5L88H

Afamin antibody fragment, n14 fab, l1- glycosilated, crystal form i, non-parsimonious model
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
217
Chain Sequence
EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPGSATNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-afamin antibody N14, Fab fragment, heavy chain
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 217
sequence length 219
ec nomenclature
pdb deposition date 2016-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l88H02
4IRJA 1MCHA 1CI5A 2BMKA 1TJHH 4YX2L 4R90H 2ICEA 2A9ML 2N7AA 1JIBA 3WFEL 3B9DA 4QO1A 4KI1A 3VXQA 2D7QA 1U8NA 1LQSR 4HXAH 5CILL 5GSVB 1KC5H 2X5PA 2FATH 3I50L 4A6YB 3EGSA 3WO4B 1WCQA 5DJ6B 1LK3L 2PO6C 5I1AB 2VDPH 4ZQKB 5EIIA 2J8HA 1U95A 3FRUA 4MXWL 3W9DB 5IBTH 5ESAA 3EDFA 1E6JL 5EO1B 5CJXA 5I9QB 4E5XA 4XMKH 5F9JA 1OGTB 3BIKB 3QIBB 1HYSC 5IK3A 5BW7A 2QKIB 1A1OA 5L88L 2EKSB 3BYTA 3V4PH 1G0DA 4PRHB 2B1AL 4KK9C 2UVEA 4EVNB 1A9BA 3E1F1 4GRLD 3KJ4B 1DUYB 4J4PA 5CGMA 4N0UA 2DQDL 3VW3L 3U1SH 2I5YL 1YMHA 3DJ9A 3L5WA 3R06B 1CXKA 3K46A 5CIPB 1OY3B 5D2NA 2EE9A 4KMTH 3PGDB 4ENED 2CK0L 1U8OA 3MLZH 4Z9KB 2BSRA 4NZTL 3BHBB 1MHEB 1DVFA 5JIIA 2GUOB 3P9MA 5D7IF 3PUCA 4LQFH 5LWYL 2OK0H 5HI3C 1RJZA 1IKFL 4WFGE 1LE5B 5D7SH 5SX5K 1GOHA 4KC3B 5I18H 2IG2L 2HWZL 2H6PA 3MV8D 1NKOA 2WZPD 4L4TD 1FNSH 1LMKA 5GGRA 3QUYC 3EFFB 3J7HA 4PRIA 1A6VL 4M7KL 1WFNA 4QRPA 3RY6A 1SM3H 1XF2B 1R3JA 1YY8B 2OI9C 4HV8A 4Z0BH 4FQJL 4WGVB 5C7XH 1G9ML 2V9RA 4Y19A 5DMYA 5DEFB 3X17A 2YN3A 1WK0A 4ONGH 1FIGH 2FWOB 5DJ8A 4F80A 1T66D 3GBLA 1A7OH 4PJHE 2DQGL 4P2QA 4DEPB 1ZLUH 3LMJL 3T4YB 3SE9L 1LP9A 4P2OB 4C56A 1QVOA 4YZFE 2XXMB 4LGRB 4ZFZB 1H0DB 5I8OL 1J8HB 4YUEL 4KRPB 5J06A 4V1DE 2A6KA 2XYCA 3W5MA 1CWVA 2UVFA 2APBA 4BH7A 3DNKA 3TFKD 1SMOA 3GNML 1MY5A 3MOAH 5AAMA 1OLZA 4E41D 4N1HB 1DEEA 4YQXH 2HJKB 1P4BH 4NKMB 2GSIB 4X6CE 4WFHD 3ULUD 1V7NL 1C16B 3BZFB 1SHMA 4WFEE 2MPAL 5B38A 3L7FA 3WLWC 43CAA 1JZ4A 2HYMA 2Y06H 4X83A 4PJHF 1NBVL 2BNQA 5GGQH 4TTDD 3WHE0 4GW1B 3BE1L 2IALB 2P1YA 3UDWA 2Y6SD 3LQAL 5KOVC 1JF1A 3IB4A 5SWSE 1OSPL 3N85L 3RGHA 4NT6A 2DQJL 3PWNB 4M6ML 4JRXB 3WNLA 3BUTA 1IBGH 4K23H 3VD7A 5I1LB 1F4WL 3FFCA 2F19L 2ILLA 1BOYA 4ZXBA 2VL5B 4B7IA 3TH2T 3DBXA 4X6CF 4Z8FL 1K8DB 3L3OB 5DK2B 3EOAA 1JHLL 2FECL 1ADQH 4IHOA 4HF5H 2I9TB 2JJSC 5GRUH 5JPMB 3TYGL 3D25B 3KLAA 3HCVB 4KQ3L 2H2PC 1JN6A 1FNLA 3WJJA 4OLVH 4QHKJ 2NY7H 3DUSB 1NJ9B 3MJ8A 4ZUSB 4Y5VC 2YA1A 2VDLH 5AG9A 3RHWF 5HHPA 4OLXL 4P59L 5C09B 2E7CA 4Z7NE 3TZVA 3HNTL 3RWCA 2IQ9L 3BGFB 3WKMH 4XBPB 2FBOJ 4GSDL 5CD3A 2EXWC 1E28B 3U4EB 1FNEB 3EOTL 1I85A 4Y4FD 1K4CB 3MBXH 3SE3A 1XGYL 3MV8E 4AG4L 2IMNA 3AS0A 4D0DA 2BOCA 4JKMA 3BJ91 4LVOC 3L5JA 3MBEA 4ODXB 3SDAA 3GO1H 2IH1B 3SDDA 5DUML 4C54A 3ARBA 3JBG7 3VXOA 4W68A 5A2LH 1A4JA 3HNSL 3V95A 4EEEA 5LQBL 3GM0A 1OSZA 1HI6B 4ELMA 4WWKB 1D5BB 1EVTC 1W8OA 5F88B 5IHBA 3QO1B 4PGBB 1U92B 4TNVF 3P3YA 3LKOB 5J3HC 3WEXA 5HHNA 3V5KB 2EYTB 3MX0A 3QQ4A 4YAQA 4EQ3A 1DBKH 1BM3H 2HH0H 3FTGB 3I75A 4LKXB 3VXRA 1KTDA 4WHTB 1UA6L 1MPAH 4O5LL 4J12A 5LAXB 4MXVE 4XPHL 3KPQA 2Z31A 1S78C 3TO4D 1FJ1A 5C0JA 1IEAB 4C4KT 1S7VA 3MGAA 3SPVA 5INDA 4J8RA 1FYTB 5JIPA 1KJ2L 3S6CA 4WTXA 4KTEL 2J8OA 5FECA 1S7RA 4FQIH 4X7TA 2XWBA 1RZFL 2VZ3A 2FO1A 3JUZA 3M07A 3AXLB 3SDXB 4KVNH 3NN8A 4G9DB 3BXNB 4E41E 1CFNA 4OCRH 1QFWH 4XCYA 3RU8H 1I1CA 1KCUL 2FJFB 4HPYL 4W70A 5E94B 2I26N 3MCG1 5J6GB 4W6WB 5T3XD 4WFHE 3ULUE 1BGXH 2RCSH 3BKML 4YHNA 1AP2A 2DJSA 3HPLB 4BH8B 1A6WL 4OAWA 5HVGB 2AXFB 1LHZA 1WIOA 1VCAA 1R6VA 4NO0A 3LS4H 1EV2E 3TVMB 5IR1A 3PWLB 5E8NB 2DLFH 2ICCA 4HJ0D 1GGUA 5DR5H 3L1OL 5D71H 4P23C 5E7BA 2VH5H 1I7TB 1KCKA 4QTHA 1CICB 1JWMB 4PJ5D 1VGEL 2M1KA 3KNBA 4N0FA 4F58L 2GJZA 3TESA 2OTWA 1HHIB 1GSMA 3I6GA 2Z91B 4PTUB 4LHUA 3L3GA 1II4E 3H9ZA 3VFTB 2YPVL 4J6RH 4R8WH 3QRFM 2XTLA 1XCTA 4YX2H 1MI5B 4X5XB 3RL2B 2A9MH 3ULUF 2IBBA 2A74B 4K3DL 4XP4L 3VH8B 1WWWX 5K9KA 5D1XB 4OZ4B 5CILH 3P73A 1SJEA 4HULB 4RGMB 3QUXC 3F58L 3O11A 1TQCC 1LK3H 1XR8B 2X89A 1WBZA 3DX6A 1KG0B 2WLZA 4KH2A 5EBWA 1IGIL 4L5FL 2XOTA 4MXWH 5FOBB 1WZMA 3O6FA 1S8DB 4N0UE 3U4BL 3ROLB 1HN1A 4NKDA 3DETD 2WQ8A 3O3EA 4YO0B 1E6JH 2HG5A 1NGZB 3IYLW 2ED8A 3VE0A 3MV11 3P0VL 4OCNC 1MCNA 2BNRE 2MMXA 5L88H 1H8SA 2XG4A 1M7IB 4M61B 2B20A 4CAGA 4MVBD 3RP1A 1ZK9A 1JNHB 1OAQL 2B1AH 2V5MA 2HTKC 3ES6A 2AK1L 4U6XA 5IEKB 4JHWH 4OKVB 5FHAL 2HFEB 1IQWL 2DQDH 2DYPB 1IC7H 2ATPB 3VW3H 4JGUA 2XN9B 2I5YH 1MCIA 4CU7A 1QSEA 3C9NA 4HX1B 1IAKA 3BKJL 3QXDB 3REWA 2CK0H 1CVRA 4NZTH 5IB2A 5L2JB 1IAIM 4XPBL 3RL1B 1M05B 5LJYH 5IROA 4KI5E 2A1WL 4O9HH 1QO3A 3QIBD 3RVUC 2VQ1B 2J88H 3MCKA 5HPOA 3O4OB 4ONFL 1HINL 2IG2H 2PN5A 3SQBA 1M6OB 4QT5B 4F7MB 3MRHA 4PRHD 2DOCA 1T21A 3RBSA 2BRRL 4FMKA 3O2WL 4K71B 1UB6A 5INCB 1YUHB 4JN2A 1LP9E 3HZMA 1HHHB 4C56E 5HYSB 1G9NC 5TE7L 5DD3L 4M7KH 3O41B 4RFNB 3MJGX 4CW1A 1Q9KA 1RIVL 4QXTB 2Q6WA 4UBDD 4FQJH 1QOKA 5CD5C 3MNVB 1JGDA 1G9MH 3DTXA 5T3XE 4PJEE 4XVJH 3OV6A 1ZT1B 3SGKC 2EH7L 2NY0C 5HVFB 1FO0A 2V2XB 4M5YL 3G5ZB 2DQGH 4KI5F 5IKCB 3LMJH 1FPTH 2DF3A 1F6FB 4JFQB 3SE9H 1UT9A 2A6IA 5ILTL 3ARFC 1H8OA 1P6AB 3RDTB 2DQTL 3L3IA 4CN6A 3U6RA 1A2YA 2HJLB 5I8OH 4PJ8A 4YUEH 5MEOA 4DVBA 1QYGL 3A67L 2CR6A 2R1YA 3DX9A 1W72B 2X41A 4HWZB 2A0LD 4WWID 1BVKA 5ACZB 3OKMA 2FL5B 3SGEH 2WBWB 1V7NH 3F12B 2QQLL 1QSVA 3DUUB 4PJEF 1S5IL 2MPAH 5ICZA 4JRYB 1XF1A 3T2OA 2ITDB 4P2OD 3MRQB 4B5EA 3FB8A 1NBVH 2H2SD 3PWJB 2OL3L 4Q9RL 2X4UA 1VESA 3BE1H 1GGTA 3CX2A 1Z9LA 1J8HD 3IFLL 3MR9A 4KRPD 4DKEL 4PLJC 3LQAH 3OKEA 1HQ4B 2XA8L 5HHXL 1OSPH 1XGUA 1A7BA 1L6XA 2ORBL 1R3KB 4LBEB 4M4PA 2DQJH 5DMGD 1FFPA 2P42B 5HDQL 3WO3B 4OUOA 1TZGH 5EU7C 1Q9OA 2W07A 2W0KA 1U8IA 2F19H 5TDOB 1QSFA 1FDLH 5KN5A 2CLZB 5FA4A 3O45A 4PIRF 1AD0B 1JHLH 4BQCA 1EEUA 1F90L 4LLAA 4WV1C 4I9WD 3RA7L 5LKNA 3FFDA 2A73A 1XGTA 5E6YA 3TYGH 1LNUA 4LGPB 2KZWA 2Q8BL 3GMLA 4KQ3H 2P49B 1KPVB 3KXFB 4IOIA 4OGAC 5IQ7L 4XXCA 3GSQB 3SE4A 1QQDB 4DVRL 1OCWH 3BP4B 2DLGA 5IW1B 4OLXH 4P59H 4PRAA 4JRXD 1T3FA 3I3EA 3HNTH 1I8IB 1I3GL 4EN3B 3RPIA 3VXTB 4GSDH 2NTFA 3EOTH 5EUOB 3T3PF 1IGTA 1NLDL 3F5WB 1XGYH 2JB6B 1AGDB 2A6DA 4PRHE 4WW2A 5F9WC 3MRRA 3MFFA 4U6YA 3FQUA 2J5LB 2NY5H 5DJ0A 1X5YA 4PRDA 2FH8A 1P4LA 4JG1H 3HNSH 5LQBH 4M1GL 1U36A 4X0KA 3ZKSD 1HK6A 5I2IA 3EO0A 1KXVC 1BMGA 3TJHC 3ILPA 2R0LL 3LN9A 2GTWA 3QFJB 1NLBH 3ZSSA 5J1AB 4ZOCA 4FS0A 1F5WA 1BBJA 2PYEA 5C09D 5IFJA 2YD5A 1ZHNB 4LSUL 1H3WM 2RFXB 3S4SG 4D0BA 2EDJA 4HZLB 1FLTX 3V9FA 3SO3C 4O5LH 4QY8B 3C09B 1A1MB 4NNXA 3VXUB 1R5VA 4XPHH 5EC1A 4Q9BA 3WD5L 5I6XC 1UCBL 3GSUA 2KQNA 3H3BC 4QWWC 4MJID 4XP1L 3T4AA 3TN0B 4U1KA 2DQFA 1GXEA 3J8F7 3LH2L 1KCVL 1FZMB 5FYKE 5D1QA 5EZJB 4KTEH 4P5TA 3O2DL 5BO1L 4WWKD 2ZZUT 2CIKA 3NOIA 5BS0A 4Y16C 3BAEL 1ZLVH 1N2RB 1QLRA 3CC5A 1KCUH 4HPYH 2BSSB 1JPFB 2E9JA 2PTTB 4X6BB 5GXBB 4XNMA 4L9LC 4LRNL 5ESVB 4AZ8A 2AQ2A 4CVUA 1A6WH 4KJQC 5CEXB 5L8LB 2FX9L 2GQHA 4E42B 1Q38A 1UENA 1T7WA 3HG1A 4GLRH 4X4XA 2F74B 3L95A 3L1OH 1PKOA 1FYTD 1CXIA 3ZDXE 3BH9A 2EECA 4LCCC 3OWEA 5FO9A 4M02A 2DL9A 2WIMA 2X4OB 2GI7A 3WCYA 4F58H 2FEDD 1BJ1J 1DBBL 1H5BC 2R1XB 4UQ2A 1MWAL 4P2RB 2Q8AL 1V8HA 2XI9A 5MEQB 3NFNA 3WNKA 4P3CL 3VXSB 3OKYA 1X4XA 1P84J 3BWUC 2KKQA 4K3DH 4PLNC 4Y88A 5DD1L 4O51A 2V6HA 4U1SA 1BQSA 3L3JB 1WWBX 1XF4A 1YC7A 1AC0A 3C60B 3TVMD 1OD9A 3BIAX 4I5BB 1HCFX 5D72L 4LHQB 4DUXA 2YMXH 3G6DL 3Q5OA 2DLEA 3JV0A 4Y1AA 3O3BA 1G9NL 3BDXA 4IMKC 4HEME 4ZO9A 3BO8A 1CICD 1IGIH 4L5FH 3ZDXF 4HQQL 3MLTA 1VERA 1VADA 5F7WC 4EDXB 4RMUA 2C1OA 4EI5D 4GAGH 4WUUB 1FHGA 3IDIB 4WI5A 1G6VK 4OFIA 4HKXA 5CMAB 3P0VH 4ZO7A 1MI5D 3DUHA 3L6FA 4NKOB 1ZGLB 2Y9RT 4AYFA 3WL9B 1RAMA 4X7CC 1OAQH 4HWBA 4M1CC 2AK1H 5D1XD 2X4SA 1QLFA 1KN4L 1P53A 5FHAH 2BY0A 4OI8A 1IQWH 3MJ9L 5CP7A 3WIHH 1QFUL 4LCIL 1NAMB 1I8MA 4U1NB 4Y4KC 4KJYA 1ZEAL 3FT2A 4ERSL 2QQQA 5C09E 1NGXA 3PGFL 5C08B 4X6DB 4WDIB 1MCDA 4K94L 4MJ4A 5DUBB 2A1WH 4F7EB 4BFEA 1M4KA 2X7LA 5T1MA 1HINH 4NKQB 4LLUB 4P57B 3U48A 3MRPB 3K0WA 3VRJA 4ZNEE 4WHYH 1K8IA 2CO7B 1E27A 2DWDA 2VZVA 4NM4H 2BRRH 2UUDH 3O2WH 1PQZB 3QXTA 1NGPL 1KPRA 5CS7A 1AXSA 2DYPD 4WHYG 2XN9D 5TE7H 5DD3H 2P8LA 4Y5YA 1RIVH 4WO4A 3MA7B 3DX7B 1PYWB 5JPNA 5FF6A 3OKKB 3ALWA 2KQMA 2ZKHH 2WWMC 3I2CL 4PR5B 2EH7H 4M5YH 1EFXB 4WIQA 4KGJA 4QHMA 3VA2C 2GJJA 2LVCA 5ILTH 3MRJB 5EZOL 4AENB 3VFNB 2DQTH 1FYTE 2OP4H 1ZGLM 1F3RB 1UWEL 4JPKL 1CBVH 5BMFL 2W0FA 2GY5A 1QYGH 1FNGB 1KCRL 1IM9B 1IAMA 2WWKT 1AD9A 4PGDB 3LSOA 3RWDB 2NX5B 2WP3T 4LPXA 5HD8D 3RZWA 4H8WH 5DRWB 3MO1B 4G42A 4NQEA 2HT2D 2V7NB 1DDHB 5CEZD 4GAFB 2MKWA 3PGCB 1KCLA 4OV5B 1OGAA 5GRVK 4CVWA 5IMMA 3RFZC 1S5IH 3EJJX 4ZTPL 1CTOA 4YHIA 3QI9A 3DX8A 4Z0XB 3O6ML 3RDTD 3KPSA 4H25B 2OL3H 3IDNA 2BFVL 3ULSA 2X4QA 1FGVH 4GRLC 1RJYA 3KJ6H 4DKEH 2I07B 1OPGL 5D96B 2XA8H 3UTZA 5BVJA 5HHXH 4FP8H 1I9EA 4QHNA 2ORBH 4O2CA 4KZDL 3GSNB 2FO4B 2E8YA 1U8JB 1EHNA 2VAAB 3CH1A 5ESQA 2A6JA 5BQ7A 1MI5E 1XCQA 3MJ7A 2MQ0A 3IAGC 5I75B 3OGOE 4JRYD 4P3DB 4GUPB 1FV1B 1TZIA 1BD2A 1RHFA 4LVNB 4U1MB 3R4DA 4DZ8B 3LN4A 5GZND 1DBML 3REVB 5I1EL 1F90H 4JY6A 3U30B 2PCPA 5IFAL 2X70A 3RA7H 3KYMB 1JP5A 1ZT4B 3VWJB 3DXAD 4BSWA 3MRDB 1UZ6E 4OFDA 5FYLL 2D2OA 5ICXA 5IQ7H 3DMMA 1YY9D 1BBDL 4RBPH 5HI5D 4GMSL 4DVRH 1WJ3A 3MRKB 2BXZA 4X6EA 2BY2A 3HE7A 1EVUA 4L8SC 4QRUA 1I3GH 5I1JH 3OB0H 4E5XB 5F9JB 1A3RH 1PX3A 4ZG1A 2XKNB 3IDJB 1I9JH 1NLDH 4FQHA 1S9XA 1ZGLP 1ORQA 4JFDD 4NCDA 1T66C 1XEDA 5HGDA 4NM8L 1F6AA 4K7PL 4Y5XA 1A9BB 3S88H 3CVIL 3ECBB 1YYML 2XTJB 2Y4SA 3W0WB 4LCWB 3X11A 1HQRB 4Z7QE 1TQBB 4M1GH 3ARXA 4CUCA 3NVQA 2D31A 5I71B 1UZ6F 1FORL 2H3NA 2R0LH 4NNPL 3P9MB 4LSUH 4OB5L 3AGVA 1F4XL 1IC4L 1UEYA 5BS0E 1IGCL 4EN3D 3AM8C 1JYVA 1YEGL 5JDSB 4N90D 5C07E 2AKRA 4X99B 3WD5H 2J4WH 5DJXB 1RZ7L 2NLJA 3QPQD 4P5MB 4XP1H 3R8BB 3UPRA 1RK0A 3QWQB 2PR4L 4WI3A 1NCAL 2JLLA 35C8L 2DLTA 3LH2H 1KCVH 5GGSY 4PV9B 1G6RH 3F8UB 4TTDC 1BVLA 3LEVL 3O2DH 1ITCA 4PRIB 1IEHA 5BO1H 4CRPA 3OKDA 2Y6SC 3TT1L 1CZ8H 4ODVL 5HHQA 5EC2A 2YWZA 3BAEH 4Z7QF 2CRYA 1QG3A 5ECJE 3QFJD 4WEMB 5A43C 1KIRB 3ARGA 5CEZE 5J6HB 4MDIA 4U0QB 1A4KB 2R15A 4GBXA 5C0DB 1U8MA 5HYQB 3WN5C 4ODUA 5B21A 3VXUD 3NCCB 2FX9H 1T22A 5DHYA 5EPMA 1I7ZB 3MFGB 3JTTA 3BFOA 3TN0D 4NC2B 5SX4H 3QDGA 5D5MA 3ZE0E 2RIKA 4IRSB 1VGKB 4WFFE 4AJ0A 1CGSL 1MLCB 2X4RA 4GRMA 1IKNC 1XFPA 2Q8AH 1DQLH 4KROB 3CUPB 3GSRB 2I27N 3U7YL 1DEEB 3D0LB 4ZUVB 4P3CH 3HZVA 1QNZH 3F6IA 5I0DA 1OAZL 5A3ID 3S3SA 4S2SB 5KAQG 4Y4FC 4LSDA 1AQDA 3MLPA 3TIEB 1QACA 3DV6B 3B4NA 1BQLL 5JXEC 1N5AB 5GS2D 1KXTB 1FFQA 1G9NH 3EYQC 2B5IC 3ARZA 1LEIA 2GK0A 1JF1B 1A1NB 2UWEB 3QCVL 4X5LA 4NIKB 3B6SB 4HQQH 4YDVB 2GIYA 2P8PB 3ZE0F 3RWIA 1XZ0A 4NHUA 2IPTH 2QHRL 3MV7B 4F2MA 4JE4B 3DV4A 3EHBC 2LAAA 2OJZL 3VXSD 32C2A 3SGEI 2I9LA 3AREB 2P47B 2DIBA 2VDRL 1F3DJ 3C60D 5A16B 2XWJB 4WNQB 1XIWB 3TO4C 1FAIL 4GW5A 5DHVH 1KN4H 3GGWB 1V3LA 1J87A 1KLFA 5IEHA 2UYLB 1QFUH 4LCIH 4YDIL 5C0CA 5LGHL 3RWHB 3MGTB 3KXFE 1JN6B 2GITB 3QWRA 4QKXB 4BZYA 3IJSA 1ZEAH 1TJGH 4NO3B 4QOKA 4PB9L 5E24E 1AXIB 4ERSH 3WNPA 3CDCA 4JO2H 3PGFH 4WUUD 4K94H 5CZXD 3MRFB 2K7PA 3RWCB 1CU4L 4OZFB 5E1AA 3RVVD 2NW2A 5EUOE 3DGGB 4N90E 5I76A 5EU3A 3KHOA 3UTQB 4LP4A 3FO2A 1XAUA 5L7XL 5L2KA 5GZOD 4BZ1L 3QQNA 5GPRA 4XWGL 3FQXB 4BFIA 3DI2B 3NCMA 3RGVB 1MAMH 3VG9C 2GAZA 2FECI 2EDXA 1U0QA 5FIEA 4H88H 4FZEL 5T5FL 2R0ZH 2WBKA 1NGPH 4LLMB 4HJ0C 1JFQL 2Y07H 2ED7A 1OSZB 3HC0B 1KGCE 1P9MC 4AIOA 3VFPB 3FZUD 2BC4A 5C08D 4ZUUB 2QADC 2BX5A 3O2VH 2VLKA 4JLRB 3OF6D 5DJCB 4JDVA 3ULVC 4U2ZA 3I75B 4FXGB 1KTDB 3VXUE 5DJAB 2FEEL 3O8XB 4JREB 4NQEE 1FRGL 5EUOF 5EZOH 1JPST 2VXVL 3VFWA 5C0JB 5FM5M 3L3KB 5E70A 4XCEB 3GJEA 1UWEH 3GIZL 5KSAB 1WZ1L 2AJYH 1AGEB 2EH8L 5BMFH 1A6PA 1KCRH 4H1LB 1OAKH 1OTUD 3ILQD 2WNGA 1FL5B 5HXMA 5FDWB 4ZPTB 5FOJA 3CPLA 1H8NA 1BAFL 1RULH 4TNWF 2LTQC 4WHDA 1CXFA 3QPXH 4YIQB 3O6KL 1EFXD 4ZTPH 1AGFB 4HS6A 4HFWB 4NO0B 1CFQB 3O6MH 3TCLA 5FO8B 4MVBC 2WIIA 1ZHBA 1BD2E 3G04A 5MI0C 3OXSB 1OPGH 1SJHA 2VKXA 3OAZH 1VFBB 3QEQA 4MAYC 1QKZL 3C6LB 1IM9D 5FYKU 1TVBB 2OTWB 4KZDH 2GY7B 5FV2A 4P2RE 2NX5D 4LSVL 3LS5L 1U3HB 3L3GB 3W5NA 3HLAB 3UJIL 5FUZL 1WV7T 3LB6C 1UWXH 5I9QC 2VE6A 2CDGA 3PV7A 4LLVA 5HGBB 4UNVA 3UJTL 5KG9B 4ZSOA 4TVSa 3ULUL 5C3TA 4LNRA 1IGML 1C1EH 1DBMH 3ZKXB 1OF2B 5I1EH 3LQMA 4QYOA 1ZTXL 1JI2A 3T3ME 1RZ8A 3CFJA 3P73B 4GLRI 1X5HA 4U0RB 4NDMA 5TE4L 5C8JB 4M3JA 4R3SB 4DOHB 3KJ4C 4FTVB 5FYLH 4OZGA 4IM8A 1CXLA 2OXHA 4P4KA 1O0VA 4MDJA 4NKDB 4NNYB 4AIZA 2QTEA 4UQ3B 5F1KC 2HG5B 5FCSH 4OZIA 2BVQB 1V3KA 2W0LA 3FB6B 1CK0L 4NJ9L 5JXAL 2HRPH 3RPKA 1AGCB 3G6JB 3GIVB 3LKPB 5E2VL 4JFHE 4C83B 4NM8H 3TA3B 2R39A 4K7PH 1WT5C 4KKCD 1E4WL 5DUPL 2JCCB 3CVIH 1KIQA 1RU9L 1NH6A 1JMXA 5EOTB 3VWJD 4U1IA 2JF1A 1ND0A 3UEZA 2DI9A 4XZUA 3MUHL 1N6QL 1RUKL 3PHQB 4UV7H 2YPLB 4OCXL 4HKZA 1MREL 5D9SA 3SKJH 1FORH 5BV7B 2RAMA 3KPMB 3ME0A 2VLRB 4R6UA 4NNPH 4X6DE 1GGCL 3UBXB 1BQHG 3TWCL 5ITBL 4ZFGH 2X6MA 3WYRA 1T5WA 1KOAA 2A0LC 3WXVL 4OD3H 2R1WB 3OB8A 4EUPB 3AB0B 4U1HA 3MCLL 2VO5A 1CDGA 1RZ7H 2OZ4H 5EU4A 1IM3A 1YMMA 3MRHB 2YK1L 2PR4H 3QUML 1NCAH 3G5YA 5GGSA 2H2SC 4RAVA 4X4ME 5E2UL 5EO0A 5C6TL 2XTJD 3W0WD 1MELA 4LCWD 2XPGA 3LEVH 4JR9L 3BVNB 2FZ3B 2AEWA 4KRPC 3TT1H 4HG4K 4KQ4L 3BEVA 4TULL 2E5EA 1ZANL 1NBZB 5B39G 3LN5A 1BZ9A 3GMOA 1CGYA 5E2TH 3GK8L 1FO0B 4X6DF 1DTUA 2JIXA 3HI5L 4RA3A 5DJZA 1R3HB 2BVPA 5BRZB 3DVGB 3T1FB 1K6QH 2VERN 5FO7A 2BK8A 3EUUA 2H26B 5J0BA 1IAOB 4PJ8B 5I1HH 2MKLC 2APVA 4MA8H 4PRID 1HOCA 5B8CB 2ZUUA 6CGTA 2YD1A 4QRPD 4K07A 1CGSH 3LRSA 8FABA 4DK6A 3JV6B 4J3WA 5JQHC 3AY4C 4Y19D 1KV3A 5GS1B 3MRIA 1PG7X 3IFPA 1OAZH 4QRQA 5T3XL 5EZLB 4KHXH 3DIFA 3GJFB 5L9DH 4YEEA 1U3YA 4RIRB 5I16A 4RWYL 3CDGB 1WQVT 5EU5B 4J3XA 4Z7WB 2D7TL 1BQLH 5DI8B 1MCBA 4MWFA 5GGUA 1ONQB 4CJ0A 3ALXA 4ODHL 3DRTB 1F02I 3QCVH 4IRSD 5E9DB 4IJ3B 3BW9A 1WAAA 5C0CE 4KKBD 2ZUVA 1S7UB 4G80B 1QBML 1QRNA 3B5HA 1M1SA 2ZPKL 4KROD 4NOFA 3T2NL 4B0MM 1Q9OB 1DQJA 4HKJB 4HLZH 3SE8L 5HYJA 4OF7A 3CD4A 5HGHB 2OJZH 4Q58C 5CINH 3QEHB 1U8KB 4PRPA 4XNXL 4NQSA 5AYQA 2EDLA 2VDRH 4HLZG 1EGJL 2R23A 1CFTB 5AD0A 1K2DB 3OAYH 1FAIH 5I73B 2AGJL 5IOPB 2OXGA 1FCCA 5FGBC 3HZKB 3S5LG 4RMRA 4YDIH 2Q87A 3G5VB 3LKRB 3CZJA 4MD0A 1DFBH 1EUUA 4PB9H 5D6CA 4WWKC 4AEIL 1OWRM 3IT8D 4NQXA 3UAJD 3MV7D 1HNFA 1JGEA 1P5UA 1ORSB 3AVEA 4OFPA 4TPRL 4U6VH 4RFOL 1YC8A 1K4DA 3CLEL 5GRWA 2VLKE 5L7XH 4BZ1H 3CK0L 5EUKA 4TUOB 1ZS8A 5HHOB 4XWGH 5JW3L 5EBLA 3MRRB 2DIJA 5CBAB 3H9SA 4G8GB 1XIWD 4R7NB 4FZEH 1J0KA 4XNYH 3W0WE 3BP5B 4LCWE 1R5IB 4BQ6A 5KVDH 3BEWA 4XGZA 3QULA 3CX5K 2GT9B 4JO1L 3T65B 3D2UB 1HHJA 4A6YL 4RA0C 3VXPA 1AIFB 2QQKL 3X14B 4G6JH 3CFKA 4YPGA 4U1LA 1AI1L 3WNMA 4JAMA 2PYEB 2AJUL 3IDXL 3DO3A 2V2WB 1MH5B 2V7HA 1HYRC 4PREB 4FFWD 2AJXL 4PRNA 1FRGH 1Z2KA 2N4IA 3NTCL 5DRXA 1X4YA 5IT2L 3C5JA 3FN0H 1DUZA 4TOYL 3RGVD 1Q9WB 5E5MA 2FX8L 1S9YB 3GIZH 1WZ1H 3BP7A 1TCMA 1P69B 2W38A 4GAYB 1TLKA 3E0GA 5CHNB 2WUCL 1OL0A 1D9KA 4YHKL 4FQPA 1CICC 2DQCL 3A6BH 4UMGA 3QEQE 2R8SL 4P46B 4ZUWB 1H9VA 1BAFH 2OTUB 4PLKD 1AY1L 4I13B 5IMKA 4EI5C 1C7TA 4NWUL 1BFOA 4HUXB 3O8XD 2E7HA 2J8UA 4JFYA 5ALBL 2Z31D 5DSCA 4MNHB 1CT8A 5H2BA 3KS0H 1RUML 1Z3GL 2WLYA 3VFOB 2DBLL 5KSAD 2QR0A 5C70A 1NMAL 5MENA 1MFEL 1N4XL 3TBYA 1EBPA 1ZWIA 4NRXA 4U6HB 4XH2B 4UQ2B 5F1IB 3PHSA 1JNNL 3LS5H 1Q94A 3AU1A 5IB1B 3UJIH 5FUZH 4NQDB 1AR2A 5ENWB 4BYHA 3K8LA 5I8CA 1KULA 3UJTH 3ULUH 1EZVY 4JZJA 4MXQD 1WBYB 4U1SB 3VXMB 1AH1A 4NO0D 5DQDL 1OLLA 1D6VL 4ZAKB 3UZVB 3N1GC 4XCFL 3RWJA 1UVQA 4G9FB 3VI3E 5SX4I 3ZMRA 2VDQL 5TE4H 1LK2A 4BQBA 2UWEE 4Q6IC 4OCWL 4TVPD 3BUYB 3C6LD 3EO9L 5D93C 1VADB 1U2CA 1FN4A 1QEWA 3NCFB 2V5SA 3ARTA 3CLFL 3MXWL 1YEHL 1UZ8A 1U3HD 2PXYA 1CFBA 1A14L 5ABDE 4UINH 1CK0H 4NJ9H 5JXAH 3IDYB 2Z4QB 4GKNA 5J89A 2G5RA 4LPYA 2GJ6B 3A6CL 4HH9B 4N9GA 4XBEL 1OB1A 3KPNB 3O4OC 3PV6A 3V4UL 2PO6B 1E4WH 2EDHA 5DUPH 8CGTA 3MROA 3BSZL 1RU9H 4B50A 4Q74A 5I66B 4H5SB 2IANA 1FBIH 3E8UL 4FTVD 2FCBA 3VI3F 3BD5A 1N6QH 1RUKH 4UNTA 4KAQL 4OCXH 1MREH 2UWEF 1U8PA 4OTXH 4RFNC 2JK5A 1GGCH 5ITBH 4I18C 1BFSA 2Q76A 3GM8A 3AFLA 1MHPH 1YNTB 5HD8C 3WXVH 3T0DA 1KTRL 2E9IA 4DGYL 2HT2C 1CXHA 3TH4T 5JOPD 3MYJB 4LLDA 5TQ0L 4OFVA 3ARQA 3MCLH 1TTFA 2YBRB 3TA3D 5LGKA 1RZIA 2H9GB 3QUMH 4IDJH 4CMMA 3BRDA 4MMZC 1CD9B 4HUUB 1F4HA 5E2UH 4HMDA 3RDTC 5C6TH 1NDMB 2OR9L 1KT2A 5EOQH 5EULV 5JHDB 1RHHB 4JR9H 5K9JL 1U8QA 4BSVA 2APTA 2EEBA 4QRRA 4KQ4H 2YPLD 4TULH 4W4OC 1ZANH 4XPFL 4WO4B 2D03L 3SY0B 3ZKQD 1YYLL 2VLRD 2B4CC 3GBNL 1JYNA 4NRZB 3RIAF 5HYFA 4I3GA 2C4XA 2D7OA 3IETB 3SCMA 1J0ZA 2CLRA 1TCRB 2GFBA 2Z92A 3TPUB 3HI5H 1N26A 3IKCB 4ZUTA 4YR6A 1A9EB 3MRCB 3QUYB 5D6DC 4XP6L 5SX5H 1LE9B 3RNQA 4LSSL 2DQIL 5GZNC 3GBML 3P30L 4R0LA 2E27H 2OI9B 2VRAA 5KSBA 4RAUB 4FXKB 2ESVA 4HBQA 2NW3A 3DURA 1T03L 3MUGB 3PL6B 5HI5C 2E6QA 5TDNA 2Y36L 1G7QB 1FL3A 5AYUL 4O02L 2AK4B 4LF3A 4Z7UA 2ZUWA 5T3XH 3OR7A 3KWWA 3MLYL 1CGXA 2G5BB 5CZVL 4RWYH 4GAJL 5BRZD 4YBQC 5IMOB 2D7TH 1S7WA 4LVEA 4PJ8D 1I3RA 3IU3B 3RVXD 2X1XR 4ODHH 2H32A 1B0RA 2X2YA 3TC9A 2F53A 4TSAL 5LBSL 4R96A 1PKQA 3MREB 4OD2B 3BZ4A 1INDH 3NBNA 1Z9SA 4HBCL 2ZPKH 3T2NH 3H9HB 3SE8H 1A6ZB 2VABB 1N8ZB 5HBBA 1LO4L 4HIJB 2PETA 3G5XB 4QCIA 2A6JB 5BQ7B 5GRYA 4XNXH 4ZO8A 5DK0B 1I1AC 1WCBB 4XPTH 1EGJH 4KV5F 4ZS6C 5FB8A 1F42A 1MCRA 3LN4B 5EBMB 1A7RL 1MVUB 1MUJA 4TSCL 5L8JB 2Z35A 3QPQC 2PCPB 2AGJH 5E8OA 3BZEB 4DOHE 1OW0A 4M8QB 4FTVE 1J9CT 3UTTB 1EHLL 4XI5D 5E9DD 2XZCH 3BPCA 1IAIL 2R0WH 3FN3A 3VRIB 4KRLB 4OCSL 4XPAL 4QRUB 5DEZA 2JJTA 2L0DA 1QSFD 4QF1A 4TPRH 3WLBB 5KVGL 5IV2A 5TFSL 5GHWL 3S4SA 3CLEH 3QNXA 3OG4B 4PP2A 1DQMH 4L1HA 5JW3H 4I0PA 2AJ3B 5IG7A 2JCCE 2HT3C 4RMVA 3TN0C 1FFOB 1KTKE 1B0GB 1FAKT 2Q7NA 3TBSB 4RGND 1CN4A 1TVDA 5GJSL 2OMNA 1IT9L 1N6UA 2QQKH 3BKYH 3STLB 2VLRE 3NACL 2DJUA 3RX8A 3X3FH 1HHGB 3PWPA 1AI1H 4CVXA 2AJUH 1Q0XH 4W81A 1A7PL 1L6ZA 2R2EA 1KJ2A 3IDXH 4K8RL 4KJWC 3B8SA 5DJYA 3D3VB 3C87A 4S1SL 3RAJH 2D0GA 3ZDYE 3U0TB 3IJYA 1FZOA 1S9VA 3KYNA 2DS4A 3NTCH 4RCAA 3IJHB 4EQ2A 3G6JF 1T1ZA 1GGIL 5B22A 5IT2H 1LO2H 4TOYH 4G8GD 1OARL 2SEBB 3JTSA 4OZHB 2J8UE 2FX8H 3ZHDA 1T4KB 5HGAA 5K9OB 2JCCF 5I74B 1WLHA 3BI9X 4Y2DB 4Z5RA 1SEQL 1OP3H 3D2UD 2FJGA 1H15B 4Z77A 2WUCH 4BKLA 4YHKH 3QSKB 4LPTA 5HHQB 3RIFK 5MENE 4LAQH 3QAZB 5CIPH 1GZPB 1FZJA 5IQ9A 2R8SH 2PYED 1AY1H 4O58L 2NPLX 3CSYB 4DFHA 3PJSA 4NWUH 3PIQB 1PDKA 2DM3A 3HS0A 1QA9B 4MB4A 4HIHA 1AHWC 5DDHA 2CQVA 5BRZE 3JZ7A 5ALBH 5T1LA 4RNRB 4MQ7A 1C7SA 1ZT7B 1F4AA 4PJDA 1GOGA 5FGCE 3HAEB 2DBLH 1V3JA 1NMAH 3OJDB 3RWFB 1BZ7A 1YPZA 4K2UL 4HH8A 1N4XH 4LLYA 5FYKH 4NQCA 3KYOB 2HLFD 2HVJB 3MRGA 3OX8B 5E6IA 1CLCA 4ZPVA 1JNNH 3ZLQC 2KZ1B 4P46D 2C3GA 1RIHH 1IL1B 1KF9B 3MSPA 4X9HA 3T8XA 3WFDH 4Z76B 1TTGA 2NXZD 2E6JA 3V6ZA 5CZXC 3HN3A 3VJ6B 3MUY1 5CEZL 4ONHB 4ORGA 5F6HI 3RVVC 4L3EA 1D5XB 3PABB 2W9DL 4XBGA 5J4MA 2ZG2A 3MTRA 4P23B 3NPZB 3M45A 1AKJA 1F3JA 1D6VH 2XNAA 5GZOC 4XCFH 4K9EC 43C9A 1D3CA 1TZHB 4M6AA 2WINB 2BJML 2VDQH 1IRAY 1BEYL 3B3IA 3V0VB 2DI8A 4XC3L 2C3HA 1BIIA 3HR6A 4BJLA 1ED3B 3MLUL 4NZUL 1KB5B 4PJIB 2G60H 5C9JA 3EO9H 4WCYL 1SYSA 5IHZB 1JHTB 5MHSE 3CLFH 3MXWH 1RZGB 1YEHH 1IGYA 3FZUC 3VFRA 4HIEB 1W72L 3CFIC 5HPMA 1A14H 3CXHK 2CIIA 4FQCL 4NQDD 1G7HA 2CUIA 3NA4A 4X6FA 4XNQB 2ZJSL 3H0TB 3A6CH 4XBEH 3K1KC 3QUXB 1EEYB 3VXMD 3V4UH 1T2QL 3BYYA 4ZAKD 3GMMA 1KJMB 2AJSL 3MNWB 3R1GL 4G9FD 2ICES 4AM0A 1FGNH 1A64A 2EDKA 3E8UH 4Z7WF 1LEGA 2X1PA 2IPKB 4DN4L 3CFEB 4KAQH 1UADC 1HDMA 4U3HA 3VCLB 3S3JA 1GGYA 1OTUC 3BOVA 4G43B 3RY5A 3UJJL 1T83A 5F7UA 5DVMA 5D7LA 3T0EB 5KSVB 2B7DT 1A47A 1ZSDB 3RQ3A 1CYGA 4JM2B 4LIQL 4XAKE 1WZKA 2VITA 2WK2A 3NFPA 5DO2D 5EU3B 2DB8A 3ZYIA 4CGTA 1UJTA 1RZJH 5HHOE 3D39B 4AT6A 2AV7A 4IIQB 4P99A 4IMLA 2DLHA 3MRNB 1CLYH 3BN9D 5C0AB 1UQSB 4OM0L 4CVZA 3GKWH 4XXDB 1RUAL 4GQ9H 5GS0D 1I7RA 3L5IA 3QWOA 4NC0B 5I8EB 4PY7B 4G8FA 2IQAB 5DD0L 4XPFH 3KR3L 2MCG1 2D03H 5KSBE 1JMZA 1CE1L 4BFGA 3GBNH 4OLWL 2YUVA 4KPHL 4DGIL 4ETQB 4KK9D 2P5WA 1R3IL 1YDPB 4Y5VA 2X4PB 4XP6H 4LSSH 3ROOB 3GBMH 1MFAL 3P30H 1HH9A 3WMSA 3GJEB 2VR9A 4ALAH 2UZIL 3LDBC 4YBLC 5JHDD 3PXJA 1G7IB 1X5JA 5D96C 4WO4D 2NY0B 1JGUH 3WUZA 3SKOA 4DCQA 2OL3A 1T03H 3U9UB 2Y36H 2F53E 3FT3A 5AYUH 5IVZA 1F4YL 4XRCA 2FLRT 4O02H 3FB5B 5IBLD 3FQTA 2ARJB 2FEEI 3MLYH 4IRJC 4F7CB 5CZVH 3SDYH 3QUYD 4MNGA 4GAJH 5I75C 1IEBA 2HVKB 3AS1A 4LVNC 2LU4A 1KNOA 1MFCH 2XQYG 1V5JA 1UXWA 3EYFB 3LKSA 4C58B 3U30C 4CADB 4XHJD 4LPUA 1JV5B 2Z8WC 4U4BA 3VFUA 4OF8A 3VWJC 5F6IB 5FCUH 4MD4A 4TSAH 2VLJB 4KVCH 5LBSH 2W92A 4YNYB 1VFAA 4HBCH 4JFOB 5C2BH 3PL6D 3HMXL 1NC4A 5KJRH 4BQ8A 1LO4H 4PY8J 2AK4D 1OGAD 4PGZA 2CJUL 5CJXC 3BP6A 2Q7YA 5JNYB 1MHHB 4RAHA 4G9FE 2PYFA 2Z8RA 2C5DC 4L8CB 5EZIL 5FK9B 4LVHC 2VISB 4WU7B 1HILA 4DFIA 5IF0A 2XTJC 4KTDL 3WNNA 1OOAA 5CSBA 4HDIA 1MLBB 2YWYA 4WEBL 1TQBC 5IVXA 3FB7B 1IAIH 2BHYA 4NN7C 5I71C 5D2NC 3IU4L 2C7UA 3NPSB 4XPAH 2FHBA 4L3CA 3BQUA 4HW6A 2WSKA 1CS6A 2GJ6E 4PJAB 5B4MD 5KVGH 5A1AA 5GHWH 5H37H 1MCLA 1UJ3A 5FGSA 1FZKB 1FCGA 2LABA 1CDBA 5TH2B 2XXCB 4YXLH 4ODWA 3ZYZA 4KKAD 4UDTB 5H37G 4NPYB 1MRDL 3CDYA 3CMGA 3H7BB 3E6FB 1CG9A 1JZ6A 5EU6A 4EXKA 3UTTD 3UTSA 4JFFB 3UTPD 5GJSH 1QR1B 5FM8A 3VH8G 1I8KA 2YR3A 1IT9H 3DMMD 3OR6A 1TPXB 3NACH 3ZT7A 1UFUA 3RY6C 4PJ7A 1ACYL 4U31A 5F89A 1A7PH 2CDEA 3IKKA 4D8PA 3K4AA 4K8RH 4PJGA 4M4RA 3D69B 4NO5A 3RWGA 2G2RA 4MSWA 4K3JL 1GGIH 3K4ZA 1X5AA 1F97A 3ETBF 1MHCB 4OD1H 4L4VA 5KANG 4E9LA 1OARH 4ISVA 3UROR 5K9QG 2ZSWB 4LEOB 3HHRB 5JHDE 2BDNL 3ISWA 3RNKA 5F7DB 3V4VH 1K3ZA 1NBYA 1SEQH 3UX9B 4WRLA 1KN2L 5JIHA 1NAML 1P1ZA 4IRSC 2NY1B 1NFIB 5TJWK 2EXWD 4HUWA 4TTGA 4NQCE 1NANI 4KKBC 4O58H 5ISZB 2VLLA 3D3VD 4KROC 4YXHL 2UZYB 5CWSA 5D7KE 4QXUH 2JIXB 4JJ5A 4NQUA 3MLSL 2ADGB 1JWSA 1V7ML 1YN6B 1MWAA 4HJGA 4M7LL 4PJXB 1XGPB 1JK8A 3T77B 4Y16B 1F58L 5EB9A 3LQZB 1UM5L 4Y2DD 3VMOA 1NQBA 2XZQL 3UDWC 1VKXB 2ICWI 4L9LB 8FABB 3NFSL 2F54B 1BF2A 1GHFL 1U8LA 3RIFF 5HYSG 4I1NB 3SKMA 2AK4E 3P0YL 2R2HA 4GBXD 4MA3A 2PUQT 1TJIL 5CEZH 4L29A 3B9KA 3RUGA 3OGCA 3NCJH 3LEXB 2W9DH 2OSLA 3D87B 3N1MC 4NSKA 5HTSA 1J12A 4O2FB 4MZ2A 3BISA 3DVIA 3LAFA 3O4LA 2BJMH 3SGKA 1BEYH 1OM3H 2YKLH 4XC3H 3VFGL 2BSTB 3P0GB 1H5BB 3RZCA 4D9LL 3LIZL 5D2LA 3LPWA 4PTTA 4NZUH 1HWHB 3DO7A 3VWKA 1X5ZA 5EO9A 5T1KB 5I17B 3ARFA 3WJJC 4ZFOL 1OQXA 5FKPB 1IILE 3LY6A 4F7PB 1ZA6A 3V5HB 1W72H 4M7ZB 1P7KA 5DHVA 3MJ9A 4PJFB 2NTSP 2LU7A 3QDMA 2R9HD 1P7QB 2DWEB 2FHCA 3M8OH 2ZJSH 4PRPB 5D7LE 5GGTA 1B2WL 4FFWC 4KDWA 5IGXL 4P23D 2YC1A 1DQQB 2R23B 1T2QH 4O4YH 4Z7VB 3SE3C 3B9AA 1QFHA 2XA3A 4CN4A 2VL4A 3FQWA 1Q72L 2AJSH 3R1GH 4ZS7H 4OT1L 3RGVC 3UTTE 3MBEC 1AJ7L 1KACB 3GUTA 2EE2A 3SDAC 3SDDC 4DN4H 4PV8A 1IC5L 3ARBC 4NN6B 5J11C 4N8PA 3ARDA 3VD3A 4PGEA 3A0OA 5D6CB 1YN7A 1DEDA 3K4DA 4PG2A 2F8OA 3QUZB 4JDZB 2AEQL 1HSBB 4K55A 4PLKC 3AAZA 3EDJA 4NC1C 4YGAB 3L3HB 3WFBL 3SDCB 3WXWH 4KRNA 4X98B 3O8XC 3N1PC 2NXYB 4JREC 3WIIH 3GMPB 4RFEA 2Z31C 2VDMH 3LV3B 2DBJA 3HUJE 4OM0H 4Y4KB 2R4SH 1R24A 2OJEA 3QULB 1RUAH 2EE6A 2AXGB 5IMLB 2AAVA 4X8JA 4YEFA 4H0GA 5F3BB 1HHJB 5F9DC 1UH2A 5DD0H 5GRJH 5A40E 1IQDA 1MJJA 3KR3H 4QRSA 2J7LA 4WV1A 4OLWH 4JAMB 3D3VE 1JGVL 3FQNB 1GPOH 3T0ED 4JGMA 3P77B 1ZA3B 4DGIH 3S36X 4JM2D 3NAAH 5I1DB 3TBVA 1E4XL 1R3IH 2HFTA 3VMPA 3L3DB 1MEXH 1CR9L 3AMLA 4O00A 4OZHE 3OAZK 4MXQC 1GAFL 4RMWA 2X09A 3D85A 3O3DB 1MFAH 4YDJA 5C0AD 5ANMA 1A02N 5FYJD 2UZIH 3CFDA 5D1ZB 4LPVA 3SJVA 4LKCA 3BGMB 3HUJF 1A8JH 5KTEL 2O61A 3C6LC 2VSCA 3U9PL 3PDGA 1F4YH 4MNQB 4Z7OE 3N9GH 1U3HC 3MA9L 4D94A 4E0RA 1XF5A 4G8IA 1YECH 1I4FA 1Y0LB 1CT8B 3V6OA 5ITFA 3BH8B 3FONA 5EBGA 3MRBA 3W9EB 3ZKXC 4APQA 2OLDA 1TETL 1S7SA 3AROA 4JFEA 2R69L 1FC2D 5IB4A 1AGBB 4OZHF 2EIBA 5CD5D 3VFVB 4U0RC 4QHLB 3V5DB 2PW1B 4I2XB 4FA8A 2NY0D 2EICA 3NIFE 3ARSA 1FG9C 1DN2A 5FFLA 3TJEL 5IVXE 2OBGA 4U05A 4MJ5A 5I8CB 1HH6A 2CJUH 3V6BR 1EJOH 3JV4A 4JY5L 1UM4H 3LHPL 5EZIH 3TA3C 3ZE1E 1NDGA 1QFWM 5F1NA 4LK4A 4P2CG 4KTDH 4PJIE 5GS2H 3PWUA 4ELKB 4WEBH 2VLJD 4HAFA 1MQKL 1N0XL 1SY6L 4G6KL 4PLOB 1H3PL 5ICYB 4L8DA 1LO0L 4O2EB 5E56A 3UTSE 1U58A 3IF1A 5T1DL 3HI1B 2HT4D 1R3LA 3IU4H 3IVKA 4LCCA 4N5EC 2HN7B 3NIFF 5DZLA 1BQHA 1RIUL 3KLHC 1XGQB 4IDLA 5IROC 4BELD 5DGRA 5IVXF 3OKOA 4N0YL 1TITA 5IHLB 1OB1B 1YNKH 2IJ0C 1MCOH 1J05A 3AB0C 2AV1A 2EYRA 5D7IA 3FOMB 1V05A 3MRMB 5CUSL 3MROB 1CDYA 2VIRA 4WU5B 2WBJB 4L4VE 4XB7A 4OIIL 4MB5A 1YEDA 1TVHA 3ZE1F 1AO7A 4L8SB 3Q3GA 4XTRC 5FKAA 2ZSVA 3WHXA 4PJIF 3EYSL 5HI4C 3PHOB 1ACYH 2Q76B 4LSTL 3MRLB 5F8QC 2DL2A 4PGCB 5B39A 1PJ9A 4ZD3L 4K3JH 3D39E 4EI6A 2DMBA 4NQVA 4YHPA 1A22B 3PNWB 1RURL 3ET9F 3VDBA 2QHLA 3MMEB 4MLIA 3KVQA 1LD9B 3C5ZA 1KJVB 1T0MA 1FVDA 4P4RA 3EYVA 1I75A 4PJ8C 1KN2H 1IVLA 3RVXC 1BQUA 4UTBL 1NAMH 1E6OL 3QDJB 5B8CC 4U7MA 4P48A 3TBWB 2OMBA 5F1OB 3WKNA 3SCMB 4YXHH 3ZL4L 3BPOB 4HGWB 2DLIA 5DQJA 4GXVL 2P8MA 3TYFB 4J3OC 1NCDL 4JM2F 1UG9A 3MLSH 4FABL 5SWZB 1UM6L 3GSWB 4HS3A 4CJ1A 1BX2B 3QZWB 3GSOA 2XY1A 1NCWL 5EOCH 4CNIA 4R0LB 4BFBD 1KPUB 2GCYB 2C3VB 1F58H 3GI8L 3TJHD 1UM5H 1Y6MR 4HJJL 5DMIL 4PJBB 4JZOB 2ADJB 3ELAT 4LLWA 2FYYB 2QSTA 5F7EL 2IBZX 1I1FA 3K80A 4XI5C 4PJHA 2NY1D 3NFSH 4LSRL 5D2LE 3DURB 2DKUA 3WN5B 4HT1L 4AEEA 4KKLC 3P0YH 5ISZD 4XVTH 1IZKA 1TJIH 1PZ5A 3AS2A 4JANA 3I9GH 1SVZA 2JIXD 1G7PA 3LKQA 1B4JL 2MOVA 3OAYK 4LSPL 4LDLB 5I1IL 3O6LL 1W0VA 1Z6JT 4KDTC 4V1DA 4IRZL 1SEBA 4J23A 3W81A 2G9HB 2QSCH 5IW6A 3STZA 1C5CH 3KG5A 3P4OB 4PD4J 5SWQA 1N3NA 4GH7B 3D18B 5C0RL 1FVCA 4Y16D 5I73C 2K3TA 1I3RB 2VC2L 4D9LH 3LIZH 1IC1A 5BCAA 2GEEA 1HXYB 3S5LA 4X6CA 5C0IB 4RGNC 3QXVA 3ABZA 1PKQB 1BLNB 2CMRL 1ZHKA 2F54D 4XXCC 3QFDA 1YJDC 4KJQD 4NO2B 4LCUA 5CSZB 4FQQB 3MOBL 4Y4FB 1URLA 1NGWB 2YUWA 4GKZA 1S5HA 4Y0GA 4M6NL 3C5SB 2P7TB 1B2WH 5IGXH 3SKNB 3IDMB 1Y18A 4LU5L 5ID1A 2ZOKA 1ES0B 4XT1C 2B5IB 3TBTA 1Q72H 1I1RA 1UB5A 4WJ5A 4IS6B 2NNAA 3MJ6A 2D0HA 2EO9A 3QUKA 4OT1H 4Z78A 1AJ7H 4FQXB 5EFIB 3OHXA 5IIEB 3W39A 1BF8A 5JW4R 1IC5H 5EU7E 1EERB 3C8KB 3FRPG 3QJFA 5JW5B 1LWRA 3BGAA 5T1KD 1D5IL 4YLQT 2X4TA 5KW9L 3S96A 1XF3B 1T04A 2V5YA 4UAOB 4PJAE 4AEHH 1P7QD 2D0FA 5DWUL 3RX5A 3VFSB 1HXMA 3Q6GH 4PRPD 3TO4B 4HEPG 3HPJA 1SYVB 4GG6E 1CD1A 2FJHB 5IW3A 4QGTA 1Q8MA 3JWDC 3P4MA 4HK0A 4JFFE 2A83A 4HIIA 4OM1L 3WNOA 5C0FB 4XMPL 1KIPB 4P5TC 5IB5B 4R4BA 1IAII 3MV8A 4DKAA 4CVXB 1JGVH 2R2EB 3I85A 3QUZD 3VGAB 1HHKA 5GQBA 4P46C 2O93L 2EDOA 5F21B 2DMKA 4JG0L 2NXZC 3ARPA 4U1JA 1BOGB 3QIUB 3IFNL 3SDCD 1S9VB 3VG9B 3BRGC 2A38A 3M17A 4PJAF 4MS8D 1CR9H 2RHEA 4Y8DC 5DVLA 2NXYD 4OJFL 1EO8H 3H9SD 1T1XA 5F7HA 2HLAA 4MQXD 4GG6F 3P9LB 2M8XA 2ATKB 4ZOBA 5CZKA 5KTEH 2QADB 4YK4B 1D6EA 1ZHLA 1T0NA 3QO0A 1JUFA 3BDYL 2GSGB 2YRLA 3U9PH 1RZKH 5BV7L 3DHJA 3MGOA 4XNUH 3THML 2ZCLL 6FABL 5T3ZE 3QEUB 3CFBA 1L7IL 3VGBA 5DC4B 3HE6B 1U6AH 4WI2A 5FA3A 4K7FA 4GW4A 3TM6A 4EIGB 2CXGA 5KANI 5HHMB 3RVTC 1BWWA 5CGTA 5K9QI 5E1HB 1Q9LA 3DVNB 2E7MA 4PPTA 5C0GB 1C08A 2VQUA 1FIEA 1I8LC 4E41A 1TETH 3OKLB 4ZAKC 3B9VA 5T5NG 2R69H 5D1ZD 2CLVB 1L0QA 4Q97A 5CKAA 3FT4B 2X9WA 3TNNB 3LKNB 2OR7A 3ZZ1A 4J1UA 1O7VA 3LD8C 5LGJB 5JOFB 2YSSA 5E6IB 1FVEB 3QYCA 5GISL 2N7BA 5C0BB 5D7JA 5IJKA 1P2CB 4MNQD 4MJ6B 3WUWB 4KWUA 4X7DC 2YPKB 4P3WA 3FO1A 1C12A 1X6LA 3IDYC 4JY5H 5DO2C 1RJLB 1NGYB 5MI0B 3K1DA 1T5XA 4JJHA 4MAYB 3LHPH 5BXFB 4JKWA 2HFFB 3BN9C 2Z8VC 3B3IB 4KU1A 4PJXF 1SVCP 2B0SH 1BIIB 1PY4A 3IGAA 5D7IE 3D6GA 1N0XH 1MOEA 5GS0C 1H3PH 1LO0H 3BZDA 5T1DH 4XAWL 1T20B 2DKMA 4JCMA 4D9QD 3WS3B 1C5DB 4JPIA 1AO7E 4RISL 1RIUH 4Y4HA 5JW4N 1FFRA 4JRWA 3OMZA 1KB9K 4X7FC 5DEGA 4MQTB 4N0YH 1KENL 2K7QA 1C5BL 4HWNA 5MEPB 3HZYA 1S7TB 4QNPF 1MCWW 3V8OA 5J9PB 2XV6B 1GZQB 2CGRL 5E8PA 3ZYOA 2AJZA 1F45A 4PUBL 5DS8A 4Y5YC 2BNRA 3S37X 4GKSB 3EYSH 3QUMA 1VFMA 1M7DB 2E3VA 4WO4C 3VD4A 4WI7A 3TIDB 2X4NB 2AJVL 4PGJA 1MFBL 1V3MA 2A9NL 2YHGA 2ICWA 4G7YL 1D5ZA 4X5WB 5ERWA 5IBLC 1EAPA 1G7MA 2WQRA 3HNVH 4DAGL 5JORA 2E8ZA 2E7LA 4Z7VF 4JQXA 4H26A 5C1MB 3NGBC 2WBJD 2DJ4A 4P5KB 4XHJC 4UOW0 2P24A 3NZ8B 4UTBH 1E6OH 4PS4L 4LASH 5CJ8A 4NOBA 2QJDA 3CCHA 3G6AB 3PL6C 2ARJQ 3ZL4H 4GXVH 5CP3H 5DVNA 3TNMB 4R97C 2EIZB 1NCDH 4FABH 1NBQA 1GC1H 1KLUA 1VACA 4WW1A 3HI6L 3BMVA 5EIVA 4XWOD 4I4WB 1NCWH 4LOUD 3D1MC 4PJCE 2APXA 3QI9C 4HGMA 4OZFG 2EC9U 3G08A 4YHZL 3GI8H 5DRNB 4HJJH 3VFMB 5DMIH 1FG2B 3L7EB 4HXBL 2IADA 2EXYC 4PJEA 3CZFA 1OTSD 3EO1B 5F7EH 5DHXB 1LILA 1NEZB 3OXRB 3QDJD 3JWOL 2V5TA 2AABL 4LSRH 4DKFL 4HHAA 4HT1H 5HHVL 4YH6A 4UTAL 3QXAA 3SCMD 2I25N 3I6KB 1CFSA 5F97E 1XGRB 2Q20A 3FQTB 5BZWA 4LSPH 2O5XL 3AS3A 5I1IH 3O6LH 5B4MC 4IRZH 1NSNL 5SWZD 1HZHL 4ZNCD 5GSRA 2G75A 4XCNA 5JA8B 3F7VA 4EDWL 4J3SA 2CK2A 1X7QA 4JFPA 5DFVD 4MCYA 5C0RH 4KKAC 2VC2H 4MJ2A 5DTFB 4D9RD 4PJCF 1S3KL 1EGJA 3D48R 5IB3A 3P11L 3B43A 2CMRH 4H1LH 3DMMC 3HMWL 4D9QE 2VZUA 5BJTB 4NUGL 4QRTA 2OS7A 2CH8A 4P9HH 5DRZA 3MOBH 3TO2B 4H1LG 1KFAL 4Q2ZA 2R2BB 4Q9CA 2IH3A 2FR4B 2XWTB 5E0QA 1CE6A 2XFXB 4LU5H 3X13B 3K74B 3L9RB 25C8L 2CO6B 5H94B 2PYFB 2HJFB 3IDGB 3U0PB 2JTDA 3KHQA 5DJ2A 4Y5XC 5H35B 4GG8B 5KS9B 3EKCA 1VB9A 3F7YB 1KEMH 2MJWA 1A3LL 2YUXA 4NHCL 1UKTA 3U2SB 5KW9H 1RVFL 2R0KL 5GSVA 5JOEA 1JE6A 1ERNA 3S37H 5DWUH 4M62L 4A6YA 3V0WL 3QA3B 4L4TE 4MJIB 5B3JF 5DJ6A 5I1AA 2EYSB 5JXED 4ZQKA 1UJ3B 1RK1B 5BVPL 2F5AH 3W9DA 3EYQD 1S7QB 1OP3K 4OQTL 3SEPA 2EDRA 2D4DA 4FQXD 4OM1H 5DURB 3TT3L 1FLRL 1OGTA 5GS3A 1XR9B 3BIKA 4N8VB 3QIBA 5I74C 1MAKA 1YEIL 4TRPL 4TUJB 4POZD 4Y2DC 1NUDA 2QKIA 3EHBD 4HK3N 2EKSA 1CIDA 4PRHA 1IGJB 4UIMB 1BIHA 3QAZC 3GMQB 1G6RB 3ZHKA 2KL6A 1DUYA 1XH3B 3P4NB 4JG0H 4JB9L 1WZLA 3IFNH 4GBXC 3PXHA 1JTPA 3R06A 5E6ZA 2FBJL 5CIPA 5F7NC 3PGDA 3WIFB 3MC0A 4PBVC 5DJDB 2J6EL 2VWEC 4BA8A 3BHBA 1MHEA 4PJ9B 1CDUA 2IFFL 2GUOA 3EYUL 5F96L 1ZOXA 1WISA 1LE5A 1OTTC 3QDJE 3SGJA 3BDYH 1P1ZB 1I7UB 4NUJB 4NBYB 1EEZB 5DFTA 5BV7H 3THMH 2ZCLH 6FABH 1HSAB 3EFFA 3QIUD 2R9HC 4LARL 3A6OA 4GJTB 1WSST 2CKNA 3UBXG 1XF2A 1YY8A 4EUPH 3QNZB 1AR1D 4HJGB 1VSCA 1YEKL 2UY6A 1YA5A 1JNJA 3TV3L 5ADOH 4PJBE 4D9RE 5DEFA 1GYAA 4EUPG 2FWOA 1W0WB 1IJ9A 2QADD 1T7VA 4PRBB 5IJVB 4EI5B 3T4YA 3ULVD 4P2OA 4JZNB 5GISH 4MB3A 4M1DL 2JJWA 3FMGL 4GXUN 3WFEH 3HE6D 3D0VA 1J8HA 4LGSB 3B9KB 5HHMD 1DN0B 3WJLC 4NSKB 3T08A 1WTGT 1QBAA 3I50H 3HRZB 4YGVB 5F6HJ 3DOSA 4KK6D 3HKFA 2HJKA 1IARB 3RZCB 3MV9B 4NKMA 2GSIA 5ETUA 1C16A 3BZFA 4PJBF 3BX7C 4FQ1L 2C3WA 5E6ID 5C0BD 4FXLA 4NZRL 4S1DC 4GW1A 3QDMB 3DVFA 3T0EC 2IALA 3QDAA 4JM2C 1VENA 1KENH 3UYRL 1C5BH 3V6FB 4MAYD 2DKSA 3PWNA 4Q6IB 4IIQC 1EAJA 1KTLB 1MNUL 5D4QA 1U41A 4JRXA 5D93B 5I1LA 2CGRH 1AQKL 5IM7B 4RZCB 5J12B 2FRGP 2VL5A 5K93A 3LB6D 1EH9A 1FL6B 1Z5LB 1K8DA 5LWYH 5DK2A 3GB7A 3GRWL 1IKFH 1F11B 2AJVH 2I9TA 1MFBH 5JPMA 2E9WA 2A9NH 4ZO6A 3H42L 2HWZH 3D25A 1WBXB 3HCVA 4G7YH 1I9IL 5E4IA 3KPRB 4DAGH 2EEAA 2GTZA 2Y7QB 1NJ9A 3DUSA 1RY7B 4A2LA 4ETYA 4ZUSA 4RSVA 2YRPA 4GRWB 2C3XA 3FL7A 3DPBA 2C26A 5C09A 1A6VH 5DD6B 1NMBL 1VHPA 4XBPA 2ZWLT 3GMNB 4R4FL 4NFDA 1E28A 4I18B 3U4EA 3SN6N 1FNEA 5F44A 1K4CA 4K3EL 4QRSB 4PS4H 4FQLL 2X9YA 4MAUL 5TPWL 4ZNEA 4N0CD 4MD5B 2XQYK 4PG9B 4ODXA 2D7MA 2IH1A 2W60B 4KUCD 5F3HB 4MA7L 4G6AD 1HI6A 4F9LA 1D5BA 2MFNA 3HI6H 3QO1A 4PGBA 4JFXB 1U92A 3GMRB 3D85B 3LKOA 5FM4A 5M95B 3LCYA 3UPAA 3V5KA 3W2DL 2EYTA 4PJ5E 4OF3A 5IP4A 3B5TA 2XG5A 3FTGA 4LKXA 2I60L 4WHTA 3GNMH 5LAXA 3ULVE 5F6IC 5MERB 3JWOH 2CDFB 4DKFH 5HHVH 4LSQL 1MCPL 1IEAA 4KK5D 2HT4C 4X4ZA 2QV2A 4J2XA 1N5YL 3QH3B 1FYTA 1JPGB 4AK1A 3DGCR 5HHME 3BD4A 2O5XH 1KEGL 5AZEL 4ZYKB 1Q0YL 4G8IB 1E4XI 3KYAA 2FD6L 1NSNH 4F15C 1HZHH 2BCKB 3AXLA 5F1SA 4EDWH 4G9DA 3BXNA 3DXAB 2FSEB 1K3IA 2FJFA 5E94A 5J6GA 3QQ9D 3N85H 1S3KH 4BH8A 3HPLA 3DROB 2XRAL 3P11H 4M6MH 4UB0L 4WTWA 1VEOA 2ADIB 2AXFA 4V2BA 3HMWH 4KKNA 3T3PE 4QXGL 5C0BE 4P4KC 1F4WH 4NUGH 1UXSB 2FGZA 4YBHA 3TVMA 3ULVF 1G1CA 3PWLA 5E8NA 1DBJL 2H32H 2E9BA 1KFAH 3NPSC 4JFDB 2P5EB 5JUEL 4Z8FH 1I7TA 2HAZA 1R5WA 3O81A 4ZDHB 1CICA 1KLGB 1JWMA 1EZVX 1FP5A 4MX7B 1HHIA 25C8H 2EZ0D 2Z91A 1T1WB 5CJQL 4PTUA 4OKDA 2NY4B 1TNMA 1TTUA 3VFTA 5F1NB 2VDKL 2BNUB 1ZVSB 5C0EB 3X3GL 1A3LH 1MI5A 4X5XA 3RL2A 2L4OA 3KS0J 1CDIA 2A74A 3K81A 1W2KT 4L8DB 5HDOA 4NHCH 3UXFA 3VH8A 1GCFA 1RUQL 1TPXC 1R3LB 2IQ9H 2B2XL 1N64L 1I1AB 2R0KH 2APWA 1ZVHA 5D1XA 4OZ4A 2ENSA 3MUZ1 1J0IA 2VSDA 1BQHB 4QHUB 4AG4H 4M62H 3EJZD 3WFHB 1XR8A 1VEPA 1KG0A 1JCKA 4ZFFB 5BVPH 1J05B 1NFDB 5DUMH 4U33A 5FOBA 1S8DA 3ROLA 3CJJA 4OQTH 4YWGL 4YO0A 2PW2B 4FN0A 3QNYB 1NGZA 1A6TB 2OQJB 5CEYA 5CBEB 1H3GA 1TVHB 2ADFL 1YEIH 4TRPH 2UV3A 1M7IA 4M61A 1JNHA 3CIQA 2NY1C 4UUJB 2H8PB 5GIRB 3ZTJG 1UA6H 3FCTB 5IEKA 4OKVA 2DYPA 3B5GA 3GHEL 4JB9H 2ATPA 1EXUB 1FQ9C 5CJ5A 4AL8L 1X5IA 2FBJH 4HX1A 1HEZB 5HGGS 3QXDA 4NRYB 5D8JL 4PP1D 1KJ2H 4CDGC 3VXNB 2J6EH 3Q6FB 1DANT 1GOFA 1BWMA 1T0MB 1LEKB 5L2JA 2IFFH 1DE4B 4AMKL 1FVDB 1RZFH 3EYUH 5F96H 1M05A 3AC0A 5DURD 2K1MA 2QQNL 4OLZL 1WC7B 1DSFL 2VQ1A 2KH2B 4OLUL 5C07A 1PBYA 1M6OA 3PDOB 4F7MA 5TGBB 3BKMH 3CVHB 3RWEB 1YUHA 5DK3A 2P8MB 1JWUB 1HHHA 5HYSA 3B2VL 4DN3L 1J10A 2Q86B 3JVGA 3O41A 2EDFA 4KUCF 4QXTA 1J8HE 1IMHC 1YEKH 1AXTL 3MNVA 4F3FB 1CFVL 1D5MB 4PJ9D 3TV3H 1VGEH 1INQB 1U93B 1ZT1A 2V2XA 4WENB 3TEUA 3G5ZA 2X05A 5IKCA 1BFTA 1HKLL 1X3DA 4JFQA 3RJQB 2YPVH 3KPLB 4KDVA 4M1DH 5JLZA 3FQRB 1AHWB 4M7ZC 2HJLA 4XP4H 2Z8SA 4D0CB 1MF2L 4I9WE 1G7JB 2HTLC 3VGGA 1EK3A 3MNZB 4HAGA 1ITBB 4S1RL 1W72A 3F58H 4OUUB 1YNLL 3I02B 1B88A 2BOBB 1N7ML 3GSXB 5C0NC 1U91A 3BWAB 4A2MA 2FL5A 5F72S 3F12A 3U4BH 1LDPL 4N8CL 4R2GB 4X6CB 3CNKA 3DUUA 1NC2B 4FQ1H 1NCCL 4JRXE 4NN6C 4JRYA 4OFYD 1DLHA 1ZHKB 2ITDA 2BVEA 3WE6A 3MRQA 1YQ2A 1QP1A 4S11A 3PWJA 5E99L 5DMKB 1RV6X 5FV1L 4PYGA 3QUZC 5BZDB 1MQ8A 3B9KD 1CLOL 1HQ4A 4YDKL 3S35L 3SDCC 4HUMB 1UH4A 2X44D 1R3KA 5ID1B 4LBEA 5SWSB 3C8HA 4MS8C 2Z93B 5DC9B 1MNUH 2M26A 3U36B 2NXYC 3EFDL 3O4LD 3STBA 5KS9E 2CRMA 1AQKH 4DW2L 3RZCD 3MV9D 3BKJH 5TDOA 1M71B 4MQXC 5GGTL 3S8WA 1LO5B 4XPBH 3S7GA 4X8XA 2JE8A 1TMCB 2CLZA 3QXUA 2P44B 1AD0A 4WGWB 3GRWH 2NR6D 4HXAL 3ZO0A 2J1KA 1YQVL 2OR8A 3QDMD 4ONFH 2FATL 1S9WB 1W0YT 4MJIE 1I9IH 1KPVA 3KXFA 2HMIC 3S97C 3BP4A 3KDMA 5IW1A 3GSVB 2A83B 1I8IA 4EN3A 1NMBH 3VXTA 5D1ZC 1J8KA 2BVOB 5KS9F 4HKBB 2Y25A 2DM7A 4K3EH 5EUOA 4TNWK 3F5WA 4FQLH 2JB6A 1AGDA 4MAUH 1P4IL 3F62A 1CDCA 2MHAB 3H9YA 2CKBB 4Y89A 3S34L 2ITCA 4AH2B 1H3XA 3EZ8A 4MA7H 2EDWA 3EOBB 3KPRD 1G7LB 4KMTL 3IXTB 2COQA 2O26U 3QFJA 1JZ7A 5J1AA 5DYOB 1ZHNA 1GGBL 3SDXE 3A67H 4HZLA 2OK0L 2YXFA 2I60H 4QY8A 2BVUA 1A1MA 3VXUA 3QO0B 4F8TA 3CMOL 3QJHB 3CAFA 4LSQH 1MCPH 2ZG1A 2QQLH 1VPOL 4HWUA 3C6SA 1FZMA 4M6OL 1KEGH 3IFOB 4K7FB 2CRIA 5EZJA 4G8EB 5I1GL 1T2XA 2FD6H 1A7QL 1S7XB 1A6AB 4LCYB 4Q9RH 1T1YB 4JZJC 3LDBB 4YBLB 3HMXA 5AUMB 4HK3J 1A0QL 2A77L 1N2RA 2GKIA 3D85D 3IFLH 5C7XL 1JPFA 2PTTA 4X6BA 5BOZG 4R4ND 3PQYB 5ESVA 4FFYL 2XRAH 3KPPB 3Q5TA 5CEXA 4UB0H 2DQHL 2ERJB 4LMQE 5HDQH 3SDXF 4E42A 4DUWA 4IRJB 5F93C 1DBJH 4ODSL 2BMKB 2IF7A 2F74A 2PXYC 3GHBL 2ICEB 3UBXI 4F33A 5JUEH 3VXQB 4IOFC 2VUOA 5T3ZL 4LHJB 1U8NB 2X4OA 5E8EA 2FNBA 4JFZL 1QHPA 4I3RL 2R1XA 3BIBX 3MOAL 5CJQH 3EGSB 4P2RA 2Q8BH 4JFED 5MEQA 3MV9E 5EIIB 4YQXL 1U95B 1P4BL 2VDKH 3NABL 3FRUB 3X3GH 2WBJC 5ESAB 5E7FA 5TF0A 3HAEG 2WAHA 4YFDB 5C6WH 1N64H 3C60A 4WTZG 4I5BA 5GGQL 5IK3B 4YBQD 1A1OB 2P5ED 1J0YA 3BRFA 5HDLA 1J0JA 4LVHB 1O7SA 4EDXA 4NYLA 5DLML 2XN9E 4N0UB 1X9QA 1G9MC 4XWOC 3EW3B 4LOUC 2NY4D 1YMHB 3L5WB 1IBGL 2QSQA 4NN7B 4J3VA 5D2NB 3H3KA 5CMAA 2ADFH 2AJZB 4JQIL 1U8OB 2BSRB 4JVPA 4NKOA 1OTSC 1DVFB 1RFDL 1ZGLA 3WL9A 5AG8A 1I1AD 1RJZB 4DTGL 4ZS6D 3RTQA 5J1SC 1TDQA 5GRUL 1UCBH 3GHEH 4BK4A 3SCMC 2H6PB 1N6VA 3BPOC 3KPRE 1NAMA 1D5ZB 4JHZA 5FAAA 4AL8H 1AFVL 4U1NA 5EG6C 5D8JH 2YD7A 4GRWE 5GGRB 5C08A 4AMKH 4X6DA 1H3VA 4WDIA 1NCTA 3OF6A 4QRPB 5DFVC 4R0LC 4OLZH 5DUBA 1R3JB 4F7EA 1DSFH 3WKML 4HV8B 4OLUH 3RY4A 3OL2A 4LLUA 4P57A 4Y19B 3MRPA 1NEUA 2XT1B 4LRNH 1G0XA 5DJ8B 4B7LA 1PQZA 5JW4M 5A2IH 4P2QB 4X4MA 2BY3A 3ZE2F 1DZBA 1QBLL 1LP9B 1WICA 2HT3D 3ESVF 3UCRA 4C56B 1QVOB 3LQAC 4UV4L 4FFZL 4WW1B 2R2CA 5IESL 1CFVH 2CXKA 4OLEA 3DX7A 4URTB 1PYWA 4UILL 3V7AE 2A6KB 4GRWF 3O0RL 4PR5A 1BM3L 1YEEL 4BH7B 1DBBH 5K33A 5L0QC 1EFXA 4WFGD 1MWAH 4KJWD 1HKLH 3MRJA 4AENA 3VFNA 1WEJL 5TF1L 4JRYE 1F2XK 5DD1H 5B38B 3L7FB 43CAB 1FNGA 1MCKA 4ZFOA 1G1YA 3L5XL 2BNQB 1IM9A 5D72H 3DXAE 3G6DH 4PGDA 2ZUTA 4AY0A 3RWDA 2NX5A 2N56A 1YNLH 1QFWL 1N7MH 3RU8L 1OQOA 5DRWA 3MO1A 2YN5A 5JTWA 1I9RL 3AMKA 2V7NA 1DDHA 3PGCA 2RCSL 4FQXC 3EJYD 4N8CH 4NT6B 5IB3B 1NCCH 4LIQE 4YHLL 2BZDA 4M7LT 2VR5A 5FHBL 3FRPA 1N59A 4POZC 4Z0XA 3FFCB 2NY5C 4H25A 5E99H 4U7KA 1F13A 4ZXBB 2BERA 1CD8A 2P45B 4JFDE 1VFUA 3DBXB 2JJTC 4UAOC 4HS8L 2I07A 1CLOH 4JQVC 5E5RB 4U1GC 4YDKH 3EOAB 3S35H 3FO9A 4IHOB 3MJ9H 3EFDH 5FUOL 3KLAB 2FO4A 4RDQF 1U8JA 3IRPX 4DW2H 5IWLA 2VAAA 5GGTH 4J6RL 3FKUS 4R8WL 3IDUA 3MJ8B 4L4JA 4R2GD 4EKXA 1NC2D 1UKQA 1JTOA 4P3DA 4GUPA 1FV1A 5HHPB 1PG7W 1ZMYA 4DZ8A 4U1MA 4WFED 3TZVB 4R26L 3REVA 1TNNA 4K7PX 3NCYP 4QLRA 5CD3B 1YQVH 3KYMA 1ZT4A 3VWJA 3VGAC 5FUCC 3MRDA 4D0DB 1EHAA 2BOCB 1E4KA 1ZKAA 3U46A 3ZYJA 3IS1X 1NFDE 3MBEB 2XZZA 3QIUC 3SDAB 3SDDB 3SKUD 5SWSD 3ARBB 3MRKA 5J11B 4I8DA 3VXOB 1MCQA 1AR1C 1A4JB 1K9TA 3WHE1 1T7YA 3I84A 4ELMB 1NPUA 2XKNA 4HCRL 2V5RA 3IDJA 3QFJE 3WEXB 4YK4C 5HHNB 1NUFA 3QQ4B 4G6ML 4YAQB 3I2CH 1P4IH 4UOJA 1QR4A 4KY1L 4BQ9A 3VXRB 4JHAL 4DKDC 3UP1A 2DIAA 3ECBA 3S34H 3QG6A 4JHWL 3KPQB 3W0WA 4LCWA 1P84K 2Z31B 1EO7A 3O9WA 1IC7L 1HQRA 3V52L 1FJ1B 3HE6C 3O3AA 1UACL 2ED9A 1G0YR 1S7VB 4XX1G 3SPVB 5INDB 4J8RB 1DL7L 4S0SD 4JPKH 1NFDF 2V9TA 5FECB 1S7RB 4X7TB 1GGBH 1GL4B 2XWBB 3QHFL 5KBNC 4O9HL 3NN8B 2MSPA 4KK6C 1CFNB 5JDSA 1EO5A 2IFGA 2J88L 4XCYB 4X99A 4GQPH 2UY7A 3CMOH 3QB7C 5DJXA 4P5MA 4Z18A 2F9BT 4POUB 4YHNB 1AP2B 4Y2OA 5E6IC 1VPOH 3MZGB 4OAWB 4PV9A 1L9MA 4M6OH 3LRHA 5I19L 5I1GH 3SQOL 2ZUQB 4XCCL 1A7QH 5IR1B 4EXPX 1CF8L 2BFVH 1A0QH 2A77H 3MLXL 2W59A 2OYPA 1KIRA 4QTHB 4WI6A 5J6HA 4G6FB 4XVJL 1JYXA 4F37F 1A4KA 1CLZL 3KNBB 2GJZB 4N0FB 4FFYH 5C0DA 5HYQA 3F7PC 1JVKA 4NWTL 2DQHH 2FH6A 3I6GB 3OQ3B 4LHUB 5DA0B 1FPTL 1MCCA 1I7ZA 3VXSE 3X12A 4ODSH 3EYOA 1XCTB 3GHBH 4LLQA 4XHQA 5I30L 3D0VB 3F65A 5T3ZH 1SY6A 4JFZH 4IRSA 5K9KB 1VGKA 5IFAH 1LO3L 1MLCA 4I3RH 1SJEB 4M00A 3QCTL 1K85A 3O11B 3CUPA 3GSRA 1WBZB 3DX6B 3D0LA 4ZUVA 5EBWB 5M7QA 1QLEL 1WIPA 3PQYD 2C4FU 3NABH 1BBDH 5ETUB 4GMSH 3O6FB 2VNCA 4S2SA 1BVZA 3O3EB 4WUUE 4MA1C 3UZEA 5DA4A 4ORZC 4IRJD 4HPOL 3TIEA 5D7JD 3VE0B 3DV6A 2DD8L 4N0CC 1N5AA 1T83C 4Q0XL 1U2HA 4XNZB 4YZFF 3ES6B 1A1NA 2UWEA 3KPOA 3B6SA 4U6XB 4YDVA 2P8PA 4G6AC 4X9BA 1YYMH 5DLMH 3MV7A 1TZGL 1QSEB 2XY2A 3C9NB 1IAKB 4XVUD 4EJ1C 2VXQL 4ODBD 4JQIH 3REWB 5C08E 1FDLL 3AREA 3RIAK 2QBWA 5IB2B 1RFDH 4OB5H 1F4XH 1IC4H 2X1OA 5AAWA 4JKLA 1IGCH 2P48B 4GXUM 3GB7B 5A16A 2XWJA 4WNQA 4DTGH 1XIWA 1QO3B 1YEGH 1QPPA 3WFZA 3MCKB 3MV01 3GGWA 4KK5C 4EOWL 4Y4HD 1IE5A 1M7XA 2UYLA 1U3JA 3RWHA 3MGTA 2K9UA 2GITA 1AFVH 3N06B 1T21B 4NO3A 35C8H 2GTZB 5AWNL 1UB6B 4JN2B 3HZMB 4J4PD 5AZ2L 5DGQA 1OCWL 4H8WC 5E4EC 5CP3A 4DUVA 3MRFA 4JM4L 2D9QB 1DQDL 4ODVH 1Q9KB 2VUYA 4OZFA 3UMTA 4CW1B 3QQ9C 2Q6WB 3DGGA 3UTQA 3NMEA 1JGDB 3DTXB 2BNRD 3OBAA 1DVFD 4M5ZL 2IPUG 3FQXA 3CSGA 3RGVA 2NY5L 5DFWH 4S10A 2M2DA 1T89C 3QISA 4LLMA 1JZ3A 4X9GA 2VLMD 1QBLH 1X5KA 4JG1L 2A6IB 1CVSC 4S1QL 4UV4H 3HC0A 3L3IB 4FFZH 1PAMA 4KMLB 1A2YB 3VFPA 3U6RB 1EMTL 3QXWA 4U7SA 5IESH 3IXAA 4UILH 4ZUUA 1NLBL 2EZ0C 4DVBB 5MEOB 4LDOB 4JLRA 3O0RH 5DJCA 1YEEH 4FXGA 1Z0NA 2NX5E 2R1YB 3DX9B 4KI5D 5DJAA 4Z7NF 4QXWA 3O8XA 2EDNA 4X7SL 3U7YH 2AS5M 2IC2A 1BVKB 1KSRA 4Y7MA 1WUNT 3OKMB 1WEJH 3L3KA 5TF1H 4XCEA 4HUVA 4RQQA 5ICZB 5KSAA 4P2QD 1T7ZA 1AGEA 5C86A 1MIEL 4M9PA 3DYPA 4C56D 3FB8B 3L5XH 3EJZC 4H1LA 5F9AC 1LDSA 5IUSA 1FL5A 3D9AL 2MTPA 2X4UB 4MYWB 5FDWA 4ZPTA 4YE4L 3MR9B 5F7YC 3OKEB 1I9RH 3PQYE 2Y5EA 1XGUB 3H6JA 1PVHA 4L8BA 4YIQA 1EEQA 1FFPB 4YHLH 2QHRH 1E0OB 1AGFA 5FHBH 1U8IB 2CR3A 4HFWA 1CFQA 5FO8A 4MXVF 3ULVL 5E08L 1QSFB 2C1PA 5JZ7D 1DLFL 5KN5B 1BJ8A 3V0AC 4HS8H 3OXSA 3BQUC 1R5WB 3O45B 1VFBA 5FA4B 5F70A 2BNQD 3C6LA 1HIML 1TVBA 3FFDB 2A73B 3CGTA 4U49A 1XGTB 1UJ3C 2EC8A 5EWIL 1LNUB 5FUOH 5LGHH 3GMLB 4PP1C 4RGNB 5DQ9A 1U3HA 3HLAA 4IOIB 5CKGA 4F9PC 1FSKC 3SGDI 3I6LD 5HGBA 5KG9A 1PY9A 4PRAB 1T3FB 2E7BA 4R26H 1CU4H 1OF2A 3FFCD 3RPIB 1DANU 4ZXBD 1RPQA 2NTFB 2YMXL 5C8JA 1IGTB 4YDLC 4R3SA 3K2UL 2A6DB 4WW2B 4FTVA 1OAXL 4U6YB 1B6UA 3MFFB 3FQUB 1Z9MA 5DJ0B 5J1TC 5T5FH 2XTJE 3T2PA 4NNYA 2DM4A 4PRDB 1MCFA 1P4LB 4UQ3A 1JFQH 3INUL 1JGLL 2BVQA 2FIRT 2XIDA 4GAGL 4X0KB 4XMLL 5D2NE 3SBWA 3FB6A 4PJ9C 5IHUL 5I2IB 3EO0B 4HCRH 5CEYB 1AGCA 3G6JA 3ILPB 4KK8D 4WEUD 2GTWB 3GIVA 3LKPA 1BBJB 4G6MH 4W6YB 1PZUB 5IFJB 3EZJB 5EH1A 3TZVD 2IAMA 2AQ1A 4H20L 4C83A 4JPWL 3TA3A 4D0BB 4KY1H 4JHAH 2JCCA 4NNXB 1R5VB 2VLME 5EOTA 5EC1B 4NN5C 3GSUB 3WIHL 3V52H 1SJVA 2VXVH 4OI7A 1J1OL 3T4AB 1UACH 3MBED 4U1KB 2DQFB 3PHQA 3SDAD 2YPLA 3SDDD 1DL7H 3KPMA 3ARBD 5D1QB 1F00I 2VLRA 3KYKL 2EH8H 2KPNA 4PRIE 3WDJA 1YEFL 4P5TB 3UBXA 4QRPE 2GHWB 3QHFH 2CIKB 5KVEL 5BS0B 2FGWL 2R1WA 1QLRB 3CC5B 4Y19E 2EEDA 4EUPA 1U8HA 1QSZA 5C07B 4XNMB 2NXZB 4NM4L 3VXRD 3O6KH 4P2QE 5T5NF 1GRWA 5I19H 12E8L 3SQOH 4XCCH 3BVNA 2FZ3A 1L4IA 3B9KC 3HG1B 1CF8H 4X4XB 3L95B 3MLXH 1NBZA 3BH9B 1MJ8L 1D7FA 5FO9B 2BXYA 2ZKHL 1QKZH 4HMEA 1CLZH 3E2HC 1J88A 2N1KA 4NWTH 3RZCC 1R3HA 4FRWA 3PWVA 4LSVH