5L8JB

Aurora-a kinase domain in complex with vnar-d01 s93r
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
MARVDQTPRIATKETGESLTINCVLRDTACALDSTNWYRTKLGSTKEQTISIGGRYSETVDEGSNSASLTIRDLRVEDSGTYKCKAIDSCWLRREGAGTVLTVKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aurora kinase A
publication title Allosteric inhibition of Aurora-A kinase by a synthetic vNAR domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 24
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l8jB00
1SVCP 2BY1A 4DAGH 1CDYA 4U3HA 3KVQA 4F3FB 4ZOAA 4KK8D 3GHBH 4PJXF 1CDIA 1IAIH 5HD8D 4L3CB 3T2NH 1CIUA 2DBJA 2P8PB 4G8GE 3G5XA 3TNNA 1XCTA 3B9DA 2ZUQC 3IXAA 2X1WL 2R2BA 4JM2B 4UDUA 3HI1A 4D3CH 4M48L 4L4VE 2Y9RT 5ILTL 4I77L 3SKNB 5E94A 3U83A 2UZIL 1U3YA 3KPRD 3PL6D 4W81A 4X9IA 3SGEH 2NX5A 4F7EB 4GMTL 4LHQB 2BDNL 2QQKL 3DVIA 4JHZA 4P3CH 3BDYH 5EU3A 4GMSH 3VRIB 2FRGP 1T7YA 4KMTH 3GRWL 5AYUL 3W2DL 3ZKND 3BSZL 1E4XH 1LEKA 4FABH 1CLCA 4UZGA 4YDLC 4KV5F 3MRFA 4Q7DA 5E2JA 1U8HA 3RL2A 4FFZH 4WTXA 4G6ML 5E5MA 1AQKH 4ZFGL 5I75C 1A6UL 3IDNB 1LEGA 3LKRB 4OF0A 3P30L 2VLRD 3K0WA 1X9QA 3NABH 2LE9A 2MCPH 5ETUB 5F6HI 3LKNA 4FP8H 1CD1B 1TMCB 1OTUC 2EE3A 3C5ZA 5FM5M 4OLUH 4FQIH 2FX7L 1DQQB 1PG7W 4Z7QE 4CVUA 1E4WL 4NYLB 3NTCH 2BZDA 1EGJA 1N2RB 2HKHH 1CE6A 4CGTA 4G42B 2HN7B 5IESL 4Y8DC 3RTQA 1Y6MR 4GJTB 5J4MA 1E27B 3ALPA 4Z7VF 4EIZC 1RMFH 5D71L 4MZ3A 2HFTA 5C8JB 3LN4B 2A38A 1T5XB 2AAVA 3V4UL 3HB3D 1MI5D 2FBJH 4K8RH 3V0VA 3F58L 3WNPA 4Q0XL 4D0CA 1EFXD 1MWAB 1RIUH 1I7UA 1JPGA 4K3DL 2W92A 3IXTA 3WKNA 3GIZH 3L5WA 4YHIB 3ULVH 4ERSL 2J8HA 4X6EB 3K74B 2FLBT 3RWFB 1KC5L 4F2MB 4ZFOA 4LLWB 3BE1H 3QDHA 3LN5B 2Y5TA 3VFWA 4KROB 2XWTA 4NBYB 4CJ0A 4R4FH 1U2CA 1AD0A 2ADIA 3W0WE 1J1XL 1FN4A 3CPLB 1E28B 4Y4KD 5C7XH 2CDGB 1C5BH 1EXUB 1A64A 3SQOH 2F53E 1P84K 5KSBF 2RCSL 3O11B 5IFJA 3VFNB 2FD6L 5T5NG 4NNPH 4AENB 1ZT4A 2BOCB 2OLDA 1MIML 4XP1L 3TBWB 2ZUUA 4RCAA 3VCLB 3V4PL 5DMIL 1PKQA 4K9EH 4KZEH 3FO0L 4U1JB 3PIQB 4DJMA 4R8WL 4PG9A 4UUJA 4P4KC 1QLRB 4NN5B 1UB6B 3HR5B 1EHLL 4DQOH 4CVXA 4F7CB 3QQNA 5I1LA 4HUWB 4UNUA 4YDKH 1MJ8L 4U1KA 5FUZH 4M61A 1HHIB 4D2NA 3GM8A 1G6RB 3ULVE 4FFWC 4JY5L 1B0RB 4TTDD 1BGXH 1PFCA 4M7LL 4RFNC 5DF0A 1MFDL 4YHZL 4Y8AA 4HUXB 2X5PA 2BRRH 3QNZB 35C8H 3FN9A 4NZUH 3A6OA 3VWJC 1K5NB 3D39A 5JPMB 1AXTH 3STZA 1VGEL 2E9WA 4Q9RH 5FHAL 2JCCE 1G7PB 1XGTA 1RJCA 5BVPH 3MRRB 1HIML 4GW5A 4R7DA 3A6CH 2C1OA 1CD9B 5CCKL 3KPRB 3PL6B 5BRZB 1MRCL 2VDMH 4JN1L 2ADGA 3G08A 3UTTA 1MQ8A 2I5YL 3UCRA 1NGXB 3GJFH 2AQ1A 5ACZB 4XBPB 1S9YB 4YX2L 4HFWB 1H15B 2X89D 3SO3C 4NQXB 3VXSD 5FECA 3VW3H 3G6AA 1ZLSL 2R29H 2OTUA 1NUGA 1PYWB 3OJVC 1JMXA 4KI5D 4JFYA 1LE9B 3IFPB 3L3HA 3Q0HA 2LU4A 4JQIH 4PRAA 4XGZB 5DRZB 1AD9B 4HFUH 4GT7A 4WI4A 3UTQA 1XF3A 3QCVH 3QUZD 3U1SL 4QXUL 3MRPA 4ODUA 4ONFL 4OF7A 3QXDA 4LARL 3S5LA 2JJWA 4AEFA 4P2RD 3WHE1 4V2CB 4JZJA 4NC0B 2QL1A 5SX4I 3GMQB 1TZHA 2Y72A 4PJ8A 4BSVB 1XGPA 3CVHL 5CSZB 1FAIL 4KTDL 1LO0H 3FQWA 3TYFA 3MRLA 1ETZB 3CLEH 2ARJB 5HYEA 1CDJA 4RAVA 3HC4L 4NDMB 3L9RB 3EW3B 1F11A 2J88H 1A3RH 1DN0A 4PV8B 1K4DA 3MFGB 1EFXB 5FCUH 4RAHA 4NQTA 1LP9F 3GKWH 1XZ0B 1YEDB 3EOTH 3ZL4H 4MD4A 4HV8A 1QKZL 2XKNB 1KJ3L 3SE9H 4IRZH 1BFTA 5CBAB 3LSOB 4OLXH 5A2LH 3MRKA 2EC9T 5F7NC 2EDJA 3AREC 3B9KA 1T0NB 3DURA 1I1AC 2GJ6E 1JNHB 5C0GB 4R7NB 1Z2KA 3JV6A 5HVGB 1NFKA 2Z8RA 4XTRD 4L8DA 5T5FL 1X5LA 1MHEA 4D94A 3T77B 1WVZA 1N64L 3H3PH 4PJIB 5JXAH 1VPOH 3MRGA 3BGFB 4TNWK 2AVGA 4Z6AT 4PYGA 5H2BA 2GHWB 4M43L 2YSSB 2DLGA 5FO9A 1JP5A 5CBEB 3OL2A 1A6VL 4TOYH 1MJJA 4ZTPL 4JFFA 5IQ7L 1DSFH 3INUL 1IFHL 4QEGA 2QQLL 4DKEL 3UTPE 3FB7A 1G9MH 2HH0L 3CDYA 3CDFA 5ID1A 3S37L 3QDJE 1DLHA 3O9WD 3P9LB 4ELKA 5EUKA 1FGNH 4FQCH 4Z78A 4JFDD 2OJEA 1G6VK 4NCC2 3L1OH 4JFPA 5GS1B 4M6MH 4L8CA 4LRNL 3VRJB 5CWSB 3MRHB 1IGJB 2DDQH 3Q1SL 4U31A 4Y7MA 5I19L 4GG8B 1FZOB 4HKJA 5CHNB 5IVOA 2OQJA 5D70H 3UJJH 1IC1A 2WLYA 3OR7A 3ROOB 43C9B 4XMLL 4MWFB 4KWUA 4C58B 5KW9H 5DMJB 3QUYD 4A6YH 3D85A 4HSQA 2ZJSL 3U46B 1AI1L 4YXLH 2YRZA 3DETD 3DX7A 2D9QB 1R0AH 4P9MH 3QRGH 5EOTA 3OKOA 1R5WB 1FPTL 5CJOL 4D0DA 1TZGL 4PRIA 1OTUD 4Q9QH 1CL7I 3LMJH 4P23A 5BVJB 4HK0B 1LILA 3BPCA 1KTLA 4UBDC 5FEBA 4PJDE 5HDOA 5FOJA 2L4OA 4IMLA 4Y2DC 5DC4B 3C09B 5TDOA 3GSXB 1P4IH 4XZUB 2I07A 3QO0B 3RUGE 5F3HB 1FNSH 3IDIB 2KPNA 2HVJB 1FZKB 5T3ZH 1YEJL 2VR4A 2DLFL 3STLB 4L9LA 3G6DH 2Q7YA 5C3LD 3VFVA 1M7XA 1XGUB 4OM1L 2ERJB 1RU9L 2A6KB 1AO7A 2FEDC 3I6GA 4OD3L 5J1SC 2EICA 4KH2A 4H1LA 5KJRH 2AEWA 2D4DA 2DQIH 3W82A 4ZUWA 1P6AB 4NFCA 3U2SB 2WWMC 3TO4D 1N0LA 1HKFA 5I30H 1ZGLA 1X3DA 5FGBA 1KCSH 1VGKB 2AJXL 5EIIA 4QRQB 1WV7T 2YA2A 3ZE2E 1RUAL 1F02I 3QUZB 4JQVC 3BUYB 1MY7A 2Q3AA 2APWA 4N0YL 3JV4A 2W9EL 4ISVA 4P2QD 2XPGB 5DZLA 4ALAH 3BZ4B 3IAGC 1WK0A 5C0CE 2Z4QB 4OGXL 1DJSA 1NANI 4WU7A 4WY7H 4RMUA 1SJHA 1ZHKB 4OCXH 4WFED 1UVQA 4PGCA 3QG7L 5KAQG 3U7WL 4AMKL 3MLPA 4DGYH 5ALCH 3GGWA 2DBLH 2P5WD 1J0ZA 3HAEG 2EDLA 3FQNA 4LFHG 5BS0D 5DURD 3IKCA 4NN7B 3G5YA 4JFZL 1UFUA 4I0PD 4IBLT 2YA0A 3JTTB 4P4KD 3RWIB 2DQTL 3ZDXF 3AGVA 4CKVX 2YRPA 3QIWD 5T3ZE 3DROA 1QQDB 2UWEE 2UYLB 5IB2B 4J8RB 1U8JA 2DB8A 3JWDL 1EO5A 1SY6H 3B3IB 3ALWA 1SYSB 5JNYB 2EDKA 3RNQB 5I1AB 1U58B 4NO2B 5GZOD 4ZS6D 5F1OB 4OKVB 1F3DH 4PREB 2JLLA 5HGDA 1Q9WA 1EAPB 4OZIA 5B38A 3GSNL 4G6KL 3SCMA 1R3LB 3AROA 2DLIA 1RZ8B 3IVKB 4PRHD 4JY4B 4DTGH 5JHDE 4LPWA 3IU3A 1IGML 2NXYD 2V9RA 4HMCA 4XPGH 2A0LD 2WLZA 1H8OA 1NC2B 1KYOK 5GQBA 2QLVB 2AEQH 4OZHB 5GRJL 5KVDH 2W59A 1IBGH 3MJ6A 5L2KE 2GK0B 5SWZA 1KT2A 4G6JL 1MJUL 3HCVA 3O9WB 5DD1H 3AS1A 3FFCE 1OGTB 4JFDB 1HHGB 4X4XB 5EUOB 3HZKB 4ZDHA 1ADQH 3IAPA 3OKNA 3VE0A 5JPNB 2W9LA 1DBMH 4TSAL 1J8HB 2Z35A 3QEHA 4CNIB 1A0QL 4NN6C 1R6VA 4PJGB 2DM7A 2P46B 3U30B 5HPMA 1HH6B 4RDQG 2CDEB 3WS3B 3QUYB 3VGAC 4P9HH 4QOKA 4D9LH 1QVOB 1T1WA 2C7UA 3U6RA 3FO1B 5DMGC 5E4EC 3KPQA 4ZS7H 4LAQL 1LO4H 2VXVL 3P11L 1S7WB 4JPVH 3MJ8A 4JDVA 4RWYL 5JOFA 3DMMA 2HKFL 4S2SB 5IQ9B 4OCYH 2AK1L 3N1FC 4X7DC 3SDXB 3RVXD 4LDOB 2VZ3A 1QFWH 5D2LF 4LLMA 4BELD 12E8L 3GKZA 4PJEB 1TXKA 3HA0A 4R96A 3FB6B 1PLGL 1ERNA 3GMRA 4YZFF 3JWDC 2X41A 4G9FA 1UCTA 5I1HH 5FKPB 2VAJA 1XFPA 3QHTC 4QRPD 4OKDA 3LEVL 4Z77A 3BJLA 4PJ9D 1RZ7H 3HRZA 5D8JH 2IBZY 1L7IH 4LVEA 5E2VH 2GTZB 4HIJA 4IJ3B 1IQWL 1KCVH 3VI3E 5D7IF 4MB3A 2FIKB 3TO4B 3X14B 1WEJH 2W65B 2BFVH 1OAQL 2X9WA 4OZ4A 1G9EA 4ZXBD 2OZ4H 3NA4A 5C2UB 2DD8L 1ZHLB 4PG2A 5I73B 3BISA 1IKNC 3T65A 4K3EH 1I3RA 4UQ2A 3OKDA 4HWNA 2FEEI 2GUOB 1OSZA 1YMMA 1CGTA 5DHYA 5EN2A 3A6BL 5FYLL 1FJ1A 3DV4A 4N5UA 3PWPD 3RKDD 4QHLB 2FWOA 3IFOB 1EAJA 2P5WB 5CEZL 3BI9X 2Z92A 3QUMH 5BS0B 1JTPA 2BVOA 1MQKH 1NAML 5DVMA 4N90E 3VFMB 2CIIA 1NH6A 4I0PB 2OL3L 1W72B 5BJTA 2M8XA 4EI5C 3MROA 3O81A 3QIWB 2DTMH 4Y1AE 5E00A 5BXFA 4F7PA 4XAWL 3VDBA 4PJCE 3Q2CA 3UZQA 4F3FA 2F19H 5GGTH 1A7OL 3ZKMC 4L3CA 2P8PA 1MPAH 4U1MB 5KVMC 2CKBL 5K9QI 2Y6SD 4JM2A 3GSUB 3SKNA 4CMMA 2NTFB 1A9EB 4OJFH 3RWDB 5BO1H 4F7EA 1T89A 1UACH 2A1WH 5J6HB 5D6CB 5CFHA 5LCVH 5MEQB 2F74B 3FTGB 3VRIA 4PRHB 3EYUH 5FGRA 2C3XA 2NXYB 2VDLL 4OT1L 3VXUE 4ZUSA 4J3SA 2FX9L 4XHJC 1CFVH 2EH8L 5LGJB 4MA7L 1V5JA 2O5XL 3JVGA 4GXUM 3TN0D 2FB4L 3WN5C 5ABDE 4AZ8A 1P9MC 1WWAX 3E3QC 5GGQH 4DGVL 3KPNB 4G9DB 3IDNA 5C07E 3DXAD 3LKRA 5BW7A 1HHHB 4QXGL 1U8QB 5ETUA 4AH2B 4X6CE 1CD1A 3VG0H 1CT8A 4OB5H 3SE3A 1ZT7B 5CINH 2KDGA 4LP4A 1DQQA 1LWRA 4NYLA 5EULV 4E5XB 4G42A 3R06B 3MCKB 3QCUL 5BV7H 5T3XH 5F6IC 3EDKA 1E27A 3VXME 3DX8B 1OSPH 3MRMB 1FV1B 1C08B 3LN4A 1FZJB 5C8JA 2CK0H 3GBML 2CO7B 1PY4A 3ISWA 5D6DA 1P4LB 2DQFA 5DVKA 1URLA 4WO4D 5IMMB 3MV7E 1WBZB 5CZVL 2VDQL 4Z95H 5IFAH 5DJ8B 3L7FB 3VD4A 1FLTX 4JPKH 1N6UA 4TUJB 3WSQH 5JMRA 4YHIA 3NIGE 4EIGB 4X6EA 3QCTL 3RWFA 4LNRB 4G8FB 1JI1A 4OSUL 4F2MA 4QRPB 5EBGA 4XAKE 4LLWA 5C0AB 5INDB 3I9GH 2F15A 2XICA 3LN5A 3CFJB 1TPXC 3QXVA 4PJ9B 3ARBD 3BEWB 1IGIL 2MJWA 3MBEB 2AJ3B 2Q76B 2WBWB 2VABB 5IOPB 5GRYA 3CPLA 1E28A 3QULB 1EXUA 5HYSB 3CZJA 1IC4H 1KCLA 3GO1H 3O11A 3VFNA 4FQHB 4IDJH 2ZPKL 4AENA 2BOCA 3K4AA 3VH8G 1GSMA 2PW2B 3TBWA 5F7LB 4ZXBB 2WBJC 4NBZB 3LH2H 3VCLA 5T3XE 3E1F1 3D25B 1AR1C 2F5AL 1UCBH 1YEHH 5GXBB 3UDWA 2VLJE 1NCWL 1NBVH 1OWRM 1IMHC 5DVLA 4U1JA 4NQDA 2P5EB 3PIQA 4M03A 2AJUL 4OZGF 1RIHH 3RIFF 1FNGB 3ZLQC 1SJVA 5EBWB 1QLRA 4QGTA 3S37X 2M2DA 1NFDF 3A67H 1UB6A 3HR5A 4JM4H 1KTDB 3PWPB 4GUPB 3FQTB 3MODL 1OD7A 4F7CA 4UT9H 2EZ0C 4HUWA 2PYEE 4OUUB 3V6FB 1HHIA 1YECH 1Q0YL 1ZMYA 2IPUK 1G6RA 1GGCL 3BYYA 5C0NC 1L7TL 1HKLL 4F37K 4KK6C 3IB4A 3KHQA 2IAND 1MCEA 5EO0B 4HUXA 1GPOH 2NY2C 3QNZA 2DL9A 3OAUL 5CJXA 4P2OC 1K5NA 2AJSL 2LVEA 5HYJD 5JPMA 3RY6A 4JKPL 2HWZL 1G7PA 3MRRA 1P7QB 4NZTL 3BAEL 5DMGD 3ESUF 1J1OL 4GBXC 4MS8C 5BRZA 1WBXB 4M1CC 3NCYP 4GW4B 4QTIH 2CIKB 2QHRL 3OHXB 4K7PL 4B50A 4ZTOL 5CUSH 3MA9H 5KOMC 3V8CA 4X7SH 1X4XA 4NPYB 1KJMB 1NGXA 3O2DA 1RULL 3OWEA 3QJFB 4Y4FC 4QHNB 2MHAB 5ACZA 3O8XD 1S9YA 4IRSC 5IIEB 1CXLA 1NL0L 4HFWA 4NP4L 5A2JH 5GRVL 4LVHC 4X9HA 1H15A 3I50L 4NQXA 3BXNB 1X44A 2KL6A 3T3MF 1CL7L 3HNTL 3L3JB 4LGPB 1AY1L 5DEGB 3D9AL 2VR9A 3DPBA 4U7KA 3TN0B 1BQHB 4XNZB 1FDLL 1PYWA 4HUUB 1A21A 3IFPA 1LE9A 1T0MB 1XF1A 3KYAA 3DXAB 4XGZA 5DRZA 4KKAD 1AD9A 5I1CH 3DO3A 2GSGB 4U6HB 2R0LH 4OTXH 4WV1C 2H2PC 3GI9H 1F8TH 1CGXA 1AIFB 3GMQA 4KQ4L 4OCSH 4ODTL 5DQ9B 2AXGB 4I18C 1CLOH 4BSVA 5E2WL 5CSZA 2JK5B 5E8DH 5EO1B 3X11B 1JI2A 3QUXC 2ZCHL 4RFOH 1ETZA 4OLZH 3WO4C 2XQBL 2SEBB 2ARJA 2C3VB 3RWEB 1F4WL 1HDMB 3BFOA 3KYKL 3O2VH 4YUEL 1EIBA 1GGBL 2A74B 1E4JA 1YQVH 4NDMA 3EOBB 3DSFH 4LEOB 4JB9L 4FNLH 4U6VH 4HH9B 3B2VH 5MEOB 4WO4B 2QQNL 3CK0H 2DQJH 4PV8A 3RWCB 2P49B 4Z5RB 1EFXA 2EYTB 4XWGH 1XZ0A 1YEDA 4PJCB 3K80A 4NKMB 1Q9LA 2JF1A 1BVZA 2KZ1B 3SGDH 5EOQL 2JJUA 2XKNA 3KR3H 4HCRH 4K2UL 3TPUB 3UJTL 4ZFFB 9CGTA 1EMTL 1DL7H 4I3RH 5CBAA 1ED3B 1TVBB 4BZ2H 2AXHA 3ARBB 1T0NA 5TPWH 4JRXD 1FO0H 3HG1D 3OG4B 1JNHA 3WXVL 2DS4A 5C0GA 4R7NA 5F8QC 4PYHA 3PGFH 3VFOB 5IMOB 1RUQL 5F7DB 3U79A 4CMHB 4TSCL 2VNCA 4LHUG 4NHCL 2EXWC 3T77A 5JQ6H 4PJIA 2VMFA 3ZYOA 5AZ2H 2A77L 2WQRA 2XZAH 4KDTC 1U8NB 4XPHH 2YSSA 5CBEA 1NEZA 4OBRA 3AMKA 4CAGA 1DR9A 1OAUL 4HIXL 1FYTD 1NAKH 3DV6B 3QB7C 5DD5H 4TULH 1G7JB 3BYTA 4TSBH 4LPUA 3U82B 4J4PC 2R0KL 1X7QB 5J0BA 2GYSA 3T04D 4JGMA 3F7YB 3P9LA 2CRMA 1RURH 3P73B 5GS1A 4TTGA 1NGPH 2XOTA 3VRJA 3S34H 5CWSA 3E2HB 4Z8FH 2VLRE 2VC2L 3C08H 3MRHA 4BQ6A 1IGJA 4K23L 1CLZL 2ZKHH 4GG8A 1FZOA 2AEPH 4MHHG 5IEHB 3ROOA 3O6KL 43C9A 4MWFA 2RAMA 1F4YL 3HZYB 5LG1A 3U46A 3D2UD 2OTWB 1EJOL 4MXWL 2XYCA 2IANB 3NMEA 3GBLA 3B9AA 3U4BH 1R5WA 5ICZA 4NN6B 4O2FB 4TUOB 5BVJA 4HK0A 5DUBA 4YHKH 1P69B 1YNLL 5DGQA 4JKKA 2AGJH 4BSJA 4PGEB 1MI5E 4YBLB 1GC1L 3O0RH 3GSVA 1N4XH 3FAWA 4JFHE 4S0TD 4OGYH 1C5CH 2UZXB 4WI9A 3ARGD 5IBUB 3WO3B 4NNXB 2WWKT 5FYLD 1CDGA 2GY5A 3GSXA 5AZEH 4OI9A 5FYKL 4XZUA 2XI9A 2H1PH 3QO0A 1I8LC 5C09D 3DYPA 2BVQB 1ZAGA 4LLYB 5CEZD 5F3HA 1K6QL 3IDIA 4HS3B 2EIZB 2HVJA 3O8XB 4HH8A 3O4LE 5D7SL 4XBEL 3STLA 1KEML 3WMSA 1WZ1L 1XGUA 1G0DA 4NWTH 3RX5A 1A3LL 2A6KA 2O5ZH 2MTPA 1LVEA 5BQ7B 1FH5H 3FQRB 3Q6FB 3C60C 4WEUD 4U1IA 3MLYL 1WCBB 3U2SA 2B4CH 3GBNH 1S7XB 4YEFA 4JE4B 1VGKA 3ZE0E 2EE6A 4HGMA 4OBSA 2VXUL 4MGXA 4GW1B 3QUZA 3SJVD 3BUYA 4Q2ZA 1CXHA 1DQLH 4XVTL 3MA7B 4M8QB 3ZE1E 4EUPB 4OIIL 4B0MM 2CJUH 3AMLA 3BQUD 2XPGA 3BZ4A 5GS2H 3S9DB 2Z4QA 1Z3GH 1H9VA 5HGBB 1H3PL 5D5MB 3K1DA 4XC1H 4JFOB 4P99A 1ZHKA 4HG4J 1I8MB 4N1HB 3WNNA 5SX5H 4LLAA 2J8UE 4Z18A 3AC0A 5DZOA 5CJBA 2EH7H 2QJDA 5E08H 2AP2A 3QFJE 3I6LE 4QRRB 1KJ2H 3RAJL 3L5HA 4F7MB 3JTTA 3RWIA 1FBIL 2Z31B 4JDTH 1K8DB 4WUKH 4QCIB 3GFUA 4PBVC 4EOWL 1QQDA 3MLUH 2UYLA 3MNZB 4J8RA 4B7IA 5IB2A 4KVCH 2CLZB 3B3IA 1CGUA 1SYSA 3OJDB 5JNYA 3RNQA 5I1AA 5F7HA 1U58A 2FEEL 4NO2A 4PJXE 5SWSD 4OKVA 2R2EB 4NWUH 3EFDL 2B7DT 5ITFB 1X5ZA 4PREA 4PJBF 5LGKA 1GC1C 4G3YH 2XXMB 5H37G 1EAPA 2C5DC 4BH7B 3IDGB 1QBLH 4UV4L 4JRXB 3HG1B 1I85C 1CFSB 1R3LA 4WHYH 3LN9A 4ZUUB 1T03H 2I9LB 1RZ8A 5I76B 3IVKA 4DVBB 4JY4A 3WIHH 5HYSG 1X5GA 3GSOB 1E6JH 3S97C 1NC2A 4HAGA 2VWEC 4RMTA 5GJTH 5FDWB 2EC9U 2YMXH 4N9GB 4OZHA 2A9ML 5F8RC 1FYTB 3MYJB 1Q72L 4D9QD 5DFVC 1MFAH 1AH1A 2GK0A 4KV5E 3HUJF 4LCCA 4OCWH 1A1MB 4QRTB 1XGYH 4KUZL 2DAVA 3MC0A 3O9WA 4G7YH 4PJFF 2DQCH 2MFNA 3PWLB 3V0AC 3P40A 1OGTA 4JFDA 1HHGA 4X4XA 4DVRL 5EUOA 3Q3GB 3HZKA 3WHXB 1T2XA 1JTTA 1ITBB 4BH8B 1MUJB 1J8HA 1KB5H 3DSNA 3QAZC 4LSTL 4CNIA 4HWUA 5EBLB 4PJGA 1ZEAL 5GJSL 4ZO8A 3EJZC 3I2CH 1NQBA 4LBEB 1IGYB 3SBWC 1HH6A 3W5MA 1XT5A 2CDEA 2P4AB 3WS3A 3B43A 4G6AC 3HKFA 3QUYA 4GG6F 4P2RE 4WTWA 1QVOA 3D2UB 3AB0B 3FO1A 3GM0A 4FTVE 3RU8H 3T0BA 2VZVA 5F9OH 3WBDA 1S7WA 1DBAH 4Z7VE 5IQ9A 4JKMA 1TETH 4M4PA 3SDXA 1P4BL 3O4OB 5C2BL 2C4FT 1A7RH 2W1NA 3GJFA 5JIPA 3W5NA 4OM0L 4GRLC 3HI6H 4HUNB 1JPTL 3ARGB 1KV3A 4PJEA 2VDNH 4OFYD 2F54E 4HUMB 1DP0A 1UKSA 3BMWA 3R8QA 4PJAB 1KG0B 1HQRB 4JFQB 5C09B 4NJ9L 3FOLA 4KAQL 3FB6A 3H0TB 1H3GA 4Z0BL 2NY6B 4Y4HC 5JIHA 4NUGH 1KN4L 5C9JB 1P53A 5GHWH 3BP7B 5FKPA 1FL6B 1WSST 1NAMB 2UVFA 5IMLA 5J8OA 4O2CB 3DWTA 4I2XE 5DQDL 4Z7WF 4U6YB 2GTZA 5E95B 1FGVH 2GJZB 3EIFA 4M7KH 2BHZA 3KYNA 2FIKA 3B8SA 2E9BA 3TO4A 3U0TB 3X14A 1JMZA 2W65A 5KSBE 1JPFA 3ZHDA 1KELH 4AL8L 1ZHLA 1BBJB 3SJVB 1P84J 4LVNC 2KBGA 5IW6B 4OQTL 3BQUB 1YEFL 2GUOA 5FYJD 4HF5H 1Y6KR 5EZIL 5GGVH 2ICEB 4P2YA 3UAJD 3C8KB 5C08D 3HLAB 4W68A 4R26H 5EORL 5BZDB 4QHLA 1YEIL 4GS7B 3IFOA 2P5WA 4U0QB 3LOWA 4TPRH 4XNYH 1N7MH 4M48H 3VFMA 3ZTNL 5ILTH 4I77H 4I0PA 1T83C 1W72A 3QQ4B 5HGHB 2PTVA 3QIWA 4GMTH 3EYQD 2QQKH 5FOBB 3MPCA 4CW1B 1MIEL 2A6IB 4UMGA 1FL3A 3P0GB 2DLHA 4ZNEE 4OV6F 1G7MB 5AYUH 2XTJC 4U1MA 1OAYL 3BSZH 5SWSB 1RJYB 3ZKSD 4EQ3A 3EAKA 3GSUA 5F96L 5DK2B 2NTFA 1A9EA 2NYYC 3RWDA 2DLTA 4Y5VC 1A7BA 5J6HA 5D6CA 5MEQA 2F74A 3FTGA 4G6MH 2VERN 4PRHA 3RHWF 1CYGA 4N8VB 4ZFGH 2ENYA 2N56A 4K7PX 3OKEB 1S5IL 5HDQL 4ZMAT 2R4SL 3P30H 5F7YC 3TV3L 5CJQH 3WFCL 5LGJA 1I8KB 4MXQD 1OQOA 2J8OA 4MD5B 4CN4A 1E4WH 5JIIA 4HEPG 5B22A 2HJFB 1OTSC 1Q9OB 1KTKE 4PRBB 4XB7A 3VXPB 4F37F 3KPNA 4TVPL 3P77B 5EZOL 2DLEA 4G9DA 1Q0XH 4UV7H 1HHHA 1YNTB 1U8QA 5D71H 4JZNB 5KZCD 5DJCB 4AH2A 3EUUA 1BBDL 1CDBA 4LRIA 1B6UA 3Q5YA 4I9WD 3V4UH 1ZT7A 1QSVA 2V2WB 2VSCA 1HOCB 3C6LB 4RGND 4N0UB 3IDXL 4E5XA 4Q0XH 4P2QE 3R06A 5F7MC 1VENA 4PJHF 3MCKA 4K3DH 3K1KC 2VKXA 4ZPVB 5D93C 3DX8A 4ZAKD 4ERSH 4RA3A 3EYOA 3MRMA 1FV1A 1Z9LA 1C08A 1B4JL 1FZJA 1KC5H 4HBCL 3KLDA 2R1XB 5JDJA 2DWDB 3RX7A 4BZ1L 1P4LA 2Q86B 5DFWH 5IVXF 5IMMA 1WBZA 5IBUG 3AXLB 4X5XB 1S5HA 5F6HJ 1J1XH 5DJ8A 2NY4C 3L7FA 2OR7A 2BNQD 2E7BA 2ZP0T 1LP9E 4TUJA 43CAA 1G9NH 3K4ZA 1MFNA 2H32H 4GLRI 5FGSA 1P5UA 4ZUVA 5FV1L 4G8FA 2FD6H 4QRPA 1MIMH 5C0AA 4XP1H 1LD9B 4PJ9A 1TCMA 4MJ4A 3BEWA 5EBMB 3MBEA 5CGYC 2AJ3A 1B88A 2D7MA 2Y07L 4JHWL 2VABA 4R97B 4MNHB 5DMIH 2GITB 5IOPA 2WV3A 5JHDA 4C4KO 3QULA 1X4ZA 3TH2T 1WQVT 4FQHA 3NGBC 1F45A 3SOBL 2FGWH 4JZOB 4B7LA 5EA0L 1EHLH 5IKCB 3RI5K 3HMXH 1VB9A 2PW2A 3CX5J 4ZXBA 3MMEB 1IEAB 1JGEB 2VDRH 1MJ8H 1LO5B 4YH6A 1RD6A 4JJ5B 1AP2A 2CPCA 5JXED 3D25A 4Y5YC 1DFBH 1CBVL 1A4JB 4R90L 3SY0B 3QIBD 3QR2A 2P5EA 3MOAL 1FNGA 5HI5D 1MFDH 4YHZH 1EGJL 5C08B 3HE7C 1KTDA 3PWPA 4GUPA 2V2XB 3FQTA 5DFVD 3GI8L 5FV2A 1VGEH 3VXRD 5FHAH 4MXVF 4OUUA 1JFQL 3V6FA 3QHZL 2XG4A 1HIMH 2HT2D 1INDH 5CCKH 2FGZA 1YZZA 3T0ED 1UZ6F 4KRPD 4FTVB 1BD2D 4NKDB 5I8KH 2LTQC 2VN4A 5EO0A 4XI5C 3MBXH 2EEDA 2BRQA 2I5YH 4PLJD 3EJYD 3NPZB 2MNUA 1E6OL 4LVOC 4ZSOE 1GGIL 1J88A 2AK4D 5IGXL 4M7ZC 2HA1A 3O6ML 2NMSA 1P7QA 5HI4C 3IFLL 1KIRB 2Z91B 5HI3C 4HJGB 2PO6D 1LHZA 4ZFOL 3KLAB 1RUPL 1TQCB 3NFSL 4GW4A 2CIKA 3OHXA 4XCEB 5J6GB 4JO4L 1HZHL 4NPYA 3OPZH 1KJMA 3QJFA 2P8MB 2MHAA 4QHNA 4O58L 4LSPH 5IIEA 4Z0XB 3CFIC 2AEIT 2ZUVA 1BOYA 4OCRL 4HGKC 2EECA 3U1SH 5IG7B 1ADQA 3BXNA 3JTSB 5ALBH 4ONFH 3L3JA 4PRPD 4LPCA 5DEGA 3WE6B 5FKAB 3QSKB 3TN0A 1BQHA 3GJEB 4QRUB 2W0FB 4HUUA 2IPKB 1BMGA 2WM0A 3CVHH 3ZO0A 1FAIH 4KTDH 1T0MA 4L8SB 2CQVA 3TJEL 1PBYA 3DXAA 1GXEA 4DW2L 1AKJD 5H35B 5DMKB 5KZCB 2GSGA 3P4MB 4U6HA 3MGOB 2X7LB 3BT2L 3HC4H 4QHKJ 2XN9D 4RGNB 5LWYL 2P7TB 1ORSB 5ECJE 1AIFA 4P3DB 3C5ZC 5DQ9A 1WAAA 3VWKD 2OI9B 4FQ2H 4OLVL 4DCQB 2JK5A 3MGTB 2DI7A 1GYAA 2DQUL 3X11A 1LDPH 3MRBB 5JW4M 1QKZH 3QJHB 4ZAKB 1KJ3H 2SEBA 3RWEA 3RTQC 4HXAL 1HDMA 4PJ5D 1T5WB 4ONGH 2A74A 1QFUH 3EOBA 2XY2A 2CRYA 3O45B 1SM3H 4HH9A 3D3VD 5MEOA 4WO4A 4GKZB 4XP4L 1MCSA 3RWCA 1I9IH 3K2MC 1AC6A 4Z5RA 4NZDA 3TBYB 3ZDXE 1GHFH 3WFHB 4C59B 4L3ED 4PJCA 1J9CT 3NFPB 3QPXL 4NKMA 2BNQB 1A02N 2MSPA 1DANU 1CE1L 3CMOL 3I6KB 3UMTA 3TPUA 4ZFFA 3R0NA 2DJ4A 4M3JA 4UILH 1NCDL 2PYFB 4H0GA 4PUBL 1ED3A 4YDJB 1TVBA 2VRAA 1NBZB 1JZ7A 1A6VH 3ARBA 4MJID 5IT2L 5IQ7H 3P0VH 3RWHB 1BZQK 1IFHH 4DKEH 2QQLH 2HH0H 3VFOA 2AJVL 5F7DA 5IMOA 1OD9A 3LKPB 4HLJA 1T66C 1GIGL 1GOFA 2COQA 3S37H 5FHBL 4FQJH 4LSRH 3VXTB 2EKJA 3VXUA 2ZZUT 1U8NA 2NYYD 4F57L 5DJZB 4HPYH 5CAYB 1MFBH 2EDOA 3DV6A 1M7IB 4G5ZH 5GRUL 3HRPA 5E2TL 1X7QA 4FQLL 2ZJSH 4DKFL 3QIBB 1AI1H 4XMKL 1KYOJ 3P73A 1N3NB 3LEYL 4YFLI 4LSVH 4XCNB 1FPTH 5CJOH 3BWUC 1TZGH 2DJSA 1HXMB 2QTEA 3MLWL 2J7LA 5T1DH 5CZXC 3VXRB 5IEHA 2Y36L 3IJSB 2AI0L 2YD6A 1KLUB 3DVGB 3HZYA 3WLBB 4ZNCD 3T0EB 2OTWA 4KRPB 1BD2B 3VXMA 2UY7A 5KSAD 1VHPA 5I8EB 3VFPB 5GISL 4AT6B 3MLZL 5EFIB 2BJML 4O2FA 4TUOA 4MX7B 1MCNA 1S7VB 25C8H 2H8PB 4YQXH 3HTLX 3B6SB 1WIPA 1FIEA 2AK4B 1D5BB 4RWHA 2DLFH 2X70B 4PGEA 3K3QA 5DEZA 5IR1B 4PP2B 1T20B 4BFIB 4NQCD 2PO6B 5D72H 4OM1H 5D2LE 4NNXA 1RU9H 4OD3H 1RK0B 1JE6A 4OZFG 2DOCA 1U8PB 2BVQA 1HYSC 5E7FA 2QV2A 4LLYA 1AGDB 4N8VG 1NCAL 4HS3A 2EIZA 3MXWL 2A2QT 3O8XA 4YZFE 4EDWL 3TVMD 2VR5A 4X7EC 3NCBB 4PR5B 4GQ9H 8FABB 4ESKA 5E9DD 2NY3D 2V5MA 5IB4B 1CFQB 1ZWIB 3AS0A 1UEYA 1IL1B 3B5HA 4N0YH 4DFIA 5E8OB 5BQ7A 4PRPB 3FQRA 3Q6FA 2W9EH 1WCBA 3MV8E 4OGXH 5D7IE 3B8YA 2EDQA 1S7XA 3SKOB 5AAWA 3QG7H 4AMKH 1AKJB 4GW1A 1TJGL 3BJ91 1SMAA 1EBPA 2RGSA 4NC1C 1DQML 4NKIL 3MA7A 1UM6H 3RGVD 4M8QA 2XN9B 5HHMD 4JFZH 4EUPA 2B0SL 3CCHB 2FH8A 4WTZG 4WEMB 4GRWH 1AGBA 3VWKB 5HGBA 4JO3L 3NPSB 3LV3B 5D5MA 4JFOA 2YD7A 3SGJA 1I8MA 3F5WA 3JWDH 1FNFA 2YEZB 4JZJC 4QYOB 3QPQD 5TE4L 4Y5XA 2JJVA 4PJ8C 3T2QA 2KQNA 2APFA 4LL9A 2D03L 4PJ5B 1F6FB 5FGCB 2H32B 1OP9A 4QRRA 5K93A 1T2JA 3QWQB 4UAOB 2DQGH 3MNWB 1ZLUH 1QFOA 3D3VB 4GKOA 4NQUA 3ZKQD 4F7MA 2Z31A 3GSNH 1K8DA 3HE7D 2Z8VC 3EO0B 1WT5A 4QCIA 5AEAA 4L3EB 5ICXB 3MNZA 5EC2B 2CLZA 3ZYJA 5HYJE 1Q8MA 1IGMH 3OJDA 3S36L 5F9AC 1PEZA 4D9RE 4NCDA 2R2EA 3BZEB 5ITFA 1FP5A 1CN4A 3Q5OA 1QSEE 1KCUL 4YLQT 4MJIB 4BH7A 3IDGA 1X5XA 5SV4A 4JRXA 3HG1A 5I0ZA 1CFSA 4G6JH 3UX9B 1SEQH 4ZUUA 1MJUH 3B9KC 2I9LA 4V1DE 5I76A 1MNUL 4DVBA 1W8NA 3MJ7B 3GSQB 3KLHD 3GSOA 5ERWB 3BPNC 2VXTL 2JELH 1A7QL 3PDOB 3TZVD 3QRFM 5FDWA 2DQDH 2HMIC 4N9GA 1DQDH 4DN4L 4GRWE 1FYTA 3MYJA 4PIRF 5DHXB 2D0HA 2CR6A 2E27H 4QRTA 1A1MA 5GGRY 1MCPL 3PWLA 3MUGB 1U3ZA 5KG9B 3Q3GA 3WHXA 1I3GL 1JJUA 1PX3A 4BH8A 4LAQH 2VXVH 2LU7A 3P11H 1F4HA 1JZ2A 4GKSA 4RWYH 5DJAB 1I7ZB 3PUCA 3L3KB 1UJ3B 5CGMA 4LBEA 5C3TA 1IGYA 3PHSA 3DGCR 1JCKA 3EYVA 1ZSDB 1IILE 1OAXL 3VFSB 1N5YL 3NA9H 1JBJA 3D2UA 5GPRA 2ZCLL 1ZK9A 1DBJL 3CMGA 2BNUB 2V5TA 5KSAB 1G7IB 1M7DB 1PLGH 2IH3B 3I3BA 3MJGX 3ZSSA 4K3JH 4WI8A 1QLEH 3WEXA 3WFDL 3LEVH 3C5ZD 2PKDA 4P23C 3O6FD 1RHFA 4NQCB 3ARGA 3U7AA 3Q48A 5EH1A 1OAZL 1IQWH 4N68A 4PJAA 3THML 1KG0A 1HQRA 4PB9L 4JFQA 5C09A 3H0TA 4J7RA 5C9JA 4Q9CA 4WNQB 3BP7A 1U9KA 4LCWE 1FL6A 1OAQH 3FKUS 4Q6IB 5GIRB 4ELMB 3T1WA 4O2CA 3TVMB 3BRGC 3HPLB 5ISZE 1YJDL 3T0DA 5GZND 3T8XB 1JRHI 5E9DB 2NY3B 2YN3A 5L8KB 3SO5A 2HJLB 1KEGL 4U6YA 5T33L 2R2CA 1NLDH 4L9LC 4J1UB 2B5IC 2AJZB 4MA1B 3FONA 2UY6A 4XXDA 5HVHC 1NUNB 3U0TA 2VH5L 1MEXL 2BC4B 4QNPF 2YXFA 4YC2B 2VXQL 2X9YA 3A6BH 2EEAA 4EN3D 1MRDL 1FRGL 4BM7A 1T1XB 2MQCA 4ODSH 2DF3A 1BBJA 4PS4L 3SJVA 1T66D 1CD8A 5FGBC 2G75B 5AUMB 3RGVB 3QI9D 1TVDA 2D7OA 3UPAA 2OL3H 3BQUA 3U9UB 3VGHA 3QDME 5I8OL 1QNZL 2RFXB 2ICEA 3KPOB 1T7WA 4OZGE 5EU6D 4NZRL 3HLAA 3H2WA 5BZDA 1NFDE 4MA3A 3CSBA 1RVFL 1A7OH 1PSKL 3TPKA 3VFGL 4YHLL 4HCRA 2CKBH 1RV6X 2Y7QA 3IGAB 3E3QE 2NCMA 3MRNB 3QQ4A 3SKUD 5HGHA 3HE7B 4PD4K 1I1FB 1TZIA 2FH6A 2JJTA 3ZKXC 2VDOL 5DRXB 5FOBA 4CW1A 4OGZA 4KKNA 4HX1B 5JUEL 2A6IA 2RHEA 1FVEB 2W0PA 4OI8A 3C5JB 3MFFB 1ZVYA 4WCYH 1G7MA 2VDLH 5SWSA 1RJYA 1A7PL 2Q8BL 4R4NC 1HYRC 1V8HA 3RI5F 3KGRA 2FX9H 1VACB 4NGHL 5DK2A 4GXUN 2ZG1A 2EH8H 1A1OB 4MA7H 3DVFA 4Q6YA 5FYLE 2O5XH 4KY1L 2JB6B 2FB4H 2AV1B 5F1KC 3SCMC 4N8VA 4ETYA 1HILB 1O7VA 3ARZA 3OKEA 5C6TL 4OCNC 3TCLB 1UB5B 5DJXB 3TZVB 5MENE 4QXGH 4X6FB 3B83A 5DD3H 1YJDC 5FYKU 5T1LD 2L7UA 3ZT6A 1I8KA 4XNXL 3JWOL 2FATH 4MD5A 2XQYK 2ITCB 5D7IB 1UYWL 2YD1A 3H7BB 3T3ME 4M3KB 2QSCH 2HJFA 2XY1A 3UTTD 1DUYB 1Q9OA 2EDRA 4PRBA 3V8OA 3VXPA 2BNRE 5J12C 3P77A 1SYVB 4RIRB 2P42B 3HZVB 4MNGE 3UEZA 1F6AB 4XPTL 1YNTA 3VI4F 4YGVB 4JZNA 5FM4A 5DJCA 1LEKB 3HC3L 3GBMH 5KTEL 3IT8D 2VIRB 4JG1H 2V2WA 1J11A 1HOCA 3C6LA 3H9YA 5AYQA 4N0UA 4MD0B 4J2XA 2X09A 2YUXA 3PQYD 3RL2B 4K71B 1K9TA 3DUSB 2VDQH 4UDTB 5CZVH 3EYFB 1ZLVH 4C55A 2DTSA 4ZPVA 3TF7C 1WFUA 1ODAA 4X83A 1VFAB 1V05A 3OX8B 5EOCJ 3QCTH 4KVNL 2N4IA 3FN0H 5LVEA 4YXKL 1HN1A 2HFGL 2R1XA 1OY3B 2DWDA 1U41A 4Z7UB 5SX4H 2XRAL 1J5OH 2Q86A 3DMMC 5GGRB 4U49A 3O6FB 1BJ8A 1OP3H 2EIEA 2VUYA 3AXLA 4X5XA 5FF6B 5D1XD 1MFEL 4OFYA 4XNUH 2IBGA 3GDBA 3BPLB 3PP4L 4UINL 4CN6A 4PJ8D 1UWXK 3OV6A 5C92A 4GAYB 3BW9B 1JL8A 1GAFH 5GS0D 2ZPKH 4G8EB 4LDEB 5A1AA 4F7TB 1YYML 1LD9A 4ENED 2FYYB 2HAZA 3SHSA 5L88L 2AV7B 5EBMA 2Q6WB 5DD0L 2FJHB 1C16B 3ULUD 4D0CB 5DHVH 4MNHA 2F5AH 5J56B 4ONHB 3DVNB 3PNWB 3MV9D 2AJUH 4H26B 4HWZB 1NPUA 4XP6L 4JZOA 4EN3B 2BSSB 5IKCA 4OD1L 4GRWB 3KJ6H 2OXGA 3MMEA 1IEAA 4XWOC 5KS9B 1JGEA 2XZCL 4KDVA 4OZIF 3MQIA 1LO5A 4JJ5A 1Q0YH 1ZANL 3JWOC 4WWKD 3QI9B 5F93C 1A4JA 5KVEL 1GGCH 3SY0A 1FN4B 4PG2C 1L7TH 1HKLH 3X13B 3LPFA 3N85L 4H5SB 4KTEL 3RX8A 5ELIA 2HTKD 1CIDA 5EU6B 1FIGH 4XPAH 5C08A 3IRPX 4ONOA 2V2XA 2AJSH 4JKPH 1MHCB 2BP3A 2EDEA 5C0RL 2MKWA 4M1DL 5DJ2B 1YYLL 2AKRB 1KFAH 1OT1A 5JA9A 4NZTH 3NCYS 4NO0D 1J1OH 3MX0A 5IB1B 2QEJA 2CXGA 4FTVA 4NKDA 4L4TE 1MCLA 1RJLB 5A3IC 1KPUB 3DHJA 4D8PB 4K7PH 2EDYA 4NQEE 1F3JB 4HQQL 2J3SA 5JDSB 1RULH 3C8HA 4M62L 1CR9L 4BSWB 1NL0H 5SX5K 1T2QL 4U1KB 2Z91A 5D1ZD 4HJGA 4BUHA 4YBHA 3I50H 3PHOB 3KLAA 3D85D 3LDBB 1VADB 1CL7H 4JM2C 4OF8A 1AY1H 3D9AH 4XCEA 5J6GA 1NMAL 3MRCB 1CCZA 4IRJB 2Z8SA 1FDLH 3BKYL 1T89C 2P8MA 4LQFH 2PR4L 3QHFH 4MHHI 3LIZH 2HTLC 4Z7OF 2ZCKL 5DUPH 5IG7A 5T1LB 4JVPA 3JTSA 3CAFA 6CGTA 5F7FA 4MJ6B 4YJZL 2FLRT 5I17B 4RMRA 2J5LB 3WE6A 4LIQL 5FKAA 3RQ3A 1FCCA 2YK1H 3GJEA 4QRUA 3UTTB 1JIBA 2W0FA 4KQ4H 4ODTH 5BMFH 2IPKA 5KSBA 4XP5L 4JO1H 2XA8L 5E2WH 3JVGC 3LCYA 4L8SA 3HR6A 4ZODA 2ZCHH 5H35A 5DMKA 1RZFH 2XQBH 2R23B 3P4MA 2ESVB 3MGOA 1F4WH 2X7LA 4YUEH 1GGBH 4ZQKB 5BW7C 3N9GL 4EKXA 1BAFL 4RNRB 1FSKC 4E41E 1AO7D 2P7TA 3C2AL 1ORSA 2IC2A 3KS0J 2QQNH 4LKXB 4OCMC 3PQYB 3SE3C 2BX5A 1G6RL 3NCCB 4DCQA 1MVFA 1G1YA 3MGTA 4P5TD 1QACA 3MRBA 1S7UB 1XIWB 2HP4A 3QJHA 4ZAKA 5E8EB 1C1EL 2I60L 4K2UH 3UJTH 3RVTD 1EMTH 1T5WA 4X5LA 4ZUTB 5CD3B 4MAUH 5IW1B 3BIBX 1NANH 2D9CA 3O45A 4GKZA 4WFFE 3WXWL 5D1XB 5JW3L 3TBYA 3WFHA 3H9SE 5D6DC 1K2DB 3NFPA 5ACLA 1RUQH 3TJHC 2BNQA 4TSCH 4PJ8B 5HBBA 1CU4H 4NHCH 3I6KA 4GAJL 1QFHA 4N0FB 2FSEB 2H41A 2A77H 4R0LB 5GRZA 3RL1B 2PYFA 4HWEL 4YDJA 3S36X 1NBZA 1L6ZA 4OD2B 4HIXH 3RWHA 4PJBE 1I9EA 4KROC 3LKPA 4EXKA 1FQ9C 4LCIH 3MV9B 4FFVC 2YUWA 2YC1B 4LGRB 2IQAB 3VXTA 5I2IB 4R4ND 1R5IB 5DJZA 4JM2F 2IAMD 2VC2H 1WFOA 4FG6C 4K23H 1D6VL 4JCMA 1B2WL 1M7IA 5HDBF 4UNTA 3HNSH 5JXEA 4PJ7B 4WWKB 1IAKB 1I3VA 1EDQA 3QIBA 3ZDYF 3HUJE 3QFDB 2XG5A 1EJOH 1N3NA 4G7VL 3UDWC 6FABL 4XCNA 1A6ZB 5F21B 3SDYL 3QDGD 4NIKB 1BWWA 1QD0A 5KVFL 1HXMA 1JF6A 3VXRA 4UT7H 4NN5C 1YNLH 3IJSA 4JR9L 1KLUA 2I26N 5GGSB 1GC1H 3DVGA 3MRIB 1V3MA 1T1YB 1KN2L 5SWZD 3FB7B 3WLBA 5C0BD 1RZKL 4NO0B 5ID1B 3T0EA 4NM4L 1BD2A 4GG6E 1JYXA 5FYKH 5E0QA 2OK0H 3VFPA 2OCFD 4AT6A 5EFIA 3NACL 4MX7A 1K6QH 1TJHH 1S7VA 2D0FA 2H8PA 4IHOB 4YHOL 3B6SA 4R6UA 1F2QA 2AK4A 1D5BA 2PW1B 5D7SH 4XBEH 2X70A 5CJXC 1IKFL 3NBNA 1V7ML 2X4SB 4KK8C 2IALB 3BDBA 3S4SG 5D1ZB 1HHJB 4PP2A 3RY6C 1T20A 5B3NA 4BFIA 2PO6A 5HD8C 2DM4A 1LP9A 1LQSR 1CF8H 3DYOA 4XXCA 1RK0A 3ME0A 3OXRB 3NFNB 4F80A 2X1QA 2VDPL 5JHLL 1J1PH 1ZGLP 3NAAH 3MLYH 3MZTA 5KAQF 1AGDA 4OUOA 5I1DB 4RQQB 4TUKH 4PR5A 1TLKA 2CUMA 8FABA 5IB4A 1CFQA 1ZWIA 1LK2B 4JRYE 5EWIL 4ACPA 3ZKNC 1CG9B 1UWEL 4XVTH 1IL1A 4IIQB 1EJ6A 4Z7WE 5E8OA 4PRPA 4OIIH 2HG5B 1X5KA 1GOHA 1DBBH 4NSKB 3LZFL 5IW3A 4BFBD 1JVKA 5KOVC 1H3PH 3IKKA 3SKOA 4HDIA 5F1SA 1IGTB 3BEVB 4H8WL 4GXVH 1AKJA 3BKMH 3FT2B 5GRWA 3F6IA 5HHOD 5FYKE 2XN9A 4U1HB 3WLWD 4Y19E 1AO7B 3CCHA 1FBIH 3RPIB 1CDHA 3GHBL 1XH3B 4MMZC 2VWEE 3VWKA 3LV3A 4XWOD 4EOWH 1OF2B 3D18A 4P5TB 1C7SA 1GRWA 2NXZB 2YEZA 4QYOA 1P1ZB 1OGAB 4JKWA 2H32A 1BVLB 5MHSD 3MNWA 3D3VA 4GMSL 2WNGA 4J3TA 1RZKC 3AFLA 3EO0A 3KXFD 2YD9A 4KMTL 3HB3C 4L3EA 2VAAB 5ICXA 1HINH 3TBTB 5EC2A 4FABL 4R4BB 1ZVSB 1UXWB 1OLLA 3BZEA 1RY7B 4UOW0 4JANB 2IG2L 4RDQF 1RUMH 3D6GA 3WDJA 5A3ID 4YPJA 5DJ6B 4MJIA 5J3HD 1Q72H 1AQKL 3HMXA 4BUGA 3LRHA 4NT6B 1KGCE 1W0WB 1QFWI 1NLBH 1H3WM 1WBYB 3TBSB 3NABL 1SJEB 1FFNB 3MJ7A 3GSQA 4S1QL 4DGIH 4PPTA 4DVRH 5ERWA 1CLYH 1EO7A 4MNQE 4ZYKB 4OLUL 1LGVA 1DVFD 4FQIL 3PDOA 5IB5A 2JJSA 2IAMB 3NTCL 3BGFC 4LSTH 1ZEAH 1XCQB 5B38B 3UJIL 4CU7A 3TP4A 3UBXB 3CH8A 3MUGA 4YR6B 4KRLB 5KG9A 4QRSB 1JGLL 2MMXA 3QDGB 1WFTA 2FBJL 4K8RL 4H8WC 1OAKL 1I7ZA 2XV6B 3L3KA 1UJ3A 4GFTB 5GS1C 5KN5B 4OV5B 5C2BH 5D7KD 4OM0H 1ZSDA 3WNLA 5SWZB 3GIZL 3VFSA 1V3JA 5C0BB 3ULVL 1JK8B 3I85A 3LEXB 2X2YA 3O41B 2BNUA 4PJHE 3G6JB 5KSAA 1G7IA 1M7DA 1U6AH 1UEMA 4KAQH 4NJ9H 3BE1L 4TTDC 2IH3A 1HSBB 4OQ1A 4ZDHB 3CX2A 4LSDA 3ILQD 3JUZA 1WWWX 1MLBB 3STBA 1M05B 4EEEA 1YPZB 4JDZB 5DQDH 5C7XL 5ANMB 4NQCA 1C5BL 4ZOEA 4HJJH 5IVXE 2VQTA 1WIOA 3GIVB 4KXZI 4E42B 2PXYD 4E0RB 4Q74A 3M8OL 1QRND 2DYPD 1NSNH 3E8UH 3C09C 4WNQA 4HIHB 1KF9B 4JDVB 2WANA 4DOHE 4AIZB 4Q6IA 5DLMH 5GIRA 4ELMA 3TVMA 3HPLA 2R8SL 4GKNB 4K9EL 2VJXA 3U9PL 3T8XA 1CICB 5E9DA 4DK3A 3S7GA 4AL8H 4P2CG 3FAXA 3TJHD 2HJLA 5J57B 3H42H 4IOFC 4J1UA 4XCCH 2ATKA 3FB8B 2AJZA 4OQTH 5TE6L 2VL4A 1CVRA 4CU8A 2ERJC 2XTJE 3VU2A 3FZUD 3BKCL 5IF0B 1IGFL 4TNVF 1MAMH 1MLCB 4FZ8H 4OLWH 3MJ9H 5J9PB 4KI5C 5HHOB 2YPLE 2G75A 5AUMA 3RGVA 4FFVD 5K9KB 1YDPB 2BRRL 3QUZC 3U9UA 4ODHL 4PJIF 3C5SB 3TFKD 1AXTL 5ESAB 2RFXA 3KPOA 4FG6D 3O3DB 1MIEH 1UADC 5CJ8A 5HDLA 1SMOA 4LASL 2JB5L 1IC7L 2YRLA 3BZDA 1OAYH 2VDML 3KPSE 4KK9D 4MXVE 1U93B 4WUUD 3IGAA 3MRNA 5F96H 4M93B 3NIFF 3KXFB 1I1FA 4NN7C 4NQDD 4U2ZA 4PBXA 5HGGS 1UZ6E 5DRXA 3S3JA 2CO6B 4PFEA 4CN1A 4HX1A 1QBMH 4LLUB 1FVEA 2VLKB 5JZ7D 3C5JA 2FHCA 3MFFA 1S5IH 2EYSB 3VMPA 1ZGLM 4YFDB 3PJSB 2R29L 1C12B 3TV3H 4EBQL 1TNMA 1VACA 4X6DB 3WFCH 3CSGA 1A1OA 4ZOCA 3FFDB 3HNVL 2APBA 4JFEE 3UTSD 2BK8A 4JQIL 1HWHB 2JB6A 4XMPH 4HFUL 1L0YA 2AV1A 4LSUL 1HILA 4TVPH 4XTRC 1T21B 3TCLA 5L6YH 1DVFB 1UB5A 5DJXA 3TZVA 2I24N 4X6FA 4M02A 4S1RL 3U0PB 4K9EC 1BIHA 1BBDH 1MRFH 3WFZA 4CMMB 3EKCA 3MV8A 5BRZD 3BIKB 1LO0L 2ITCA 3LD8B 1QEWB 5D7IA 1RSFA 3H7BA 1DUYA 3CLEL 3KS0H 5I71B 3GMPB 4XT1C 4HPOL 3TA3D 1SYVA 4RIRA 5HTSA 1XGQB 3HZVA 3BKJH 1JGDB 2W07A 1F6AA 3O9WC 1F3DJ 4YGVA 5E8PB 3AU1B 4HAFA 4M6NL 1B4JH 4ZUSB 4HBCH 5FCUL 5D7LE 2VIRA 3ZL4L 2WP3O 5HHME 4MD0A 5C0IB 3MLRL 4DEPB 4UDTA 3DUSA 2ZUSA 3EYFA 5IWLA 2DIBA 4KI5F 3U30C 4FOMA 4IRZL 3SE9L 1W72L 3QUYC 1AHWA 4OLXL 1MCBA 1VFAA 1JZ8A 1IAOA 4HWBH 3OX8A 1CI5A 2PTTB 3DETC 1FSKB 3MLSL 4RMVA 4Z7UA 3ES6B 3X3GH 1CT8B 1DE4B 5GGRA 1IZKA 3O6FA 4L3AA 4M6OH 5C0DB 5A40E 4TVPE 5FF6A 1W2KT 4JHWH 1WIUA 2PXYB 4HIIB 4BQBA 1QRNB 2DYPB 4C56B 5D2NE 5B39B 4GAYA 3RIAF 3BW9A 4P5KB 4G8EA 1VKXB 4FXLA 1ZLWH 4F7TA 2D0GA 2C9AA 1U8KB 3K4DA 4ETQB 2FYYA 1JN6B 2AV7A 2Q6WA 1WZKA 2DQFB 4K94L 3TWCL 2FJHA 1C16A 4FQCL 2XT1B 4ZD3H 2NY5L 3L1OL 3DIFB 5MP6L 1TENA 1NBQA 4ONHA 3QEQE 4R90H 2IQ9H 3DVNA 3I75B 3PNWA 1HCFX 3IDUA 2DDQL 3MOAH 2D7TL 3PWNB 4IJ3C 4H26A 4HWZA 5D70L 1E4KA 3QP3A 4GSDL 4EN3A 4Q9BA 2BSSA 3BGMB 2VUOA 2ZUXA 4QWWD 1K4CB 4L4VD 3TO4C 3GI8H 5KS9A 5DSCB 4XNMB 4HHAB 1JFQH 3FMGL 1ZT1B 5GGVL 1ZA3B 3QHZH 4CVWA 1R0AL 3QI9A 2NX5E 4H1LG 1DUZB 3S3SA 5I73C 4JREB 3X13A 5DI8B 2N7BA 3LMJL 4H5SA 2HLAB 1L9NA 3P0YL 5IP4A 4IMKA 5EU6A 3L3DB 4KJWD 4F33B 5GGUB 4OZHF 1CVSC 1MHCA 1E6OH 4LLQB 1IM3B 1GGIH 4HC1H 1P4IL 1H3XA 5DJ2A 4M4RA 2AKRA 2CLVB 4LNVA 4WUUB 1M71B 2ITDB 5IB1A 3TT1L 3NFSH 1RZIB 1RJLA 1YUHB 4NQDB 5EUOF 1KPUA 4G80B 4D8PA 3BN3B 5T3ZL 4I0PC 4JO4H 1HZHH 4YHYB 3G6DL 1F3JA 2HYMA 3VG9B 5JDSA 3QIWC 4BSWA 4PJGF 5ICYB 3P9WB 5I1IH 4XX1E 1F00I 1PZUB 4OCRH 5KJRL 1ACZA 1VFMA 3PHOA 2GJJA 5GZOC 3FN3A 4ZS6C 1V7NH 1VADA 1JGUL 2FCBA 3A0OA 4OFIA 5I30L 1ZLUK 3UTSB 3MRCA 1KCSL 3OGCB 4IRJA 4HKXB 4M5YL 3VD3A 1BVKB 1G0XA 3RJQB 3SDXF 3QUKB 4JRWA 3TJEH 4DW2H 1NUFA 1TJIH 2YR3A 2NXYC 4ALAL 1NCBH 5T1LA 2A0LC 4PJEF 4K94C 5B38G 5I6XB 4MJ6A 1FAKT 5B8CB 2NY5C 5I17A 4JAMB 5LWYH 4OCXL 4L8BB 1S9XB 4DGYL 5JW4N 4FXGB 1RZJL 5AAMA 2Y4SA 4OLVH 3ROLB 3TA3B 4KK5D 1QBBA 2IFFH 4KHTL 1NGQL 4U1GB 4LPTA 3RY5A 2R23A 2ESVA 4IOFD 4OFVA 5B4MD 3W0WD 4ZQKA 4RNRA 2YWYA 1FORH 1ORQA 1U8LB 4LKXA 1LO3H 4N1EA 3PQYA 4LRIC 2F58H 4RFEA 3QPXH 3BX7C 4KGJA 5F3BB 3UZVB 1S7UA 1XIWA 1CE1H 3HHRB 5E8EA 1J10A 4I4WB 3KPSB 4I0CC 5EPMB 4ZUTA 4M5ZH 5CD3A 2WUCH 5IW1A 4PUBH 1YMHB 1LEIB 3V7MA 3WFEL 3ARFD 1PKQE 3EOAB 3VFRB 3ZTJH 5D1XA 3RVXC 4YHPA 4XPGL 1K2DA 4KJQC 3QWRD 2AJVH 4K8RD 5C9KA 5HYQB 3OR6B 1AGCB 1GIGH 3NCJH 2AEQL 3V4VL 5KVDL 4N0FA 5IHUL 1IBGL 2FSEA 5D1QD 5FA4B 5CEYB 1H8SA 3JV0A 2VN7A 4R0LA 4HT1H 4YBQC 4QY8B 3RL1A 4F57H 3CFBB 4GAGH 3ULVD 1G0YR 2G5BB 4OD2A 4M7LT 5FUCC 5GRUH 2NY7L 5E6YA 3RIFK 4PJ9C 5E2TH 2D31B 1ADQL 1S7RB 1AGEB 4FQLH 3OAYK 1JYNA 3MBEC 2W60B 2J6EA 1DBML 3MV9A 5I9QB 1Q9LB 2YC1A 3OAZH 2IQAA 5I2IA 4XC3L 2C1PB 1R5IA 3D39E 3LEYH 4G8GB 1MCOH 5ESQB 5D96C 3GMMB 2AJYL 4RGOH 4L4VB 3MLWH 2H2SD 4P9HL 2HFEB 3V5KB 2Y36H 2AI0H 1A6AB 4PJ7A 4WWKA 4ZXBC 1IAKA 1H8NA 3BPOC 3S6CA 1QR1B 1LO4L 2VO5A 2R9HC 3V6OE 2K7QA 3QFDA 3P9MB 1RZJC 3U36B 4KUCF 2YS4A 1A6ZA 1N8ZA 5GISH 1NC2D 1QFWL 2BJMH 1S8DB 2BVPB 5D7LB 3P4OB 1NEZB 2ZSWB 4WEBL 1BQLH 5FM8A 1MCKA 2R1WB 4KJPD 5GGSA 3RKDC 5I74B 4TQEL 3MRIA 4A2MA 1T1YA 4OAWB 4U0RB 4NO0A 1CK0H 3DJ9A 5I1HL 4R3SB 4YK4B 4OGAD 2BVYA 3UPRB 4NC1E 1RZ7L 3JZ7A 3MXWH 1SEBB 4IHOA 4EDWH 1J8HD 3ARDD 1L7IL 2PW1A 5E2VL 2GSIA 2IPTH 4P5MB 2X4SA 2IALA 5D1ZA 1HHJA 1T04B 3MRJB 1VEPA 5C0FB 3LB6D 1WEJL 2Y6SC 2QADD 4GO6B 2AQ2A 3NFNA 3OXRA 1XF4B 1F2XK 4YO0B 5D2NB 5EU7C 2P24B 3CXDL 5EC1B 5ICZB 2LFGA 1FCGA 5I1DA 3S8WA 3LVEA 4RQQA 4ZPTA 5DUBB 1XR8B 1LK2A 1YEGH 3GNML 3GSVB 2EE9A 3NZHL 3QIUD 1WITA 1CG9A 2WQ8A 4LSQH 1DQMH 3LRSB 4IIQA 4HULB 2HG5A 3BHBB 4G8IB 4NSKA 1PG7H 2F9BT 3NIDF 3V7AG 4JO3H 1REIA 2NY1D 4QNPE 3TN0C 4BK4A 1IGTA 3BEVA 2MPAL 4XNZC 1MQKL 3FT2A 2GCYB 3ORJA 2FJFB 3LPWA 5TE4H 3L95B 2GJ6D 2D03H 4P9HC 2ZG2A 2BY3A 2FIRT 4QXTB 3W0WB 1D9KD 4U1HA 4OI7A 5AD0B 3S88H 1J0KA 3RPIA 5KVGH 2F19L 2F53B 1XH3A 4U1IB 4WI2A 3F7VB 1OF2A 3JV5A 4P5TA 5B3JF 5IK3B 2MCG1 1RK1B 3IJYB 1UWGL 1ZA6A 3S36H 4OJFL 4PY7B 4QT5B 1QO3B 1P1ZA 5BO1L 1OGAA 2B1HH 3UTPD 4JFFE 1MFCH 1BVLA 2A1WL 4Q2ZB 2UVEA 3QDJD 3ARFB 4LU5H 3V6ZB 1C8PA 3OQ3B 4MAYD 1A7NH 2CKNA 2V5YA 2VAAA 4NQEA 3QISA 7CGTA 3TBTA 4WO4C 1MNUH 2BSTB 1ZLVK 1CFVL 1SQ2N 2PTUA 4R4BA 5D1QB 1ZVSA 1UXWA 3TO2B 4S10A 2VXTH 2PN5A 4NQSB 4PD4J 4JANA 4DN4H 4XNQB 4OFKA 1UM4L 5DJ6A 2D2OA 5TQ2L 1B0WA 4S1DD 2NNAB 1DEEB 1CXKA 4NT6A 1W0WA 4AEHL 1UT9A 1OP3K 1WBYA 3ARBC 3TBSA 2WZPD 1MCPH 4LOUD 1SJEA 1FFNA 2VZTA 2VDKL 4CU6A 2NW3B 4PRIE 2YBRB 2JCCB 4CMHC 1I3GH 5I15L 4ZYKA 5CINL 1KXQE 2EKSB 5I16B 2IAMA 1Y0LB 1HI6B 2M26A 4MQSB 1I1CA 1XCQA 4N0CD 1IM9D 5DWUH 1OAXH 1ROWA 3UBXA 1N5YH 4YR6A 4QRSA 3T0XA 1UGNA 2X9XA 5J13B 3VDAA 3QDGA 4NJAL 4KUCD 2HRLA 1NBYB 3VI4E 1R3HB 5KN5A 3QQ9D 4OV5A 5IFAL 3MACL 3E2HC 2DMCA 3N50A 2ZOLB 1UZ8A 3E0GA 5C0BA 1CZ8L 4LCCB 4UTBH 1JK8A 2HVKB 3LEXA 2FX8H 1OAZH 3O41A 5INCB 5FFLA 3G6JA 4PB9H 1S7TB 5MEPB 4NRXB 1HSBA 4PY8I 1D5XB 3IFNL 4O4YL 2LU3A 1CQKA 3P4NB 1MLBA 3ARDB 1M05A 2CD0A 1YJDH 2W9DL 1YPZA 4JDZA 3OKMA 1FFQA 1TIUA 1F6LL 5ANMA 5C0CD 3WNMA 3QYCA 1QSFE 3CSYB 1KEGH 1WAAF 3GO1L 3GIVA 4E42A 4YBLC 5T33H 4IDJL 2QADB 3CUPB 2YZ8A 4IOIB 4E0RA 2K3TA 4F8TA 4HJ0D 5I0DA 5DVOA 5HYIA 2L0DA 2VH5H 1MEXH 4JN2B 4HIHA 2VXQH 4F9PA 1J18A 3LH2L 4AIZA 1JNNH 32C2B 3LY6A 3MSPA 4GKNA 5MI0C 1CICA 1MHPH 5L2JB 4KJQD 3GJFB 3O8XC 3QIUB 2B20A 5T3ZD 5GRVK 4GLRH 3FB8A 2VLME 4JM4L 4CVZB 1SJXA 3BUTA 4YBQD 1PJ9A 3KJ4B 4NM8H 3FOLB 1MAKA 2DMKA 3OJMB 4R9HA 5IF0A 2NY1B 3QZWB 1YECL 1MLCA 2OR9H 3B2UC 4U1SB 5IMLB 1I8LA 5C0AD 5J9PA 1RVFH 3VGGA 5TF1L 2GJ6B 3H3KA 4WFGE 5HHOA 1I9RH 3QG6A 4KPHL 4OZIE 1D9KB 4YHLH 3MBED 3VFGH 5I18H 4KKAC 5K9KA 4H25B 1GPOL 1YDPA 4BFGA 5DR5H 5JHDD 1J7VR 3C5SA 3RVVD 4RGMB 3KYNB 4YGAB 3D1MC 5ESAA 1KBGL 1NCNA 2VDOH 3KPLB 4EJ1C 3O3DA 1JPFB 1VCAA 4FQXD 3HMWH 4DZBB 3NZ8B 4RISH 4C83B 5L2KD 4QHMB 5E56A 2ZNXA 3SGJC 2R9HD 1U93A 2Q8BH 4Y5XC 3QDJB 4NGHH 2XWJA 2MKLC 4X7SL 2LV4A 1BZ9B 3RZWA 3FFCD 3KXFA 4MAYB 3PWUB 2P5ED 1ITCA 4FFYH 4NQVB 2YN5A 3UYRH 3DNKA 2Z31C 4OIAA 2EXYD 4LLUA 2VLKA 1WT5C 4N5ED 4FN0A 5C6TH 2EYSA 2Y25A 3B9VA 3PJSA 3PWVB 1C12A 4J3VA 4U1NB 4X6DA 1NMBL 4KKLD 3VD5A 2OYPA 1EH9A 1JHTB 4XNXH 3JWOH 3FFDA 4QOKE 4XVUD 3HFMH 2PNDA 2VXSL 2YHGA 3KLSA 3CLFH 1IGCH 3LQAL 2R0LL 3AVEA 1FL3B 5F88B 3T1FB 1T21A 2VITA 3HPJB 1DVFA 3MUHL 4XPTH 1EERB 3IAQA 3U0PA 4PJDB 4Z7OE 1P7QD 3GI9L 2ZWLT 3HC3H 3JWNC 1NEUA 3Q5TA 4NUJB 3BIKA 1IM9B 4IM8A 5E8DL 5TGBB 1QEWA 5J11B 3RPKA 3RUGB 1ZV5A 1BM3H 1KXVC 4OLZL 3OB8A 3QXAB 1OB1B 3GMPA 3O3BB 3VDCA 3HS0B 1XGQA 1YQVL 4KKCD 4G9FE 1JGDA 3DSFL 1Z9MA 3SN6N 4O5LL 5E8PA 3AU1A 3U0WL 1NEZG 3V79C 3CK0L 4YXKH 2HFGH 4O02L 1G7QB 4POUB 2FJGB 5C0IA 2WBKA 4HCRL 5DD6B 1S78D 3WV0A 3IETB 1KB9K 2QR0A 4FQ1L 2X4PB 3VXOB 2IBZX 3CFCL 5C0EB 4A6YB 3WIIH 4X8JB 2PTTA 2XTLA 3AB0C 2B1AL 4XVJH 1Q1JL 2J1KA 1WZLA 3ELAT 4HKZB 3ES6A 1YYMH 5F9WB 1NGWA 3ESVF 1B3JA 1DE4A 5C0DA 5L88H 5E70A 1XF2B 1TTGA 5C0CB 3O4OC 2NZ9D 2GW5A 4MQXD 2PXYA 1YMME 5D5MF 4HIIA 2HRPH 3AAZB 4KGLA 3ARGC 1QRNA 2DYPA 4C56A 5ACMA 5B39A 4PGZA 3KPMB 4P5KA 5DD5L 3EYOB 4XP6H 4XP9H 4TSBL 1VKXA 4C4KT 2IJ0C 4JQXA 4WVRA 5DO2C 3QEUA 2NY6C 1U8KA 4N90D 4DN3L 4ETQA 4PLKD 1JN6A 3BD5A 3RA7H 3RNKB 1ZANH 2E9JA 2UUDK 2WUBL 4APQD 5E2UL 1S5HB 3DIFA 4KMLB 2B2XH 2UWEB 1NGPL 3I75A 1UH3A 4Z8FL 3N85H 3PWNA 2ZKHL 43CAB 1I9JH 1QYGL 3FO2B 4JEGB 3LQAC 5KANG 3D69B 1PAMA 4NBXB 3BGMA 4ZUVB 3LKSA 1XF5A 3CFKA 5F70A 1K4CA 3FT3B 3VJ6B 1R3IL 5DSCA 1JWSB 3V6BR 4XNMA 4HHAA 5C0RH 1ZT1A 1ZA3A 4M1DH 1ES0B 1BJ1H 5HDBE 1YYLH 5HHNB 3U4BL 5L9DL 5HHPB 3HAEH 1DUZA 5E6IB 3WD5L 5JHDB 3TM6A 5DI8A 2HLAA 5DTFB 5D96B 4YHKL 3ZDYE 3HE6D 1P5VA 2R4RH 3VXUD 3L3DA 3BQUC 2XFXB 4F33A 3O0RL 4U6TA 5GGUA 1MWAH 1N4XL 4FQXB 3VMNA 4OGYL 5L2KB 4LLQA 1CR9H 1F58H 1IM3A 3F62A 3BPOB 2NY0B 4X7TB 4H88L 2CLVA 1AP2B 2H1PL 3VGBA 5HY9B 4WUUA 1HEZB 5DUMH 4TN9A 1NC4D 4GS7C 1FNLA 1M71A 2ITDA 1QPXA 1KACB 3U48A 3RHWK 2V7NB 3FFCB 3KYOB 1RZIA 2BMKB 5JR1H 1YUHA 2JIXD 4JHAL 4G80A 2VKWA 1NMAH 3PGCB 1EZVY 3Q6GH 4RAUB 2HT3D 2JJTC 4NWTL 1CGSH 5ICYA 5DDHA 2BCKB 1JUFB 4BYHA 1G84A 4U1LB 3OSKA 2B4CL 4N8CH 1OL0A 4XH2B 1JHLL 1FE8H 3GBNL 4LIQH 3N1GC 3UTSA 5FA3B 3VXMD 5IHBA 1EVTC 3OGCA 4WFHE 3MUZ1 4HKXA 3V52L 1BVKA 2XA8H 2JTDA 3F7RA 3QUKA 2I27N 3V0WH 1JZ5A 3EOYG 3MLTB 4X98B 4KKBD 3MV7D 4KJYB 4POYA 4W4NA 2E3VA 3BOVA 5B8CA 5HSFA 1BAFH 4PJAF 4JAMA 3LQZB 3C2AH 3TIEB 3CFEB 1GZQB 4L8BA 4MLIA 1S9XA 5SWQB 1Y6NR 1H5BB 1NGYB 4FXGA 2R0ZL 3ROLA 1G6RH 3TA3A 1FG2B 5JOPD 4XAKD 3D5OF 5FYJL 3TLRA 1C1EH 1II4E 2I60H 1LNUB 2WSKA 3E6HB 3OB0K 4JDTL 4JLRB 1A9BA 4YXHL 1U8LA 3TNMB 2K9UA 4MSWB 1IAMA 2J4WL 2ZG3A 3WXWH 4LK4A 3B2UD 4X9FA 3C6LC 3MXVH 1NCCH 5F3BA 3O3UN 3SE8L 4BQ8A 1WGOA 4I4WA 4GAJH 3KPSA 4Z9KB 4NO5B 5EPMA 1QBLL 4J3XA 4POZD 3KWWB 5T3XD 1N6QL 4LIQE 3PV6B 1FLRL 1EBAA 4XPFL 5ID0B 5IHZB 1YMHA 1LEIA 3O2DH 2VLJD 3EHBC 1WC7B 2PUQT 1YY8B 3L3IB 4H20L 4LCUB 3EOAA 3VFRA 3G9VA 1E6JL 4X4ZA 3KNBB 3OR6A 5HYQA 1AGCA 5GJTL 2OBGA 1NUDA 3UC0H 1NKRA 5FA4A 5CEYA 2PYED 3MLXL 3CNKA 4GRMB 4QY8A 3CFBA 4FMKA 4OCWL 1XGYL 1MELA 1V3KA 2G5BA 1KCKA 3DX6B 4G7YL 2FR4A 4QRRD 2DQCL 3ZZ1A 4X4ME 1D5IH 2Z31D 2B4CC 1BJMA 3MJ9A 4APQB 4Y1AB 4F15B 2D31A 5F1NB 1OPGL 1S7RA 1AGEA 3O2WH 5J89A 2I25N 1FNHA 2W60A 3CVIL 1S3KH 2P1YA 4R97C 3MOQA 2C1PA 3QZWG 3ARPA 4G8GA 7FABH 6FABH 5ESQA 3SDYH 3GMMA 4AYFA 3ETBF 4L4VA 5C6WH 5KVFH 2CUHA 1UA6L 2HFEA 2XZQH 3V5KA 1A6AA 3IU4H 3KPRE 5BRZE 2Z93B 1KN2H 1QR1A 5KSUB 4MJ2A 1RZKH 5EZJB 3P9MA 4NM4H 3EJJX 1TETL 3HE6B 2W91A 5ADOL 3U36A 1KPRB 1A7RL 3VXUB 5DS8B 1FG9C 3LAFA 2BVPA 2X4OB 1S8DA 3HI6L 5D7LA 3P4OA 3UAJC 2ZSWA 2Y1VA 4YHOH 5C70A 1JWMB 4JVUA 4V2BA 2GKIA 2R1WA 1IKFH 1V7MH 4OAWA 3UYOD 1NC4B 3DI3B 3S35L 1BZ7B 1ZHNA 3X17A 3QUMB 5D4QA 2IF7A 4R3SA 3SDAD 5CEXB 2JIXB 3KPTA 1RIVL 1MREL 5C07B 4AM0B 3CJJA 1AXSB 2JE8A 3UPRA 1K3IA 5D7JB 4I13B 1SEBA 2YXMA 3EYQC 4X6CB 3MLVL 1WICA 2ICWJ 2GAZA 4P5MA 2YPVL 4M7KL 3QXUA 1T04A 3MRJA 1I75A 4WWID 5EWIH 1UWEH 5C0FA 4S1SH 1UWXH 3H9ZA 2DKUA 3NCEB 5ITBL 4HK3N 1ZTXL 4YO0A 1XF4A 5D2NA 4NHUB 1KIQB 3VXMB 5JORB 1JWUB 2P24A 3AS2A 1AXIB 5EC1A 1TQCC 3B5GA 3RDTD 1KELL 5BOPA 2QBWA 3FT4B 3FHQA 4H8WH 1XR8A 1J0JA 4YEEA 3MV7B 3VGDA 1P6FA 4HF5L 4O51B 1CFTB 3LRSA 1HE7A 4UT6H 2OMNA 4R26L 1T7VA 3BHBA 4G8IA 3PGDA 4MXQC 1QTYT 1AE6H 5DO2D 2NY6D 5MI0B 1JRHH 4TPRL 3WJLA 3LS4L 4XNYL 4MLSA 1N7ML 2XWBB 2GCYA 2FJFA 2Y06L 2APXA 3X3FH 3L95A 4L8SC 4QXTA 5DFTA 3W0WA 4HWBA 3WHE0 2CLRB 1R3JB 2X05A 3DBXB 5AD0A 2F53A 5C71A 1AFVL 1ACYH 1EV2E 1H3VA 1L9MA 4OF5A 4FQQB 3F7VA 1BQSA 5CKAA 4PJIE 4RGNC 3G5VB 2R56L 3CC5B 5IK3A 1RK1A 3IJYA 5E24E 3CFDB 2OI9C 4PY7A 3ARTA 4QT5A 1QO3A 5BV7B 4BKLB 1UM5L 4RA0C 4ZAKC 2P47B 3L5XH 2IG2H 2VLJB 4P59L 5CP7B 3ARFA 1XEDA 1BREA 5FM5O 3V6ZA 3K7UA 4GH7B 3SDCB 3AUVA 3SQBA 1EFQA 3QQ3B 3NIFE 3QWRA 5E8NB 1AGBB 1FC1A 5I1GL 2BSTA 5CJQL 5A2IH 4S1QH 3F5WB 2PYEB 5D1QA 3TO2A 4Y5XB 1A5FL 4NQSA 4P46D 4XNQA 2YOCA 15C8H 2NNAA 1DEEA 3UJIH 1W0YT 5DK0B 1Q0XL 4X9GA 4ZO7A 4UV7L 1NDGB 4KHXL 5ESVA 5TFSH 3F7PC 4EZMA 2NW3A 1QFWM 2YBRA 5CS7A 4F58L 3HAEB 2JCCA 1JGLH 1XR9B 4JKLA 3WFBL 2EKSA 5I16A 3GSWB 1OAKH 4JFHD 2DIJA 2L7JA 1L0XA 1MCJA 1Y0LA 4KMQA 1D6EB 1HI6A 4WI7A 3NH7L 1ZLWK 4ODVL 2HT4D 3LPGA 4IS6B 2FNBA 4HC1A 1YNKH 4RMSA 5JXEC 2AABL 2X4RB 1N26A 1NGZB 1T22B 3O4LD 2R69H 3RZCB 3QIBC 3TYGH 5HI5C 1U3HD 1NBYA 1X5AA 1R3HA 1JYVA 3K81A 3W9EB 3VXSE 3FCTB 4JGJA 4CJ1A 1S7QB 5FK9B 2ZOLA 1G9NL 2HVKA 5CZKA 3SDAB 5INCA 2HT2C 5J1TC 5I1JH 1S7TA 3M8OH 4KI5E 5MEPA 4R2GD 3GHEL 4NRXA 3T0EC 2OXHA 1T6WA 4KRPC 1D5XA 1FFPB 2VSDA 4U3XA 4GKSB 1D5MB 3ARDA 3P4NA 5F97E 2R8SH 4NC2B 1ZHBB 2Q8AH 3U9PH 5HGAB 4PLJC 3EJYC 2E7LA 2DQHH 3C6LD 3EYVB 5IBLD 3PG2A 3CSYA 4PLOB 2FGWL 3CUPA 4IOIA 5TE6H 1A1NB 2PO6C 3HMXL 3RDTB 2VDRL 1H3UA 4JN2A 4XXCC 3BKCH 1IGFH 3EHBD 2P44B 32C2A 3VMOA 3QFJD 1DFBL 3I6LD 3WEXB 4L29B 5L2JA 3IDYB 4K3HA 3WYRA 3QIUA 4P57A 2E5EA 1H3TA 1EX0A 1A14L 5JA8B 4JG0L 3DARA 4CVZA 2NPLX 4ODHH 3BVNB 4HS6B 5KBNC 3QZWA 4MCYB 1N6VA 4U1SA 5IUSA 1B90A 2ED7A 4LASH 2JB5H 1IC7H 1INDL 4PP1D 3TIDB 2GJ6A 5I8KL 1KLGB 1D9KA 1MJ7L 5AWNL 4H25A 4XCFL 3V6OA 3SEPA 3RKPA 3MBXL 3U4EB 1BQHG 3FONB 3FRUB 4QHKI 3W11C 3K8KA 3FRPG 5LXGH 4XXDB 3NCFB 3KPLA 4YE4L 1BFOB 5GS2D 3GZKA 4DZBA 3VWKC 3NZ8A 4C83A 3L3GB 3NPSC 4QHMA 4OZHE 4U6XB 3EZJB 3ZYIA 2OM5A 3PABB 2EO1A 3NOIA 3UROR 4EBQH 3QDJA 1TDQA 1G9NC 1NMCB 1BZ9A 3OPZL 4MAYA 3PWUA 3HNVH 4NQVA 4O9HH 4LSPL 4UAOC 2P45B 4JFDE 5EUOE 2VLRB 2H26B 4LSUH 2HLFC 2PCPA 4HZAA 5ALBL 1J8HE 4MA3B 5E99L 1T3FB 2IGFL 1ZXQA 3R0MA 3PWVA 4P46B 1U42A 4PJGE 4U1NA 4S1RH 5D9SB 2Y7QB 2E9IA 5K33A 1JHTA 4QGYA 2UZIH 3DI2B 2RIKA 4FTVD 1TZIB 2BDNH 1IVLA 2BVEA 3OG6B 4Y16D 1FO0B 3EO1B 4JO2L 3WDHA 4HPOH 3ZDZF 2BERA 2G60L 5F88A 3T1FA 2QSVA 3GRWH 1MI5B 3HPJA 4HXBL 5EO9B 3SDXE 3W2DH 1B0GB 4PJDA 1CXFA 1FZMB 2VLLB 4K55A 4M6NH 3SDDD 1U2HA 1QHPA 1BF2A 1EPFA 2F54D 2YD2A 4FQ2L 2JJSC 4NUJA 4PJEE 4XRCB 1IM9A 5TGBA 3RVUD 1LDPL 3RUGA 2VZUA 3MLRH 2IMMA 3QXAA 1OM3L 1OB1A 3O3BA 3BP4B 3GMLB 3HS0A 1OP5H 3O4LB 4ONGL 1W72H 1QFUL 1MCRA 1A6UH 2K7PA 5ENWB 1SM3L 3OAZK 1BF8A 2F5BL 1U3HB 1G1CA 1I9IL 3MLSH 1G7QA 1GHFL 3CX5K 3V95A 2FJGA 5TDPB 1DN2A 4Y4KB 2FX7H 1UJ3C 2C3HA 2CH8A 3PDGA 5DD6A 3IETA 2C4XA 3EGSB 2X4PA 3VXOA 2YD3A 4UILL 5C0EA 2WIIB 5IESH 3DRTB 3QNXB 4A6YA 4R2GB 3OZ9L 2BHUA 4X8JA 1Q94B 5IB3B 3R1GL 3P0VL 2YPKB 5TQ0L 5KSAC 2A6DB 4HKZA 4U33A 3T2OA 4NOBA 4WW2B 3MOBL 5A16B 1XF2A 3UBXI 3TWCH 3F58H 4K94H 5C0CA 4FQJL 1YC7A 4LSRL 1A47A 1KLFA 2NY5H 1Y18B 5MP6H 1TQBB 3AAZA 1AGFB 4LPXA 5F9JB 4HPYL 2J8UB 1ZKAA 1B6DA 2G9HB 4WFEE 2D7TH 1MFBL 4I3SL 3KPMA 2J12B 4G5ZL 1MVUB 2P5WE 4GSDH 4U7SA 3QFJB 5I66A 5BS0E 3MRDA 1EEYB 3RNKA 4BZYA 5GGVY 3FMGH 4Q6IC 1MCCA 3TVMC 2Y5EA 5I1EL 5JOEA 2UWEA 4LSVL 2NY3C 2UZYB 3FO2A 5T1DL 3P0YH 4QHUB 1K3ZA 3D69A 4LMQI 4MA1C 2XKUA 4PJXB 2RCSH 3WL9B 3FT3A 1OCWL 1WISA 3QXTA 1A22B 3VJ6A 4CRPA 4YC2C 5GS3A 1WUNT 1JWSA 1FNEB 4AEIL 1ES0A 5HHNA 5HHQB 4UQ3B 3V4PH 1SBBA 1BWMA 5HHPA 5E6IA 4J12A 5F44A 3TT1H 5DTFA 3FO0H 3RGVC 25C8L 4PRHE 4YQXL 4X6BB 4R8WH 5F7EL 2XFXA 1KENL 2A83B 4FQXA 3W81A 4WI5A 5L2KA 5D72L 3VXSB 3S98A 1BOGB 3IF1B 4X7TA