5L8IA

Crystal structure of human fabp6 apo-protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
125
structure length
125
Chain Sequence
b'FTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gastrotropin
publication title Identification and Investigation of Novel Binding Fragments in the Fatty Acid Binding Protein 6 (FABP6).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 125
sequence length 125
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14651 Lipocalin_7 Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5l8iA00
1ICMA 1TOWA 5FENA 2A2GA 1EPBA 3WJBA 5FFHA 1TVQA 4IB8A 1OPAA 2FWVA 1SA8A 4XMHA 2G79A 1MVGA 1I05A 2HZRA 3C77X 3FELA 3KFFA 1SY0A 5L8IA 3CQNA 3VG4A 1BM5A 1EUOA 5KHPA 4I9SA 2F73A 5D45A 4QAEA 4UU3A 4AW8A 2R56A 2JN3A 3TZSA 1B8EA 1EPAA 4MVIA 3TGAA 1CBQA 5LJBA 3KQ0A 5HZ5A 5EZ2A 1NP4A 1X8QA 2HLVA 1VYFA 5LKEA 4IMNA 3NX2A 2RD7C 1ACDA 4OS0A 1LPJA 5LJDA 1DZMA 1MUPA 4HPCA 2LBAA 1BJ7A 1QFTA 3D95A 4WFUA 2HMBA 1RBPA 2AMMX 1LIDA 1QY1A 4TLJA 3F8AA 5D4AA 4AZPA 3NR3A 3FR5A 5F6BA 2RCQA 2RQ0A 1FENA 4ZJ0A 3QKGA 3P6EA 2L67A 2NNEA 4LKTA 2FRSA 4XMGA 2E4JA 4O9SA 3FENA 1QY2A 5BVSA 5BVQA 1KOIA 1HN2A 1NP1A 5HZ8A 4OS8A 5LJHA 1E5PA 2ACOA 5C0NA 1KQXA 4AZMA 3WJCA 5F7GA 1OEKA 2FR3A 2W2BA 2A2UA 2K23A 4ZHCA 1IKEA 1EIOA 3Q6LA 1IKJA 2MM3A 1FEMA 1S44A 1BEBA 1RLBE 4ZR2A 1D2UA 1GM6A 2LBVA 3IFBA 2QO5A 1LF7A 5EPQA 4D6BA 4RUUA 2CBSA 5LKFA 3MVFA 1IFBA 1YWCA 2KTDA 2CM9A 5IO6A 2CBRA 1OPBA 3WXQA 1SXYA 1MX7A 2JOZA 3BRNA 4YKOA 2Q9SA 3TGBA 1X8PA 5HZQA 3TF6A 1LIFA 3HWEA 1QG5A 1H91A 1P6PA 1ALBA 1ZRYA 3PPTA 4ORWA 1BRPA 3K3LA 4YGZA 4NNTA 1Z24A 2GC9A 3PECA 2QO6A 4QGWA 2WWPA 5H9KA 2QM9A 3CBCA 3O19A 3EMMA 5HCDC 4YKMA 1DZKA 1SXXA 4IAWA 4HPBA 1A57A 1HMSA 3L4RA 1DFVA 4ZH6A 4LKPA 5LJGA 4OMWA 3VG6A 2L9CA 5HTEA 3VG2A 3APUA 1KT4A 4YDAA 1OEJA 4ZHGA 2Q39A 3FW4A 2L68A 2JU3A 3U03A 3WJEA 4TKJA 2POAA 1GT4A 4IBAA 4A8ZA 1B0OA 3AKNA 2ALLX 3FEPA 3BSZE 3UEVA 5D47A 3DTQA 3ZUOA 3FA9A 1BRQA 3P6GA 4WFVA 1G7NA 3BX7A 3IA8A 3FA6A 3FR4A 1KT7A 5HZ9A 1BSQA 3C78X 4N7CA 1HMTA 1GGLA 1QQSA 4Y0PA 2G78A 2N93A 1SXWA 3NX1A 2HZQA 1VPRA 4XMCA 3AKMA 3PP6A 3FLLA 3UEXA 4I3CA 1LIBA 5DG4A 1ZNDA 1B4MA 1JV4A 1X71A 3CR6A 4WBKA 1AELA 2AL0X 3B2KA 2FS6A 1ZNLA 4QYNA 1DV9A 4ORSA 5AQ6A 1G74A 3EBKA 4GH7A 4AYHA 3JS1A 4ZFXA 2CZTA 4LZUA 4MVLA 4HPAA 4I3DA 1ZNGA 1LKEA 3P6FA 3STNA 1D3SA 1GX8A 2AH7X 4BVMA 4YFRA 5LJCA 1JJJA 5CE4A 2FTBA 1O1VA 3B2LA 1LICA 2JU7A 5HCCC 4XMDA 1KZWA 1DZPA 2XKLA 4QGVA 1YWBA 3NADA 2OVEA 2WQAE 3CMPA 4CK4A 2FLJA 3ELXA 4R0BA 3B2IA 5EEDA 1HMRA 3B2JA 1JYDA 5H9LA 1NGLA 3F9DA 1SY1A 1YUPA 3P6HA 4M7MA 1A18A 1N0SA 2OFRX 4AZNA 4YMYA 3WJGA 4ORRA 4YBPA 3STKA 1T68X 1T8VA 1U0XA 5FAZA 1YWAA 5DPQA 1LFOA 2MO5A 3TGCA 1I4UA 2LB6A 1T0VA 1OBUA 1YP6A 5IO7A 4ALOA 5KIDA 3CQRA 1CBIA 2NNQA 4IB9A 2JU8A 4N7DA 2ANSA 2WR6A 3S26A 1UZ2X 1OBQA 2AT6X 4ORUA 1HBQA 3FW5A 1ZNHA 2EU7X 3HWDA 1XKIA 1IIUA 3SAOA 5HTDA 1CJ5A 4TJZA 4IMOA 3ZQ3A 2PY1A 1X8NA 2ASNX 1G85A 3BU1A 4A1YA 1HBPA 1EIIA 3KFIA 1S2PA 4ZGUA 1GX9A 5KICA 3NQ9A 4EXZA 1G5WA 1GKAA 4HFOA 1TXLA 4YBUA 1DZJA 3PEDA 4YFPA 3RSWA 1R0UA 3ZUIA 3PH5A 4GNWA 2BLGA 4NNSA 5K06A 2R73A 3HWGA 2LKKA 1OBPA 4I9RA 1GT3A 4IAXA 2RCTA 1YP7A 4QZTA 2WQ9A 1E02A 1A2DA 4ES7A 5EEEA 3T1DA 3BU9A 1JJXA 3FIQA 5H9NA 3ELZA 1FDQA 3NQ3A 3U9PC 2GTFX 3WJDA 3GAQA 2QOSC 4ZCBA 4QYPA 2NP1A 4EDEA 1KQWA 2HNXA 3U0DA 5F1EA 2AKQA 1PEEA 1ERBA 2W2FA 2A3FX 1B56A 1FELA 1XCAA 1YIVA 1I06A 4MVKA 4HPDA 2A13A 4GRJA 4D6AA 4AZOA 3P6DA 2W2AA 4NYQA 3UEUA 4KIIA 1GT1A 2LFOA 1ML7A 1QWDA 1TW4A 3CBSA 4A60A 1S7DA 4GETA 1CBSA 2OVDA 3BDRA 4TKBA 5EDBA 4YH0A 4Y0QA 1MDCA 1U17A 2WUTA 3B2HA 4BQUA 2CZUA 4IB7A 2Q2PA 4XMEA 2K62A 3APXA 1IW2A 1EALA 4GKCA 2GJ5A 1BSYA 3BLGA 1SXUA 5LJEA 1CBRA 1KT6A 1BSOA 5HAEA 4NYRA 4YGGA 3BX8A 2WSJA 4ZHHA 5L8OA 1KT5A 1MX8A 1I04A 3CWKA 3APVA 1SY2A 2R74A 1HQPA 1EW3A 4K19A 2AT5X 3EBWA 5HBSA 1VYGA 2X46A 3G7XA 4AZQA 2OVAA 3VG3A 4DQ3A 2G7BA 4Y0SA 1PBOA 4ORXA 3MBTA 1X89A 1O8VA 3OJYC 1PMPA 4TKHA 3FEKA 4ORYA 2MJIA 3APWA 2Q2MA 1X8UA 5D48A 4RUNA 2OZQA 4EFGA 2CM4A 5H8TA 1E00A 3FR2A 4YGHA 4ALBA 4NLIA 4QZUA 1YWDA 5D8JA 1ADLA 1KZXA 1JYJA 1GT5A 1KT3A 2Q4NA 3EYCA 3O2YA 5IO5A 1OEEA 2AT3X 2OFMX 2X45A 3P6CA 1EXSA 5B27A 2WEXA 4UU2A 4XMFA 4YDBA 2IFBA 1GXAA 2P8GA 4IB6A 3JSQA 5HCEC 3STMX 2L5PA 1LIEA 1FE3A 5HWZA 2RA6A 3D96A 3KZAA 1DC9A 2FR2A 3KFHA 5BVTA 1AVGI 1UREA 3D97A 1FTPA 5B29A 1L6MA 1QY0A 2AT0X 4GNYA 4OS3A 1X8OA 4TNNA 2DM5A 4GE1A 1A3YA 1QABE 2AT8X 4I3BA 4DQ4A 5F6ZA 3VG7A 4M6SA 3I17A 1JZUA 1BLRA 4A1HA 1BWYA 4ODDA 3RZYA 5LJKA 4ARHA 3EM0A 1LNMA 3UEWA 4YCHA 3FA8A 1GKAB 1KXOA 4OMXA 2FT9A 3HK1A 1E06A 4LZVA 1EQDA 3DSZA 3FA7A 1DF3A 3O22A 5HZ6A 2ACPX 1PM1X 1JBHA 3PH6A 1KGLA 1ZNKA 1IFCA 1ERXA 3NPOA 4PSQA 3NP1A 2HYSA 5EDCA 5H9AA 1ICNA 2NNDA 3KFGA 4QGXA 2QO4A 2YG2A 1U18A 1AB0A 5F58A 4ZHFA 2FS7A 4Y0RA 1AQBA 3WBGA 2XSTA 3WVMA 4NLJA 2A0AA 4YCEA 3I0AA 1SY3A 1CRBA 3BS2A 1BBPA 3FMZA 4ZH9A 5L8NA 1O1UA 3VG5A 5HA1A 3HWFA 2WEWA 4YFQA 1ZNEA 2O62A 4NP1A 3WJFA 4BOEA 5JR8A 4ZHDA 4TQ2A 1TOUA 5HA0A 2KT4B 3BY0A 3C76X 4AZRA 4EEJA 1QFVA
chains in the Genus database with same CATH superfamily
1ICMA 1TOWA 5FENA 2A2GA 2OY1O 1EPBA 1SWRA 4GGZA 4Z6JA 3WJBA 5FFHA 1TVQA 1WUBA 3HOLA 1OPAA 2FWVA 1SA8A 4IB8A 2BSZA 3RDQA 4XMHA 2G79A 1MVGA 1STRB 5B11O 1I05A 1JMZA 2HZRA 3C77X 3FELA 1SY0A 3KFFA 3CQNA 5L8IA 5B2AO 3VG4A 1BM5A 1EUOA 5KHPA 2RTNB 4JHQA 4I9SA 2F73A 2WPUA 5D45A 1LDOA 4QAEA 4UU3A 4AW8A 4ON1A 1I78A 2OF8A 2R56A 2JN3A 3TZSA 4O4OA 1MM9A 5FQ8E 1B8EA 1EPAA 1RXJA 4MVIA 3TGAA 3ZW1B 1CBQA 4CSBA 5LJBA 3ZI8A 3KQ0A 5HZ5A 1W4TA 4NV8A 5EZ2A 5AEOA 1NP4A 3WZPA 1X8QA 2QCBA 2HLVA 2Z4IA 5IRAA 2CAMA 1VYFA 4C5PA 5LKEA 4GDAA 3NX2A 4IMNA 2RD7C 1ACDA 4OS0A 1LPJA 5LJDA 3T2WA 1DZMA 1MUPA 4HPCA 2RTGB 1K3BA 2LBAA 3VU1A 1BJ7A 1QFTA 4I60A 5K67A 3D95A 4WFUA 2HMBA 1RBPA 2AMMX 1LIDA 1QY1A 4TLJA 1AVEA 1VWIB 3F8AA 5D4AA 4BCSA 1W6FA 3VE1A 4AZPA 3NR3A 3FR5A 3VHMA 3RE5A 5F2BA 2RCQA 5F6BA 3RDSA 2RQ0A 1FENA 2RTIB 4ZJ0A 1UYNX 3QKGA 3P6EA 2L67A 2LA7A 2NNEA 4LKTA 2FRSA 2KD2A 4XMGA 2M4LA 2FHLA 3NQKA 3VG5A 1VWEB 2E4JA 4O9SA 4MISA 4JGLA 3JQOA 3FENA 1SWBA 1VWKB 1QY2A 4KT5A 5BVSA 5BVQA 2IZBA 2FHNX 1KOIA 1HN2A 1NP1A 4O3ZA 2I5VO 1VWRB 5HZ8A 1JQPA 4OS8A 5LJHA 1E5PA 2ACOA 5C0NA 2IZGB 4MIRA 4U3QA 1KQXA 4AZMA 3WJCA 2OL8O 2X34A 1OEKA 2FR3A 3D4RA 2A2UA 2K23A 2W2BA 3PDFA 5F7GA 1IKEA 4BX6A 4KH8A 4ZHCA 2GTLN 1EIOA 3Q6LA 1IKJA 4OEMA 2MM3A 1VWQB 2RTKA 1FEMA 1S44A 1BEBA 1JJUA 1RLBE 4ZR2A 3RKGA 1D2UA 1Y9TA 1VWOB 1GM6A 2LBVA 3IFBA 1NC9A 2QO5A 1LF7A 1VYOA 2UZ2A 5EPQA 4D6BA 4RUUA 2CBSA 5LKFA 4FBVA 3MVFA 3MX7A 2OL7A 1IFBA 1SWGA 1YWCA 2KTDA 1SWHA 2CM9A 5IO6A 2CBRA 1OPBA 3WXQA 5B10O 1SXYA 1MX7A 2AVIA 1SWUA 3WOVA 2RTHB 2JOZA 3S5XA 3BRNA 4YKOA 2Q9SA 4KCAA 4ID2A 4CDFA 2GH7A 1X8PA 5HZQA 3TF6A 3TGBA 1LIFA 3HWEA 1QG5A 1H91A 2OY8A 2A5CA 1P6PA 1ALBA 1ZRYA 3PPTA 2RTFB 1BRPA 3K3LA 4ORWA 4YGZA 5CSEA 4NNTA 1Z24A 4EQAC 3VHHA 2GC9A 3PECA 2GTLM 2QMIA 2QO6A 2Z4HA 4PJ2A 4QGWA 2VFCA 2WWPA 5H9KA 2QM9A 3CBCA 3O19A 3EMMA 5HCDC 3T6FA 4YKMA 1DZKA 1SXXA 4IAWA 3ZWEA 4HPBA 4BBOA 1A57A 1HY2A 3EW1A 3P02A 1HMSA 3H3IA 3L4RA 3VHIA 1DFVA 4ZH6A 4LKPA 5LJGA 4OMWA 4CPIA 3VG6A 2L9CA 2MF6A 5HTEA 3VG2A 1VWLB 1N43A 4MEEA 3APUA 1KT4A 4YDAA 1OEJA 4ZHGA 1NQMA 2Q39A 3FW4A 2L68A 4I95A 2JU3A 4BX5A 4ZGFA 3U03A 3WJEA 4FQBB 4TKJA 2POAA 1NBXA 1GT4A 4IBAA 4A8ZA 3ZW0B 1B0OA 3AKNA 2ALLX 4ML7B 3CKFA 4FGIB 3FEPA 3BSZE 3UEVA 5D47A 1SWEA 2F09A 3DTQA 3ZUOA 2IZEB 1LUQA 3FA9A 1BRQA 4NV7A 2IZAA 3P6GA 4WFVA 2GTLO 1G7NA 4GJVA 3BX7A 3IA8A 3FA6A 4CPHA 3FR4A 1KT7A 2MWHA 1BSQA 3C78X 2ZAGA 4ORUA 4N7CA 3VPJE 5HZ9A 1AVDA 1HMTA 1GGLA 1QQSA 4Y0PA 2G78A 2N93A 1SXWA 2X8SA 4INNA 3NX1A 3WYQA 3WYPA 2HZQA 4CPEA 1VPRA 4XMCA 3AKMA 3PP6A 3FLLA 2PI3O 4I3CA 3UEXA 1LIBA 5DG4A 1ZNDA 1B4MA 1JV4A 1X71A 3PK2A 3CR6A 4WBKA 2OFAA 1AELA 2AL0X 3B2KA 2FS6A 3SLTA 2RTOB 1ZNLA 4QYNA 4LQZA 1IJ8A 2X8TA 4CDCA 1DV9A 4ORSA 5AQ6A 3ZW2A 1G74A 2X55A 4IABA 4YVBA 3EBKA 4GH7A 4AYHA 3JS1A 4ZFXA 2IZCB 2CZTA 4LZUA 4MVLA 4HPAA 4I3DA 1ZNGA 1LKEA 1Y52X 3P6FA 1D3SA 1GX8A 2AH7X 3SLOA 3STNA 3SZJA 4BVMA 4YFRA 1SRJA 5LJCA 1JJJA 1N9MA 5CE4A 2FTBA 1O1VA 3B2LA 1LICA 3QQ2A 3RE6A 2IZFB 5IRWA 2JU7A 5HCCC 4JO6A 2RTCB 1I9HA 4Z28A 4XMDA 1KZWA 1DZPA 2HKDA 2XKLA 4QGVA 4IRWA 1YWBA 2OF9A 3NADA 4GDZA 2OVEA 5L3YA 3EW2A 2WQAE 3CMPA 3WZOA 4CK4A 2FLJA 3ELXA 4R0BA 3B2IA 5EEDA 1HMRA 3B2JA 4Z2PA 1JYDA 5H9LA 5CYBA 2RTBB 3FYFA 3V8UA 1NGLA 3F9DA 1SWKA 1SY1A 1LDQA 4O3XB 1YUPA 1SRIA 3P6HA 1STPA 4M7MA 1A18A 4B55A 1N0SA 3OD9A 2OFRX 4AZNA 4BX7B 4YMYA 3S5VA 3WJGA 4ORRA 5FQ6E 4YBPA 4CDDA 3STKA 1SWQA 1T68X 1T8VA 1U0XA 2RTLA 2UYWA 1YWAA 5DPQA 5FAZA 1LFOA 2MO5A 2OVSA 1I4UA 5BVTA 3TGCA 2LB6A 1T0VA 1OBUA 1YP6A 5IO7A 3HTYA 4ALOA 5KIDA 3CQRA 1CBIA 2NNQA 4KC8A 5K68A 2C1SA 4IB9A 1VWJB 1Y53X 2JU8A 4N7DA 2ANSA 2WR6A 3S26A 1UZ2X 1OBQA 2AT6X 2MHDA 4BX6B 4Z2VA 2A8GA 1RAVA 1HBQA 3FW5A 1ZNHA 2EU7X 3HWDA 1XKIA 1IIUA 4HWMA 3MM0A 3SAOA 4TJZA 5HTDA 1CJ5A 4IMOA 3ZQ3A 2PY1A 2KTSA 1X8NA 2ASNX 3LHNA 1G85A 3BU1A 2JGSA 2A5BA 1HBPA 4A1YA 1EIIA 3KFIA 1SWSA 4I6SA 1S2PA 4ZGUA 1Y55X 2VFBA 1GX9A 2Y32A 5KICA 3NQ9A 4GK9A 3AEHA 1GKAA 3WZQA 4EXZA 1G5WA 4HFOA 1SWJA 1TXLA 4MVEA 5CHKA 2RTRB 3F6ZB 4YBUA 1DZJA 3PEDA 4YFPA 4DNEA 2Y3FA 1PTSA 3RSWA 2BS6A 1R0UA 4GJSA 3RDXA 3T2XA 3ZUIA 5B5FA 4CV7A 3PH5A 2IZKA 2BLGA 4GNWA 4NNSA 2R73A 3HWGA 2LKKA 4QQ1A 5K06A 1OBPA 4GUZA 1GT3A 4I9RA 4IAXA 4BX5B 2RCTA 1YP7A 4QZTA 2WQ9A 1E02A 2JMBA 1A2DA 5AJCA 4FBRA 4ES7A 5EEEA 3T1DA 3Q34A 3BU9A 1LCZA 1JJXA 1K24A 3RY1A 3FIQA 1MK5A 4Z2OA 5H9NA 3ELZA 1FDQA 3NQ3A 3U9PC 2RTQB 3T6LA 2GTFX 3WJDA 3GAQA 3FDCA 1VWGB 2QOSC 4ZCBA 4QYPA 2NP1A 3HOEA 4EDEA 1KQWA 2HNXA 3U0DA 5F1EA 1RXHA 2AKQA 1PEEA 3ZW0A 1ERBA 2W2FA 2FKJA 2A3FX 4QNIA 1B56A 1FELA 4WHIA 1XCAA 4OELA 1YIVA 1I06A 2FKGA 4MVKA 4FBOA 4HPDA 2X32A 4O4SA 3RWXA 2A13A 4GRJA 4U8UN 4D6AA 3OE3A 4AZOA 4Z27A 3P6DA 2W2AA 4NYQA 4BJ8A 5IXGA 3UEUA 4GZVA 4KIIA 1GT1A 1ML7A 2G5LA 2LFOA 1QWDA 1TW4A 3CBSA 3GE2A 1S7DA 4GETA 1CBSA 2OVDA 3BDRA 4A60A 4TKBA 5EDBA 2RTEB 4Y0QA 1MDCA 4QRLA 4YH0A 1U17A 2IZIA 4CPHB 4EKVA 1SWDA 2WUTA 3B2HA 4BQUA 1SWTA 2CZUA 4IB7A 2Q2PA 4XMEA 3PQSA 1SLDB 5B5GA 2K62A 3APXA 4GGRA 4O4XA 4O4UA 2VDFA 1IW2A 5BYPA 1EALA 1MEPA 2QOMA 4GKCA 2GJ5A 1BSYA 2FGSA 3BLGA 1SXUA 5LJEA 1CBRA 1KT6A 1VWAB 1BSOA 5HAEA 3LV4A 4NYRA 3BX8A 2WSJA 2X4MA 3P24A 4YGGA 4ZHHA 1KT5A 1MX8A 5L8OA 1I04A 1UYOX 3CWKA 4GD9A 3WZNA 4GU8A 3APVA 4O3YA 1SY2A 2R74A 1HQPA 1SLEB 4U8UM 3SOTA 1EW3A 4K19A 2AT5X 3EBWA 2DJFA 5HBSA 1VYGA 2X46A 3G7XA 2OYBO 4AZQA 2OVAA 1KL4A 3VG3A 4DQ3A 2G7BA 4Y0SA 1PBOA 2RTMA 1SWFA 2ZAIA 2X8FA 3MBTA 1X89A 4ORXA 3MG5A 4Y5DA 1O8VA 3OJYC 1PMPA 4TKHA 5IRUA 2OY5O 3S60A 3FEKA 4ORYA 1SWCA 4Y59A 2MJIA 1W5RA 3APWA 1VWCB 2Q2MA 2RTAA 1X8UA 5D48A 4RUNA 2OZQA 3SZHA 4EFGA 2CM4A 5H8TA 1E00A 3FR2A 4YGHA 4ALBA 1SMPI 1FJ1E 1N4JA 2BT9A 4NLIA 4QZUA 1YWDA 4NW4A 2KW1A 3HPEA 5D8JA 2OY7A 2RTDB 1ADLA 2YMSA 1KZXA 1JYJA 2X56A 1GT5A 4GGTA 3N91A 1LCWA 3KVNA 1Y0GA 1EI5A 1KFFA 1OSPO 1PBYA 4BX7A 4CPFA 1KT3A 2Q4NA 3EYCA 1RXKA 1SLGB 3O2YA 4U8UO 5IO5A 1OEEA 2AT3X 2OFMX 2X45A 3P6CA 1WBIA 1EXSA 5B27A 3SLJA 2C4IA 2WEXA 4UU2A 1Y9LA 4XMFA 4U9CA 4YDBA 1SRHA 1NQNA 2IZHB 2IFBA 4O49A 3RDOA 1GXAA 1VWPB 1JIWI 1VWFB 1LELA 2P8GA 3JSQA 3FIDA 4IB6A 4CDEA 1MOYA 5HCEC 3STMX 2L5PA 1LIEA 1STSB 1SWLA 1FE3A 4O3WA 2RA6A 5HWZA 3RBYA 3ZW1A 1N7YA 1SREA 3D96A 4JNJA 1SWOA 3KZAA 5B3MO 1DC9A 1SWPA 2FR2A 3EC5A 3KFHA 3OBLA 1AVGI 3NBXX 1KL5A 1UREA 1FTPA 2IZLB 1L6MA 3D97A 3RDMA 1QY0A 5B29A 2AT0X 4GNYA 4OS3A 1X8OA 4TNNA 4OKAA 1RSUB 2DM5A 1A3YA 1QABE 2AT8X 4GE1A 1SWNA 4I3BA 2F01A 4DQ4A 1DF8A 5F6ZA 3VG7A 4M6SA 3VGWA 2BHVA 3I17A 4L3RA 1JZUA 1BLRA 2AF5A 1SRGA 1N9YA 2BC3A 4A1HA 1KL3A 2OL6O 1RSTB 1BWYA 4ODDA 3RZYA 5LJKA 4ARHA 3PQUA 2I5ZO 2JW1A 2RTJA 3EM0A 1LNMA 4DCBA 1SLFB 3D9WA 2OFBA 3E3CA 4YCHA 3FA8A 1GKAB 1KXOA 4OMXA 3UEWA 2FT9A 3HK1A 1E06A 4LZVA 1EQDA 3DSZA 3FA7A 1DF3A 3O22A 4KC7A 1LCVA 5HZ6A 1SWAA 2ACPX 5FQ7E 3UAQA 1PM1X 1JBHA 3PH6A 5JD2A 1ZNKA 1KGLA 1IFCA 3CKGA 4BGFA 1ERXA 1SRFA 3NPOA 2RN4A 2G8CO 2RTPB 4PSQA 3NP1A 2HYSA 5EDCA 2BS5A 5H9AA 3RY2A 2ZSCA 1ICNA 1VWHB 1VWMB 2NNDA 1HXLA 3KFGA 3LTWA 4QGXA 2QO4A 2C1QA 2YG2A 1U18A 1AB0A 5F58A 4ZHFA 1NDJA 2FS7A 1JMXA 3ZZVA 4Y0RA 1AQBA 2IZJA 3WBGA 2XSTA 3VE2A 3WVMA 2DJGA 1VWDB 4NLJA 1GX3A 2A0AA 3RDUA 1VWBB 4YCEA 3I0AA 3X00A 1HXZA 1SY3A 1CRBA 3BS2A 1BBPA 3SZIA 3FMZA 4L1NA 5AJBA 1E2TA 4U46A 4ZH9A 5L8NA 1VWNB 1HQQA 1O1UA 5HA1A 3HWFA 2WEWA 2Y3EA 1ZNEA 2O62A 4NP1A 4YFQA 3WJFA 4BOEA 2IZDB 5JR8A 4ZHDA 4TQ2A 1TOUA 5HA0A 3AUMO 4COTA 2KT4B 3BY0A 3C76X 4AZRA 4EEJA 1QFVA
chains in the Genus database with same CATH topology
1ICMA 1TOWA 5FENA 2A2GA 1EPBA 3WJBA 5FFHA 1TVQA 3HOLA 1OPAA 2FWVA 1SA8A 4IB8A 4XMHA 2G79A 1MVGA 4EQAC 1I05A 2HZRA 3C77X 3FELA 3KFFA 1SY0A 5L8IA 3CQNA 3VG4A 1BM5A 1EUOA 5KHPA 4I9SA 2F73A 5D45A 4QAEA 4UU3A 4AW8A 4ON1A 2R56A 2JN3A 3TZSA 4O4OA 5FQ8E 1B8EA 1EPAA 4MVIA 3TGAA 1CBQA 5LJBA 3ZI8A 3KQ0A 5HZ5A 5AEOA 5EZ2A 1NP4A 1X8QA 2HLVA 2Z4IA 1VYFA 5LKEA 4IMNA 3NX2A 2RD7C 1ACDA 4OS0A 1LPJA 5LJDA 1DZMA 1MUPA 4HPCA 2LBAA 3VU1A 1BJ7A 1QFTA 3D95A 4WFUA 2HMBA 1RBPA 2AMMX 1LIDA 1QY1A 4TLJA 3F8AA 5D4AA 3VE1A 4AZPA 3NR3A 3FR5A 5F6BA 2RCQA 2RQ0A 1FENA 4ZJ0A 3QKGA 3P6EA 2L67A 2LA7A 2NNEA 4LKTA 2FRSA 2KD2A 4XMGA 2M4LA 3NQKA 2E4JA 4O9SA 4MISA 4JGLA 3JQOA 3FENA 1QY2A 4KT5A 5BVSA 5BVQA 4O3ZA 1KOIA 1HN2A 1NP1A 5HZ8A 4OS8A 5LJHA 1E5PA 2ACOA 5C0NA 4MIRA 4U3QA 1KQXA 4AZMA 3WJCA 5F7GA 1OEKA 2FR3A 3D4RA 2A2UA 2K23A 2W2BA 4ZHCA 1IKEA 4KH8A 2GTLN 1EIOA 3Q6LA 1IKJA 2MM3A 1FEMA 1S44A 1BEBA 1RLBE 3RKGA 4ZR2A 1D2UA 1Y9TA 1GM6A 2LBVA 3IFBA 2QO5A 1LF7A 5EPQA 4D6BA 4RUUA 2CBSA 5LKFA 4FBVA 3MVFA 3MX7A 1IFBA 1YWCA 2KTDA 2CM9A 5IO6A 2CBRA 1OPBA 3WXQA 1SXYA 1MX7A 3WOVA 2JOZA 3S5XA 3BRNA 4YKOA 2Q9SA 4KCAA 4ID2A 3TGBA 1X8PA 5HZQA 3TF6A 1LIFA 3HWEA 1QG5A 1H91A 1P6PA 1ALBA 1ZRYA 3PPTA 4ORWA 1BRPA 3K3LA 4YGZA 4NNTA 1Z24A 2GC9A 3PECA 2GTLM 2QMIA 2QO6A 2Z4HA 4PJ2A 4QGWA 2WWPA 5H9KA 2QM9A 3CBCA 3O19A 3EMMA 5HCDC 4YKMA 1DZKA 1SXXA 4IAWA 3ZWEA 4HPBA 1A57A 3P02A 1HMSA 3H3IA 3L4RA 1DFVA 4ZH6A 4LKPA 5LJGA 4OMWA 3VG6A 2L9CA 5HTEA 3VG2A 3APUA 1KT4A 4YDAA 1OEJA 4ZHGA 2Q39A 3FW4A 2L68A 4I95A 2JU3A 4ZGFA 3U03A 3WJEA 4FQBB 4TKJA 2POAA 1GT4A 4IBAA 4A8ZA 3ZW0B 1B0OA 3AKNA 2ALLX 4ML7B 4FGIB 3FEPA 3BSZE 3UEVA 5D47A 2F09A 3DTQA 3ZUOA 3FA9A 1BRQA 3P6GA 4WFVA 2GTLO 1G7NA 3BX7A 3IA8A 3FA6A 3FR4A 1KT7A 2MWHA 1BSQA 3C78X 2ZAGA 3VPJE 4N7CA 5HZ9A 1HMTA 1GGLA 1QQSA 4Y0PA 2G78A 2N93A 1SXWA 2X8SA 4INNA 3NX1A 2HZQA 1VPRA 4XMCA 3AKMA 3PP6A 3FLLA 3UEXA 4I3CA 1LIBA 5DG4A 1ZNDA 1B4MA 1JV4A 1X71A 3CR6A 4WBKA 1AELA 2AL0X 3B2KA 2FS6A 1ZNLA 4QYNA 4LQZA 2X8TA 1DV9A 4ORSA 5AQ6A 3ZW2A 1G74A 4IABA 3EBKA 4GH7A 4AYHA 3JS1A 4ZFXA 2CZTA 4LZUA 4MVLA 4HPAA 4I3DA 1ZNGA 1LKEA 3P6FA 3STNA 1D3SA 1GX8A 2AH7X 4BVMA 4YFRA 5LJCA 1JJJA 5CE4A 2FTBA 1O1VA 3B2LA 1LICA 2JU7A 5HCCC 4XMDA 1KZWA 1DZPA 2XKLA 4QGVA 1YWBA 3NADA 4GDZA 2OVEA 2WQAE 3CMPA 4CK4A 2FLJA 3ELXA 4R0BA 3B2IA 5EEDA 1HMRA 3B2JA 1JYDA 5H9LA 5CYBA 3FYFA 3V8UA 1NGLA 3F9DA 1SY1A 4O3XB 1YUPA 3P6HA 4M7MA 1A18A 1N0SA 3OD9A 2OFRX 4AZNA 4YMYA 3S5VA 3WJGA 4ORRA 5FQ6E 4YBPA 3STKA 1T68X 1T8VA 1U0XA 5FAZA 1YWAA 5DPQA 1LFOA 2MO5A 2OVSA 1I4UA 3TGCA 2LB6A 1T0VA 1OBUA 1YP6A 5IO7A 3HTYA 4ALOA 5KIDA 3CQRA 1CBIA 2NNQA 4KC8A 4IB9A 2JU8A 4N7DA 2ANSA 2WR6A 3S26A 1UZ2X 1OBQA 2AT6X 2MHDA 4HWMA 4ORUA 1HBQA 3FW5A 1ZNHA 2EU7X 3HWDA 1XKIA 1IIUA 3SAOA 3ZW1B 5HTDA 4TJZA 1CJ5A 4IMOA 3ZQ3A 2PY1A 2KTSA 1X8NA 2ASNX 3LHNA 1G85A 3BU1A 4A1YA 1HBPA 1EIIA 3KFIA 4I6SA 1S2PA 4ZGUA 1GX9A 5KICA 3NQ9A 4GK9A 4EXZA 1GKAA 1G5WA 4HFOA 1TXLA 4MVEA 3F6ZB 4YBUA 1DZJA 3PEDA 4YFPA 3RSWA 2BS6A 1R0UA 4CV7A 3ZUIA 3PH5A 4GNWA 2BLGA 4NNSA 4QQ1A 2R73A 3HWGA 2LKKA 5K06A 1OBPA 4I9RA 1GT3A 4IAXA 2RCTA 1YP7A 4QZTA 2WQ9A 1E02A 2JMBA 1A2DA 5AJCA 4FBRA 4ES7A 5EEEA 3T1DA 3BU9A 1JJXA 3FIQA 5H9NA 3ELZA 1FDQA 3NQ3A 3U9PC 2GTFX 3WJDA 3GAQA 2QOSC 4ZCBA 4QYPA 2NP1A 3HOEA 4EDEA 1KQWA 2HNXA 3U0DA 5F1EA 2AKQA 1PEEA 3ZW0A 1ERBA 2W2FA 2A3FX 4QNIA 1B56A 1FELA 4WHIA 1XCAA 1YIVA 1I06A 4MVKA 4FBOA 4HPDA 4O4SA 3RWXA 2A13A 4GRJA 4U8UN 4D6AA 3OE3A 4AZOA 3P6DA 2W2AA 4NYQA 3UEUA 4GZVA 4KIIA 1GT1A 2LFOA 1ML7A 1QWDA 1TW4A 3CBSA 3GE2A 1S7DA 4GETA 1CBSA 2OVDA 3BDRA 4A60A 4TKBA 5EDBA 4YH0A 4Y0QA 1MDCA 4QRLA 1U17A 2WUTA 3B2HA 4BQUA 2CZUA 4IB7A 2Q2PA 4XMEA 3PQSA 2K62A 3APXA 4O4XA 4O4UA 1IW2A 5BYPA 1EALA 4GKCA 2GJ5A 1BSYA 3BLGA 1SXUA 5LJEA 1CBRA 1KT6A 1BSOA 5HAEA 3LV4A 4NYRA 3BX8A 2WSJA 4YGGA 3P24A 4ZHHA 5L8OA 1KT5A 1MX8A 1I04A 3CWKA 4GU8A 3APVA 4O3YA 1SY2A 2R74A 1HQPA 4U8UM 3SOTA 1EW3A 4K19A 2AT5X 3EBWA 5HBSA 1VYGA 2X46A 3G7XA 4AZQA 2OVAA 3VG3A 4DQ3A 2G7BA 4Y0SA 1PBOA 2ZAIA 4ORXA 2X8FA 3MBTA 1X89A 1O8VA 3OJYC 1PMPA 4TKHA 3S60A 3FEKA 4ORYA 2MJIA 3APWA 2Q2MA 1X8UA 5D48A 4RUNA 2OZQA 4EFGA 2CM4A 5H8TA 1E00A 3FR2A 4YGHA 4ALBA 1SMPI 2BT9A 4NLIA 4QZUA 1YWDA 4NW4A 2KW1A 5D8JA 1ADLA 2YMSA 1KZXA 1JYJA 1GT5A 3N91A 1EI5A 1KT3A 2Q4NA 3EYCA 3O2YA 5IO5A 4U8UO 1OEEA 2AT3X 2OFMX 2X45A 3P6CA 1EXSA 5B27A 2WEXA 4UU2A 1Y9LA 4XMFA 4U9CA 4YDBA 4O49A 2IFBA 1GXAA 2P8GA 1JIWI 4IB6A 4CSBA 3JSQA 5HCEC 3STMX 2L5PA 1LIEA 1FE3A 4O3WA 2RA6A 5HWZA 3RBYA 3ZW1A 3D96A 3KZAA 1DC9A 2FR2A 3KFHA 3OBLA 1AVGI 3NBXX 1UREA 3D97A 1FTPA 5B29A 1L6MA 5BVTA 1QY0A 2AT0X 4GNYA 4OS3A 1X8OA 4TNNA 2DM5A 4GE1A 1A3YA 1QABE 2AT8X 4I3BA 4DQ4A 5F6ZA 3VG7A 4M6SA 2BHVA 3I17A 4L3RA 1JZUA 1BLRA 4A1HA 1BWYA 4ODDA 3RZYA 5LJKA 4ARHA 3PQUA 2JW1A 3EM0A 1LNMA 3E3CA 3UEWA 4YCHA 3FA8A 1GKAB 1KXOA 4OMXA 2FT9A 3HK1A 1E06A 4LZVA 1EQDA 3DSZA 3FA7A 1DF3A 3O22A 4KC7A 5HZ6A 2ACPX 5FQ7E 3UAQA 1PM1X 1JBHA 3PH6A 1KGLA 1ZNKA 1IFCA 1ERXA 3NPOA 2RN4A 4PSQA 3NP1A 2HYSA 5EDCA 2BS5A 5H9AA 1ICNA 2NNDA 3KFGA 4QGXA 2QO4A 2YG2A 1U18A 1AB0A 5F58A 4ZHFA 2FS7A 3ZZVA 4Y0RA 1AQBA 3WBGA 2XSTA 3VE2A 3WVMA 4NLJA 2A0AA 4YCEA 3I0AA 1SY3A 1CRBA 3BS2A 1BBPA 3FMZA 4L1NA 5AJBA 4ZH9A 5L8NA 1O1UA 3VG5A 5HA1A 3HWFA 2WEWA 4YFQA 1ZNEA 2O62A 4NP1A 3WJFA 4BOEA 5JR8A 4ZHDA 4TQ2A 1TOUA 5HA0A 4COTA 2KT4B 3BY0A 3C76X 4AZRA 4EEJA 1QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICM A;  1TOW A;  5FEN A;  2A2G A;  1EPB A;  3WJB A;  5FFH A;  1TVQ A;  4IB8 A;  1OPA A;  2FWV A;  1SA8 A;  4XMH A;  2G79 A;  1MVG A;  1I05 A;  2HZR A;  3C77 X;  3FEL A;  3KFF A;  1SY0 A;  5L8I A;  3CQN A;  3VG4 A;  1BM5 A;  1EUO A;  5KHP A;  4I9S A;  2F73 A;  5D45 A;  4QAE A;  4UU3 A;  4AW8 A;  2R56 A;  2JN3 A;  3TZS A;  1B8E A;  1EPA A;  4MVI A;  3TGA A;  1CBQ A;  5LJB A;  3KQ0 A;  5HZ5 A;  5EZ2 A;  1NP4 A;  1X8Q A;  2HLV A;  1VYF A;  5LKE A;  4IMN A;  3NX2 A;  2RD7 C;  1ACD A;  4OS0 A;  1LPJ A;  5LJD A;  1DZM A;  1MUP A;  4HPC A;  2LBA A;  1BJ7 A;  1QFT A;  3D95 A;  4WFU A;  2HMB A;  1RBP A;  2AMM X;  1LID A;  1QY1 A;  4TLJ A;  3F8A A;  5D4A A;  4AZP A;  3NR3 A;  3FR5 A;  5F6B A;  2RCQ A;  2RQ0 A;  1FEN A;  4ZJ0 A;  3QKG A;  3P6E A;  2L67 A;  2NNE A;  4LKT A;  2FRS A;  4XMG A;  2E4J A;  4O9S A;  3FEN A;  1QY2 A;  5BVS A;  5BVQ A;  1KOI A;  1HN2 A;  1NP1 A;  5HZ8 A;  4OS8 A;  5LJH A;  1E5P A;  2ACO A;  5C0N A;  1KQX A;  4AZM A;  3WJC A;  5F7G A;  1OEK A;  2FR3 A;  2W2B A;  2A2U A;  2K23 A;  4ZHC A;  1IKE A;  1EIO A;  3Q6L A;  1IKJ A;  2MM3 A;  1FEM A;  1S44 A;  1BEB A;  1RLB E;  4ZR2 A;  1D2U A;  1GM6 A;  2LBV A;  3IFB A;  2QO5 A;  1LF7 A;  5EPQ A;  4D6B A;  4RUU A;  2CBS A;  5LKF A;  3MVF A;  1IFB A;  1YWC A;  2KTD A;  2CM9 A;  5IO6 A;  2CBR A;  1OPB A;  3WXQ A;  1SXY A;  1MX7 A;  2JOZ A;  3BRN A;  4YKO A;  2Q9S A;  3TGB A;  1X8P A;  5HZQ A;  3TF6 A;  1LIF A;  3HWE A;  1QG5 A;  1H91 A;  1P6P A;  1ALB A;  1ZRY A;  3PPT A;  4ORW A;  1BRP A;  3K3L A;  4YGZ A;  4NNT A;  1Z24 A;  2GC9 A;  3PEC A;  2QO6 A;  4QGW A;  2WWP A;  5H9K A;  2QM9 A;  3CBC A;  3O19 A;  3EMM A;  5HCD C;  4YKM A;  1DZK A;  1SXX A;  4IAW A;  4HPB A;  1A57 A;  1HMS A;  3L4R A;  1DFV A;  4ZH6 A;  4LKP A;  5LJG A;  4OMW A;  3VG6 A;  2L9C A;  5HTE A;  3VG2 A;  3APU A;  1KT4 A;  4YDA A;  1OEJ A;  4ZHG A;  2Q39 A;  3FW4 A;  2L68 A;  2JU3 A;  3U03 A;  3WJE A;  4TKJ A;  2POA A;  1GT4 A;  4IBA A;  4A8Z A;  1B0O A;  3AKN A;  2ALL X;  3FEP A;  3BSZ E;  3UEV A;  5D47 A;  3DTQ A;  3ZUO A;  3FA9 A;  1BRQ A;  3P6G A;  4WFV A;  1G7N A;  3BX7 A;  3IA8 A;  3FA6 A;  3FR4 A;  1KT7 A;  5HZ9 A;  1BSQ A;  3C78 X;  4N7C A;  1HMT A;  1GGL A;  1QQS A;  4Y0P A;  2G78 A;  2N93 A;  1SXW A;  3NX1 A;  2HZQ A;  1VPR A;  4XMC A;  3AKM A;  3PP6 A;  3FLL A;  3UEX A;  4I3C A;  1LIB A;  5DG4 A;  1ZND A;  1B4M A;  1JV4 A;  1X71 A;  3CR6 A;  4WBK A;  1AEL A;  2AL0 X;  3B2K A;  2FS6 A;  1ZNL A;  4QYN A;  1DV9 A;  4ORS A;  5AQ6 A;  1G74 A;  3EBK A;  4GH7 A;  4AYH A;  3JS1 A;  4ZFX A;  2CZT A;  4LZU A;  4MVL A;  4HPA A;  4I3D A;  1ZNG A;  1LKE A;  3P6F A;  3STN A;  1D3S A;  1GX8 A;  2AH7 X;  4BVM A;  4YFR A;  5LJC A;  1JJJ A;  5CE4 A;  2FTB A;  1O1V A;  3B2L A;  1LIC A;  2JU7 A;  5HCC C;  4XMD A;  1KZW A;  1DZP A;  2XKL A;  4QGV A;  1YWB A;  3NAD A;  2OVE A;  2WQA E;  3CMP A;  4CK4 A;  2FLJ A;  3ELX A;  4R0B A;  3B2I A;  5EED A;  1HMR A;  3B2J A;  1JYD A;  5H9L A;  1NGL A;  3F9D A;  1SY1 A;  1YUP A;  3P6H A;  4M7M A;  1A18 A;  1N0S A;  2OFR X;  4AZN A;  4YMY A;  3WJG A;  4ORR A;  4YBP A;  3STK A;  1T68 X;  1T8V A;  1U0X A;  5FAZ A;  1YWA A;  5DPQ A;  1LFO A;  2MO5 A;  3TGC A;  1I4U A;  2LB6 A;  1T0V A;  1OBU A;  1YP6 A;  5IO7 A;  4ALO A;  5KID A;  3CQR A;  1CBI A;  2NNQ A;  4IB9 A;  2JU8 A;  4N7D A;  2ANS A;  2WR6 A;  3S26 A;  1UZ2 X;  1OBQ A;  2AT6 X;  4ORU A;  1HBQ A;  3FW5 A;  1ZNH A;  2EU7 X;  3HWD A;  1XKI A;  1IIU A;  3SAO A;  5HTD A;  1CJ5 A;  4TJZ A;  4IMO A;  3ZQ3 A;  2PY1 A;  1X8N A;  2ASN X;  1G85 A;  3BU1 A;  4A1Y A;  1HBP A;  1EII A;  3KFI A;  1S2P A;  4ZGU A;  1GX9 A;  5KIC A;  3NQ9 A;  4EXZ A;  1G5W A;  1GKA A;  4HFO A;  1TXL A;  4YBU A;  1DZJ A;  3PED A;  4YFP A;  3RSW A;  1R0U A;  3ZUI A;  3PH5 A;  4GNW A;  2BLG A;  4NNS A;  5K06 A;  2R73 A;  3HWG A;  2LKK A;  1OBP A;  4I9R A;  1GT3 A;  4IAX A;  2RCT A;  1YP7 A;  4QZT A;  2WQ9 A;  1E02 A;  1A2D A;  4ES7 A;  5EEE A;  3T1D A;  3BU9 A;  1JJX A;  3FIQ A;  5H9N A;  3ELZ A;  1FDQ A;  3NQ3 A;  3U9P C;  2GTF X;  3WJD A;  3GAQ A;  2QOS C;  4ZCB A;  4QYP A;  2NP1 A;  4EDE A;  1KQW A;  2HNX A;  3U0D A;  5F1E A;  2AKQ A;  1PEE A;  1ERB A;  2W2F A;  2A3F X;  1B56 A;  1FEL A;  1XCA A;  1YIV A;  1I06 A;  4MVK A;  4HPD A;  2A13 A;  4GRJ A;  4D6A A;  4AZO A;  3P6D A;  2W2A A;  4NYQ A;  3UEU A;  4KII A;  1GT1 A;  2LFO A;  1ML7 A;  1QWD A;  1TW4 A;  3CBS A;  4A60 A;  1S7D A;  4GET A;  1CBS A;  2OVD A;  3BDR A;  4TKB A;  5EDB A;  4YH0 A;  4Y0Q A;  1MDC A;  1U17 A;  2WUT A;  3B2H A;  4BQU A;  2CZU A;  4IB7 A;  2Q2P A;  4XME A;  2K62 A;  3APX A;  1IW2 A;  1EAL A;  4GKC A;  2GJ5 A;  1BSY A;  3BLG A;  1SXU A;  5LJE A;  1CBR A;  1KT6 A;  1BSO A;  5HAE A;  4NYR A;  4YGG A;  3BX8 A;  2WSJ A;  4ZHH A;  5L8O A;  1KT5 A;  1MX8 A;  1I04 A;  3CWK A;  3APV A;  1SY2 A;  2R74 A;  1HQP A;  1EW3 A;  4K19 A;  2AT5 X;  3EBW A;  5HBS A;  1VYG A;  2X46 A;  3G7X A;  4AZQ A;  2OVA A;  3VG3 A;  4DQ3 A;  2G7B A;  4Y0S A;  1PBO A;  4ORX A;  3MBT A;  1X89 A;  1O8V A;  3OJY C;  1PMP A;  4TKH A;  3FEK A;  4ORY A;  2MJI A;  3APW A;  2Q2M A;  1X8U A;  5D48 A;  4RUN A;  2OZQ A;  4EFG A;  2CM4 A;  5H8T A;  1E00 A;  3FR2 A;  4YGH A;  4ALB A;  4NLI A;  4QZU A;  1YWD A;  5D8J A;  1ADL A;  1KZX A;  1JYJ A;  1GT5 A;  1KT3 A;  2Q4N A;  3EYC A;  3O2Y A;  5IO5 A;  1OEE A;  2AT3 X;  2OFM X;  2X45 A;  3P6C A;  1EXS A;  5B27 A;  2WEX A;  4UU2 A;  4XMF A;  4YDB A;  2IFB A;  1GXA A;  2P8G A;  4IB6 A;  3JSQ A;  5HCE C;  3STM X;  2L5P A;  1LIE A;  1FE3 A;  5HWZ A;  2RA6 A;  3D96 A;  3KZA A;  1DC9 A;  2FR2 A;  3KFH A;  5BVT A;  1AVG I;  1URE A;  3D97 A;  1FTP A;  5B29 A;  1L6M A;  1QY0 A;  2AT0 X;  4GNY A;  4OS3 A;  1X8O A;  4TNN A;  2DM5 A;  4GE1 A;  1A3Y A;  1QAB E;  2AT8 X;  4I3B A;  4DQ4 A;  5F6Z A;  3VG7 A;  4M6S A;  3I17 A;  1JZU A;  1BLR A;  4A1H A;  1BWY A;  4ODD A;  3RZY A;  5LJK A;  4ARH A;  3EM0 A;  1LNM A;  3UEW A;  4YCH A;  3FA8 A;  1GKA B;  1KXO A;  4OMX A;  2FT9 A;  3HK1 A;  1E06 A;  4LZV A;  1EQD A;  3DSZ A;  3FA7 A;  1DF3 A;  3O22 A;  5HZ6 A;  2ACP X;  1PM1 X;  1JBH A;  3PH6 A;  1KGL A;  1ZNK A;  1IFC A;  1ERX A;  3NPO A;  4PSQ A;  3NP1 A;  2HYS A;  5EDC A;  5H9A A;  1ICN A;  2NND A;  3KFG A;  4QGX A;  2QO4 A;  2YG2 A;  1U18 A;  1AB0 A;  5F58 A;  4ZHF A;  2FS7 A;  4Y0R A;  1AQB A;  3WBG A;  2XST A;  3WVM A;  4NLJ A;  2A0A A;  4YCE A;  3I0A A;  1SY3 A;  1CRB A;  3BS2 A;  1BBP A;  3FMZ A;  4ZH9 A;  5L8N A;  1O1U A;  3VG5 A;  5HA1 A;  3HWF A;  2WEW A;  4YFQ A;  1ZNE A;  2O62 A;  4NP1 A;  3WJF A;  4BOE A;  5JR8 A;  4ZHD A;  4TQ2 A;  1TOU A;  5HA0 A;  2KT4 B;  3BY0 A;  3C76 X;  4AZR A;  4EEJ A;  1QFV A; 
#chains in the Genus database with same CATH topology
 1ICM A;  1TOW A;  5FEN A;  2A2G A;  2OY1 O;  1EPB A;  1SWR A;  4GGZ A;  4Z6J A;  3WJB A;  5FFH A;  1TVQ A;  1WUB A;  3HOL A;  1OPA A;  2FWV A;  1SA8 A;  4IB8 A;  2BSZ A;  3RDQ A;  4XMH A;  2G79 A;  1MVG A;  1STR B;  5B11 O;  1I05 A;  1JMZ A;  2HZR A;  3C77 X;  3FEL A;  1SY0 A;  3KFF A;  3CQN A;  5L8I A;  5B2A O;  3VG4 A;  1BM5 A;  1EUO A;  5KHP A;  2RTN B;  4JHQ A;  4I9S A;  2F73 A;  2WPU A;  5D45 A;  1LDO A;  4QAE A;  4UU3 A;  4AW8 A;  4ON1 A;  1I78 A;  2OF8 A;  2R56 A;  2JN3 A;  3TZS A;  4O4O A;  1MM9 A;  5FQ8 E;  1B8E A;  1EPA A;  1RXJ A;  4MVI A;  3TGA A;  3ZW1 B;  1CBQ A;  4CSB A;  5LJB A;  3ZI8 A;  3KQ0 A;  5HZ5 A;  1W4T A;  4NV8 A;  5EZ2 A;  5AEO A;  1NP4 A;  3WZP A;  1X8Q A;  2QCB A;  2HLV A;  2Z4I A;  5IRA A;  2CAM A;  1VYF A;  4C5P A;  5LKE A;  4GDA A;  3NX2 A;  4IMN A;  2RD7 C;  1ACD A;  4OS0 A;  1LPJ A;  5LJD A;  3T2W A;  1DZM A;  1MUP A;  4HPC A;  2RTG B;  1K3B A;  2LBA A;  3VU1 A;  1BJ7 A;  1QFT A;  4I60 A;  5K67 A;  3D95 A;  4WFU A;  2HMB A;  1RBP A;  2AMM X;  1LID A;  1QY1 A;  4TLJ A;  1AVE A;  1VWI B;  3F8A A;  5D4A A;  4BCS A;  1W6F A;  3VE1 A;  4AZP A;  3NR3 A;  3FR5 A;  3VHM A;  3RE5 A;  5F2B A;  2RCQ A;  5F6B A;  3RDS A;  2RQ0 A;  1FEN A;  2RTI B;  4ZJ0 A;  1UYN X;  3QKG A;  3P6E A;  2L67 A;  2LA7 A;  2NNE A;  4LKT A;  2FRS A;  2KD2 A;  4XMG A;  2M4L A;  2FHL A;  3NQK A;  3VG5 A;  1VWE B;  2E4J A;  4O9S A;  4MIS A;  4JGL A;  3JQO A;  3FEN A;  1SWB A;  1VWK B;  1QY2 A;  4KT5 A;  5BVS A;  5BVQ A;  2IZB A;  2FHN X;  1KOI A;  1HN2 A;  1NP1 A;  4O3Z A;  2I5V O;  1VWR B;  5HZ8 A;  1JQP A;  4OS8 A;  5LJH A;  1E5P A;  2ACO A;  5C0N A;  2IZG B;  4MIR A;  4U3Q A;  1KQX A;  4AZM A;  3WJC A;  2OL8 O;  2X34 A;  1OEK A;  2FR3 A;  3D4R A;  2A2U A;  2K23 A;  2W2B A;  3PDF A;  5F7G A;  1IKE A;  4BX6 A;  4KH8 A;  4ZHC A;  2GTL N;  1EIO A;  3Q6L A;  1IKJ A;  4OEM A;  2MM3 A;  1VWQ B;  2RTK A;  1FEM A;  1S44 A;  1BEB A;  1JJU A;  1RLB E;  4ZR2 A;  3RKG A;  1D2U A;  1Y9T A;  1VWO B;  1GM6 A;  2LBV A;  3IFB A;  1NC9 A;  2QO5 A;  1LF7 A;  1VYO A;  2UZ2 A;  5EPQ A;  4D6B A;  4RUU A;  2CBS A;  5LKF A;  4FBV A;  3MVF A;  3MX7 A;  2OL7 A;  1IFB A;  1SWG A;  1YWC A;  2KTD A;  1SWH A;  2CM9 A;  5IO6 A;  2CBR A;  1OPB A;  3WXQ A;  5B10 O;  1SXY A;  1MX7 A;  2AVI A;  1SWU A;  3WOV A;  2RTH B;  2JOZ A;  3S5X A;  3BRN A;  4YKO A;  2Q9S A;  4KCA A;  4ID2 A;  4CDF A;  2GH7 A;  1X8P A;  5HZQ A;  3TF6 A;  3TGB A;  1LIF A;  3HWE A;  1QG5 A;  1H91 A;  2OY8 A;  2A5C A;  1P6P A;  1ALB A;  1ZRY A;  3PPT A;  2RTF B;  1BRP A;  3K3L A;  4ORW A;  4YGZ A;  5CSE A;  4NNT A;  1Z24 A;  4EQA C;  3VHH A;  2GC9 A;  3PEC A;  2GTL M;  2QMI A;  2QO6 A;  2Z4H A;  4PJ2 A;  4QGW A;  2VFC A;  2WWP A;  5H9K A;  2QM9 A;  3CBC A;  3O19 A;  3EMM A;  5HCD C;  3T6F A;  4YKM A;  1DZK A;  1SXX A;  4IAW A;  3ZWE A;  4HPB A;  4BBO A;  1A57 A;  1HY2 A;  3EW1 A;  3P02 A;  1HMS A;  3H3I A;  3L4R A;  3VHI A;  1DFV A;  4ZH6 A;  4LKP A;  5LJG A;  4OMW A;  4CPI A;  3VG6 A;  2L9C A;  2MF6 A;  5HTE A;  3VG2 A;  1VWL B;  1N43 A;  4MEE A;  3APU A;  1KT4 A;  4YDA A;  1OEJ A;  4ZHG A;  1NQM A;  2Q39 A;  3FW4 A;  2L68 A;  4I95 A;  2JU3 A;  4BX5 A;  4ZGF A;  3U03 A;  3WJE A;  4FQB B;  4TKJ A;  2POA A;  1NBX A;  1GT4 A;  4IBA A;  4A8Z A;  3ZW0 B;  1B0O A;  3AKN A;  2ALL X;  4ML7 B;  3CKF A;  4FGI B;  3FEP A;  3BSZ E;  3UEV A;  5D47 A;  1SWE A;  2F09 A;  3DTQ A;  3ZUO A;  2IZE B;  1LUQ A;  3FA9 A;  1BRQ A;  4NV7 A;  2IZA A;  3P6G A;  4WFV A;  2GTL O;  1G7N A;  4GJV A;  3BX7 A;  3IA8 A;  3FA6 A;  4CPH A;  3FR4 A;  1KT7 A;  2MWH A;  1BSQ A;  3C78 X;  2ZAG A;  4ORU A;  4N7C A;  3VPJ E;  5HZ9 A;  1AVD A;  1HMT A;  1GGL A;  1QQS A;  4Y0P A;  2G78 A;  2N93 A;  1SXW A;  2X8S A;  4INN A;  3NX1 A;  3WYQ A;  3WYP A;  2HZQ A;  4CPE A;  1VPR A;  4XMC A;  3AKM A;  3PP6 A;  3FLL A;  2PI3 O;  4I3C A;  3UEX A;  1LIB A;  5DG4 A;  1ZND A;  1B4M A;  1JV4 A;  1X71 A;  3PK2 A;  3CR6 A;  4WBK A;  2OFA A;  1AEL A;  2AL0 X;  3B2K A;  2FS6 A;  3SLT A;  2RTO B;  1ZNL A;  4QYN A;  4LQZ A;  1IJ8 A;  2X8T A;  4CDC A;  1DV9 A;  4ORS A;  5AQ6 A;  3ZW2 A;  1G74 A;  2X55 A;  4IAB A;  4YVB A;  3EBK A;  4GH7 A;  4AYH A;  3JS1 A;  4ZFX A;  2IZC B;  2CZT A;  4LZU A;  4MVL A;  4HPA A;  4I3D A;  1ZNG A;  1LKE A;  1Y52 X;  3P6F A;  1D3S A;  1GX8 A;  2AH7 X;  3SLO A;  3STN A;  3SZJ A;  4BVM A;  4YFR A;  1SRJ A;  5LJC A;  1JJJ A;  1N9M A;  5CE4 A;  2FTB A;  1O1V A;  3B2L A;  1LIC A;  3QQ2 A;  3RE6 A;  2IZF B;  5IRW A;  2JU7 A;  5HCC C;  4JO6 A;  2RTC B;  1I9H A;  4Z28 A;  4XMD A;  1KZW A;  1DZP A;  2HKD A;  2XKL A;  4QGV A;  4IRW A;  1YWB A;  2OF9 A;  3NAD A;  4GDZ A;  2OVE A;  5L3Y A;  3EW2 A;  2WQA E;  3CMP A;  3WZO A;  4CK4 A;  2FLJ A;  3ELX A;  4R0B A;  3B2I A;  5EED A;  1HMR A;  3B2J A;  4Z2P A;  1JYD A;  5H9L A;  5CYB A;  2RTB B;  3FYF A;  3V8U A;  1NGL A;  3F9D A;  1SWK A;  1SY1 A;  1LDQ A;  4O3X B;  1YUP A;  1SRI A;  3P6H A;  1STP A;  4M7M A;  1A18 A;  4B55 A;  1N0S A;  3OD9 A;  2OFR X;  4AZN A;  4BX7 B;  4YMY A;  3S5V A;  3WJG A;  4ORR A;  5FQ6 E;  4YBP A;  4CDD A;  3STK A;  1SWQ A;  1T68 X;  1T8V A;  1U0X A;  2RTL A;  2UYW A;  1YWA A;  5DPQ A;  5FAZ A;  1LFO A;  2MO5 A;  2OVS A;  1I4U A;  5BVT A;  3TGC A;  2LB6 A;  1T0V A;  1OBU A;  1YP6 A;  5IO7 A;  3HTY A;  4ALO A;  5KID A;  3CQR A;  1CBI A;  2NNQ A;  4KC8 A;  5K68 A;  2C1S A;  4IB9 A;  1VWJ B;  1Y53 X;  2JU8 A;  4N7D A;  2ANS A;  2WR6 A;  3S26 A;  1UZ2 X;  1OBQ A;  2AT6 X;  2MHD A;  4BX6 B;  4Z2V A;  2A8G A;  1RAV A;  1HBQ A;  3FW5 A;  1ZNH A;  2EU7 X;  3HWD A;  1XKI A;  1IIU A;  4HWM A;  3MM0 A;  3SAO A;  4TJZ A;  5HTD A;  1CJ5 A;  4IMO A;  3ZQ3 A;  2PY1 A;  2KTS A;  1X8N A;  2ASN X;  3LHN A;  1G85 A;  3BU1 A;  2JGS A;  2A5B A;  1HBP A;  4A1Y A;  1EII A;  3KFI A;  1SWS A;  4I6S A;  1S2P A;  4ZGU A;  1Y55 X;  2VFB A;  1GX9 A;  2Y32 A;  5KIC A;  3NQ9 A;  4GK9 A;  3AEH A;  1GKA A;  3WZQ A;  4EXZ A;  1G5W A;  4HFO A;  1SWJ A;  1TXL A;  4MVE A;  5CHK A;  2RTR B;  3F6Z B;  4YBU A;  1DZJ A;  3PED A;  4YFP A;  4DNE A;  2Y3F A;  1PTS A;  3RSW A;  2BS6 A;  1R0U A;  4GJS A;  3RDX A;  3T2X A;  3ZUI A;  5B5F A;  4CV7 A;  3PH5 A;  2IZK A;  2BLG A;  4GNW A;  4NNS A;  2R73 A;  3HWG A;  2LKK A;  4QQ1 A;  5K06 A;  1OBP A;  4GUZ A;  1GT3 A;  4I9R A;  4IAX A;  4BX5 B;  2RCT A;  1YP7 A;  4QZT A;  2WQ9 A;  1E02 A;  2JMB A;  1A2D A;  5AJC A;  4FBR A;  4ES7 A;  5EEE A;  3T1D A;  3Q34 A;  3BU9 A;  1LCZ A;  1JJX A;  1K24 A;  3RY1 A;  3FIQ A;  1MK5 A;  4Z2O A;  5H9N A;  3ELZ A;  1FDQ A;  3NQ3 A;  3U9P C;  2RTQ B;  3T6L A;  2GTF X;  3WJD A;  3GAQ A;  3FDC A;  1VWG B;  2QOS C;  4ZCB A;  4QYP A;  2NP1 A;  3HOE A;  4EDE A;  1KQW A;  2HNX A;  3U0D A;  5F1E A;  1RXH A;  2AKQ A;  1PEE A;  3ZW0 A;  1ERB A;  2W2F A;  2FKJ A;  2A3F X;  4QNI A;  1B56 A;  1FEL A;  4WHI A;  1XCA A;  4OEL A;  1YIV A;  1I06 A;  2FKG A;  4MVK A;  4FBO A;  4HPD A;  2X32 A;  4O4S A;  3RWX A;  2A13 A;  4GRJ A;  4U8U N;  4D6A A;  3OE3 A;  4AZO A;  4Z27 A;  3P6D A;  2W2A A;  4NYQ A;  4BJ8 A;  5IXG A;  3UEU A;  4GZV A;  4KII A;  1GT1 A;  1ML7 A;  2G5L A;  2LFO A;  1QWD A;  1TW4 A;  3CBS A;  3GE2 A;  1S7D A;  4GET A;  1CBS A;  2OVD A;  3BDR A;  4A60 A;  4TKB A;  5EDB A;  2RTE B;  4Y0Q A;  1MDC A;  4QRL A;  4YH0 A;  1U17 A;  2IZI A;  4CPH B;  4EKV A;  1SWD A;  2WUT A;  3B2H A;  4BQU A;  1SWT A;  2CZU A;  4IB7 A;  2Q2P A;  4XME A;  3PQS A;  1SLD B;  5B5G A;  2K62 A;  3APX A;  4GGR A;  4O4X A;  4O4U A;  2VDF A;  1IW2 A;  5BYP A;  1EAL A;  1MEP A;  2QOM A;  4GKC A;  2GJ5 A;  1BSY A;  2FGS A;  3BLG A;  1SXU A;  5LJE A;  1CBR A;  1KT6 A;  1VWA B;  1BSO A;  5HAE A;  3LV4 A;  4NYR A;  3BX8 A;  2WSJ A;  2X4M A;  3P24 A;  4YGG A;  4ZHH A;  1KT5 A;  1MX8 A;  5L8O A;  1I04 A;  1UYO X;  3CWK A;  4GD9 A;  3WZN A;  4GU8 A;  3APV A;  4O3Y A;  1SY2 A;  2R74 A;  1HQP A;  1SLE B;  4U8U M;  3SOT A;  1EW3 A;  4K19 A;  2AT5 X;  3EBW A;  2DJF A;  5HBS A;  1VYG A;  2X46 A;  3G7X A;  2OYB O;  4AZQ A;  2OVA A;  1KL4 A;  3VG3 A;  4DQ3 A;  2G7B A;  4Y0S A;  1PBO A;  2RTM A;  1SWF A;  2ZAI A;  2X8F A;  3MBT A;  1X89 A;  4ORX A;  3MG5 A;  4Y5D A;  1O8V A;  3OJY C;  1PMP A;  4TKH A;  5IRU A;  2OY5 O;  3S60 A;  3FEK A;  4ORY A;  1SWC A;  4Y59 A;  2MJI A;  1W5R A;  3APW A;  1VWC B;  2Q2M A;  2RTA A;  1X8U A;  5D48 A;  4RUN A;  2OZQ A;  3SZH A;  4EFG A;  2CM4 A;  5H8T A;  1E00 A;  3FR2 A;  4YGH A;  4ALB A;  1SMP I;  1FJ1 E;  1N4J A;  2BT9 A;  4NLI A;  4QZU A;  1YWD A;  4NW4 A;  2KW1 A;  3HPE A;  5D8J A;  2OY7 A;  2RTD B;  1ADL A;  2YMS A;  1KZX A;  1JYJ A;  2X56 A;  1GT5 A;  4GGT A;  3N91 A;  1LCW A;  3KVN A;  1Y0G A;  1EI5 A;  1KFF A;  1OSP O;  1PBY A;  4BX7 A;  4CPF A;  1KT3 A;  2Q4N A;  3EYC A;  1RXK A;  1SLG B;  3O2Y A;  4U8U O;  5IO5 A;  1OEE A;  2AT3 X;  2OFM X;  2X45 A;  3P6C A;  1WBI A;  1EXS A;  5B27 A;  3SLJ A;  2C4I A;  2WEX A;  4UU2 A;  1Y9L A;  4XMF A;  4U9C A;  4YDB A;  1SRH A;  1NQN A;  2IZH B;  2IFB A;  4O49 A;  3RDO A;  1GXA A;  1VWP B;  1JIW I;  1VWF B;  1LEL A;  2P8G A;  3JSQ A;  3FID A;  4IB6 A;  4CDE A;  1MOY A;  5HCE C;  3STM X;  2L5P A;  1LIE A;  1STS B;  1SWL A;  1FE3 A;  4O3W A;  2RA6 A;  5HWZ A;  3RBY A;  3ZW1 A;  1N7Y A;  1SRE A;  3D96 A;  4JNJ A;  1SWO A;  3KZA A;  5B3M O;  1DC9 A;  1SWP A;  2FR2 A;  3EC5 A;  3KFH A;  3OBL A;  1AVG I;  3NBX X;  1KL5 A;  1URE A;  1FTP A;  2IZL B;  1L6M A;  3D97 A;  3RDM A;  1QY0 A;  5B29 A;  2AT0 X;  4GNY A;  4OS3 A;  1X8O A;  4TNN A;  4OKA A;  1RSU B;  2DM5 A;  1A3Y A;  1QAB E;  2AT8 X;  4GE1 A;  1SWN A;  4I3B A;  2F01 A;  4DQ4 A;  1DF8 A;  5F6Z A;  3VG7 A;  4M6S A;  3VGW A;  2BHV A;  3I17 A;  4L3R A;  1JZU A;  1BLR A;  2AF5 A;  1SRG A;  1N9Y A;  2BC3 A;  4A1H A;  1KL3 A;  2OL6 O;  1RST B;  1BWY A;  4ODD A;  3RZY A;  5LJK A;  4ARH A;  3PQU A;  2I5Z O;  2JW1 A;  2RTJ A;  3EM0 A;  1LNM A;  4DCB A;  1SLF B;  3D9W A;  2OFB A;  3E3C A;  4YCH A;  3FA8 A;  1GKA B;  1KXO A;  4OMX A;  3UEW A;  2FT9 A;  3HK1 A;  1E06 A;  4LZV A;  1EQD A;  3DSZ A;  3FA7 A;  1DF3 A;  3O22 A;  4KC7 A;  1LCV A;  5HZ6 A;  1SWA A;  2ACP X;  5FQ7 E;  3UAQ A;  1PM1 X;  1JBH A;  3PH6 A;  5JD2 A;  1ZNK A;  1KGL A;  1IFC A;  3CKG A;  4BGF A;  1ERX A;  1SRF A;  3NPO A;  2RN4 A;  2G8C O;  2RTP B;  4PSQ A;  3NP1 A;  2HYS A;  5EDC A;  2BS5 A;  5H9A A;  3RY2 A;  2ZSC A;  1ICN A;  1VWH B;  1VWM B;  2NND A;  1HXL A;  3KFG A;  3LTW A;  4QGX A;  2QO4 A;  2C1Q A;  2YG2 A;  1U18 A;  1AB0 A;  5F58 A;  4ZHF A;  1NDJ A;  2FS7 A;  1JMX A;  3ZZV A;  4Y0R A;  1AQB A;  2IZJ A;  3WBG A;  2XST A;  3VE2 A;  3WVM A;  2DJG A;  1VWD B;  4NLJ A;  1GX3 A;  2A0A A;  3RDU A;  1VWB B;  4YCE A;  3I0A A;  3X00 A;  1HXZ A;  1SY3 A;  1CRB A;  3BS2 A;  1BBP A;  3SZI A;  3FMZ A;  4L1N A;  5AJB A;  1E2T A;  4U46 A;  4ZH9 A;  5L8N A;  1VWN B;  1HQQ A;  1O1U A;  5HA1 A;  3HWF A;  2WEW A;  2Y3E A;  1ZNE A;  2O62 A;  4NP1 A;  4YFQ A;  3WJF A;  4BOE A;  2IZD B;  5JR8 A;  4ZHD A;  4TQ2 A;  1TOU A;  5HA0 A;  3AUM O;  4COT A;  2KT4 B;  3BY0 A;  3C76 X;  4AZR A;  4EEJ A;  1QFV A; 
#chains in the Genus database with same CATH homology
 1ICM A;  1TOW A;  5FEN A;  2A2G A;  1EPB A;  3WJB A;  5FFH A;  1TVQ A;  3HOL A;  1OPA A;  2FWV A;  1SA8 A;  4IB8 A;  4XMH A;  2G79 A;  1MVG A;  4EQA C;  1I05 A;  2HZR A;  3C77 X;  3FEL A;  3KFF A;  1SY0 A;  5L8I A;  3CQN A;  3VG4 A;  1BM5 A;  1EUO A;  5KHP A;  4I9S A;  2F73 A;  5D45 A;  4QAE A;  4UU3 A;  4AW8 A;  4ON1 A;  2R56 A;  2JN3 A;  3TZS A;  4O4O A;  5FQ8 E;  1B8E A;  1EPA A;  4MVI A;  3TGA A;  1CBQ A;  5LJB A;  3ZI8 A;  3KQ0 A;  5HZ5 A;  5AEO A;  5EZ2 A;  1NP4 A;  1X8Q A;  2HLV A;  2Z4I A;  1VYF A;  5LKE A;  4IMN A;  3NX2 A;  2RD7 C;  1ACD A;  4OS0 A;  1LPJ A;  5LJD A;  1DZM A;  1MUP A;  4HPC A;  2LBA A;  3VU1 A;  1BJ7 A;  1QFT A;  3D95 A;  4WFU A;  2HMB A;  1RBP A;  2AMM X;  1LID A;  1QY1 A;  4TLJ A;  3F8A A;  5D4A A;  3VE1 A;  4AZP A;  3NR3 A;  3FR5 A;  5F6B A;  2RCQ A;  2RQ0 A;  1FEN A;  4ZJ0 A;  3QKG A;  3P6E A;  2L67 A;  2LA7 A;  2NNE A;  4LKT A;  2FRS A;  2KD2 A;  4XMG A;  2M4L A;  3NQK A;  2E4J A;  4O9S A;  4MIS A;  4JGL A;  3JQO A;  3FEN A;  1QY2 A;  4KT5 A;  5BVS A;  5BVQ A;  4O3Z A;  1KOI A;  1HN2 A;  1NP1 A;  5HZ8 A;  4OS8 A;  5LJH A;  1E5P A;  2ACO A;  5C0N A;  4MIR A;  4U3Q A;  1KQX A;  4AZM A;  3WJC A;  5F7G A;  1OEK A;  2FR3 A;  3D4R A;  2A2U A;  2K23 A;  2W2B A;  4ZHC A;  1IKE A;  4KH8 A;  2GTL N;  1EIO A;  3Q6L A;  1IKJ A;  2MM3 A;  1FEM A;  1S44 A;  1BEB A;  1RLB E;  3RKG A;  4ZR2 A;  1D2U A;  1Y9T A;  1GM6 A;  2LBV A;  3IFB A;  2QO5 A;  1LF7 A;  5EPQ A;  4D6B A;  4RUU A;  2CBS A;  5LKF A;  4FBV A;  3MVF A;  3MX7 A;  1IFB A;  1YWC A;  2KTD A;  2CM9 A;  5IO6 A;  2CBR A;  1OPB A;  3WXQ A;  1SXY A;  1MX7 A;  3WOV A;  2JOZ A;  3S5X A;  3BRN A;  4YKO A;  2Q9S A;  4KCA A;  4ID2 A;  3TGB A;  1X8P A;  5HZQ A;  3TF6 A;  1LIF A;  3HWE A;  1QG5 A;  1H91 A;  1P6P A;  1ALB A;  1ZRY A;  3PPT A;  4ORW A;  1BRP A;  3K3L A;  4YGZ A;  4NNT A;  1Z24 A;  2GC9 A;  3PEC A;  2GTL M;  2QMI A;  2QO6 A;  2Z4H A;  4PJ2 A;  4QGW A;  2WWP A;  5H9K A;  2QM9 A;  3CBC A;  3O19 A;  3EMM A;  5HCD C;  4YKM A;  1DZK A;  1SXX A;  4IAW A;  3ZWE A;  4HPB A;  1A57 A;  3P02 A;  1HMS A;  3H3I A;  3L4R A;  1DFV A;  4ZH6 A;  4LKP A;  5LJG A;  4OMW A;  3VG6 A;  2L9C A;  5HTE A;  3VG2 A;  3APU A;  1KT4 A;  4YDA A;  1OEJ A;  4ZHG A;  2Q39 A;  3FW4 A;  2L68 A;  4I95 A;  2JU3 A;  4ZGF A;  3U03 A;  3WJE A;  4FQB B;  4TKJ A;  2POA A;  1GT4 A;  4IBA A;  4A8Z A;  3ZW0 B;  1B0O A;  3AKN A;  2ALL X;  4ML7 B;  4FGI B;  3FEP A;  3BSZ E;  3UEV A;  5D47 A;  2F09 A;  3DTQ A;  3ZUO A;  3FA9 A;  1BRQ A;  3P6G A;  4WFV A;  2GTL O;  1G7N A;  3BX7 A;  3IA8 A;  3FA6 A;  3FR4 A;  1KT7 A;  2MWH A;  1BSQ A;  3C78 X;  2ZAG A;  3VPJ E;  4N7C A;  5HZ9 A;  1HMT A;  1GGL A;  1QQS A;  4Y0P A;  2G78 A;  2N93 A;  1SXW A;  2X8S A;  4INN A;  3NX1 A;  2HZQ A;  1VPR A;  4XMC A;  3AKM A;  3PP6 A;  3FLL A;  3UEX A;  4I3C A;  1LIB A;  5DG4 A;  1ZND A;  1B4M A;  1JV4 A;  1X71 A;  3CR6 A;  4WBK A;  1AEL A;  2AL0 X;  3B2K A;  2FS6 A;  1ZNL A;  4QYN A;  4LQZ A;  2X8T A;  1DV9 A;  4ORS A;  5AQ6 A;  3ZW2 A;  1G74 A;  4IAB A;  3EBK A;  4GH7 A;  4AYH A;  3JS1 A;  4ZFX A;  2CZT A;  4LZU A;  4MVL A;  4HPA A;  4I3D A;  1ZNG A;  1LKE A;  3P6F A;  3STN A;  1D3S A;  1GX8 A;  2AH7 X;  4BVM A;  4YFR A;  5LJC A;  1JJJ A;  5CE4 A;  2FTB A;  1O1V A;  3B2L A;  1LIC A;  2JU7 A;  5HCC C;  4XMD A;  1KZW A;  1DZP A;  2XKL A;  4QGV A;  1YWB A;  3NAD A;  4GDZ A;  2OVE A;  2WQA E;  3CMP A;  4CK4 A;  2FLJ A;  3ELX A;  4R0B A;  3B2I A;  5EED A;  1HMR A;  3B2J A;  1JYD A;  5H9L A;  5CYB A;  3FYF A;  3V8U A;  1NGL A;  3F9D A;  1SY1 A;  4O3X B;  1YUP A;  3P6H A;  4M7M A;  1A18 A;  1N0S A;  3OD9 A;  2OFR X;  4AZN A;  4YMY A;  3S5V A;  3WJG A;  4ORR A;  5FQ6 E;  4YBP A;  3STK A;  1T68 X;  1T8V A;  1U0X A;  5FAZ A;  1YWA A;  5DPQ A;  1LFO A;  2MO5 A;  2OVS A;  1I4U A;  3TGC A;  2LB6 A;  1T0V A;  1OBU A;  1YP6 A;  5IO7 A;  3HTY A;  4ALO A;  5KID A;  3CQR A;  1CBI A;  2NNQ A;  4KC8 A;  4IB9 A;  2JU8 A;  4N7D A;  2ANS A;  2WR6 A;  3S26 A;  1UZ2 X;  1OBQ A;  2AT6 X;  2MHD A;  4HWM A;  4ORU A;  1HBQ A;  3FW5 A;  1ZNH A;  2EU7 X;  3HWD A;  1XKI A;  1IIU A;  3SAO A;  3ZW1 B;  5HTD A;  4TJZ A;  1CJ5 A;  4IMO A;  3ZQ3 A;  2PY1 A;  2KTS A;  1X8N A;  2ASN X;  3LHN A;  1G85 A;  3BU1 A;  4A1Y A;  1HBP A;  1EII A;  3KFI A;  4I6S A;  1S2P A;  4ZGU A;  1GX9 A;  5KIC A;  3NQ9 A;  4GK9 A;  4EXZ A;  1GKA A;  1G5W A;  4HFO A;  1TXL A;  4MVE A;  3F6Z B;  4YBU A;  1DZJ A;  3PED A;  4YFP A;  3RSW A;  2BS6 A;  1R0U A;  4CV7 A;  3ZUI A;  3PH5 A;  4GNW A;  2BLG A;  4NNS A;  4QQ1 A;  2R73 A;  3HWG A;  2LKK A;  5K06 A;  1OBP A;  4I9R A;  1GT3 A;  4IAX A;  2RCT A;  1YP7 A;  4QZT A;  2WQ9 A;  1E02 A;  2JMB A;  1A2D A;  5AJC A;  4FBR A;  4ES7 A;  5EEE A;  3T1D A;  3BU9 A;  1JJX A;  3FIQ A;  5H9N A;  3ELZ A;  1FDQ A;  3NQ3 A;  3U9P C;  2GTF X;  3WJD A;  3GAQ A;  2QOS C;  4ZCB A;  4QYP A;  2NP1 A;  3HOE A;  4EDE A;  1KQW A;  2HNX A;  3U0D A;  5F1E A;  2AKQ A;  1PEE A;  3ZW0 A;  1ERB A;  2W2F A;  2A3F X;  4QNI A;  1B56 A;  1FEL A;  4WHI A;  1XCA A;  1YIV A;  1I06 A;  4MVK A;  4FBO A;  4HPD A;  4O4S A;  3RWX A;  2A13 A;  4GRJ A;  4U8U N;  4D6A A;  3OE3 A;  4AZO A;  3P6D A;  2W2A A;  4NYQ A;  3UEU A;  4GZV A;  4KII A;  1GT1 A;  2LFO A;  1ML7 A;  1QWD A;  1TW4 A;  3CBS A;  3GE2 A;  1S7D A;  4GET A;  1CBS A;  2OVD A;  3BDR A;  4A60 A;  4TKB A;  5EDB A;  4YH0 A;  4Y0Q A;  1MDC A;  4QRL A;  1U17 A;  2WUT A;  3B2H A;  4BQU A;  2CZU A;  4IB7 A;  2Q2P A;  4XME A;  3PQS A;  2K62 A;  3APX A;  4O4X A;  4O4U A;  1IW2 A;  5BYP A;  1EAL A;  4GKC A;  2GJ5 A;  1BSY A;  3BLG A;  1SXU A;  5LJE A;  1CBR A;  1KT6 A;  1BSO A;  5HAE A;  3LV4 A;  4NYR A;  3BX8 A;  2WSJ A;  4YGG A;  3P24 A;  4ZHH A;  5L8O A;  1KT5 A;  1MX8 A;  1I04 A;  3CWK A;  4GU8 A;  3APV A;  4O3Y A;  1SY2 A;  2R74 A;  1HQP A;  4U8U M;  3SOT A;  1EW3 A;  4K19 A;  2AT5 X;  3EBW A;  5HBS A;  1VYG A;  2X46 A;  3G7X A;  4AZQ A;  2OVA A;  3VG3 A;  4DQ3 A;  2G7B A;  4Y0S A;  1PBO A;  2ZAI A;  4ORX A;  2X8F A;  3MBT A;  1X89 A;  1O8V A;  3OJY C;  1PMP A;  4TKH A;  3S60 A;  3FEK A;  4ORY A;  2MJI A;  3APW A;  2Q2M A;  1X8U A;  5D48 A;  4RUN A;  2OZQ A;  4EFG A;  2CM4 A;  5H8T A;  1E00 A;  3FR2 A;  4YGH A;  4ALB A;  1SMP I;  2BT9 A;  4NLI A;  4QZU A;  1YWD A;  4NW4 A;  2KW1 A;  5D8J A;  1ADL A;  2YMS A;  1KZX A;  1JYJ A;  1GT5 A;  3N91 A;  1EI5 A;  1KT3 A;  2Q4N A;  3EYC A;  3O2Y A;  5IO5 A;  4U8U O;  1OEE A;  2AT3 X;  2OFM X;  2X45 A;  3P6C A;  1EXS A;  5B27 A;  2WEX A;  4UU2 A;  1Y9L A;  4XMF A;  4U9C A;  4YDB A;  4O49 A;  2IFB A;  1GXA A;  2P8G A;  1JIW I;  4IB6 A;  4CSB A;  3JSQ A;  5HCE C;  3STM X;  2L5P A;  1LIE A;  1FE3 A;  4O3W A;  2RA6 A;  5HWZ A;  3RBY A;  3ZW1 A;  3D96 A;  3KZA A;  1DC9 A;  2FR2 A;  3KFH A;  3OBL A;  1AVG I;  3NBX X;  1URE A;  3D97 A;  1FTP A;  5B29 A;  1L6M A;  5BVT A;  1QY0 A;  2AT0 X;  4GNY A;  4OS3 A;  1X8O A;  4TNN A;  2DM5 A;  4GE1 A;  1A3Y A;  1QAB E;  2AT8 X;  4I3B A;  4DQ4 A;  5F6Z A;  3VG7 A;  4M6S A;  2BHV A;  3I17 A;  4L3R A;  1JZU A;  1BLR A;  4A1H A;  1BWY A;  4ODD A;  3RZY A;  5LJK A;  4ARH A;  3PQU A;  2JW1 A;  3EM0 A;  1LNM A;  3E3C A;  3UEW A;  4YCH A;  3FA8 A;  1GKA B;  1KXO A;  4OMX A;  2FT9 A;  3HK1 A;  1E06 A;  4LZV A;  1EQD A;  3DSZ A;  3FA7 A;  1DF3 A;  3O22 A;  4KC7 A;  5HZ6 A;  2ACP X;  5FQ7 E;  3UAQ A;  1PM1 X;  1JBH A;  3PH6 A;  1KGL A;  1ZNK A;  1IFC A;  1ERX A;  3NPO A;  2RN4 A;  4PSQ A;  3NP1 A;  2HYS A;  5EDC A;  2BS5 A;  5H9A A;  1ICN A;  2NND A;  3KFG A;  4QGX A;  2QO4 A;  2YG2 A;  1U18 A;  1AB0 A;  5F58 A;  4ZHF A;  2FS7 A;  3ZZV A;  4Y0R A;  1AQB A;  3WBG A;  2XST A;  3VE2 A;  3WVM A;  4NLJ A;  2A0A A;  4YCE A;  3I0A A;  1SY3 A;  1CRB A;  3BS2 A;  1BBP A;  3FMZ A;  4L1N A;  5AJB A;  4ZH9 A;  5L8N A;  1O1U A;  3VG5 A;  5HA1 A;  3HWF A;  2WEW A;  4YFQ A;  1ZNE A;  2O62 A;  4NP1 A;  3WJF A;  4BOE A;  5JR8 A;  4ZHD A;  4TQ2 A;  1TOU A;  5HA0 A;  4COT A;  2KT4 B;  3BY0 A;  3C76 X;  4AZR A;  4EEJ A;  1QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...