5L8RC

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
b'SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l8rC00
1C4CA 3MM9A 1VJWA 1B0VA 1FRXA 2FJAB 4OV1A 1FRIA 2VPZB 4OMFG 3MMAA 2PA8D 3IR5B 1DAXA 3LW5C 3MM8B 1KQFB 3EUNA 1GT8A 2V4JA 2FJBB 1FXDA 3MMBB 3MMCA 2GMHA 4XK8C 1B0PA 1SJ1A 2XSJA 2WSCC 3OR2B 1BWEA 1FTCA 1A6LA 1JB0C 1RGVA 4Y28C 1KEKA 1IR0A 2Y0SD 1JNZB 1D3WA 1HFEL 1FRJA 1DFDA 1DURA 2IVFB 2GMJA 1BD6A 1FRKA 3MM7A 3EGWB 1BQXA 1FD2A 2Z8QA 1AXQA 1G6BA 5E7OB 1FF2A 4DHVA 3IR6B 4CI0B 2VPXB 4KT0C 1C4AA 2VPYB 1FDBA 1FXRA 1WTFA 4YDDB 5BYRA 5BYQA 2WAQD 1SIWB 1FRHA 3EXYA 1FDDA 2WSFC 3MM8A 5BYSA 3C8YA 2ZVSA 1Y5NB 1Y5LB 3OR1B 1FDNA 3IR7B 1PC5A 1FCAA 3MMBA 3MM6B 1ROFA 1F5CA 5L8RC 1B0TA 3OR2A 4XDCA 5CH7B 7FD1A 3HKZD 1FRLA 1FEHA 1Y4ZB 3GYXB 1Q16B 1IQZA 1KQGB 1R27B 1XERA 1CLFA 2FDNA 3MM5B 3MM9B 1K0TA 2V2KA 7FDRA 1PC4A 1F2GA 2FJDB 1GTHA 4L6V3 2FGOA 3MMAB 1FDAA 2WB1D 1FRMA 2PDAA 2VKRA 2V4JB 4ID8A 2PMZD 1SIZA 2WSEC 3MMCB 4RKUC 1F5BA 1H7WA 2XSJB 1H7XA 5FD1A 3PNIA 3OR1A 2FD2A 1BLUA 6FDRA 1Y5IB 2VPWB 1BC6A 4AYBD 3MM6A 2C3UA 2C3MA 1H98A 1G3OA 3MM7B 2UZAA 2C3PA 2C3OA 1GTEA 1FERA 2C42A 1JNRB 5CHCB 1GAOA 2O01C 6FD1A 4XDDA 1H0HB 3MM5A 2FJEB 2C3YA
chains in the Genus database with same CATH superfamily
4I6YA 2PEHA 3CD5A 3F44A 2D69A 3OVBA 4LF8J 1V6HA 2V4JA 1FXDA 4LJMA 2HYIB 4F4KA 1ZZNA 2B43A 1S6PB 3M2UB 4DV0F 2W4PA 3NMRA 1YKWA 4DX5A 4WIIA 2HQIA 2VODA 4YB6A 5C2CA 3OR1B 3HFVA 4JB8B 5K8OA 1BWVA 2C22A 1U09A 1M0SA 1VQ8S 2YY3A 3HK2A 2H1YA 1XK8A 1S6PA 4QPTA 2CZ4A 3HVAA 3M2UA 1GQEA 1RCXB 4OLOA 4FKXA 3FZ2A 1ULRA 3C6TB 4X62F 1SJ4P 3M6WA 5ITHA 4B9VA 4CLZA 3OR1A 3MECB 2UVVA 4K4YA 1VR6A 5KFDA 2N4DA 5D78A 2BR0A 4URQU 3G6XA 4JI0J 2FJXA 4P7TA 5DO2A 1YJRA 2ZBCA 2C42A 1Q8LA 4TXSA 2J9CA 4D3HA 4XDDA 3QIDA 3R5BA 1XC9A 3K59A 3V2UC 4KHMA 5B7WA 3SFGA 4ANCA 1NHVA 5L39A 3FCVA 1XMQJ 3C6TA 4ES1A 3MECA 3CC7S 3W62A 2L48A 4C6AA 1IJEB 4MYTA 3K5OA 5HK4A 2PMHA 5HBMB 5KG7A 1JIHA 2XS2A 3UDLA 4DSFA 1G1XA 2RILA 5KFMA 1ZBTA 4W4MA 2N7YA 1QSYA 4DN9A 1N0UA 3J7A1 1RQ0A 3L95X 4UW2A 1RT3B 3G6ES 3RBXA 3KUEA 1FDAA 2MHEA 5CYMB 1S79A 5HBMA 3UR0A 1L5UA 5IV3A 3ISND 4X4PA 4RR5A 2XCAA 2O5DA 1EKRA 3LO3A 3THTA 1R7IA 4FYXB 4MTPA 1IBKF 2ZBIA 1BY9A 3AQOA 4FPRA 4CH0S 2K2PA 1RT3A 2RH3A 2R3VA 3GQCA 2B51A 3Q8RB 5CYMA 5H9FJ 1RLDA 2HWTA 4L3NA 4KR0B 3UW1A 1SQFA 4LRBA 2B4OA 3RZAA 3MDFA 2JH3A 2VV5A 1BXNA 1FJEB 4Q2MA 1JNZB 4UUWA 4FDFA 3AJDA 1FD2A 1WG5A 5KFEA 3ADAC 4KT0C 4P9SA 2UUAF 4ECQA 1S9FA 4KHPF 2WSFC 2UVWA 4HACB 2MLYA 3OTOJ 2WW8A 3MPWA 2HBQB 4YR3A 2J7KA 3RB0A 4K4SA 1G4CA 3UFCX 4DSJA 3S1TA 4AT1B 1EAYC 4OI2A 1P9YA 4DV4F 5CZVA 1ZA1B 4OYAA 2RSQA 3KUGA 4XPEA 2I6WA 2VG7B 2E9TA 4HACA 2B9WA 3PRVA 2XQCA 3H98A 2VJUA 2ZC3A 3M8QB 3EZUA 4F4YA 2ZDPA 4RWXA 2P6TA 3MCMA 4IDKB 3D2WA 3LW5C 4NXMF 1N33J 1MU2B 4ZVTB 2BE7D 2VG7A 2FHKA 2QMWA 4PG7A 1S57A 2HNDB 4C0HA 1S9EB 3JB9k 2JJ4D 2IVFB 4NYZA 3M8QA 2AJ4A 4IDKA 4IO9Q 3QMQA 2E7WA 4NPOA 4G1PA 1HD0A 3EPGA 2ZKTA 4ANDA 1MU2A 4FN5A 4ZJOA 5E41A 1KHWA 3CDUA 2HGNA 4J37A 3HHNB 4YY3J 2UXCF 3L7UA 4JV5F 4FF2A 2J76E 1HA1A 2ASLA 2AZ3A 3PXGa 3PJXA 1UETA 2HNDA 1S9EA 1XNRJ 2FDNA 2YNHB 4USVA 1RT7B 2QT7A 3OVAA 2G4BA 1EIYB 4NLOA 3E3XA 3BKUA 1SC1B 2ZVIA 2R4FA 3GSIA 2MTLA 3ILIA 3O5TB 2ZH5A 2W01A 2R7OA 5DGBA 4YDXA 3AJ2A 1VQ7S 2C2OB 2DEIA 1IUJA 2G1DA 2XC9A 4P2XA 2YNHA 1S10A 4JI6F 3T5LA 4PWWA 5KFJA 4CIOA 3SFUA 3K2YA 4J9KA 3HO1A 1QSSA 5EWEA 1I94F 3GTYX 2VIHA 4E8UA 4WIQA 1X8DA 2WHOA 5KFUA 2MB0B 2V63A 5E3PA 3AH6A 3R97A 2V2ZA 2NR0A 3B54A 2UUCF 4HDGA 3HSGA 4DZ6A 3VHQA 1JXEA 2ZKUA 5DETA 3JYTB 2E1CA 1N8RT 4WYLA 4Z7CA 1AT1B 1S9GB 1UP1A 2FYXA 1P8GA 2PMZD 5DQIA 2N7CA 1U1LA 4OJHA 1WD6A 1H72C 1T9YA 3PRBA 4RW7B 1HD1A 3QSIA 3OL9A 2KYXA 2LMIA 2CVIA 2FZKB 3WIUA 1HWKA 1U25A 2VKZG 3GONA 4B3SF 5A8RA 1NSQA 4N56A 2IVMA 2MQ8A 5F8IA 3JYTA 1OMSA 2AJ2A 3U02A 4I69A 1S9GA 3UDCA 2FVRA 2EEYA 3IWLA 4KIAA 2XCPA 3MMBB 1KOHA 1ZOTA 1UL3A 4LR9A 4RW7A 1M5PC 1BD6A 2RU3A 5B0GA 2X3DA 1G7CB 1RKIA 2AD9A 2RS8A 1R6VA 2UVRA 3MMBA 2MQLA 1UA1A 1SCJB 4O3PA 2FLLA 4LUBA 3TJ9A 4RUHA 1KQGB 4DUZJ 1HQEB 8RUCA 3MM5B 2HAIA 1DY3A 1RWUA 4LFCJ 1KQSR 2HZCA 4J9RA 1N54B 2UVUA 3WC2A 1W26A 3VV2B 3KTQA 4LF9F 3CIZA 3NCRA 4QQBA 2EPIA 3MM7B 3AOBA 3I32A 2ERRA 5AE3A 3UCGA 2J9DA 1HQEA 4K5RA 3MM5A 4B08A 1RYSA 3K17A 2HFSA 3CCRS 3OD2A 1S1UB 1H38A 3FQKA 5CYQB 4L72B 4PWUA 4CO1A 4UZBA 4OQJA 5GMEA 4UOGA 1HNXJ 1UEUA 1A6LA 2B8QA 3DCAA 5LMUF 3MM7A 3W60A 3NOCA 5IT4A 1HBMB 5L9XA 1TL5A 1S1UA 1S77D 3FRZA 4LFBJ 3RB6A 2H48B 3CJ4A 4TQSA 5CYQA 1D09B 2BMBA 4P2MA 3G4SS 4Q43A 4ECSA 4CLFA 2KFNA 4XDCA 3M9MB 1TKTB 2DH9A 4TNOA 2CKWA 3SI8A 1TKXB 3FCWA 4DUYJ 4BBYA 3BEGB 4U9RA 1HBMA 2KJVA 3G86A 3LGHA 2CQ3A 3CIMA 1PJ5A 2Z0GA 4F4ZA 4ED3A 4LF8F 1TKTA 1S7IA 3EVWA 3SCLE 4C7QA 1TKXA 3A8JA 5D8HB 1YQHA 5A0YB 1RA6A 2GMLA 2DPJA 4X4VA 1FWKA 2ZFHA 2CUYA 3AJ1A 1S7HA 4DV1J 3T1HJ 4DV2J 2ZJQQ 1JB0C 5EDWA 1S72S 1IKXB 3SQOP 1WC0A 3I5CA 1DURA 3DGVA 3HXMA 1JWWA 2F8EX 3WHIA 2VONA 1FVQA 5A0YA 1XR5A 3SYZA 2R7WA 3EJMA 2XZWA 3PX0A 4FKYA 3W7BA 1YJWS 1JJ4A 1TQLA 3ZFVA 2OH2A 4ZPCA 1IKXA 1HIYA 1F9HA 4A48A 3MAQA 1FNXH 2MLXA 2XHCA 2AYMA 2VBZA 3DHWC 1V9OA 5KFZA 2W8LA 4ID8A 2RQMA 4PQAA 3MUMP 4C11B 4ED6A 3CDWA 3WC0A 3CJSA 3H2LA 4Y34A 4ED7A 3U1NA 2ABYA 1KLNA 5ETVA 2KI2A 2KM8B 3PO4A 2HLTA 4J9MA 2V94A 2HHTA 3RGIA 2ILYA 1O6XA 3QATA 3QZ7A 5ETNA 2J8AA 3R3TA 4Y2MA 4TVAB 3EMTA 4C11A 2VBYA 4EI2A 3L7OA 5HQLA 1WORA 4H54A 4F0HA 2VICA 2KVQE 2LU2A 1SL0A 1DFDA 4NYPA 4NRTA 3QIPB 3EGWB 4LF7F 4EMDA 5GAGI 3BSAA 2IYGA 4AE5A 3U1LA 3OW2R 2MXYA 5F0WA 3J7YI 2H5EA 3AD7C 3KMSA 2W8KA 4JI1F 1WEZA 1EQ0A 5KAKA 1EP4B 2F5GA 1UKUA 2EKYA 4PZVA 1OSDA 3C16B 3QIPA 2C2NA 4QW8A 2VD3A 3FSXA 2QSFA 1JLEB 3PJWA 2KG0A 2MMYA 2A0FB 1SKWA 2H5IB 1OQ6A 4OYZA 4U8YA 3GILA 4DL7A 3LP2B 1EP4A 3DN9A 1XMBA 1AFIA 3C16A 2OHDA 2F7VA 1U1PA 5LOQA 2PO4A 1RHJB 3OSNA 2HAFA 4IYQA 1JLEA 2YVSA 4RNMA 2VA2A 2H9ZA 3M2RB 3BO3A 3LP2A 4KYZA 5KFBA 2M8DB 5D0EA 3PY8A 1VQSA 4LBHA 1QLNA 2F9DA 4ZVUB 3ZZPA 1N5SA 1VGYA 3NS7B 5DM7Q 1IR1A 1B4SA 3GLJA 3LOUA 4RUBA 4UY85 1FEHA 3DXSX 2VA3A 1FTRA 4RL1A 4PQUB 3M2RA 2FVCA 2JVOA 3LH2S 4ZN3A 3LGMA 3HPOA 4PXEA 4CLUA 1TFYA 4RU9A 4XAKA 3ULHA 2MZTA 1XWLA 1NSKL 4DR7J 3TZZA 2CPZA 2CPYA 4K4XA 1VS3A 4YB1P 1DQ8A 3DMJB 1TELA 2W24A 3R9LA 2AGOA 1KFSA 1N33F 5D3GB 4ZP8A 2ZZTA 3KG1A 1JNRB 4PQUA 4JP8A 1B0VA 3SSSA 4KJIA 2IRXA 2BANB 1UJ6A 3MM8B 3QWPA 2OPRB 4LF6F 3VGSA 1X4DA 1I6JA 1HNWJ 4QJVA 2ASDA 1M90T 3DMJA 1SJRA 1WDTA 5D3GA 4BLGA 2H65B 4YY3F 1JLAB 1V3SA 2BANA 1VHFA 3MM8A 3EZ5A 4WTOB 2OPRA 4N7TA 2OFHX 1RISA 2ZUAA 3N6LA 3ZNJ1 4LF2A 1RBLA 5M2PA 3TAMB 4LQ3A 3HT0A 2K06A 4URGA 1JLAA 1FKOB 1A9NB 1R43A 2Z58B 1Q8KA 1MMDA 4KKOB 3T1YJ 3PNIA 3C15B 4K4WA 6FDRA 2QFJA 1RHUB 3FUYA 1Y10A 5MAOA 1JLGB 5ETKA 1S97A 5LJ3Y 3QZ8A 3TAMA 3K5MA 4AQYJ 2EG1A 1T95A 5HP1B 1NDKA 3CF5Q 1FKOA 5HMWA 3HT3A 4ZCMA 3OR2B 1BHNA 4KKOA 1LK7A 2QLJB 3C15A 2YKOA 2GCFA 1UFWA 1JLGA 1FRKA 5K8MA 3F41A 2POKA 1YWXA 4M63A 3GR1A 4LVNP 4Q2LA 5HP1A 2J6SA 3IG1B 1YVFA 3SDEB 4DU8A 3OR2A 2N3OA 2KU7A 3UI3A 5KT2A 1T8EA 1Q8BA 1VMBA 4IFVB 4ER8A 2IDEA 4DQRA 1WKLA 1U2FA 1K8AT 1NPRA 2V2QA 2FUG9 4DX7A 5T7LB 4RKUC 4IKAA 4L73A 5KFVA 3KFWX 4ZCIA 4JYAF 3IG1A 3D1HA 4ICLB 3SDEA 3UPFA 3OL7A 2NLWA 2BRLA 3DLBA 2XULA 4CQ1A 3W9JA 1NJYA 4LRDA 4ED2A 3ZZUA 4IFVA 1U0HB 3J7Z5 2IC3B 1VOMA 2CAJA 3OUYB 4IFYB 1QUVA 1R3NA 4ZCLA 3LALA 3VAJA 5T7LA 1ZPWX 4GRSA 4CT9A 4OHYA 4ICLA 5IM0B 4DR3J 1RWWB 4BDPA 4JI3F 3AHPA 3M05A 3J7ZT 1KOOA 1SKRA 2G0CA 4DFPA 1U0HA 2IC3A 3NNHA 4ECYA 3OUYA 4IFYA 2GX8A 5HMXA 1HARA 3CCJS 1RE1B 4LFCF 3FZBA 5LSOA 4K8RA 3RB4A 5IM0A 4LSNB 4W92B 3CEDA 3LWMA 5K14B 3E51A 4P6QA 2YBVA 4B9LA 3HZGA 2FLOA 4ZOSA 2QEXS 3BGFA 3Q86A 1LWXA 2IM2A 4USMA 3V4IB 1RWXB 1NUEA 4GO5X 1NXIA 2DPIA 1H7XA 4IO1A 2C2ZB 3GYNA 4WF9Q 5I4MA 2ZH6A 4LSNA 3D0HE 3HD1A 4OLPA 6FD1A 5K14A 1HNXF 2B7CB 3K7RA 3NCQA 5KFRA 3AD8C 4QYRA 1P1TA 2OIHA 1CPZA 4MKBA 3GU0A 3V4IA 4LFBF 3NKYA 4YB7A 1HFEL 5IQ6A 3UE2A 2BKOA 1OIAA 1J27A 4OX9J 1RT2B 1JLFB 4DHVA 1DZ5A 2XBPA 1NRKA 1SJ3P 3G6YA 1OPIA 4MH8A 3IM9A 2GW8A 4DUYF 3M32B 1RT5B 1GXTA 1ZM9A 4F25A 1QSLA 2BABA 3BN7A 4I7FB 2EI5A 4V1Ak 1SH0A 1RT2A 1JLFA 4I0WA 5L1JA 2VC1A 4WFXA 5DDOC 3QGPA 5KT3A 4K4ZA 1C2PA 1F3FA 3PW7A 5J2NB 3H5UA 2BACA 3M32A 2W4CA 1RT5A 5E33A 4DQPA 3RAMA 3N9UC 4LF5J 1I51B 4NLYA 3T1HF 4NZ0A 4DV2F 2NZ4A 4QR1A 4ZLNA 4I7FA 4C3KA 1B7YB 4RZRA 4O44B 4Z7YA 1RT6B 2CG8A 3HX9A 1VBYA 1N0VC 4TLQA 2YQ3A 2BQ3A 1W25A 4QWEA 5J2NA 2V69A 1OO0B 3SCJE 1N5YB 4KRWA 1FF2A 4HVZA 2VDIA 1WF1A 2IBOA 3IWXA 1EB0A 1T11A 4O44A 1RT6A 2KZZA 5DG9A 1IBLJ 3V6JA 4QWCA 2W2QP 2W1BA 1SC6A 3VF0B 1N5YA 2GAHC 2FZCB 3E2EA 2ILZA 2FJDB 4KGMA 5K8PA 1WC5A 2GV1A 3WBZA 1WC6A 3TX8A 2L9NA 3TI0A 1I3OB 1GK8A 1F5BA 4V19X 3SSQA 4UOHA 2AJFE 4ZVHA 4DR5F 4NCBA 4AYBD 4EU0A 2AHOB 1RADB 2LQJA 2QV6A 1YX2A 4DJBA 5DLFA 1LQ9A 3NGDA 1UVMA 2ZOFA 5A6WA 1X5OA 4TU7A 4FBTA 5F8GA 2CZVC 2BE9B 3MI7X 1FT8A 2IRUA 1FTCA 2QL5B 4LMZA 2XNRA 2DGTA 4DPYA 5K20B 5B08A 2Y0SD 2OMOA 2NS1B 5CYJA 1KWMA 2DNHA 4DL0C 2VFVA 3Q2TC 4EEYA 1WTFA 1TAQA 3PHTA 2ASYA 2OI2A 5EGYA 5KTQA 2R7XA 1Y5LB 5F8HA 2VDHA 4R5PB 3W2VB 2DIVA 3MUVP 1FJCA 2C1EB 2NPIA 2MZQA 2ZH4A 2HFOA 2W2MP 4DR1F 3CWJA 4N8OA 3EX7B 1NH7A 2JEFA 1YBTA 1FFGB 1CQMA 1R31A 1GXUA 2G2YA 3QRRA 4NMXA 3GFXA 2LECA 1XQIA 4R5PA 4G6VB 3W2VA 1HBUB 4RW9B 1HBNB 4KAIA 4YP3A 3IFEA 3OTDA 2YX1A 5H9FK 4Y2IA 4USJC 5HJYA 4NA3A 3M6UA 2QL9B 1B0PA 4NLTA 5B0DA 4IOCQ 4IH6A 2DRAA 1UAWA 1HBUA 4RW9A 1HBNA 3NG8A 3M6VA 4F7VA 4CI0B 1X4CA 1T03B 3EWGA 3KNGA 2E5IA 3R7NB 1N88A 2DT9A 2CXEA 1EX8A 3R5GA 4DX8H 4HDHA 4HI2A 1HHTP 3OT9A 2DJWA 1RAOA 4ETXA 5B0FA 1B70B 2YKPA 2CQ4A 3I0RB 4O3NA 4CO5A 4DR7F 4USWA 2UU9F 1VC6A 3NWRA 3CJ0A 1PC4A 3LGNA 4ES2A 5CABA 2MZSA 3VVUA 2W9BB 1T03A 1Q0NA 2DB1A 4CLTA 3UN2A 3EDQB 2HLUA 4BC9A 1QJHA 2WZ1A 1N5VA 2FIUA 4RUCA 1C0TB 3I0RA 4FYWB 2KFZA 3A12A 3AA8A 1QM9A 3OXGA 4CNZA 3OL6A 4ECRA 5GADU 2RRBA 1KRPA 3G8SA 3FSIA 2N3LA 2W9BA 2OAUA 3GIKA 1RBAA 1RAEB 3CCWA 4KB7A 4N41A 2VJVA 1FX2A 2RDIA 1MNEA 3TJAA 3MEEB 1C0TA 3I9ZA 1R8AA 1TKZB 4IR9A 3QQCD 1YJTA 5J2MB 5IV4A 2WAQD 2I2YA 1WF0A 4PG8A 3GSDA 2CPFA 2MY7A 2RAQA 3VAGA 2DNLA 1KD1T 2YXLA 3UNGC 3T1YF 3MEEA 2M5YA 4OV6A 5DDRC 1TKZA 5J2MA 3W8GA 4ZLLA 5F3ZA 2HHUA 4I64A 1CS4B 4OX6A 4AQYF 2C3UA 5B0BA 1NK8A 2W2OP 3KK1B 4MKVA 4MIWA 2C2EA 4UQGA 1LWEB 4X64J 3ENVA 2ZWOA 3BKFA 1CS4A 5IOLA 1HLWA 4CT8A 2R7UA 3PW4A 3BJYA 1SC3B 1HYSB 3AT1B 4NXNF 2EBEA 5C7PA 3R5DA 3KK1A 4G65A 3DRSB 4ILMA 2BA9A 3ILOA 3VCDA 3NWGA 1LWEA 3PEJA 1TFWA 2MKSA 3K5NA 3F0NA 4K4VA 1MWZA 4Y00A 2XMUA 3MEDB 4DV5J 4X4NA 4F02A 4ZIWA 3MTKA 2QA2A 5C24B 2XYHB 2V8PA 1HYSA 4IRKA 3HHKA 2R42A 3ZZRA 3DRSA 4I2QB 3ZTQA 3NRBA 1LWCB 2OPSB 2CQ1A 3BQ1A 1FE4A 4RUAA 1PAEX 3GG0A 5BXIA 4W98A 1G2EA 3BSOA 4N76A 2ADCA 2HFVA 3MEDA 2V9KA 4GKKJ 3ENAA 5C24A 1DLOB 4DR3F 1AROP 2EFOA 1SQGA 5CD4A 2JEJA 1RAJA 4ZVGA 1DAXA 4I2QA 2MDAA 3R1LA 1LWCA 4BS2A 2OPSA 1Q95G 2RE1A 3O6QA 4ZLPA 1HI0P 2IPOB 5DG8A 1M5VC 1F0XA 3MOJB 1S6QB 2GQQA 1SUQB 1ZS6A 4YQWA 1X0FA 4PYAA 2PI4A 3H7HB 4TLRA 3CE8A 2AEJA 1DLOA 2GC8A 1HNZJ 2JNJA 5AE1A 2R7QA 3CPWR 1OPZA 3BBFA 3KLIB 2ZZNA 5L8RC 1CQNA 1X5SA 4USHA 1S6QA 1SUQA 2JHEA 2V4QA 3T3FA 3DDNA 2JLEA 1IXKA 2XMJA 2MGZB 1KQKA 4NLGA 3P49B 3BBCA 2OTJS 3VAIA 4O0IA 2U1AA 5FD1A 5A2QY 3KLIA 4UT4A 4LVOP 2JLFA 3CCZA 3HKWA 3DLGB 4C8KA 3PHEA 1DRZA 1FXLA 4ECVA 1JLQB 3PIPQ 1QVGR 4O23A 2NSBA 5KG5A 2MGZA 2RQ4A 3D68A 4OX9F 3VQSA 2CVEA 2QA1A 3P4UB 4C3LA 1SPBP 3ILJA 4CO2A 2AEFA 2KT3A 2IHR1 2PE8A 1RA7A 3W5YA 4JI4J 5KT4A 4ED8A 4KGVB 4NWBA 3DLGA 4LR7A 5D0HA 5C5JA 1JLQA 2MZRA 2LXFA 1WTBA 2Y9HA 4NCGB 3FBCA 1HNIB 1HR0F 2M2BA 3KKFA 3I31A 3HDSA 3QAUA 4GC6A 4F2RA 3M8SA 2FHOB 4HLBA 2FLPA 2QA4G 2JVRA 4LF5F 2B56A 2QZ8A 4NCGA 2CWKA 3UD5A 1SC4B 3HSJA 3D4JA 1D9AA 4EBCA 1NCLA 2HFNA 1O5JA 4BWMA 5GMDA 1HNIA 1PBAA 2KM8C 1SB6A 2OPPB 2C3PA 1HW8A 4MT1A 3ONQA 2PD1A 3QBCA 2KHDA 3W2WB 4F0MA 2GFFA 1XR6A 4CLWA 2N82B 3CDAA 1KQFB 2LCWA 3THPA 3DRPB 2HS3A 3MTJA 4Q5VA 2D3ZA 1GMWD 5F9NA 2OPPA 4KH0B 2BXJA 1N34J 1X4FA 1Z2ZA 2YH1A 1IBLF 3W2WA 3OVSA 3TJ8A 1U1QA 2MZJA 3KWMA 1HQ2A 1XR7A 2BX6A 2EXUA 1N5TA 1NU4A 4CP5A 3DRPA 4JI5F 2CADA 1L3VA 4KV8B 3Q8PB 1UJ5A 2FY8A 1Q7YT 2QYCA 1JQGA 2A2DA 3SV3A 2BKPA 2VH7A 3KDNA 3JSMB 2MJNA 3HMJG 5AXNA 1DQ9A 4AL7A 1PCAA 4RNNA 2Z57B 3IA0A 3ETMA 1NJWA 4KV8A 4FXDA 2YWHA 2F1FA 5F9LA 3MCOA 5HAOA 1NZ8A 2G0IA 2FJBB 3Q8YA 2COLA 2Q3PA 3JSMA 2JFKA 2P8IA 1WOSA 3U27A 5HQ8A 1IM4A 2IA0A 3THVA 4DV3J 2PFFB 5KFAA 1WWHA 4LRCA 5D6GA 3NOGA 4M1KA 3MM6B 4USIA 3ZZOA 2GAGC 2UXDJ 1S49A 2DVIA 2K7KA 2A2CA 1MSWD 1BQNB 4HTJA 4ATNA 3UR3C 3A3PB 1WSRA 2AZ1A 1W7WA 3D7SB 1KS2A 1HKAA 1KN6A 2LLZA 3P96A 2OLWA 3RB3A 5F3TA 2VHGA 1TK5A 1REVB 4B9NA 3MM6A 2V2VA 1F60B 1REGX 2C3OA 1AUSL 1Z4UA 1T9XA 5HANA 4OV1A 3V4MA 1FJGJ 2V34A 4WK3A 1HMVB 3C46A 1BQNA 2YWEA 5HATA 4ALZA 5FIIA 3CB4A 2GS8A 3NAHA 1SJ1A 1UFKA 1T05B 1REVA 3C19A 5D4LA 1IR0A 3KG0A 8AT1B 3H5YA 1EETB 1X4BA 2P9CA 3LP1B 3ISNC 1T0TV 2UUBJ 2Z2MA 2RJZA 3GWCA 3FEYB 2MY8A 2V8DA 3R5JB 4OJGA 3PTWA 3BQ2A 1U48A 1HMVA 2E5JA 1OY9A 2ZVSA 4WK1A 2JLGA 3TA1A 4ETZA 2M8HA 1T05A 2YPZA 2B6AB 1EETA 4FF1A 4O4RA 3LP1A 5GAGU 3H0PA 2FGOA 3UCZP 4W90B 2KXFA 5KOWA 4BHQA 3UDVA 3H42A 1WKKA 3OPKA 1U1NA 3FRYA 4OJ3A 3A8KA 4J9OA 2AV5A 3BDEA 1Y7PA 2B6AA 4EK2A 4TYAA 3D6HB 4K0KF 5L9NA 1CBKA 4EYIB 5GAEI 3B8HA 4KTQA 3UO0A 4HT7A 1YIJS 4C2MA 2VUGA 3OQ2A 2XMKA 4EBEA 2F4VJ 1XMOJ 3SQGB 3IGNA 1HI1A 1UPPA 4I2PB 4AL5A 4QOTA 3AXKA 4ZPAA 1RXOB 1L3UA 2ZOMA 4U96A 3TWZA 3P8BB 3PYFA 1VC0A 3IM8A 1OYEA 1FEEA 2NXCA 4JI7F 1AYEA 4J7CA 2DNQA 1M1GA 2KFYA 2DTJA 3SQGA 1KLMB 4I2PA 1YJUA 4CZCA 1H3DA 2DEJA 1D9DA 3W9IA 1F2GA 4ILRA 3K89A 2IDLA 3BGOP 1LFPA 4CLPA 3N79A 3OV7A 5KFLA 1Q81T 2P5VA 3ZZTA 3MR3A 3G6VA 1KLMA 1U6BA 2ZE2B 4OHVA 5KFIA 2ATCB 2HW3A 2NPFA 2DRDA 1XBWA 3DDIA 4FP9A 5L1LA 4YR0A 1TUWA 4LT6A 2CJ9A 2CDQA 2HWIA 3NS5A 1NPPA 1KR4A 3NGUA 4K2JA 3PKYA 4N5SA 2NYIA 2ZE2A 2EC0A 4ECTA 4J9PA 2J0XA 5B0AA 2ROEA 2QLXA 2QMXA 2BJ8A 2Q1LA 4ITSA 1URRA 2F3JA 2R7SA 2GQCA 3QWUA 3FMWA 2XHWA 2B4UA 4USTA 3KK3B 2QLFB 7FDRA 2IAJB 1Q4RA 4ID5B 3QGHA 4X4RA 2XSFA 3QYYA 4LBIA 3QJPA 2UP1A 2K3KA 4ES3A 3MD1A 1KTVA 5GMKa 1MG7A 2HMIB 4FZVA 3KK3A 1XIQA 2DR8A 1S12A 4NA2A 4ZIVA 3FQLA 3K0JA 2HHWA 2IAJA 2ZHOA 4ID5A 2KXNB 1T94A 5GVQA 2AT1B 3QPIA 1HNZF 3DC2A 2CJYB 1PKUA 4WFZA 2HZAA 2HGMA 1RWKB 4U7UD 4Q7AA 5FLXY 1EJ7L 1C4AA 2HMIA 1H2VZ 3Q89A 3M4XA 5EHHA 1RZMA 3DNCA 3OXLA 3PW0A 2D1CA 1ZETA 4B3TJ 3TYTA 2D3UA 2BYCA 1S1VB 4OZ3A 2X1AA 3LWLA 2HRYA 1N32J 2BBEA 1Q82T 3QRQA 2QRRA 3CJQA 4NEZA 2MKKA 2KRBA 5C42B 4MJKA 3HP6A 2J0QD 1K9MT 3T5JA 4X65J 1SKSA 2NUUG 3CMAS 1EHWA 1S0NA 3QJLA 1S1VA 4KC5A 2Z2YB 4CO0A 2Y3YA 4DV6J 1FRXA 1RHQB 2D9OA 2J7WA 3GJSB 4QR0A 4DCOB 5C42A 3HHEA 5KG3A 1N52B 1XN9A 1U1RA 3MD3A 3HI9A 2NYHA 2OPQB 5E3RA 1TVRB 5M2UA 1O8BA 2JC0A 1VRQC 1FDBA 1S0OA 4I6WA 4CLYA 3D54A 4I68A 3P5BP 4B9MA 4C0OC 1VQLS 2O67A 1Y3JA 4X4SA 3SIPB 4ED0A 2Q6BA 3RW6A 1NDCA 4QBUA 4C9DA 3AQPA 4Q44A 2OPQA 3G96A 5C25B 1TVRA 3AOCA 4DF8A 5KOXA 2XY6A 2F40A 2QMUB 1GX5A 2FY1A 2QX0A 1RJJA 2W9AA 1H98A 5J2PB 4U67Q 1ICEB 4M5GA 4M5DB 4DS4A 4LF4J 4RBTA 1QE1B 3ETOA 3VAFA 5C25A 1UMJA 3IR5B 3CCQS 2ALZA 4L74A 1N34F 4I4BA 2V67A 3NGKA 2J9EA 4IR1A 4DXLA 3OTEA 2B9YA 5LXYA 4HKQA 1BGXT 5J2PA 2JZ5A 2FJWA 4I56A 4M5DA 3CJRA 4PPZA 4ZPBA 4ENOA 3V6HA 4JV1A 3NBPB 4ECZA 5CZXA 1QE1A 4B9UA 4PCQA 2XMAA 3DLHA 2YPYA 5GADI 1FDDA 2DNNA 3BDPA 3R6LB 4DR4J 4NX9A 2D9PA 2NXEA 1UEVA 1HL6A 2X1FA 4BWJA 1M1HA 3DOMB 1ELOA 1VHIA 3GFHA 3NBPA 3J7AN 3NS6A 3TVZA 3IS9B 3PJ9A 5B09A 4OYPA 4DU7A 1RAIB 2P9EA 4GVBB 3CJ2A 1B64A 2QLBB 4ZVOB 2Q79A 1VJWA 5KFNA 3DOMA 2IY5B 1VQMS 3IS9A 1WG1A 3PRDA 3BYRA 2AWZA 2DR9A 2HFZA 4DV3F 5HVFA 3ISZA 4N47A 4HR2A 4YS2A 1FRJA 4GVBA 2DCUB 4LF1A 1XJWB 3VVTA 1XNQJ 1GMVA 3Q8VA 4DN0A 1YK9A 1NK5A 2UXDF 2CQ0A 1VI7A 3G8QA 4RPFA 3EE3A 3FJ2A 4MK8A 2ZH9A 2ACYA 1WC4A 1MWYA 9RUBA 1KONA 2W25A 3QO9B 3DLEB 1Y4ZB 2J0SD 2CPJA 3D0GE 1WKJA 4Y65A 3I82A 3MM9B 4IH7A 3EXCX 1K47A 2BM1A 3O44A 2BQUA 2HQCA 2WSEC 1NO8A 3CC2S 3TX0A 3KHGA 2E1PA 2KVIA 5IWAJ 2BZ2A 2B8PA 1FJGF 1B3TA 3H2UB 3UVJA 3QO9A 3DLEA 5JJBA 1U8WA 2XG8A 2ZWPA 4HI1A 3MM9A 2WBMA 3ZTRA 2LEAA 3CJ5A 3BKTA 1X7VA 1H2UX 2H5JB 1ITPA 2UUBF 4K2XA 2W2NP 2CYYA 3NXZA 1GMWA 4Y2CA 1DTQB 3CULA 4ELTA 3LA0A 2MSSA 4EZ6A 1YBAA 3N01A 2QTWA 3BQ0A 2XMMA 1CG2A 2VB6A 3LUYA 1PILA 4F3OA 2DO0A 1NSPA 2GO8A 4TN2A 1U2CA 3M1VB 1UVNA 1D8YA 3RR7A 2L9DA 2DIUA 1DTQA 1VBXA 1T7PA 3PDNA 5G0RB 4LQ9A 5M2RA 4F4XA 4EO8A 4TY9A 4EZ9A 4PRFA 4ZP6A 2OFGX 2XSJB 1SL2A 4M95A 4F3MA 1T3OA 1VISA 2XMVA 3PYGA 3LAKA 3M1VA 1BQMB 2Y8YA 4K4TA 1TUGB 5ADZA 6AT1B 1M1KT 3D3CJ 4PR6A 4LSZB 2IYIA 5ETTA 2UUWA 3MPDA 1XMOF 2KYZA 3EGZA 5LJ5Y 2MLZA 1NKEA 5F8NA 5G0RA 2OP5A 1X5TA 3B6BA 4C4WA 3JSBA 2HBRB 2CPXA 2F4FA 2XSJA 2H51B 2U2FA 1ZA2B 3PR4A 3Q8SB 2KT2A 2I8EA 1X9SA 1VDHA 1RHKB 1BQMA 3HJFA 1MLAA 4UOCA 1Z1ZA 1RB0A 4HTIA 4USUA 2D41A 5A8RB 2M52A 3HSZA 1DJ0A 4LRAA 3GR0A 3BPSP 4Q0BB 3DU5A 4AXJA 4A8KA 3DOLB 4AUKA 2R7VA 2QJ3A 2YWGA 3HVTB 1FJ7A 1NK9A 2VASA 2AF6A 3UNYA 3X1LB 2JC1A 2BVZA 3Q0AA 4UZCA 2OELA 3OHBA 5LM7E 1IM6A 5LSRA 3ZTSA 3J80U 3T5KA 1Q8IA 4EFAC 3HFKA 4A8OA 2AIRB 3T5HA 4Q0BA 1P1LA 5CCLA 2ZH7A 3M30B 2NQPA 3DOLA 1GTEA 1M5OC 5D77A 5AXMA 3HVTA 5IC6B 1P6TA 5JUMA 3CMES 1R6YA 2VPZB 4WTYA 1SQEA 3CCVS 2FHJD 1WACA 2B9XA 3MZIA 3PCOB 4BCAA 1IWAA 3H5XA 4CCHA 2MQPA 3M30A 2WRMA 1RWMB 3PVXA 1WHXA 4TYBA 1YJ7A 4Y3CA 1IBKJ 3FDSA 2XO7A 2V50A 5I3PA 2IM3A 5BYRA 2LXUA 2CQGA 1V5VA 3KLEB 3H8YA 3GV7B 4BC7A 3IBCB 3DGPB 2IRYA 1RUSA 2ALYB 3PYDA 3A1YG 3B82A 1Q16B 3ENQA 1KBRA 1FE0A 2EWHA 1LXJA 3NAIA 3PIOQ 1PYTA 3BBBA 1C1BB 4YEAA 2MQMA 5A2QU 2N4CA 1L3SA 1FWLA 4AFFA 2HNYB 3OLAA 1NK0A 1TL3B 3KLEA 3GCWP 1HQUB 4HHJA 3DGPA 1CSJA 3M8RA 4QYZJ 2O01C 4NLUA 4QR2A 1TUVA 3U1MA 2ZBPA 1FA0A 2C3YA 2KN4A 5JVGQ 2ZBRA 1ZYQA 2J7UA 2HHHJ 1LKZA 1C1BA 1LW2B 1YJ9S 2OEMA 4MIAA 3HVRA 2HNYA 4NLXA 1TL3A 4DL5A 5BR8J 2MKIA 2WVCA 3PW2A 1HQUA 3ZXWA 2WONB 3AFGA 4B3RJ 1KP6A 4PAAA 3M8WA 3IR6B 4DL4A 3TAPA 4B3TF 4AD6A 1LW2A 4OL8A 3KUHA 3EXYA 3LAMA 4RW8B 1E6VB 1N32F 3S01A 3QFHA 3EZOA 3PX6A 5CH7B 7FD1A 1SJQA 3HKZD 3T41A 5KT7A 3DLJA 1U6FA 4QPXA 2GGPB 2WONA 1D0EA 1NZAA 3IGVA 3MUTP 4X65F 2AJQA 2IBKA 3ZZYA 4DF4A 1FD8A 3GV8B 3H20A 2KXHA 5D0RA 2KDOA 4H4OB 1RK8A 4RW8A 4O3QA 1E6VA 4DV6F 2DGQA 1TMJA 2H3EB 4DLEA 1S48A 2UV8A 4MK7A 1YRTA 1CC8A 2UXCJ 5F8LA 1WHWA 2GGPA 4NI2B 2E9RX 2DY9A 3JTPA 3QJJA 2R8GA 1Z2LA 3BO4A 1TL1B 4L75A 4H4OA 1Y9OA 4NLVA 3UN5A 3Q2SC 1WI6A 4LRFA 2AX0A 3AB2B 2AGQA 2ATLA 4N77A 1F9FA 3KNAA 4NI2A 2VPYB 2XZDB 2UXBJ 2Z56B 1TL1A 4JI0F 4A47A 3MEKA 1OY8A 2A1BA 2GNKA 4DWIA 4XIUA 2H4WB 2MEWA 1CLFA 2V8VA 4WKRA 2AU0A 4NE9C 1U2RA 2DHAA 5HVHA 3ZZZA 1XMQF 4P2FA 3NGSA 2IMOA 4LF4F 2CWXA 3LANA 4A4JA 1IVZA 5HI7A 4J9QA 2D3OR 4CLKA 1CEZA 4DZDA 2IVYA 1ZTTA 3CCES 2VC0A 4MYUA 4IH5A 4NZ6A 2XMTA 3DOKB 2OEKA 2XYGB 2HVDA 3SEOA 3I5BA 1T9VA 4B3SJ 3PX4A 3D1QA 3FFIB 4C97A 3LTOA 3NCPA 4OZ5A 1HWLA 2YX4A 2GHPA 3CCMS 1U26A 3DOKA 2LP4A 4DV7J 1JMTA 3MFIA 1NJIT 2XLJA 1PSDA 1R0BG 2KKHA 1X9WA 3FFIA 3K58A 3R27A 2QLWA 3D5MA 2HVHA 1R0CB 1BLUA 1U8SA 2Y0BB 4YR2A 4DI6A 5C2GA 2HIQA 1AUDA 1FKPB 3MEGB 1SH2A 5DM6Q 3OTOF 2KO1A 2XY7A 4YMEA 1PJ6A 1VBKA 2YWKA 4FVMA 4ZVSB 3EGNA 5U47A 4ECUA 1U47A 1VQ5S 3HD2A 1W2IA 4LIWA 4DSKA 2B5JB 1X0PA 3JS9A 1S0MA 2X3GA 1FKPA 2NCKL 1LXNA 3MEGA 1JLCB 2XGQA 5BYQA 3GIRA 1O51A 4CLLA 5J1EB 2CJKA 2FGCA 2HQGA 2V0NA 1B0TA 3WX4A 1QDUB 3CD6S 1F9EB 3C3LA 5KFTA 1LFWA 2JOQA 2B5JA 2F9JA 3C6UB 3CNQP 1NAQA 3RW7A 4IRDA 4LR8A 1JLCA 1UW9A 4F8RA 3NL0A 1U1KA 5J1EA 1WHVA 1NNDA 1PYSB 3AOAA 1ZAXA 4DSLA 1CJVB 4RNOA 2RF2B 2FJVA 3C6UA 3JTOA 1VFJA 4YUDA 4WFAQ 2DBBA 4RJVA 1X9MA 1YSJA 1PYOB 2NUHA 3N0VA 3OLBA 3A3OB 3LQVA 1XNRF 3BH7B 2GJFA 4TU9A 4A8WA 1FWPA 5D4OA 2JX2A 4J5OA 3MR5A 1WSVA 2CJBA 3KK2B 3A8IA 1CJVA 2RF2A 2DHSA 1SI9A 1RHMB 4I1TA 2GHVC 2Y1LB 1A0OB 3VAHA 3GIMA 2AMCB 2ROGA 2XO6A 4C8OA 4YOEA 3GCXP 5E0OA 2GJ2A 2CDRB 2AQ4A 2PIIA 4Z37A 1UA0A 2BV3A 3KK2A 4C8NA 2CJAA 3D66A 2RUGA 5HMZA 3N5BA 4XTTA 5HQMA 3L7PA 3MPYA 1VLYA 2R2RA 2MKCA 2DR5A 1SL1A 4G1IA 1X4GA 3MCSA 5EUHA 1RAGB 4ZPTR 2VFTA 4QIVA 2Y1IA 1GFWB 4QW9A 3AXMA 1TL7B 3ICLA 3KMQA 4S0MA 4WCEQ 3SCKE 1RWNB 2KRRA 2OD4A 2KTQA 2RUSA 2EKNA 2OJ3A 1CJTB 2BOPA 1N48A 4HH1A 4DL6A 4FXWA 1R8PA 3PM9A 2NSCA 2H54B 5K5MA 1RBOB 1J5EJ 1W2BR 4FPIA 2GQ2A 3OFGA 5A8WB 4WXWA 1T3NA 1TL7A 4OZJA 2E7VA 4B02A 3KLHB 3Q8QB 3IN5A 4FNIA 4YN3B 2HRUA 5EWGA 2DGOA 1XEZA 1CJTA 3JQKA 4Q8EA 2PSZA 4P2SA 4PPDA 3TR5A 4LF7J 4GVLA 2IMWP 2OTLS 5A8WA 5DDQC 1EARA 2XI3A 3OTBA 2BKNA 1SKUB 3W8PA 5HJXA 4CYUB 3KLHA 4J91A 3BSCA 4Y2KA 4JI2J 4TU8A 2YKMB 4JI1J 4NZ7A 2A6MA 4PYDA 1F3VA 3BR9A 4OMFG 2BJ9A 1SV5B 1JXVA 5I3QA 5EX3A 4P7VA 2A6OA 3POTB 5GAHI 5FLXU 4HT5A 4WP8A 5LT5A 4DUZF 1NPKA 3AD9C 5DGAA 4O3RA 4CYUA 1PG5B 4ELUA 4IQXA 1Q78A 2YKMA 4KE5A 3W65A 2AX1A 2Z4PA 3GIJA 4C8ZA 1NB2A 1FO1A 1MN9A 2C2DA 2AYBA 5GAEU 1SV5A 5BYSA 1QAIA 3AB4B 2MZ1A 2Y8WA 3DU6A 5RUBA 4O0NA 3POTA 5DQHA 2DXFA 3K5LA 4ZLJA 2A10A 2CPIA 3K57A 2V2KA 2CQBA 5JVHQ 1N56A 3N28A 2YKQA 2YKNB 2HHHF 2J6UA 5E3CA 2P2CB 3W63A 4HEA9 1SVDA 1VQ4S 2CRLA 1FRIA 5BR8F 4I6AA 1S99A 4B3RF 3M8ZA 2PEBA 3HVWA 2QFIA 2YKNA 3VAKA 1YGYA 4OHXA 2GMJA 1UVJA 2QO3A 3TUJC 1RTIB 3CO0P 2Y1RI 2LU1A 3I6PA 4OYMA 1FDNA 4B9SA 1RACB 3V6DB 1S4FA 3ZZ0A 3G9CA 4LF6J 4WJBA 3CUNA 2F8HA 4U6PA 5ETLA 1UWBB 1ZAWA 2ZH1A 1RTIA 4L6V3 4LFAJ 2C28A 3WX8A 3ENWA 2PC6A 4DV1F 1FRMA 3R2DJ 3W1YC 1SIZA 4PUOB 5LL6d 2P6SA 3K8WA 1RAFB 4M5NA 3V6DA 3HM9A 5D4PA 1NK4A 3IMQJ 4DCPB 2ZOGA 2LQ8A 1YBUA 5DS7A 1UVKA 2RQCA 3SV4A 2HBZB 1UWBA 3DLKB 3MGJA 1AZSB 2CQCA 4TQRA 3EGVA 2CA9A 5KFQA 2FHJA 4PUOA 2DGUA 2KJWA 5DZ7A 3DHXA 2DISA 2X7IA 2B0GA 3KJFB 2UXBF 1RT7A 4NMLA 3D6MB 4NLDA 2JL9A 1S1TB 5D15A 3ITHB 3TQEA 2PGCA 3BGUA 1AZSA 3DLKA 2M0GB 1IR2A 3R6GB 4EYHB 2B4VA 2MSTA 1S4EA 1HW9A 1WUUA 4ZMMA 1P27B 5F41A 5H9EJ 2QSWA 3H2VE 3BR8A 3SMZA 3D3BJ 3CJKB 3CVKA 4GMKA 2QN6B 4K5SA 1S1TA 3ITHA 5KFPA 2CPHA 3GJRB 3RU0A 4RBVA 3TZWA 4ED1A 3KXDA 5E3QA 4NCAA 2VPWB 2EBGA 5K8NA 1LWFB 1B99A 4O3SA 2UZAA 3H59A 4OYBA 5ETMA 3SBMA 3CJKA 3HFZB 2HWHA 4U7UK 2BUNA 4DL3A 1D8ZA 3GIIA 3VALA 2KB2A 3BPDA 1PJ7A 3K8VA 3MCNA 3MR6A 3UN3A 4WZQA 4OYIA 2BW2A 2W7AA 3KHHA 4R25A 4JYAJ 1LWFA 4EUVA 2ZZMA 3DRRB 3GYGA 5CAAA 4DQSA 2E44A 2MKJA 2DHHA 1Q5VA 3RRGA 1RTJB 2VG6B 1YG0A 1JJHA 3P45B 4DV7F 2HQFA 2HZVA 1BMQB 2YTCA 3IR7B 2ZH8A 2XWXA 1JJCB 2ZH2A 1V5IB 5JMNA 1IWGA 1RHRB 3GJTB 4CLSA 3VGVA 3DRRA 4NL5A 4MKAA 4JI3J 4IOBA 3G2XA 4J9UE 3HSDA 2HVIA 1RTJA 2VG6A 5D0GA 3IRWP 2LEPA 1UTAA 2ZJPQ 3DXBA 3B4MA 2J0WA 1RWVB 1RAAB 2VZ9A 1U1OA 2GIQA 1Q1KA 3EUNA 4CM2A 4OI1A 4Y0FA 1LK5A 4KFBB 4PWDB 4OYWA 4O3OA 4WXOA 4QZVB 4WFYA 1WOPA 4CNYA 2VPXB 1A7GE 3O2IA 4DPOA 4ZITA 2WVFA 5KFHA 2HHXA 3RBEA 1PGZA 5KT5A 3MAHA 5MLCV 4A8YA 2ZUGA 4KFBA 4PWDA 4ZP9A 1T9WA 5IFMA 4KO0B 3UWTA 4OI6A 4RLEA 2B4PA 1WJ9A 2AJ0A 3FSYA 2PDAA 2ZD1B 1HNWF 3TUZC 3T6BA 1FESA 1Q7LB 5KFGA 1BC6A 1J5OB 4NLPA 4UF4A 1NM2A 2M3DA 4KO0A 2EK6A 2DNGA 4CTAB 2HS4A 1HWUA 2DGSA 4E98A 3A8EA 3L4BC 2DRBA 2ZH3A 3HHDA 4Z2XA 5IT9Y 2ZD1A 3HJVA 3R8YA 5AE2A 3BS9A 4RWWA 4A8QA 1KHVA 1BE4A 4YHHJ 1J5OA 4OZNA 2MJUA 2BEFA 2Z2ZA 3OTCA 3W61A 4KGXB 1PBUA 4CTAA 1VIOA 4UTGA 4MAKA 5IZHA 2RB7A 1R89A 5ETQA 3V6KA 2ZM6J 1XTZA 2EG2A 3L9ZA 3MR7A 2HG4A 5BJRA 1LV5A 2XYPB 2ZBQA 2CNKB 4R0EA 2KL8A 3HHLC 4F2SA 3MAAB 1R8CA 1MN7A 3QT5A 2R7RA 1X31C 3OBIA 2R2SA 4KH1B 5IS2A 3F73A 1Q53A 2BDPA 4OIXA 3O8WA 2JSXA 2YH0A 3FBEA 2AKWB 2EK1A 2XEXA 5IXUA 1UPMB 3MAAA 5ETOA 4U7CA 1RU2A 3VTIA 2RDJA 2DY1A 1NBEB 2AYEA 3D67A 4C8MA 2XTJP 1ZM4A 2ASJA 1FFWB 4V19J 8ATCB 2CG4A 2DXDA 3MURP 3KOAA 4GKJJ 3JTNA 4ZN1A 2NXUA 3DFEA 2DXEA 2NXNA 4OI4A 1J5EF 3PZPA 1SH3A 2VG5B 3RJMB 3GFYA 4DR5J 1X4HA 1YJNS 1G6BA 2D7SA 3DRXA 4NA1A 3KYLA 2J8SA 4JBCA 2V5HG 3C8YA 2V6AA 1VQYA 1V3RA 3JAMY 4DL2A 1ZPVA 4EO6A 4X84A 2DHGA 2R8KA 3S6EA 2VG5A 4PKDB 4TKTA 5KG1A 2H4YB 3J80Y 2IJRA 2RT3A 4USKA 2FVSA 4JI2F 4QIGA 2WVDA 2XI2A 1OSCA 5EX0A 3MPVA 4X66J 2DNKA 1UW4A 2C2MB 2OGUA 3IBWA 5F0UA 1TKDA 2DCLA 3D9BA 3W5XA 4X4TA 4OI0A 5I42B 4HHHA 3TAQA 3HLUA 4WU3A 2GIRA 2BM0A 3IC1A 3QFWA 2HHVA 4U95A 2W4DA 4ZS6A 4C48A 1UCNA 4DR1J 4X4QA 3U7JA 3LF0A 5KG6A 2OEJA 2CFXA 2ZHBA 3CCSS 2DITA 2HPUA 1H2TZ 2WBRA 5KFXA 5I42A 4NYOA 3DLLQ 2I0XA 4CWBA 4RO0A 1OWXA 3IBFB 4KHRA 4YB5A 2XM3A 3W66A 4N8NA 5LSLA 3FMBA 2XB2D 3KG4A 4TY8B 1ROFA 3EM1A 3PO5A 4ZKAA 1FRLA 1AB8A 2MQNA 4X4OA 3Q8UA 2MHNA 2E5LJ 2X1BA 3B78A 3QSYB 1YRUA 4IRCA 4NLWA 2RRNA 2CQHA 4M5MA 2BJ3A 4KPYA 3M8YA 3MMAB 4ERDA 1RTZA 5E2QA 2GIFA 3H4DA 2YWWA 5F8JA 1TK0A 2J6TA 1FKAF 1U24A 4IOAQ 3EYZA 5EWFA 4QYZK 2W2PP 2E7XA 4TY8A 1D1UA 1RCOB 3A4TA 2Z2LA 5CD4H 1EZZB 4K59A 3NP5A 4NRUA 1S76D 1F6TA 3MF5A 2G0JA 1JKHB 3MHYA 3MMAA 2UU9J 1TP7A 2PA3A 2RQKA 2GHWA 2R8IA 1RU1A 3AAWB 1VRUB 4UY8T 2W9CB 2XLIA 5KT6A 1KEKA 2BJDA 3Q24A 2EW9A 1HHQA 2IA6A 5SZTA 2I9SA 2OD6A 1VK8A 2Z8QA 5A76A 3J81Y 1FXRA 1IKYB 1C1CB 1H74A 4F04B 4F0KA 1JKHA 3G87A 4H4KA 3L3CA 2DGXA 1HWJA 1VRUA 4DG1B 2DD8S 2W9CA 4LFAF 1TL4A 2E5GA 2WCXA 2E66A 2I1RA 2BJ7A 1TMMA 3SCIE 4U8VA 1YHQS 1J2VA 2LFVA 4K4UA 5KG0A 1IKYA 1C1CA 3AODA 1RTHB 1UEKA 3OL8A 1OJ4A 4DG1A 2RS2A 4A8XA 4FXVA 4ANEA 3KJQB 2LA6A 1RYRA 1RAHB 5CHCB 4ECWA 2CNLB 4K50A 4FYVB 5KG2A 1U1MA 3M9OB 3F56A 3JQJA 1RTHA 2CQDA 2LYVA 3PEHA 4O4GB 2BW7A 1Y3KA 3J81j 1D3WA 1AW0A 2VF3A 4KPCA 3GPAA 2ZITA 1LEOA 2G9OA 3IRXB 1VQ9S 5DLGA 3MFHA 4ECXA 4MKYA 5E5NA 4M94A 2EC2A 3LPYA 3T9NA 3ZO7A 3NEKA 2FVQA 1NHUA 2HGLA 2L3MA 3P5TL 4O4GA 1R27B 1H73A 5HSPA 1WF2A 5CXTA 3IRXA 1NK7A 1ZH5A 4NXNJ 4Q45A 3ET6B 2WVBA 2HKEA 4WP3A 3H90A 1Y5IB 1PIEA 1RLCL 5HLFB 4E0DA 2OMLA 2DYAA 2BOAA 2VU5A 3JSYA 3BGLA 4JUZA 1L3TA 1YTYA 2FPHX 4OFZA 2EFGA 2NXJA 2DNZA 4ED4A 3ET6A 3CJ8A 1GT8A 3RTVA 3R2CJ 1VIXA 3W64A 2XNQA 5KFKA 5HLFA 2CIMA 4J9NA 3OJSA 3C66A 4F36A 3DRYA 4B17A 2KH9A 4UUXA 1UZDA 3W5ZA 5D4NA 3QT6A 2EFVA 2FQQB 2IM1A 2C2KB 3L09A 3TA2A 3UQSA 3GYXB 3BO2A 5IT0A 2W7OA 2FB0A 3GE9A 5E3AA 3EICA 3LPEA 4M5LA 2HVEA 1H6KX 3EDRB 3CCLS 1KVJA 2YWFA 1N5QA 4DPUA 1MMLA 2AW0A 3KHLA 5I3UB 3HHLD 2QL7B 1TR0A 2YKAA 1TAUA 1PO6A 4OZ0A 4X2BA 1DHMA 1G3OA 4PG6A 2RD5C 4ZVQB 4FVCA 1S0VA 2M4MA 4K7QA 1RP5A 2DGWA 3EPIA 2ADBA 1NK6A 3MXHP 1YI2S 3IWNC 2DNPA 3NNCA 3CSKA 5I3UA 1FX4A 3BYPA 2HURA 5CCMA 4PEOA 2KG1A 4DQQA 3BSNA 1QY7A 4DR2J 2DH7A 3TUPA 1D9FA 1VC5A 1UWAA 3RR8A 3DDKA 4OX8A 3V5RA 4C0BA 3IO1A 5AT1B 1HPZB 4FS2A 4P73A 3CJ3A 1M5KC 4C98A 2XS5A 3I87A 5T41A 4DFJA 2HQ3A 1RI7A 4EGLA 4QU7A 4CM0A 2WB4A 1SXLA 3KJNB 3QRPA 2GVDB 4DBQA 4C3MA 1UZHA 1DARA 2HQDA 1AA1B 3R5AA 1F1BB 2FC9A 4WPAA 3T6JA 2DGVA 3KJVB 4QU6A 1IJFB 1HR0J 1HPZA 3RBZA 2FLNA 1IBMJ 1X60A 4J9VA 3P6YC 4YHHF 4KQZA 1FK9B 3B4DA 1VQOS 3TVKA 2DR6A 2GVDA 2APOA 3TEHB 4QIEA 4DPWA 3I56S 3VGTA 2YNIB 3OFEA 1KSPA 5LMNJ 3KJVA 2SXLA 2QE5A 1YITS 3PV8A 1AXQA 2ZM6F 1KDNA 2A3JA 1RT4B 4ZA1A 1SIWB 4DLGA 3CW2C 1QAJA 1FK9A 3GB0A 4DOZA 1WC1A 2DK2A 2X51A 2QGFB 1WG4A 2VL1A 3G8TA 3KLGB 3ZTPA 3ELHA 2LEBA 3WDOA 2RDDA 2K8GA 3VGUA 2YNIA 1F5AA 5L46A 4X64F 2MPUA 3WZ0A 2WB1D 2VKRA 1RT4A 2F8MA 4M5HA 2YQ0A 4ED5A 4P52A 3KLGA 2OKQA 3FVYA 4KGZB 4B9TA 2G2ZA 3BB5A 1H0HB 3KLFB 1EKSA 3VQTA 1T9UA 4JI5J 4GKJF 1IQTA 1VBZA 2PA8D 2R2TA 4DV5F 4XK8C 2W7PA 2YNFB 2V9WA 2FZGB 4ZPDA 5DJBA 4ZVPB 2B7BB 4RX6A 4QWDA 1KNZA 4WP9A 3CDEA 2BQRA 1S1XB 3KLVA 3KLFA 3I4HX 2R8HA 4KBIA 1Q5YA 4C8LA 3GV5B 3M9NB 4GKKF 2YNFA 3TQ1A 4LIRA 2R7TA 1NMEB 1XERA 2HFUA 4X66F 4X4UA 5G4DA 1YLXA 1S1XA 3WQPA 3QAEA 4QIWD 5A8KB 1HI8A 5DRKA 3UCUP 5KFCA 3WIVA 2FD2A 4HL9A 2XS7A 2Q66A 3PG9A 3GMGA 1LOUA 4IUFA 5DZ6A 5AXLA 4DX6A 4M5KA 3TW0A 5KFSA 2AJ1A 2P9GA 1UFLA 1BUXA 4DFMA 3BGRB 5A8KA 1GX6A 2IM0A 1BWEA 5J2QB 3KHRA 4Y28C 3N6MA 1CVJA 5SUHA 1BQXA 5AXKA 5JXSA 3JXOA 4M5IA 4MK9A 4DFKA 1R0AB 2WW4A 5IQQA 3R7SB 3RG6A 4WFBQ 2JEGA 2E5LF 3DKDA 2VFSA 3PKMA 3BGRA 2RHQB 1APSA 5J2QA 2BRKA 3E8OA 3ILLA 2DNYA 2VFUA 2IJFA 1U4BA 4KGKA 2E5HA 2G2OA 2IJNA 5HMYA 1R0AA 2E29A 3BN4A 4R0JA 3P3DA 1R8HA 2M88A 2VQEJ 4B3MJ 4PABA 3PW5A 4JI4F 2BJEA 1CJUB 4QWAA 4R8UB 4HHUA 4DPXA 1K73T 5HROB 1T02A 1FHTA 1TZ0A 2EFPA 3QT8A 4UOFA 1V3ZA 4ZJQA 1NKCA 3D1OA 1S1WB 1T9TA 4CH1A 1VQPS 2CZ9A 2A18A 2HHPA 4LREA 3TEGA 1CJUA 3S7RA 4R8UA 2E9ZA 3PACA 5HROA 4KSEB 3AY0A 3H40A 2BE2B 4NOHA 1VQ6S 2L41A 2HHQA 2LDYA 3TUIC 1OY6A 2VQFJ 2ZJRQ 2UV8G 1RABB 2JRSA 4A8FA 1HNVB 3ZC4A 3VWSA 4K0KJ 3IP0A 2GJIA 1NJXA 3Q22A 1S1WA 1X4AA 5GAHU 2WTFA 1NJZA 1VQKS 3QNWB 2Q6CA 4OX7A 3CJTA 1K0TA 5AJ3J 2RU9A 3M7VA 5KFWA 2BE2A 2L08A 3AA9A 4ZP7A 1NDLA 3OHAA 2M70A 2WVEA 5CQGA 2BJ1A 1HNVA 5KFOA 2HS0A 3QGIA 5KG4A 1Y00A 4JI7J 2FTRA 3PYEA 3H25A 3FGVA 2HK3A 2LQ9A 3CTRA 4DSIA 1N36J 1TV6B 2GO9A 4ZJLA 3OSPA 1U0SA 1LW0B 2D3O1 1TK8A 4WZMA 2LQBA 3G82B 1UJ4A 5B0EA 3RAQA 4FF4A 3I0SB 4IQMA 4LBPA 2I38A 3A13A 1SJFA 4OZ1A 4QIFA 1WEYA 5KFFA 4L3KA 1TV6A 4GC7A 1M5HA 3CCTA 4MFBB 5H9EK 1LW0A 4J9LA 1NB7A 2J5AA 1RDRA 3G82A 1VK3A 2RNEA 1IKWB 2G1HA 3I4PA 1KFDA 4WKYA 1DBDA 3KDOA 1DTTB 3I0SA 2RHSB 1SBRA 4OZ2A 4ZVFA 4J90A 2QIFA 2VOOA 3ZTOA 3Q83A 4FS1A 2ZNZA 1JJ2R 4JV0A 1QAXA 2MYFA 3FEZA 3VAMA 4MFBA 2D74B 4J9SA 3OXFA 1K44A 2C3MA 3M2VB 2CNOB 1IKWA 3W9HA 1FERA 1S5ZA 1NSAA 1DTTA 4RW6B 2ZDOA 3VR1A 3TNVA 2HIYA 2WOMB 3R7BB 3N4WA 3IAS9 4OYOA 4CO4A 3CMQA 4MMOA 1RKJA 3UDEA 3RBDA 4OYXA 1CJKB 3M2VA 3UVJB 3TP2A 3IAM9 3RUBL 5FDLB 5CA5A 1YJVA 2Q43A 1FVSA 1Y0HA 3NY0A 3NMAA 3TOQA 2ZEJA 1VRTB 4RW6A 5T14A 4YDDB 3PFOA 2WOMA 1PC5A 2MKHA 5B0CA 4EWTA 5HO4A 2XWYA 3R1HA 1KC8T 3TVYA 3EVMA 3QGGA 1S59A 2HVZA 2QG9B 1CJKA 1QVFR 4JI8J 3BREA 2YX7A 1F2HA 5FDLA 1GTHA 4DR6J 1VRTA 1RT1B 4M5JA 4LSLB 3TANA 3GFZA 2E1AA 4JOUA 2DH8A 1OS5A 4DMZA 3FC9A 2VFRA 4F26A 1QAYA 4DEZA 4XPCA 2HHSA 4Y2AA 3K5PA 5IT9U 2EFQA 1C4CA 4F50A 2X1GA 1RT1A 3MR2A 4LSLA 4ZCKA 1TU0B 3GZ7A 2O3DA 2VOPA 3BH6B 1YRXA 2Y1JA 2WK4A 3SSRA 3G71S 4DPTA 4DR2F 1M5SA 3VZIA 2MQOA 3MPUB 4OHZA 1WI8A 3R5CA 2E1RA 1NHKL 1JX4A 4Q8FA 1L3KA 1Y11A 2DNMA 4PXBA 4DV0J 4DCJB 3CDBA 2ZNYA 2LDIA 1U7LA 2GA7A 2LKZA 1C0UB 5ETSA 1KTQA 4PG4A 4RNHA 3CGIA 3UD4P 2ROPA 3EVOA 3QLHB 4EBDA 5THWA 3RRHA 3NGTA 3CXCR 2CPEA 2NREA 2F4VF 4QCLA 5J1NA 1KKHA 2B3TB 1IBMF 1N6QB 4ZVEA 2DNOA 1C0UA 2V68A 5KFYA 3H5SA 4X62J 2J9DE 3QLHA 1S6UA 1QUPA 3BZQA 5L38A 3BF4A 1U45A 1ZAVA 5LMNF 2HBYB 3CC4S 3O3LA 2CNNB 4A46A 3TO8A 4OHWA 3NNAA 1AFJA 2AGPA 3N6NA 1N6QA 1QTMA 5F8MA 4IG3B 3HCXA 5E7OB 3SZ2A 4RW4B 2VBWA 4H4MB 2ZC4A 3JAMU 1FRHA 2K3IA 3HHLB 1I5OB 1PAUB 2DO4A 1FFSB 2KZMA 3CO9A 4A8SA 2O66A 1MROB 1LNQA 4IG3A 1QTNB 4AL6A 3OJUA 1VYAA 1U6ZA 4P10A 1B7FA 3FBBA 4RW4A 1UVIA 4H4MA 4PXDA 3D0IE 3PFEA 3QT7A 1K1QA 3HHLA 3TZYA 2HK2A 4P74A 1TTHB 2GZOA 2FC8A 3T9ZA 2CQPA 3FBFA 4ZPWR 1MROA 1YDLA 1X4EA 2L9WA 4C8YA 3H4BA 1URNA 1R8BA 3PR5B 1U49A 5ETPA 1MWQA 1K0VA 4Y6IA 1NDPA 1NH8A 4G3IA 2B9EA 1X5PA 1RWOB 5H1SV 4MIBA 1ACMB 1RGVA 2GVZB 3I55S 4FNHA 2ZHAA 3Q23A 5ETRA 2DHXA 4NLSA 4F4AA 3RAXA 2M7SA 3V81B 4DSEA 4A8MP 1FNMA 4P72A 2M9KA 2LXIA 2O1PA 5A6PA 3GJQB 2C2RA 2QC3A 1RTDB 1HWIA 4NEYA 2G13A 3I9V9 1JLBB 2UUAJ 1IKVB 2GVZA 4DS5A 4ZVRB 1GXLA 2JFDA 3IXQA 4KHPJ 2CQ2A 5HVGA 3V81A 4WFNQ 4YFUA 2IFXA 1KVKA 4WBFA 5DQGA 2AEMA 1RWPB 1S6OA 2R2UA 4DV4J 1RTDA 4ILLA 3BM7A 3GP9A 1MMNA 1JLBA 1IKVA 3I5AA 4H4KC 4URSA 3D6TB 4JV2A 2R8JA 4WYWA 5HL7Q 4F4WA 5J1PA 4DQIA 1RSCA 1WOOA 2V8HA 3MOZA 2WSCC 7AT1B 3J81U 5HN0A 1O0PA 2F63A 4NXMJ 1DQAA 2YQ1A 3DI6B 4M8LA 4NLQA 1FI4A 3TARA 2QYGA 1Y5NB 4CDIA 1VLOA 4RU2A 1FCAA 9ATCB 4FYDA 3C2PA 4ZHRB 2CQIA 1IQZA 1ZZFA 4DUTA 3N5FA 1WDDA 1IBCB 2RRAA 2VQEF 4F67A 4B3MF 3A3NB 3DI6A 4JV5J 2FVPA 1U02A 5L1IA 3ZNUA 2LQ5A 2AP6A 3FCHA 3W3SA 2F65A 1P9QC 2Z30B 2XMWA 2HRTA 5DG7A 4ZHRA 1N4LA 2PMWA 3DYAB 3S8SA 4NASA 1WEXA 2FJEB 1KVIA 4WWSA 3J7YU 3OFHA 4KY3A 4RBUA 2CPDA 2XLKA 2VQFF 3FNNA 3JQMA 4ZPVR 4JI6J 4PXCA 2QA4S 3US5A 2OSQA 3I96A 3DYAA 1I94J 2MKYA 2I5JB 1HHSA 3CD7A 4ELVA 2ACMA 3TZXA 4NLRA 5AJ3F 2VBXA 1F5CA 3D6FB 3MMJA 3O1LA 3VZHA 4HYKA 4CH7A 1WHYA 4FBUA 1WC3A 2FHMA 4AXIA 2R9LA 2UUCJ 2JDJA 2I5JA 1VCTA 1E6YB 3MWBA 4OI3A 1IN0A 4QWBA 3OFFA 1N36F 1ZTWA 4CRJA 2CJXB 2XZTB 2UUTA 4ZK7M 3E01B 2V8GA 4FF3A 3M6XA 1GAOA 1NKBA 2K1RB 3T1AA 2FJAB 2XY5A 4P75A 2HEKA 3HULA 4DR4F 1YZ7A 2GMHA 1E6YA 2IIHA 1ZM3A 2RVJA 3GG1A 1WELA 2LVWA 4B3OB 1YZ6A 2MQQA 2YNGB 3E01A 4WE1B 5DDPC 2KHCA 1VQNS 5IC4B 2EVZA 2K1RA 4L76A 1Q86T 5K9FA 1MW7A 1EQMA 3CT9A 2E1MC 2V4RA 4CO3A 4PG5A 3HZEA 2EFNA 3M8PB 1I1GA 4DDFA 3BV8A 2AYGA 1OQ3A 4B3OA 4GO7X 3LP0B 2PN6A 4I67A 2YNGA 4FYYB 4WE1A 2HNZB 2NZCA 2RIJA 2OUGA 3T19A 2RMLA 5L1KA 3MMCB 1H7WA 3DM2B 1GMUA 2OO4A 4OJ1A 4D3GA 1QD1A 3C14B 2DR7A 1HBOB 3FK4A 1XNQF 3M8PA 4RNFA 2DNRA 2K7JA 3CD0A 1CC7A 3JSRA 4UQTA 2DKOB 3LP0A 4LF9J 2HNZA 3D28A 3RRKA 1OYDA 1GNKA 3SXLA 4IG0B 1VJQA 4WU2A 5FJ4A 3MMCA 3FKBA 3FEXB 1UVLA 3RYLA 1JXLA 3DM2A 2KT5A 1FNOA 4XO0A 3C14A 1CULB 4HH0A 1HBOA 2RKIB 3UD3P 2PFDA 4ZDNA 4E2FB 3NGRA 2OSRA 3HF5A 5IWAF 3CCUS 1ZM2A 2JWNA 5LMUJ 5EN1A 4IG0A 4JI8F 3NLCA 3TRGA 4DR6F 4G1QB 1CULA 1K1SA 2JEIA 2RKIA 4P71A 3X3UA 2PT0A 1NLKL 1GEHA 2V4JB 1NEEA 2CJQA 5LXRA 2HSEB 1Q79A 4OZLA 3TA0A 2LA4A 1WNEA 1GH8A 2PI5A 2XGPA 1JK9B 4G1QA 4F3QA
chains in the Genus database with same CATH topology
1P6TA 5JUMA 4Y2IA 4I6YA 5KG2A 2PEHA 3CD5A 3F44A 1U1MA 3CMES 1R6YA 4USJC 3OVBA 2VPZB 4WTYA 1SQEA 3M9OB 3F56A 3CCVS 2FHJD 1WACA 1V6HA 4NA3A 3M6UA 2V4JA 1FXDA 4LJMA 2B9XA 1B0PA 3MZIA 4NLTA 1RTHA 2HYIB 4BCAA 5B0DA 1ZZNA 4F4KA 4IOCQ 2B43A 2CQDA 2LYVA 4IH6A 2DRAA 1UAWA 3PEHA 3H5XA 1S6PB 4O4GB 2MQPA 4CCHA 1Y3KA 1HBUA 1D3WA 4RW9A 1AW0A 3M30A 1HBNA 2WRMA 3NG8A 3PVXA 3M2UB 3M6VA 1WHXA 2ZITA 2G9OA 4TYBA 3IRXB 2W4PA 4DV0F 1VQ9S 3NMRA 4Y3CA 5DLGA 3FDSA 4CI0B 2XO7A 3MFHA 4ECXA 5I3PA 2IM3A 4MKYA 1X4CA 4WIIA 1T03B 5BYRA 2LXUA 3KNGA 2E5IA 2CQGA 5E5NA 1N88A 2DT9A 4M94A 2HQIA 2VODA 4YB6A 4DX8H 3KLEB 4HDHA 4HI2A 3OR1B 3H8YA 5K8OA 1HHTP 3LPYA 3GV7B 4BC7A 2C22A 3T9NA 1U09A 1M0SA 2IRYA 2FVQA 1NHUA 1VQ8S 2YY3A 3HK2A 2DJWA 3A1YG 4ETXA 2HGLA 3B82A 1Q16B 3ENQA 5B0FA 2L3MA 3P5TL 1XK8A 1S6PA 4O4GA 4QPTA 1R27B 2CQ4A 2YKPA 3I0RB 4O3NA 1FE0A 4CO5A 2CZ4A 2EWHA 4DR7F 2UU9F 1LXJA 3NAIA 3PIOQ 1VC6A 1WF2A 5CXTA 3HVAA 3M2UA 3CJ0A 1PC4A 1GQEA 3IRXA 3LGNA 1NK7A 1C1BB 1ZH5A 4ES2A 4YEAA 2MQMA 4OLOA 2MZSA 4Q45A 2N4CA 2W9BB 1T03A 3FZ2A 1L3SA 2DB1A 1ULRA 4AFFA 2HNYB 3C6TB 3OLAA 4X62F 1SJ4P 3M6WA 1TL3B 5ITHA 1NK0A 3KLEA 4B9VA 3OR1A 3MECB 1Y5IB 2UVVA 4K4YA 5HLFB 1HQUB 2HLUA 4HHJA 5KFDA 3DGPA 4BC9A 2N4DA 1QJHA 2OMLA 1CSJA 5D78A 4E0DA 1N5VA 2FIUA 3M8RA 2BR0A 4URQU 3G6XA 4QYZJ 4RUCA 2FJXA 4P7TA 5DO2A 1YJRA 2ZBCA 1C0TB 2C42A 1Q8LA 2O01C 4TXSA 3JSYA 4NLUA 3I0RA 4QR2A 2J9CA 4D3HA 1TUVA 3BGLA 4XDDA 3AA8A 4JUZA 3U1MA 1L3TA 1FA0A 1QM9A 2C3YA 3OXGA 4CNZA 3QIDA 3R5BA 3OL6A 2FPHX 1YTYA 4OFZA 2KN4A 3K59A 5JVGQ 3V2UC 1XC9A 2J7UA 4ECRA 1ZYQA 1LKZA 1C1BA 1LW2B 4KHMA 2EFGA 3SFGA 5B7WA 5GADU 2DNZA 2RRBA 1KRPA 1GT8A 3G8SA 3FSIA 2N3LA 2W9BA 1YJ9S 2OAUA 3GIKA 1NHVA 3RTVA 4MIAA 3HVRA 5L39A 2HNYA 3C6TA 4NLXA 4ES1A 3CCWA 1TL3A 4KB7A 4DL5A 1VIXA 2XNQA 2MKIA 4N41A 3MECA 5KFKA 5HLFA 2CIMA 1HQUA 3PW2A 4J9NA 2RDIA 3OJSA 3CC7S 1MNEA 2WONB 2L48A 3C66A 3MEEB 1IJEB 1C0TA 3DRYA 3I9ZA 1R8AA 1TKZB 4IR9A 3IR6B 1YJTA 4DL4A 3TAPA 4B17A 4MYTA 5J2MB 2KH9A 4UUXA 3K5OA 4B3TF 2PMHA 5HBMB 5KG7A 1JIHA 5D4NA 2XS2A 2WAQD 2EFVA 3UDLA 2I2YA 1LW2A 4OL8A 4DSFA 1WF0A 3EXYA 2IM1A 3LAMA 2RILA 4RW8B 1E6VB 1G1XA 4PG8A 3GSDA 2CPFA 5KFMA 1N32F 1ZBTA 3S01A 3PX6A 3L09A 2MY7A 3VAGA 2DNLA 3TA2A 5CH7B 3UQSA 7FD1A 1SJQA 3HKZD 2N7YA 5KT7A 1KD1T 1QSYA 4DN9A 3GYXB 3BO2A 1N0UA 3DLJA 5IT0A 2W7OA 3J7A1 2FB0A 3GE9A 1U6FA 1RQ0A 5E3AA 4QPXA 3UNGC 2GGPB 2WONA 3L95X 4UW2A 1RT3B 1D0EA 3G6ES 3T1YF 1NZAA 3MEEA 3IGVA 3MUTP 4X65F 2M5YA 2AJQA 2IBKA 5DDRC 1H6KX 1TKZA 1FDAA 3CCLS 2MHEA 3ZZYA 4DF4A 1KVJA 5CYMB 2YWFA 5J2MA 1FD8A 1S79A 3GV8B 3H20A 1N5QA 2KXHA 5HBMA 3UR0A 1L5UA 2KDOA 4H4OB 3ISND 1RK8A 5F3ZA 4X4PA 1MMLA 2AW0A 4RW8A 4O3QA 2XCAA 1E6VA 3KHLA 2HHUA 2O5DA 4I64A 4DV6F 3LO3A 5I3UB 4OX6A 3HHLD 2YKAA 1TR0A 4AQYF 3THTA 1R7IA 2DGQA 1TAUA 2C3UA 5B0BA 1PO6A 4OZ0A 4MTPA 4DLEA 4X2BA 1DHMA 1G3OA 1S48A 2ZBIA 4PG6A 1NK8A 1IBKF 1BY9A 2UV8A 4MK7A 1YRTA 2RD5C 1CC8A 3AQOA 5F8LA 1WHWA 4FPRA 3KK1B 4CH0S 2GGPA 2K2PA 1RT3A 2RH3A 4FVCA 2M4MA 1S0VA 2E9RX 3JTPA 3QJJA 1RP5A 4MIWA 2R8GA 2C2EA 2DGWA 3GQCA 3EPIA 2ADBA 2B51A 3Q8RB 1Z2LA 4UQGA 1NK6A 5CYMA 1LWEB 5H9FJ 3BO4A 2HWTA 4L3NA 3MXHP 1YI2S 3ENVA 4KR0B 3IWNC 1TL1B 2DNPA 3UW1A 4H4OA 3NNCA 1Y9OA 4NLVA 3CSKA 2B4OA 3RZAA 3MDFA 3Q2SC 1WI6A 5I3UA 2JH3A 2VV5A 1FJEB 4CT8A 4Q2MA 2R7UA 3PW4A 3BJYA 1JNZB 4UUWA 2AX0A 3AB2B 2AGQA 1HYSB 5CCMA 2ATLA 4NXNF 4N77A 2EBEA 1F9FA 1FD2A 2KG1A 3KNAA 3R5DA 4DQQA 1WG5A 3BSNA 5KFEA 3KK1A 1QY7A 4KT0C 3DRSB 4ILMA 2VPYB 2BA9A 2UUAF 4ECQA 1S9FA 2DH7A 1D9FA 3VCDA 3NWGA 1VC5A 4KHPF 1LWEA 2WSFC 3PEJA 2UVWA 1TFWA 2MKSA 3K5NA 1TL1A 4JI0F 2WW8A 4K4VA 3RR8A 1MWZA 4Y00A 4A47A 3MEKA 3MPWA 2XMUA 3DDKA 4YR3A 3MEDB 4OX8A 2J7KA 2A1BA 3RB0A 4K4SA 3V5RA 4X4NA 2GNKA 4DWIA 3UFCX 4C0BA 4F02A 4DSJA 3IO1A 3S1TA 3MTKA 1HPZB 4XIUA 2QA2A 5C24B 4FS2A 2V8VA 1CLFA 3CJ3A 4WKRA 1M5KC 4C98A 2XS5A 1HYSA 4OI2A 2AU0A 4IRKA 1U2RA 3HHKA 4DV4F 3I87A 5CZVA 5T41A 2DHAA 4DFJA 3ZZRA 3ZZZA 3DRSA 4I2QB 2HQ3A 2RSQA 3NRBA 1RI7A 1XMQF 4EGLA 1LWCB 4QU7A 2OPSB 4XPEA 2WB4A 1SXLA 2VG7B 2E9TA 2CQ1A 3BQ1A 2IMOA 1FE4A 4LF4F 4RUAA 3LANA 4DBQA 4C3MA 3GG0A 2B9WA 1G2EA 4A4JA 3BSOA 1DARA 4N76A 2ADCA 5HI7A 3MEDA 3H98A 3R5AA 2FC9A 2V9KA 3T6JA 2DGVA 2ZC3A 3EZUA 3M8QB 3KJVB 4F4YA 4QU6A 1IJFB 4J9QA 1HPZA 2ZDPA 2D3OR 5C24A 1DLOB 4RWXA 2FLNA 2P6TA 4IDKB 4DR3F 1CEZA 1AROP 2EFOA 3D2WA 2IVYA 2JEJA 3P6YC 4YHHF 4KQZA 1FK9B 1RAJA 3B4DA 4ZVGA 1DAXA 3LW5C 1VQOS 4I2QA 2MDAA 4NXMF 3R1LA 1ZTTA 1LWCA 1MU2B 3TVKA 4BS2A 2OPSA 3CCES 2VC0A 2VG7A 2FHKA 4MYUA 2RE1A 3O6QA 2QMWA 4PG7A 4ZLPA 1HI0P 2APOA 5DG8A 1M5VC 4IH5A 4QIEA 1F0XA 3MOJB 4NZ6A 2HNDB 2XMTA 3DOKB 4C0HA 3I56S 1S9EB 1S6QB 2GQQA 1SUQB 4YQWA 3JB9k 1X0FA 2JJ4D 2YNIB 2PI4A 2IVFB 4TLRA 3OFEA 3CE8A 4NYZA 1KSPA 3M8QA 3KJVA 2SXLA 2QE5A 2AJ4A 1YITS 3PV8A 1AXQA 2ZM6F 3SEOA 1DLOA 3I5BA 2GC8A 5AE1A 2A3JA 1RT4B 4IDKA 4ZA1A 4IO9Q 2R7QA 3QMQA 2E7WA 1SIWB 4NPOA 3CPWR 4G1PA 1OPZA 4DLGA 1HD0A 3EPGA 3PX4A 1FK9A 3GB0A 4DOZA 1QAJA 3D1QA 3FFIB 2ZKTA 4C97A 1MU2A 2DK2A 4FN5A 5E41A 1KHWA 2X51A 3CDUA 3KLIB 3NCPA 2HGNA 4J37A 2ZZNA 3HHNB 4OZ5A 5L8RC 1CQNA 1HWLA 1WG4A 2VL1A 2UXCF 2YX4A 4FF2A 4JV5F 3G8TA 2J76E 3KLGB 1HA1A 2GHPA 2ASLA 3CCMS 3PXGa 3PJXA 1X5SA 4USHA 1UETA 2LEBA 1U26A 2HNDA 3DOKA 3WDOA 1S9EA 1S6QA 1SUQA 2JHEA 2K8GA 2FDNA 1JMTA 2V4QA 2YNHB 2YNIA 1F5AA 3MFIA 1NJIT 1RT7B 3T3FA 2QT7A 3OVAA 4X64F 3DDNA 2G4BA 4NLOA 2MPUA 3E3XA 3WZ0A 1PSDA 2JLEA 1IXKA 2XLJA 2WB1D 2XMJA 2MGZB 1KQKA 2KKHA 2VKRA 1RT4A 4NLGA 2F8MA 3P49B 2R4FA 3O5TB 2OTJS 1X9WA 2ZH5A 3VAIA 4O0IA 2U1AA 3FFIA 2R7OA 5FD1A 3K58A 3R27A 5DGBA 5A2QY 2QLWA 3D5MA 4YDXA 2HVHA 1BLUA 4ED5A 1U8SA 3AJ2A 3KLIA 1VQ7S 4YR2A 4LVOP 3KLGA 2JLFA 2OKQA 3FVYA 3CCZA 3HKWA 2HIQA 4B9TA 1AUDA 1IUJA 2G1DA 3BB5A 2XC9A 1FKPB 3DLGB 4C8KA 1H0HB 3KLFB 3PHEA 2YNHA 1DRZA 1FXLA 3VQTA 3MEGB 4ECVA 4GKJF 1S10A 1JLQB 1IQTA 1SH2A 1VBZA 5DM6Q 3OTOF 2KO1A 3PIPQ 2XY7A 1QVGR 4JI6F 3T5LA 4O23A 2NSBA 2PA8D 4YMEA 5KG5A 2MGZA 2R2TA 2RQ4A 5KFJA 4DV5F 2YWKA 4FVMA 3SFUA 4CIOA 3K2YA 4XK8C 4OX9F 3VQSA 4J9KA 2CVEA 2QA1A 3EGNA 5U47A 2W7PA 4ECUA 1U47A 1VQ5S 2YNFB 4C3LA 1QSSA 3HO1A 5EWEA 1W2IA 4LIWA 4CO2A 1I94F 2V9WA 4DSKA 4ZPDA 5DJBA 2B7BB 2KT3A 2IHR1 4RX6A 2B5JB 2PE8A 1RA7A 4QWDA 1KNZA 5KT4A 1X0PA 3CDEA 4ED8A 2BQRA 1S0MA 4NWBA 2X3GA 1S1XB 1FKPA 1X8DA 4E8UA 3DLGA 2WHOA 3KLVA 3KLFA 5KFUA 3I4HX 1LXNA 3MEGA 2R8HA 2MB0B 4KBIA 5C5JA 1JLQA 1JLCB 5E3PA 2XGQA 2MZRA 5BYQA 2LXFA 4C8LA 3AH6A 1WTBA 4NCGB 3GV5B 1O51A 2NR0A 3M9NB 5J1EB 4GKKF 2CJKA 1HNIB 2FGCA 2V0NA 1HR0F 2M2BA 1B0TA 3WX4A 3KKFA 2YNFA 2UUCF 3I31A 3TQ1A 3CD6S 3C3LA 3HDSA 4LIRA 3QAUA 5KFTA 4GC6A 2R7TA 1LFWA 4F2RA 1XERA 2JOQA 4HDGA 2B5JA 2F9JA 3C6UB 3M8SA 2FHOB 4X66F 4X4UA 1JXEA 2ZKUA 5G4DA 5DETA 1NAQA 3JYTB 3RW7A 2E1CA 1N8RT 4IRDA 4WYLA 1S1XA 1S9GB 4HLBA 2FLPA 3QAEA 2QA4G 2JVRA 1UP1A 1P8GA 2PMZD 1JLCA 5DQIA 4LF5F 4QIWD 5A8KB 2N7CA 2B56A 1U1LA 1HI8A 2QZ8A 5DRKA 4NCGA 4F8RA 3UCUP 3NL0A 4OJHA 5KFCA 1WD6A 1U1KA 1D9AA 4EBCA 2FD2A 4HL9A 2HFNA 5J1EA 3PRBA 4RW7B 2XS7A 1O5JA 1HD1A 4BWMA 1HNIA 1WHVA 2KM8C 2Q66A 1NNDA 1SB6A 2OPPB 3OL9A 1ZAXA 2KYXA 4DSLA 4RNOA 2LMIA 2RF2B 3GMGA 1LOUA 1HW8A 2C3PA 4IUFA 2CVIA 3ONQA 1HWKA 1U25A 2PD1A 2VKZG 2FJVA 5AXLA 3C6UA 3JTOA 4B3SF 2KHDA 5A8RA 3TW0A 1VFJA 5KFSA 4YUDA 3W2WB 2AJ1A 4WFAQ 2DBBA 4N56A 2IVMA 5F8IA 3JYTA 2GFFA 2P9GA 1X9MA 1YSJA 1XR6A 2NUHA 3U02A 3N0VA 2N82B 4I69A 1S9GA 1UFLA 3OLBA 3UDCA 4DFMA 3CDAA 3LQVA 1KQFB 2FVRA 3IWLA 4KIAA 3BGRB 3MMBB 2XCPA 1KOHA 5A8KA 2LCWA 1ZOTA 1XNRF 1GX6A 2IM0A 1BWEA 5J2QB 3THPA 3KHRA 3DRPB 2HS3A 4TU9A 3MTJA 4A8WA 1UL3A 4Q5VA 5D4OA 4Y28C 4RW7A 2D3ZA 2JX2A 3N6MA 1M5PC 1CVJA 5F9NA 2OPPA 4J5OA 3MR5A 5SUHA