUPB 3K4AA 1UXWB 3SCMB 1JBJA 1DEDA 3DXAE 1MUJB 5HHPB 3FONA 1HZHH 5FECA 5M95B 3OQ3B 1CGVA 2CDEB 1QFWI 1UADC 2VMFA 3ARED 5MENB 3EO1A 4OUUA 3L7FA 3HE7B 1YEHH 2VUOA 1RHHA 4IM8A 1FE8L 3D2UB 4UQ3B 4XC1H 5D2NE 2CXGA 1B9ZA 3GSOB 3VG9B 2OR9H 5E5RB 4NSKB 1DUZA 3NABL 4O00A 3O11A 4LHUB 2VH5L 4MAUH 3OSKA 4EN3C 5I1LB 4BZ2L 5A1AA 4KXZH 1FAKT 5HVGB 3W2DL 3VXMA 4QTHB 4K7FA 1MIMH 2QSCL 4G6KL 3UTPD 3OJ2C 3H42H 3NTCH 1FG2A 3EZJB 4TTDD 2AKRA 1AKJD 2JKXA 4CMHB 3KPLA 3QWQB 4Z7UB 3W0WB 4F33A 5CEXB 4XTRD 4QHUB 2JLLA 3QUYA 2VL5B 3RDTD 4XGZA 4LSUH 2NY1C 3X13B 4U31A 3DV4A 5EN2A 1QRNE 5CJOH 3TF7C 4ZFOB 2V2WA 4QRRE 1ZSDB 3NACL 5E8EA 5CD3B 1D5ZB 3FFDA 4JGJA 2YPKB 3JZ7A 3OZ9H 4MB3A 3S4SB 3DRTA 2BNRE 4G43B 3NIFF 1T22A 2FO4B 4TUKL 1OD9A 4G42B 2G60H 5GGQL 4N0UA 4LPVA 5EFIA 5FUZH 3HE7D 3PWPE 2RAMA 3GMPA 1CXKA 3KPSA 3MRBB 4FQLH 3QJFB 2AK1L 4YR6B 1IGYB 4AZ8A 1Q9WA 4WGWB 4GT7A 3PF2A 1UWEL 1MCNA 3WFEL 3SQOL 1FZKA 2NR6D 3KDMB 2CKBA 5HDBF 2BNQA 3SCMD 5HI4C 1IGCL 2UWEE 3QG6B 4HPOH 3ULVD 1T1XB 3QEGL 3QISA 3TWCH 3KR3H 2WIIB 1AHWA 1IVLA 1SHMA 5BV7L 3GJFH 3H3BC 3CSYA 3DGGA 4JFEB 3TJHD 3SDXE 3CFKA 4C56D 2OBGA 3QWRD 1YMME 1CT8A 3W82A 2CR6A 5I1AA 3QDHA 3JSSA 3P4LA 4HWZB 1AQKH 1RMFL 4X6CE 1BM3L 3T4AA 1J0HA 1QKZH 3SJVD 3G5YB 4MNGA 5D72H 4FQXB 3RHWF 4HCRL 2GAZB 5CP7A 3Q3GB 1JWMB 2AJSH 5FKAA 5GSRB 3V6OE 1ORSA 4UB0L 4PRNB 3HG1E 2X09A 4GO6B 1P84J 1ZT7A 4I8DA 4M1CD 4R2GB 4H26A 1TVDA 3PWLB 4N8VB 3D69B 3EIFA 4PRIB 4GW4B 3HZYA 2VQ1A 2EDRA 3P30H 3SGDI 2FECI 4HIIB 1Y0LB 4HKZA 4HKXB 4Y19D 2BFVH 4GS7C 4N1CA 3ZE0F 1A3RL 3RNQA 3IDXH 4IRZH 1BBDL 1UWXK 2DRUA 2FJGB 3TN0B 3U48A 3WJJA 3DROB 4XT1C 2BCKB 3BYTA 5IVNA 3X3GH 4I3SL 4LCYB 1HINL 1VESA 3NPSB 2YD5A 1RFDH 1EZVY 2YBRA 1MWAL 3RDTC 2Q7NA 1MHEB 1H5BC 2EO9A 3KYMA 4G6AC 4NQCA 2NY1D 3NFSL 1KN2L 5IW6B 3OF6A 4LHJB 2GCYB 5LWYL 3P4MA 4KAQH 3O11B 5E6IB 2NW3B 4LU5H 2ZWLT 4Y16C 3QT2A 5DFTA 1J1OL 1DUZB 5KTEH 1DBKH 4R4NC 2OCFD 1BVKA 4Z7WE 1KOAA 2V5YA 4TNVF 3BPOC 5D1ZD 5AYUH 2HTLC 4P23D 4FQHB 1HYSC 4JREC 1KIPA 4N90D 1G9ML 4CW1B 1ZA3B 4OFIA 1BZQK 3WD5H 4LQFH 5IHUH 4NQCE 4QRPB 5SWSE 3WS6C 2YWZA 4JAMB 5F9WC 4POYA 2DTML 1F00I 3OXSA 2P48B 4KI5D 1KPVB 5DO2C 4BJLA 3ULSA 4WFGE 2VLJA 3EBAA 3VW3L 4NWTH 1QSEB 1P69B 4LPCA 1LEKA 4DVBB 3VWKB 4JFEA 2X4PA 5CINH 5FDWB 3MLWH 5FGBA 4TULH 5FA3B 3U7YH 3RUGA 2QSTA 1QBLH 4LNRA 3BZ4B 3MPCA 3S3PA 1FGNH 2CXKA 3RGVC 1QLEH 4OZHA 3MNZA 3OHXB 3RWCA 2CJUH 5DFVC 4J1UA 3C6LB 5DJAA 2PYEE 4AT6B 1LGVA 2X42A 5HYJE 5IVXE 1M7XA 4OKVA 4UAOC 2E8YA 5E95B 5CSBA 1IM9B 3HR5A 3RNKB 2H45A 1IM3B 3FQUB 3QDJE 3OL2A 5J6GA 2DWEB 4R0LB 5JXEA 1HDMA 3B3IB 3O6FD 5BRZD 4XP5H 3E6HB 3WD5L 1ZGLA 3VI4E 4YHYC 1ND0B 4BH8B 1T5WA 2IAMC 4QF1A 1MJJB 5F9OH 1KULA 2CKBL 5T3ZD 5HGAB 1MHEA 3SDCD 1AP2B 4QNPF 4A2MA 2FCBA 2EIDA 3CH1A 1S7UA 5DTFA 5C0JB 4HXAH 5FGSA 4Z5RB 1UH3A 3KPOB 3OWEA 3WFBL 4KFZC 3F58H 4LNVA 1HEZB 2ZCHL 1AQKL 3BUYA 4D3CH 5FYKE 3G08A 4F7MA 3F7YB 4PRPB 1KJVB 1JPTH 4MMZC 5FCUH 1QRNA 2C4FU 4J23A 1OW0C 5E6IC 2AXJA 5DEGA 3WIIH 5EOCL 5AAMA 1T80A 2R2BA 2VOTA 2VLRD 2ATPA 4LDLB 5TF1L 5HHVH 4PRPD 3PHQA 1NCDH 3NAAH 4F7CA 5MEOA 4YAQA 4Y2OA 2DWDB 4XP1L 5DUML 3ZKMC 4P49A 4WEMB 3R0MA 4ZS7L 3IDUA 3FOMA 2UVFA 5DEFB 3IDMA 2C26A 1SBSH 3PWUB 5CJXA 4HC1A 3VDBA 5BRZB 3PHQB 5MEOB 5AG9A 2AJSL 4QGYA 5AZ2L 1Q8MA 3VGGA 3DO7B 4L8CA 4TNWK 5C0BE 3B9VA 2VWEC 2HFEA 3IB4A 3TO2A 3K8MA 4RIRB 4F15B 1LWRA 3LKPA 1RMFH 2JB5L 1NFDB 3B9KB 1X5HA 3TBTB 4YAQB 5BVJB 5HPOA 4I2XA 4ZQKA 3OB0H 4OLYL 4CMMA 2VNCA 2G9HA 1RZJH 3WHXA 1URLA 2C3VB 4K7PY 1XGTA 4E41D 3F5WB 4FG6D 3QEQE 3BGAA 3LH2L 1UM6H 3KYMB 5D2LB 4IHOA 5C8JA 4LIQE 1U2HA 3KPSB 4EN3D 4K94C 4NNXA 2OTPA 1VSCA 1G0YR 2GFBB 3ZE1F 1E4XH 5D7IB 4AG4L 5CJQL 4KVCH 5IB3B 5J1TC 4PYGA 2GT9B 1CDBA 4GMTH 5K9OA 1MCKA 4HMCA 1CF8L 1A9EA 2WINB 4GJTB 5J0BA 1E6JH 4ZFGL 1HNFA 4QYOB 3L3GA 4RAVA 5F1NB 4WUKH 1IJ9A 5EIIA 4NKOA 4PG2A 2W92A 5I1JL 3D0VB 2GITA 1FSKB 4LSPH 3I9GH 4PGCB 1I9IL 3GMQB 4LHQB 4PJEB 3WO4B 3Q0HA 3NCFB 1NGZA 1F8TL 1BGXH 3WE6A 1S5IH 3UJTL 2ITCB 5J6GB 4F15C 4PJDB 5DQ9B 3FL7A 3BZEA 4YFLI 3REVB 4PBVC 5KW9H 1YNLL 1FVEB 1N8ZB 4Y2DC 3LKRA 4MX7A 1FORH 4OGAD 1ES0B 4GW5B 3CSYB 2NZ9D 4K3JH 5DVLA 1C16A 1NGQH 2QSCH 4G6KH 4JFED 4RSVA 2GJZA 1T2QH 3MODH 2JCCA 3BQUA 2Z35A 1AQDB 1K2DB 1JGEA 4EZMA 5IM7A 2MTPA 3RZCB 4TUJA 4K94L 4RMQA 2QBWA 1XR8B 4TSCH 2YSSA 1YMHB 1UZ8B 2D2OA 3KAAA 5C0AD 2R29H 4LVOB 3SKJH 4KK5C 3PWVA 2UY6A 4FZ8L 4K07A 2AEWA 4HWUA 1FE8H 3MROB 1YN6B 3CNKA 3HI6L 4OUOA 4HUVA 5KJRL 5MEQA 1CLCA 4PJ5A 4MHHG 3RPIB 3G6JF 4RBPK 2FO4A 1KPUB 2Q20A 4U1NA 3HNTH 2YHGA 1IARB 4TQEH 1LO2H 1N5AB 2VAJA 3OXSB 3G6JA 3GI8L 3MZGB 4G8GD 1AGBB 2E7LC 4HBQA 4EDXA 4Y19B 3KNBA 1MSPA 5CILL 4LLDA 5MERA 5FYJU 2D3VA 5ICXB 4XGZB 1JYNA 4KRMB 5IT2L 4Z7VB 2LTQC 2YKLH 4JRXD 4WU7B 1YYMH 4XPTL 4PTUA 4PJDF 4PD4K 4JFYA 3DMMB 4MDIA 1UVQA 1XF5A 1EEUA 1C5DB 3ARPA 4IIQA 1RIUH 4K7FB 4DVRL 3BD5A 5FHBH 4Z6AT 5F6HJ 4ODVL 2GJ6B 4FFVC 3VFPB 2ZCHH 2EKJA 2DLFL 4WEBH 3D3VD 1IL1A 3HE6B 3W9EA 1R3HB 1SJEA 3NCCB 1FNGA 1AGDB 3HPLA 4S11A 3L3IA 3QDAA 3KHQA 5JHLH 5IV2A 4OQ1A 3RRQA 2J7LA 4K2UL 4JY6A 5HHQA 3MR9B 1UCBL 3FMGL 1F4WH 4OZFG 4AT6A 3LKSA 4AEIL 3QIWA 2VR9A 5ICYA 3QXUA 3NA4A 3FOLB 3QNYB 5GS0L 3W39A 5HPMB 5I1CH 1IEAB 1P4LB 4M3JA 4HDIA 5F8QC 1KB9K 3RU8L 3ILQC 1F3JA 3AM8C 5D6CB 5L88H 1HH9A 3T0VA 4UQ2B 4LNRB 2X70A 5CP7B 3Q6GH 5DJZB 5FYKH 1HHGA 3SO3C 3K2UH 5IESL 3TH4T 1UKQA 3GGWB 3KVQA 4JREB 3VGHA 3NZHH 2R1WB 4WI2A 1KXTB 25C8H 4LGPB 3IGAB 2HT4D 3JV4B 4UI2A 1JNNL 4B7LA 3QFJB 1KCSH 4OFVA 1U95A 3LEVH 3I6GA 3CFKB 4OJFL 4M7ZB 5C0CA 1T21A 4WDIA 5ALBL 5I17A 3IJYA 5BS0A 3NA9L 3FT4A 2I9LA 5C08D 1FFQA 3V6OC 3MLXH 5JQHC 3PP4L 3QUZC 3IFPA 4NO2B 5E8OA 4Q9CA 2AI0H 5DWUH 3OKOA 3KPPA 4M6NH 3ZE1E 4OCRL 3VMPA 1T83A 1YPZB 5CCKH 5HJ3B 4EVNB 1IAKA 1MRFH 4MD0A 1ZK9A 4MJID 2OL3A 4ETQA 4YPGA 1BFVH 1WZMA 4BQ6A 5EWIL 3V6OA 3FRUB 1EVUA 4F7CB 3FB8A 3MYJB 5T5NF 2BXZA 3G04A 5GGSA 2VABB 4WFHD 3S5LB 3DSFH 4MJIB 5GGUA 1ZHBA 3LRGA 4RMRA 3OGOE 5AYUL 2QKIB 2VJXA 3VXSE 3VA6A 1CFQB 4R4ND 4N8CL 3G08B 4PJIE 1PKQB 3ARBA 5TH2B 1J1OH 3T77B 5KTEL 4OLEA 5TE6L 2XRAL 4P2QA 4EBQL 4LOUC 3LDBC 4KAQL 2D7NA 4LHUA 5DJXB 1H8NA 4G6ML 5I6XB 4JFXB 1HXMB 2NQCA 2I24N 1GGCL 4ELME 3LHPH 3N1MC 4GQ9H 5T3XH 4OLYH 4NQSB 2H26B 3A6OA 2AW2A 5BZDB 3EGSA 1VGKB 3DMMA 3DUUB 4MDIB 3MMEB 3MA7B 1BF8A 1Y18A 4X4XB 4C4KT 1F4HA 1W72B 4OIIH 5DHVB 5F70A 3X17A 5TE7H 2GJ6E 2R0LL 1I3GH 3BZFA 5AZ2H 1F2QA 2R1XB 5TE4L 1A3RH 4NSKA 1IKNA 4YHIA 5IBLC 1IQWH 1AO7D 2VDQL 4ZSOB 1BWMA 1R24A 4Z8FL 4ODTL 5E70A 4MNHA 2XZAL 4QHLA 1BJ8A 5C08A 1R3KA 1T66C 1AFVL 2BOCB 1U3ZA 3FO2B 3G6JE 3KYKH 2FIKB 1YMMD 3GB7B 4K9EL 4WHTB 4YIQA 4N1HB 5ACMA 1BX2B 3P4OA 4RQQA 3PV6B 4XMPL 1U95B 3RL1A 3O3DB 4WO4D 2J12B 2OTUA 2ARWA