5L8RC

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
80
Chain Sequence
SHSVKIYDTCIGCTQCVRACPTDVLEMIPWGGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 80
sequence length 80
ec nomenclature ec 1.97.1.12: Photosystem I.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF14697 Fer4_21 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5l8rC00
2UZAA 3IR6B 2ZVSA 6FD1A 1XERA 3MMAB 1SIZA 3OR2A 1D3WA 1FEHA 3MM6B 1FRMA 4DHVA 3OR1B 1DAXA 1FERA 5BYRA 2GMJA 5FD1A 1BLUA 2C3YA 2PMZD 2VPWB 1GTHA 3MMAA 1B0PA 1KQGB 6FDRA 1SJ1A 1JNRB 1H7WA 1RGVA 1KQFB 1IR0A 2WSFC 3OR2B 2FGOA 5BYSA 1HFEL 1Y5IB 4KT0C 4ID8A 2IVFB 1FCAA 1KEKA 2C3MA 2FJEB 1SIWB 2WB1D 1VJWA 4RKUC 1AXQA 2C42A 3MM8B 1DFDA 3C8YA 1BC6A 1BWEA 1FRKA 4OMFG 4AYBD 1FRJA 4OV1A 1BQXA 1JB0C 1B0VA 3PNIA 4XDCA 3LW5C 1Y4ZB 3MM8A 3EGWB 5E7OB 3MMCA 1IQZA 3GYXB 1GAOA 3MM7B 2WSCC 3MM5B 1C4CA 2VPZB 3IR5B 2PDAA 2C3PA 2C3UA 2XSJB 1JNZB 4L6V3 1GT8A 2FJAB 1H98A 1FRLA 1F5CA 3MMBB 3MM7A 4YDDB 3MM5A 2Z8QA 5BYQA 3MMCB 1GTEA 2XSJA 2FDNA 1FDAA 1FXDA 1FRHA 1FRIA 1FXRA 2FD2A 2O01C 3MMBA 4Y28C 7FD1A 1CLFA 4XDDA 3HKZD 5L8RC 1FDBA 4CI0B 1F2GA 2FJDB 2Y0SD 1DURA 1C4AA 1R27B 1WTFA 1ROFA 2WSEC 1FF2A 1FRXA 1H7XA 1H0HB 3MM9B 1FD2A 1PC4A 1FTCA 7FDRA 1B0TA 2PA8D 1PC5A 3IR7B 5CHCB 1G6BA 2C3OA 2WAQD 5CH7B 2VPYB 3EUNA 3MM9A 2GMHA 1Y5NB 3MM6A 2V2KA 2V4JB 4XK8C 2VKRA 3OR1A 1FDDA 1BD6A 1Q16B 1G3OA 1F5BA 1K0TA 1Y5LB 2VPXB 1A6LA 3EXYA 2V4JA 2FJBB 1FDNA
chains in the Genus database with same CATH superfamily
5ETMA 2ZE2A 1HYSA 1PBAA 3VF0B 3UFCX 3T6BA 2YNIA 3PXGa 4OYPA 2R7QA 4RR5A 1XK8A 4J9SA 1NXIA 1XR7A 3I56S 1RUSA 4A8YA 4G1IA 2KHDA 1MN7A 3SFGA 5EWFA 2DNQA 1S6UA 2IC3B 3MUMP 4AQYJ 3GFHA 2UU9J 2GJ2A 3KLGA 1Y7PA 2E29A 5ETQA 4DR4J 4H4MA 2ABYA 1TKZA 2VICA 2F8HA 1WACA 1T9VA 1OPIA 1W25A 1IM6A 3MMCB 1WJ9A 2AIRB 4F3OA 2CPXA 8AT1B 3NS5A 2Q3PA 2C28A 3DLGB 2O1PA 1U2CA 1UAWA 4ER8A 3W2VA 4IFVB 3UE2A 3QIPB 4NX9A 1RTZA 1F0XA 1RU1A 4F4WA 4NASA 3TI0A 3FRYA 3MMJA 3HSGA 2XEXA 2CYYA 2R42A 1R7IA 3EXYA 3NXZA 3UQSA 5ETKA 1QM9A 4C8MA 4KV8A 3GILA 2QX0A 1EJ7L 2V6AA 2J0QD 5I3UA 2ALZA 1X31C 4ZLLA 4URGA 3OPKA 5FIIA 3P3DA 2J6SA 1S1XA 2K1RB 3MM8B 5L9NA 5DLFA 4J9NA 4ILMA 3NGUA 1SPBP 2LQ8A 4IO1A 2QMXA 4LSNA 2CQPA 2IJRA 4WKYA 1MROB 5HLFA 2XMKA 2CPEA 3VR1A 3SCIE 4MK7A 3AXMA 2RT3A 1X0FA 2CJYB 5DM7Q 3UN5A 4F04B 4C2MA 4WU3A 4DS4A 5A6PA 2UXBJ 2QA4G 4OZ1A 4O23A 2Q43A 3CDEA 5ETTA 3FKBA 3TP2A 3MAHA 5KFSA 4X66F 1FKAF 3K57A 4KB7A 1VR6A 2M5YA 2FVSA 3UO0A 2LQJA 5HBMB 1M5OC 2D7SA 1CVJA 3LO3A 3OR1B 2Y8WA 4RUCA 3O6QA 4CYUB 1JNRB 4OHWA 4CWBA 2A6MA 5FDLA 1FKPA 3FCVA 1S77D 2JZ5A 1S5ZA 5D0HA 4DR2F 5IC4B 2QL5B 2N7YA 3NWGA 2LXUA 1FJCA 5B0GA 3UW1A 3LWLA 4OZ5A 2VD3A 2J7WA 1ZZFA 3HI9A 3M8WA 5SZTA 3L7PA 2D3O1 3PX0A 4X4VA 2MQPA 4P6QA 1NJWA 2XMTA 2DT9A 3RW6A 3H5UA 4ZN1A 3DLJA 3IRWP 1F9HA 2ZDPA 1UJ4A 2UVWA 1LWFA 3D1HA 3H90A 4EO6A 3ETOA 3KLVA 3M6WA 3U02A 3B4DA 2C2RA 3IRXB 1YGYA 4DV5F 2DYAA 4ZA1A 3KDOA 3JAMY 2JEGA 1WEXA 4HTJA 2DTJA 2HBYB 1H2TZ 3MAQA 2RF2B 1WORA 2PN6A 3ZNJ1 1HFEL 4LRBA 1HARA 4EO8A 3QSIA 3CWJA 1BXNA 4A8KA 2XLIA 5BR8F 4USUA 3D2WA 3HVWA 4DV7F 2IC3A 2F8EX 4ZPCA 2C3UA 3QT7A 3PRVA 4F0MA 2EK1A 3UCUP 1GX6A 4LREA 5F8IA 1TR0A 2YKMB 2ALYB 2DNNA 4DZ6A 3LOUA 2V2VA 3JTNA 1S0NA 4DPWA 3SSRA 2WVDA 2J9EA 2ZD1B 3DLGA 1VBYA 3OVSA 2AP6A 4IFVA 1U02A 5BXIA 1CJTB 2E5HA 2HBRB 4NLGA 1NDKA 3ETMA 4DR5F 2JEJA 2FTRA 4IH5A 2MQOA 2R2RA 4MT1A 2RAQA 4J9KA 1KTQA 4EZ9A 1YJ9S 3R5GA 1RWPB 1FCAA 1SKRA 1RAEB 2AJQA 1RA7A 1U48A 3QFWA 3FSXA 3MM8A 1VOMA 4DR7F 1HHQA 1P9YA 4U8YA 3ZFVA 2NS1B 4EFAC 3D9BA 2GGPB 4OI0A 4ED1A 4JP8A 3GIMA 4OZ2A 1TELA 2FHKA 3MCMA 3D1OA 1HNZF 5DDQC 2DH9A 4F4YA 2DEJA 5DG7A 1PJ7A 2DXEA 1KQKA 2Y1LB 1LW2B 4MKAA 2IAJB 5D4PA 2MKIA 4N56A 2HS4A 3T5HA 3AD9C 3NMAA 1CJUB 2IBKA 1YX2A 5HBMA 1UTAA 4F3QA 1I3OB 3QGPA 1RWMB 5IZHA 2J6UA 2CFXA 2YNGB 5I42B 4LF9J 4CYUA 5DDPC 3BSAA 3POTB 3DRSA 1YSJA 4P2MA 2MTLA 1GXUA 2O3DA 4BWJA 2KT5A 2NXNA 3D28A 3ELHA 1H73A 2PDAA 2WVCA 2UP1A 3ISZA 3IS9B 1YKWA 1REVB 5C5JA 3KK3A 2JC1A 3EWGA 1IBLF 4EK2A 3DXBA 3SYZA 3GZ7A 3LTOA 4RBUA 3OLBA 5IT0A 1QAIA 2UXCJ 4NLQA 1FJGF 4R8UB 1YZ6A 3R7BB 3NS6A 2AZ3A 2BQRA 3LANA 4NI2B 3KK2B 1FDDA 1SKUB 4LQ9A 4N8OA 4ECZA 1UJ5A 1YJVA 1IKWB 1SH3A 3IRXA 3M2RB 2B4UA 3DXSX 3PKYA 4Q0BA 3SQGB 2DIUA 4N47A 4ED8A 4B3MF 1QDUB 1KQGB 2NYIA 5EHHA 5D0EA 2CPZA 4ED5A 3OXFA 3J7AN 5KG6A 2VC0A 4QU7A 3GMGA 3OBIA 5KFVA 4X4RA 3OV7A 2RF2A 4IRDA 2PSZA 3Q89A 4J91A 4NLTA 2CQ3A 1NKBA 1RWNB 4G6VB 5LL6d 5F8JA 3DKDA 3D67A 3RBZA 3KMQA 4J9RA 2RUSA 4UZCA 5CYQA 1FRHA 1HI1A 2EBGA 4ANCA 3QGHA 1G7CB 1TL3B 3J80U 2HBZB 4KIAA 2G4BA 1S59A 1G4CA 2GAGC 2EFVA 1JLGB 3SSQA 3QPIA 3A8JA 2DHHA 4DUZF 1U7LA 1CBKA 1XEZA 1RHQB 4QR1A 3MD3A 2ZD1A 1U25A 1AA1B 4O4GB 4MH8A 2D1CA 2EFQA 3H8YA 1CJTA 3RG6A 2BW7A 2YX1A 4OI6A 2QL9B 4QIVA 2W2PP 2FLLA 1CPZA 2IM3A 5KFTA 4QWBA 2XQCA 3BO3A 3MPWA 3AJDA 4KGMA 5I3QA 1TL4A 3E8OA 3KJVA 4DFKA 2DNZA 2GHVC 1B7FA 4O3QA 2AWZA 3OXLA 2IHR1 3SMZA 3VQSA 1UVIA 1H98A 3HDSA 1B3TA 1APSA 5A8RB 3M8RA 1UVNA 2X51A 3L7UA 4RL1A 3DOLB 2HMIB 1UCNA 3M32B 4UOCA 3GJQB 2F7VA 1VQMS 4UQTA 1IBKJ 3U27A 1Y11A 2DXFA 3CCQS 4FXWA 3HHNB 3NGRA 1VS3A 1WG1A 3MDFA 3U7JA 2LA4A 2MKCA 2AJ4A 3GJSB 1LW2A 2YWKA 2HFZA 2IAJA 1U1RA 1CJUA 4HI2A 5DO2A 2WZ1A 4CLPA 1XN9A 5KT6A 4I67A 3BQ0A 2FY8A 2G0JA 4LF6J 1HI0P 4RW8B 1WD6A 4CLTA 1XMQF 4CLSA 2PC6A 2YNGA 5I42A 3D0IE 2MZJA 2PGCA 1YRUA 3LW5C 1QSLA 2IY5B 3POTA 4K4WA 4DN9A 4BDPA 3H2LA 1RHUB 2F40A 2XBPA 2JEFA 4Z2XA 3J7A1 2Z4PA 4JI7F 2P9CA 4ZVPB 3IS9A 2EFOA 1REVA 4Q8FA 1ZPVA 3MR2A 2KKHA 4USTA 5D8HB 1H72C 5DS7A 2HHQA 2QA4S 3IR7B 2CG8A 4Y34A 1V3RA 5J2NB 3D68A 5K8MA 2GJIA 4F3MA 3WDOA 2H1YA 2MQMA 1M0SA 2M8DB 4LF2A 5LSOA 4K2JA 4JI3F 1NU4A 4NI2A 2VBXA 3KK2A 3SCKE 1SIZA 4DSFA 1FWLA 4JI1J 5KG7A 1DTQA 1X4AA 4O3OA 1EAYC 1OWXA 1RKIA 2G0CA 3L7OA 1EARA 3L09A 3SQGA 5E3PA 2OH2A 4KT0C 2HZAA 1F9FA 4ID8A 1D9FA 1KQSR 2HAFA 2OEJA 2DNYA 1DFDA 4P52A 1X0PA 3PW0A 4OMFG 3ENVA 4G65A 4JI4F 1QAXA 4CO4A 3DDIA 3T9ZA 1Q7YT 3W9IA 3HKWA 1OYDA 5ETLA 2X1BA 4X64F 2ZUGA 2MQQA 1YITS 2C2ZB 3UD4P 1U0HB 3HZGA 4ZVTB 4AL6A 2LVWA 3LGNA 2F1FA 2VJUA 2E1PA 1ZM9A 1TL3A 5KFQA 1WKKA 2HVDA 2IYIA 3OFFA 5EWGA 2BJ9A 1CJVB 3ISNC 5IOLA 2JFDA 3UR0A 3BGLA 2XNRA 1ELOA 3EVMA 3DGVA 1VQ7S 4B3RF 2XY6A 1VJQA 4O4GA 1VGYA 2HQDA 1PKUA 4DL5A 2LQ9A 1PCAA 4B9SA 1RYRA 1HIYA 4MK9A 4Z7YA 2IMWP 1FVSA 3N6MA 4LF8F 1W26A 4DV2F 1PILA 2GHPA 3PW5A 4P74A 3DGPB 4FXDA 4ED2A 2APOA 3MM7B 2XY5A 4WFYA 3P45B 1FFGB 1IKVB 4UOFA 3MEEB 4O0IA 1GMWA 2Y1IA 1IWGA 4KR0B 2WONB 1RHRB 4AXJA 2ATCB 5A8RA 4RUAA 3CD6S 3DOLA 2HMIA 2GC8A 1S6QA 3M32A 1RCXB 4WYLA 2DIVA 4DV3J 5KT5A 3KHRA 3GR1A 1S9GA 2NCKL 3CCMS 3UWTA 1RK8A 5T41A 2EW9A 4QCLA 1HW8A 5LXYA 3IG1A 3GR0A 4OHZA 4W4MA 4P73A 2XULA 3TA2A 2CNLB 3AAWB 4LRAA 4Y00A 5D4OA 4NLRA 1TV6B 3H5YA 4LFCF 1X60A 2RVJA 1FJEB 4PCQA 2HRTA 1MG7A 1R89A 1B70B 1TL5A 4HDHA 2WW4A 4DPUA 2KYZA 4RW6B 3GYXB 1Q95G 3O44A 1JLQB 3CSKA 2ASJA 1WOOA 3GG0A 5LMUJ 1EZZB 3FEXB 3T41A 1T95A 4PPZA 4EYIB 4I6WA 5H1SV 2XG8A 3WIUA 4OYAA 4K7QA 5HVGA 3QQCD 2DR9A 1QD1A 4QPXA 3CCUS 3VVUA 4X4NA 3DLEA 3NRBA 2W9CB 2MQ8A 3KYLA 2PA3A 1QE1B 2V68A 1RABB 3LP1B 4DG1B 3KFWX 1TKTB 2ZUAA 4U7CA 5J2NA 1Y00A 1C2PA 4QR0A 3HSJA 1HNIB 2R7TA 4DSLA 2WB4A 3SSSA 4X4QA 1BGXT 2UUWA 4IRKA 3OTBA 1TP7A 2MY8A 5B0BA 4Y2CA 4Q45A 4JI4J 3HJVA 2DPJA 4ZCKA 1WTBA 4RU9A 2LYVA 3KDNA 4RNNA 4ZPAA 2HHUA 2BJDA 1WEZA 4PPDA 3TARA 3JTOA 1H6KX 4ILRA 2WTFA 1SKWA 3OTOJ 1JB0C 2AHOB 4YY3F 4NPOA 4UY85 2PMWA 4B3OB 2PEHA 2LEPA 4C3LA 4JI6F 4RNMA 2DEIA 3QJPA 5HK4A 3GCXP 4YP3A 5K8OA 1U0HA 1N5SA 2HNDB 1ZAXA 5GAEI 4OYIA 1M90T 3W66A 2HHPA 3CJ4A 3LH2S 3ZC4A 3SEOA 1XNRJ 3AT1B 1G3OA 3CJKA 2QFIA 4ECUA 3M2UA 2H65B 1CJVA 3RAMA 3MUVP 3FC9A 4OHXA 1HWKA 3IC1A 2AJ0A 5L1IA 1JXEA 1JJHA 2B6AA 1RLDA 4JYAJ 3M30B 3LALA 2VJVA 2H5JB 2I2YA 5KFWA 1FRJA 1FKOB 3HFZB 5HI7A 5HJYA 4ECYA 3MURP 1XMOJ 2FYXA 3W5YA 1JLBA 3VVTA 1RYSA 3IR5B 1X5SA 5B7WA 2FJAB 2OI2A 2XHCA 3MM7A 1FO1A 2OPQB 2Z8QA 1RTDB 3S01A 1IKVA 3H40A 3MEEA 2OGUA 3P6YC 2HHHJ 1GXLA 1JJ2R 2WONA 1VC0A 4GVLA 3N5FA 4JOUA 1URNA 3A12A 4FNHA 5F41A 4JV0A 3ONQA 1KWMA 3AFGA 1N34F 4HHUA 4ELUA 2ROEA 5D3GB 1J2VA 3W60A 5C2CA 2FJWA 4IOBA 3NNCA 3CF5Q 1X4BA 5KFAA 4CO2A 3H0PA 1L5UA 3MTKA 3IXQA 4Q2LA 2LDIA 1BUXA 4ED6A 1TV6A 4DSJA 4USWA 4YHHJ 2KXFA 4K2XA 1T9WA 1KLNA 4MIWA 4NLYA 2DHGA 3D6MB 2W1BA 1S1TA 3HXMA 2R4FA 2B9YA 2CQ4A 1NEEA 5HANA 4J9VA 2R7UA 2ZKUA 4DV0F 4M5NA 4RW6A 3PZPA 1DLOB 2VF3A 2E5JA 4BLGA 2RQCA 3GIJA 1JLQA 3KLEA 1YBTA 3WZ0A 3RBEA 1M5VC 5KFYA 1NJYA 4NXNJ 4ED3A 2IA0A 3ITHB 4LIWA 3G87A 2M52A 5KOWA 3PACA 1C4AA 1YRXA 3E2EA 2RDDA 2HHXA 1T8EA 5K9FA 2KYXA 4QIGA 1R8BA 3NP5A 3LF0A 3M4XA 2W9CA 4KGXB 4RNOA 1NPRA 4DG1A 1TKTA 1QLNA 3CJTA 3RBXA 2MGZB 3UDVA 1HNIA 4TLRA 1CS4B 4M8LA 5KFLA 1VQKS 3OJSA 1FNOA 5J1PA 1RZMA 4LRCA 4O3RA 3ZZTA 1RT3B 1SIWB 1O0PA 4KFBB 4C8ZA 5BJRA 3TA0A 1OSDA 1JK9B 1BE4A 5IV3A 4KBIA 4NLDA 4EBDA 4Y2KA 2ZC4A 1VQ8S 5IFMA 3FBBA 1TL1B 5KFBA 1PAEX 2C2KB 3U1MA 3OQ2A 5KFMA 1W2IA 4IR9A 2UUTA 1JLEB 2QTWA 1N5QA 2MLYA 4AL5A 4QWAA 1DZ5A 2G2ZA 4MYTA 2YPZA 2OD4A 2E9TA 1QY7A 2KN4A 4AUKA 1K8AT 2GIQA 2WAQD 1NKEA 4V19X 2FVQA 2HNDA 2OO4A 1U4BA 2A6OA 2QE5A 5HAOA 1HR0F 3CCLS 1Q79A 2ZC3A 2BANB 3GSDA 1WSRA 5J2MB 3H20A 5K20B 2J6TA 4C7QA 3QT8A 1U47A 1L3TA 1T9YA 2E7WA 1PYSB 1LWXA 4WTOB 1OY9A 3WHIA 3N4WA 5BYSA 2RU9A 3M6VA 4R5PB 4GC6A 2HVEA 3GB0A 1N0VC 2BW2A 2YNFB 3ENQA 4LR9A 2YH0A 4OHYA 4K5SA 2FVCA 5IWAF 3M30A 4BHQA 4DF8A 5CD4H 3NCRA 2AYGA 5CA5A 4D3HA 3MFIA 5CD4A 3P96A 2AEJA 2CJQA 4HH0A 4IKAA 4WFXA 2OKQA 3AD7C 5EGYA 3ICLA 3NGTA 4XPCA 1X9SA 2J8AA 3IAM9 5KFFA 4GMKA 2OPQA 1RWKB 1Q53A 1RTDA 4QU6A 4IOAQ 1U6ZA 5CHCB 1EQMA 3OFGA 4RX6A 1HNVB 5KFHA 4W90B 2IJFA 3MEDA 2W7OA 2GO8A 3QIDA 5HQMA 2HAIA 2G2OA 2LLZA 5D3GA 1VLYA 4UTGA 1C0TB 3EGZA 2DR5A 2DXDA 1Q1KA 2Z58B 4X65F 2RU3A 4WFAQ 1WG4A 2DGTA 2P6SA 1FFWB 2JX2A 1I94J 4DLGA 3J81Y 4M63A 4ICLB 3GE9A 1S9EB 1XQIA 1RI7A 1ZZNA 4ZVSB 1NSPA 4OX9J 4N76A 3LAMA 2V2QA 4NZ7A 3C6TB 1S6PA 3FZ2A 1FD8A 4C4WA 3MHYA 2HQIA 2FLPA 3GYNA 3QJLA 1FWPA 1PG5B 2RDJA 5F0WA 3BM7A 1FRIA 3BV8A 4PWWA 2BZ2A 2VFVA 4EUVA 1KHVA 4X84A 1D8ZA 3MM9B 3ITHA 2JNJA 2NLWA 3G71S 3QYYA 1YI2S 4FYWB 2J9DE 2DGOA 2VPYB 1XMBA 5CABA 2E1AA 2V4JB 4XK8C 2DK2A 4F26A 4OX6A 4XPEA 1O8BA 1HQUB 2VPXB 2W2QP 3DC2A 3ZZPA 2Y1RI 3J7YU 5KFCA 4Y0FA 3PJWA 5E2QA 3X3UA 3PTWA 1NO8A 3I9ZA 5AE2A 1VQOS 3V4MA 2XMMA 2HGNA 1R6YA 1CS4A 1QUVA 3CJ0A 4A46A 5GADU 4MAKA 3KKFA 1RT3A 3MAAA 3CO0P 4NLUA 3W3SA 4KFBA 3GYGA 4Q8EA 1RQ0A 2HS0A 4C6AA 4CIOA 1N5YA 1KTVA 1ACMB 2A10A 3D0GE 1SH2A 4RNHA 1EKSA 2W2OP 2FC9A 4FF4A 3CDUA 2CQ2A 3D3CJ 4OJ1A 3PW4A 1N36J 3QRQA 3D54A 1WC1A 2DGSA 4Y28C 5L9XA 4KAIA 5L8RC 3WX8A 3FVYA 4ECTA 1UVJA 1RTIB 1PC4A 3V81B 3BDEA 1K9MT 1WC4A 3CJ2A 4PAAA 2YKNB 1OS5A 2YWHA 1T9XA 2G13A 2CAJA 2I6WA 2DPIA 2KZZA 3G6ES 3NAIA 2ZOMA 4F2RA 2ZHBA 4L76A 2VQFF 3UCGA 5LJ5Y 2BANA 1ZOTA 1J27A 4TU8A 3CO9A 4DX8H 2B7BB 3CUNA 2VDHA 2R7XA 3PX6A 4JI0J 1RHKB 1VYAA 1UL3A 3W9HA 4U6PA 3H5XA 2CPJA 3OVBA 3RRGA 4FNIA 4RKUC 2VG5B 4F4ZA 1NDCA 2BJ8A 1VQ4S 4Q44A 1YDLA 4ILLA 3BSCA 3N9UC 4TQRA 2V0NA 2OD6A 4UZBA 4DR3J 3Q86A 4L75A 4B9MA 2A2DA 4PKDB 1U1PA 2R2UA 1NK7A 3FNNA 1FF2A 2PE8A 3M1VA 3TNVA 2KI2A 3MEKA 4W92B 3CC2S 2YWWA 2VHGA 1VDHA 1X7VA 2IFXA 1LOUA 2OP5A 4OI2A 4C8KA 2KHCA 2BX6A 3IWLA 3G4SS 4H4OB 5I4MA 2HWHA 2XZWA 1HNVA 3MPVA 5CCLA 4X62J 3CIZA 3JXOA 3MM6B 4DR6F 1IKYB 4C97A 1GMUA 3QWUA 2FGCA 1C0TA 1KS2A 4BC7A 3P49B 2CIMA 2VB6A 5GMKa 4DQRA 4K4XA 1QSSA 1F5AA 2DD8S 4DPOA 2DKOB 1GH8A 2LA6A 2CQIA 2EVZA 2VIHA 5F8LA 3RW7A 3MGJA 3M9MB 4A8WA 2KL8A 4L72B 1BQNA 4NLSA 1JWWA 4ICLA 1Y4ZB 1S9EA 2M0GB 1MSWD 4DSIA 4ES2A 2Y3YA 3IM9A 3HHLD 5F0UA 3OL8A 4S0MA 2KB2A 2IIHA 2HIQA 3N28A 1EETB 2KVIA 4ECRA 3MOZA 2M7SA 5MAOA 1ZM2A 1JKHB 1XC9A 1FK9B 3PFEA 3FZBA 3LAKA 3TO8A 4K5RA 5KG2A 1SC3B 2Q6BA 2XB2D 1FNMA 2FB0A 3MM9A 2XI3A 3N6NA 2LFVA 3NWRA 3FQLA 5DG8A 2ZM6J 3MPDA 3AJ1A 3DU6A 4NLVA 1NRKA 2V4JA 4QW9A 1IBCB 2QMUB 4EBCA 5GAHU 4X4OA 4CO0A 2B56A 1HQUA 5DRKA 2KRRA 1GTHA 2XWYA 4U9RA 2W7AA 3THVA 5IV4A 4B9NA 5L38A 4P72A 1KDNA 1NKCA 5GMEA 1GXTA 2PI5A 4PXBA 4XDCA 1X4GA 2AJFE 2KFZA 1HD0A 4HVZA 4J5OA 3R6LB 2EKYA 1WC0A 5T14A 4ZVEA 5SUHA 1YK9A 4URQU 4NLPA 3ENWA 3DHWC 2X7IA 1S0OA 5E41A 3GV7B 2ACYA 3BPSP 1WKJA 4OYZA 3V81A 3DRYA 5IT9U 4YUDA 2J7UA 2YKNA 2ROGA 2GVZB 2UZAA 1RJJA 2HS3A 2WCXA 3CULA 3AODA 1NHUA 1HWLA 3F41A 4LJMA 1NMEB 3ZO7A 4F67A 1RWOB 4K0KJ 3DLKB 3LGHA 1XNQF 2C2OB 4DX6A 2H4WB 1FTRA 1KRPA 3R1HA 3UDEA 2MDAA 4DQSA 2VG5A 3BSOA 2WSCC 2CWXA 3VGTA 5E0OA 1OPZA 3FUYA 4L3NA 4WYWA 2UUCF 1K47A 4P10A 5DQHA 1UZDA 1AB8A 3M8ZA 3KLIB 3ILLA 4ZPWR 2BR0A 2OTLS 3TR5A 5CZVA 2D69A 2NXCA 1ROFA 3I5AA 5B09A 1UA0A 2YH1A 2CPFA 5J2PB 2HLUA 3FCWA 4OJ3A 2JLEA 2LXFA 4R0JA 2DBBA 2F63A 4QYZK 2V9KA 2UXDJ 1SV5B 2OIHA 1S79A 3RB6A 1Q86T 5H9EK 3SV3A 1A0OB 1N48A 2QT7A 5CAAA 5BYRA 1HNWJ 2C3YA 5DG9A 4C8LA 1FFSB 5G0RB 1F1BB 4DUYF 2AW0A 4KRWA 2MY7A 3QZ7A 3OR2B 1SCJB 4KGKA 1UVLA 4TLQA 1R3NA 2V94A 4KPYA 1J5EJ 3WX4A 3NY0A 1NZ8A 2ILZA 3RJMB 3K17A 5IS2A 1UEKA 1E6YA 2HFSA 3L9ZA 4MIAA 5A8WB 4JI8J 3KOAA 3AA9A 2MZRA 2GIRA 4JUZA 3HT0A 2YWFA 3DOKB 2G2YA 2PFDA 1NAQA 2E5IA 1HWIA 2ACMA 1EETA 1OMSA 1HKAA 1X5TA 3OHAA 3J7YI 4RUBA 1H0HB 2D9OA 3CD0A 1TFYA 1JKHA 4A8FA 1FK9A 3KG4A 2RMLA 3PW7A 1UVKA 2DB1A 3CVKA 1EQ0A 2WBMA 2CZ4A 3DRXA 2J76E 2A3JA 5GADI 4DV4F 4ZCIA 3DMJB 1FEHA 3TAMA 2E66A 2V8HA 1RWWB 2P9GA 1O51A 4TQSA 3C14A 3LPEA 4J90A 4DMZA 2UVUA 2M2BA 3AOCA 3PHEA 2I8EA 2IM2A 3BN7A 5M2PA 3C19A 1FE4A 3GQCA 3IAS9 2DNPA 2VG6A 2H9ZA 5AXMA 4PEOA 3W5XA 3MWBA 2XY7A 1P8GA 4ZP8A 3CC4S 2OEMA 1YJ7A 1WHVA 2BKOA 4QOTA 3KUGA 2N4DA 4MIBA 2ZH1A 2XMAA 3BH7B 1S7IA 2Q6CA 4PXEA 4MFBB 4K4ZA 2RB7A 1BWVA 2KVQE 5KG3A 3ZTSA 1NNDA 1S1VA 4GKJF 5MLCV 2EC2A 2L3MA 1ZH5A 1FEEA 1RADB 3W8GA 4DV6F 3Q8RB 1TVRB 1UEVA 5DJBA 2AX1A 1M1GA 2D3OR 4LF5F 4I69A 2AV5A 2GVZA 2RQKA 2XO6A 3UVJA 1C1BB 4ZN3A 4CO1A 3FRZA 1TMJA 3I5CA 4JI2J 4CQ1A 1FA0A 4YMEA 2EFPA 2CRLA 2DHAA 4JV2A 4F0HA 2AZ1A 2UUCJ 3GIKA 4DS5A 1RA6A 2RIJA 4NA3A 2JSXA 5ETOA 5IT9Y 3GV5B 4CH0S 4G3IA 3D7SB 5KT4A 3A3PB 2QSWA 4P75A 1OQ3A 2VKZG 3TZZA 4QR2A 1F2GA 3KLHA 3BGOP 1FNXH 5AJ3F 2Z0GA 1LFPA 3GFYA 4FPRA 2DO0A 4C3KA 2KM8C 1S4FA 2H54B 2E1MC 1VQNS 3V6DB 2GFFA 4ZLPA 4X4SA 4RZRA 7AT1B 5J2PA 3UN3A 1Q16B 1IQTA 2BOPA 4LR7A 2DVIA 3AJ2A 2N4CA 1IR1A 2BV3A 1SV5A 3MMAB 2DH8A 2FZGB 1U45A 2I9SA 4BWMA 4ZHRB 4C98A 3HJFA 3O5TB 1PO6A 5JXSA 5L46A 5G0RA 4OX7A 2OMLA 2C3MA 3MUTP 2F9JA 3MF5A 5EWEA 1Y10A 1SJQA 4B3SF 4FP9A 3W61A 2DGUA 1NB2A 4QYZJ 2Z2LA 2HRUA 1PYOB 2HSEB 2VUGA 4ZJQA 2LECA 1TU0B 2Y0BB 2IA6A 5A8WA 3VAJA 5H9EJ 4Y3CA 2L08A 2QC3A 5ETNA 5E3QA 9RUBA 1L3KA 1T03A 4KJIA 2LU2A 3NOCA 4NXMJ 3AA8A 2X1GA 3V4IB 5EX0A 2I0XA 3KK1B 3TX0A 2QV6A 3Q83A 4TYAA 4M94A 1PJ6A 1RHMB 5D78A 3DMJA 5FD1A 2K2PA 1N6QB 1TK5A 2QEXS 2UUBF 2HZVA 2QMWA 2OFGX 3H5SA 2ZH6A 4AFFA 1I6JA 2JVOA 3S6EA 1H3DA 2YTCA 3O2IA 5KOXA 2NUUG 2UVVA 1T05B 4HHHA 4HH1A 4TKTA 3HT3A 1RT1B 2B7CB 5HROB 1GAOA 1M5HA 4LBHA 3FMWA 1M1KT 2MKSA 2J9CA 3IBCB 4ZKAA 2E5GA 1VISA 4FZVA 3GFXA 3I0RA 1Z4UA 3I4HX 4C3MA 3VHQA 3GFZA 4MFBA 3W63A 4NLOA 4LFBJ 1Y5NB 3KHHA 3OTCA 2NPFA 2HQCA 2XMUA 5KFOA 2Y1JA 1NSAA 1DQAA 3RR8A 1AROP 3KMSA 1IXKA 1TVRA 5K14B 1YRTA 5J2QB 3U1NA 4RNFA 2JJ4D 4A8QA 1QVFR 4EU0A 4Q2MA 2ZH9A 1K44A 2WSFC 2HNZB 4ECVA 3T1HF 2XMJA 1UP1A 1BY9A 2PFFB 2RE1A 3QLHB 1VJWA 4E98A 5B0DA 1HBNA 2DH7A 2VDIA 1ZPWX 3IBFB 4A8OA 3ZZOA 1NK4A 4M5MA 2XLJA 4GRSA 2EWHA 1V5IB 4BC9A 5HVHA 3HFVA 2CQHA 2BE7D 1RAJA 4ZVFA 2XS5A 3C3LA 4YDDB 2F9DA 5AJ3J 2ZH3A 3RGIA 5LMNJ 1VC6A 2ZNZA 3D6FB 4JI5J 4QWDA 3WIVA 2VU5A 2CQ0A 2NQPA 3G6YA 1R27B 2QL7B 2CJ9A 3H98A 2C2EA 3VGUA 4RBVA 2HVIA 2AEFA 2HBQB 1RBAA 5KFNA 2JLFA 4ITSA 2WVFA 3A1YG 2CNKB 2E5LF 4F02A 1OQ6A 3PEJA 3BR9A 4OQJA 3M6XA 2L9NA 4K4UA 3HD2A 3HSDA 1IBMJ 1NK8A 1N33F 3CGIA 3HHDA 2N3OA 2HQ3A 2VQEF 1BLUA 1ZETA 3MMAA 1QTMA 3TX8A 3C16B 1HA1A 2MLXA 2ZITA 2OPSB 2YWGA 3KJNB 4FF1A 4ZHRA 2FY1A 2IM0A 4CLWA 1Z2ZA 3SCLE 2QGFB 2J0XA 3CXCR 1EP4B 4J9MA 3EGWB 3K59A 3KNAA 4KH0B 2AT1B 2CQBA 1KONA 4CRJA 4MTPA 3DU5A 1IKXB 5KFXA 5EN1A 1UPPA 1LFWA 1YHQS 2RSQA 1JNZB 4DV1F 3PRDA 1VQ9S 1WHXA 3IWXA 2DR6A 3PDNA 1B99A 3M2VB 3DDNA 1AFJA 2CJAA 1L3VA 2BE2B 1U49A 4LSLB 2XYHB 4I2QA 4ENOA 3QRRA 1X8DA 1MWQA 4ZITA 3EVOA 4TYBA 4DDFA 5A76A 2V2ZA 3KG0A 4RWXA 5J1NA 3NAHA 4IG0B 4ELTA 3I55S 3QRPA 1RU2A 2XMWA 3KK1A 1V9OA 2EBEA 3OJUA 3SI8A 2LCWA 3Q8YA 2ASYA 3M8QB 3MCOA 2HLTA 3KUHA 1H7WA 4D3GA 1N6QA 4JV5F 3W8PA 2Z30B 1JX4A 4WP3A 2YQ3A 1DY3A 4IOCQ 3MPYA 5EDWA 1AFIA 2FVPA 3CDAA 4A8XA 1IM4A 5FLXU 3DRRB 3MMCA 1IQZA 5HATA 2BJ3A 1T05A 3M8YA 3OL6A 4ID5B 1RT1A 4EBEA 5HROA 4LUBA 4OZ3A 1S76D 2AU0A 1RT2B 1JLAB 4YB7A 1N4LA 2FLNA 1WI8A 3QIPA 3HVTB 2YVSA 1I1GA 1ITPA 1DBDA 2MQLA 3CB4A 2AYBA 3NG8A 1GQEA 2LKZA 2LEAA 4I7FB 2UVRA 1YQHA 1VC5A 3PYEA 2HK3A 2KT2A 4ZIVA 2DNGA 1ZS6A 2B9WA 4AD6A 4RO0A 1XJWB 4KGVB 3SIPB 5IXUA 2K1RA 2E1RA 4X2BA 1U24A 3F0NA 5K14A 3RTVA 3DRPB 5J2QA 1IR2A 3IM8A 2HNZA 1MROA 3AXKA 2YPYA 3QLHA 3Q8UA 5D6GA 1V3ZA 5CXTA 4X66J 3Q2TC 3Q8VA 2LU1A 1UFKA 3CCWA 3LGMA 2HFUA 3NKYA 3PEHA 3WQPA 3X1LB 4MKVA 1WUUA 2C2NA 4N77A 1FDAA 2IMOA 1RE1B 4CI0B 2ADCA 2CJXB 1RT7B 1SH0A 5B0CA 3WC0A 2QLFB 2Z56B 4ETXA 4USMA 3GLJA 4DR2J 3LUYA 2EK6A 4RJVA 2OPRB 4PABA 3OR1A 4I64A 3PVXA 2NREA 4PQUB 4B3TF 1MW7A 2QRRA 4GVBB 4PXDA 1UVMA 3DOMB 1XWLA 3FBFA 4LQ3A 4WF9Q 2XNQA 4WFNQ 2MPUA 3D6TB 5A2QU 2MSTA 4NCGB 5D15A 3UDLA 3QWPA 2KZMA 3R9LA 4KHMA 2L41A 4XTTA 2F5GA 1D9DA 5U47A 4F7VA 3FSYA 3C16A 1Q0NA 4B02A 1RWVB 1S57A 4DZDA 2HFVA 3HHLC 1TUWA 4MKBA 4QIFA 3IO1A 4IG3B 2DNMA 1GEHA 1B0VA 5KFGA 1UMJA 1RB0A 3V6KA 3QAEA 1EP4A 4DV5J 4L73A 4NOHA 4OI1A 1HQ2A 1IKXA 4OI4A 5FJ4A 1P9QC 3J7Z5 2GO9A 1NSQA 5F9LA 1R8HA 1S7HA 5B0AA 4ALZA 1NK0A 4WPAA 2ZKTA 2KFYA 4FBTA 1T9TA 3M2VA 1B0TA 1QTNB 3DYAB 4DR1F 3EPIA 2BE2A 1PSDA 2LXIA 4LSLA 5F9NA 2BBEA 5J1EB 2C1EB 2F4VF 3THTA 2HGLA 5BR8J 4EEYA 1FI4A 4DPYA 4DV7J 1Y5LB 2FJBB 3FCHA 3UNYA 4I6YA 4DWIA 4IG0A 3MFHA 5KFRA 1KD1T 2ZH8A 4LF7F 2L9DA 5F8MA 4GO7X 3M8QA 4PQAA 2GIFA 2FJEB 2XO7A 1Y9OA 3CNQP 3IMQJ 2W2MP 1ZA2B 1FESA 4OV1A 2AYMA 1RISA 3PV8A 3ZZ0A 4DOZA 4DBQA 5LSRA 2YKMA 4WIIA 4ZMMA 3PYFA 4DR5J 4ID5A 3PW2A 1F2HA 1FXDA 1QJHA 3RBDA 1JLAA 4DEZA 3NEKA 4DFMA 1VQLS 3HVTA 1N32F 1VQ6S 1VQSA 1HBUB 1TKXB 1PIEA 4AXIA 1O6XA 2UUAF 3QT6A 2ZOFA 3NGSA 4Q5VA 3K0JA 4C0HA 3G2XA 4I7FA 4ECXA 3H4DA 1HNXF 4DR7J 3FFIB 5FLXY 2RRBA 1ZYQA 4LFAF 4LBPA 4Y65A 2ZE2B 3K7RA 1CC7A 3T1AA 4DFJA 3IP0A 2X1AA 1IWAA 4USHA 3DRPA 1TAUA 5HMXA 1HNZJ 3N5BA 1W2BR 1RAAB 2AGQA 2AMCB 4ZP9A 5DGAA 2GGPA 3R97A 3T3FA 5KT7A 1WF1A 4QYRA 1VHFA 4P7TA 4QIEA 3EGVA 3MMBB 5C42B 3V6HA 3UN2A 3BB5A 1I51B 3R5AA 2MYFA 1FDBA 5K5MA 4WFZA 1NBEB 2CKWA 4B3TJ 1MWYA 2GJFA 2KJWA 4AQYF 1RT7A 2UU9F 2ZJRQ 4NE9C 1SL1A 2CJBA 5KFEA 3W7BA 1RT5B 1BD6A 3TYTA 4HKQA 3NNAA 5B0EA 2DY1A 5DDOC 2OPRA 1F6TA 4PQUA 2EFNA 4AE5A 3DOMA 4FYXB 2DCLA 1K73T 1SUQB 3T1YF 2EPIA 3M9OB 4LIRA 1IBLJ 2XWXA 4UW2A 3R27A 4KV8B 2PO4A 4DQPA 4I4BA 2KFNA 4NYPA 4V19J 1RLCL 3VQTA 2W9BB 1FJGJ 3UD5A 4NLWA 3E51A 4RW7B 3C66A 4IG3A 1Q78A 5HMWA 1PYTA 2XSJB 2X1FA 1SQGA 4UUWA 2W8LA 1OIAA 2DNLA 4FBUA 4CT9A 2J8SA 3OTEA 4R8UA 4B3MJ 4YR3A 5L1LA 5A2QY 3Q8QB 1LXJA 3K5PA 4WZMA 1KFSA 1RAHB 3CJQA 4CCHA 3CCVS 2DNRA 2QYCA 1IKWA 1SVDA 1S0MA 2ZBQA 2R7SA 4QIWD 3M2RA 4JV1A 3DYAA 3K2YA 3RRHA 4DJBA 3BO2A 1FRMA 4ECSA 2GMJA 2PIIA 2ASLA 4U95A 2AJ2A 2M3DA 1SJ1A 1UFLA 3EMTA 1KN6A 4N5SA 3VAFA 3TUPA 1R8CA 3ULHA 2BDPA 5DLGA 2XSFA 4DPTA 2W2NP 2DITA 3HULA 3EDQB 5FDLB 1FKPB 4FVMA 4DUZJ 2IDEA 3PCOB 5E7OB 3VZIA 3AQPA 4OYOA 3Q8SB 2VONA 2JH3A 3FBEA 4M5GA 4YB5A 1JLGA 3C6UB 2HHSA 2VOPA 2W4PA 2CG4A 4A4JA 2YQ1A 4RBTA 2ZZNA 1U1OA 2QZ8A 2MKKA 3TVYA 2QG9B 5CH7B 3K89A 5LSLA 4ED0A 5T7LB 1HNXJ 4HI1A 2BE9B 1HBUA 3B82A 1TKXA 2VOOA 1LWFB 4LFAJ 3ILOA 2K7JA 4NRTA 3TAQA 3EM1A 1TZ0A 1D3WA 4H4KC 2DJWA 2JFKA 3ZTQA 4K8RA 3K8VA 4WJBA 3FFIA 1RXOB 2I38A 1EIYB 3EX7B 2ADBA 3K5LA 5HJXA 2VASA 1YJWS 3RAQA 2MLZA 3TEHB 3DLLQ 4G1PA 4JBCA 2CVEA 2MZSA 4I6AA 4OV6A 2VA2A 3NGKA 1Q81T 2IVMA 2HIYA 1CQMA 2R8GA 4R0EA 2DNKA 3MMBA 5C42A 3G8SA 5KFJA 1F3FA 4DI6A 1U2FA 3QGGA 4OYWA 1VRQC 4ZVQB 4A8MP 2FLOA 1XMQJ 3CPWR 1ZM3A 1TUGB 3T1YJ 1RT5A 1XTZA 4RW9B 3CEDA 2XYPB 2VFTA 1U0SA 1TKDA 4U96A 1GNKA 4RW8A 2OLWA 3QBCA 4JI7J 1D09B 1M1HA 3R2DJ 2HVZA 2AD9A 2V69A 1ZTTA 1U1NA 4NLXA 2MKHA 2RQMA 2V4RA 1SUQA 2GMLA 1SBRA 3QFHA 2BYCA 1NH8A 5AXKA 3R5CA 1T94A 3KLFB 3ZZZA 2Q79A 2BM0A 3R8YA 4LRDA 2FUG9 2KO1A 3OSNA 5CZXA 1RT4B 1GX5A 2DRAA 4ZJOA 2W9BA 3PG9A 3MEGB 4ZLNA 1ULRA 2C3PA 3QATA 4RW7A 4ZPTR 4JI3J 1F5CA 1QAYA 3W5ZA 4PUOB 3EDRB 4Y2MA 2XSJA 1LXNA 1K0VA 3DI6B 2DGWA 2FZCB 2RS8A 3GTYX 4WWSA 1YJNS 3HHEA 2RRNA 4NA2A 1FTCA 3PYGA 1CULB 3R2CJ 3M8SA 1R31A 1LKZA 2IM1A 3N0VA 4HR2A 3TZWA 1BHNA 4BS2A 3R7NB 2YKPA 4QJVA 2K3IA 1NDPA 2MHEA 2HG4A 1Q8KA 3MECB 3C46A 2ZJPQ 4X64J 5GMDA 2WBRA 1MMLA 4NCAA 1NJIT 1KOHA 2CZ9A 2LEBA 4I0WA 1LWEB 5HQ8A 1KP6A 3ET6B 3R6GB 1FVQA 5JMNA 5JVGQ 1U8SA 4DL2A 1NPKA 3IGNA 3TAPA 1URRA 3HD1A 4WE1B 4C0OC 4ANDA 4B9UA 3DRSB 3BSNA 5ADZA 3BYPA 3NOGA 4B3RJ 1YBUA 3D1QA 1CLFA 4LF9F 3C6UA 2FJDB 2Y0SD 2P8IA 1KBRA 4LF8J 1X5OA 3OT9A 4F36A 3KK3B 3T6JA 1GMWD 4DV2J 4CLLA 2P6TA 2QFJA 5KG0A 4KE5A 3PYDA 3SQOP 3TQEA 5T7LA 2M8HA 1QAJA 1VK3A 3KG1A 4DCJB 2H4YB 3IGVA 2HPUA 2AYEA 3GJRB 3L95X 1EKRA 1RWUA 1UPMB 3DGPA 4Q0BB 2UXCF 1AW0A 3HHKA 4DCOB 3J81U 2WVEA 3ZZRA 2BACA 2A0FB 4MMOA 1VHIA 3F44A 1HBOB 2JVRA 3CJ5A 2ZH2A 4OIXA 1RACB 3HVRA 1Q82T 3MD1A 4PXCA 4OZNA 5IT4A 4IDKB 7FD1A 8ATCB 4ZP7A 4LFCJ 1ZTWA 3FQKA 2PA8D 5CYQB 2Z57B 2NSBA 1S48A 1FWKA 4MJKA 2J9DA 2K7KA 5KAKA 4TNOA 4LT6A 4O4RA 4ZPDA 1DRZA 2JL9A 3HLUA 3PR4A 4DHVA 1DAXA 1FERA 3OD2A 2HHTA 1T0TV 3G9CA 3BF4A 4RW9A 1U1QA 3QSYB 2H3EB 3VTIA 3EZUA 3RZAA 1D1UA 1NK6A 1IVZA 1T02A 1KVKA 4IQXA 1N0UA 3AB4B 2YNHB 3UR3C 3RRKA 4XAKA 4KHRA 3KLFA 2R2TA 1VBXA 1QUPA 1U26A 4Q43A 4TY9A 5HN0A 2HHVA 3KJVB 2QSFA 4OYBA 1RT4A 2V67A 5KFPA 5F8HA 3MEGA 2V8PA 3M6UA 4BCAA 4FF3A 1QE1A 3W9JA 1RKJA 5E33A 4PUOA 3LP1A 1SC1B 1WTFA 1SKSA 3DI6A 2GAHC 1UZHA 4WU2A 2C3OA 1RAIB 3W2WB 1O5JA 4CLZA 1SXLA 2HYIB 1CULA 3CD7A 3LPYA 4U67Q 1SQEA 4YY3J 1S0VA 4F50A 5D4LA 3PO5A 1MU2B 3FJ2A 1CSJA 5DQGA 1AUDA 1N5VA 3JSMB 4Z7CA 1OSCA 3TWZA 3ZXWA 4F4AA 3BREA 5A6WA 4XIUA 4JI6J 4NYZA 3MECA 3T5LA 1RTHB 4FPIA 4IH7A 1RHJB 1LK5A 2W01A 1C1CB 1UW9A 1IBKF 5IC6B 1XR5A 3PIOQ 4YR0A 1FT8A 1LWEA 5CYMB 4OLOA 4Z37A 3ET6A 3W65A 4B3OA 3D6HB 4A48A 2V63A 4DL7A 1GFWB 2ZHOA 3C2PA 4WP8A 4M5IA 3BJYA 1R0BG 2G1DA 3I6PA 4O3SA 3Q2SC 5KG1A 4GKKF 4WE1A 3V2UC 1SJFA 4B08A 1HPZB 1GTEA 5KG5A 5IQ6A 4LF6F 3CJRA 1TK8A 4QBUA 4TY8B 4OL8A 1PC5A 3QGIA 1YWXA 2BMBA 4HT7A 1MLAA 3K58A 2XM3A 2EXUA 3BGUA 2DNOA 3F56A 1KKHA 2PT0A 3JS9A 3B78A 5F8GA 5I3PA 4KC5A 2Y9HA 3CW2C 4ZP6A 3TUJC 3UDCA 4DL4A 2FVRA 4C8YA 4ANEA 3OHBA 1FKOA 3IA0A 1DTQB 4CH1A 3ZTOA 1TMMA 4KKOB 2QLWA 2BA9A 1UWAA 1BC6A 3ZTPA 2HNYB 4U7UD 5AXLA 5D0RA 1N34J 3MM5B 1AZSB 3JB9k 2XCAA 3EVWA 4JI1F 3VAIA 2EI5A 5D0GA 1VI7A 4B9TA 1HBOA 1JJCB 4ZJLA 1KNZA 2QA1A 4X4TA 2KDOA 3CJSA 3RR7A 1DURA 2G1HA 3UI3A 4IDKA 2XGQA 1T3NA 2NSCA 2R3VA 1Q8LA 3DHXA 4DSEA 1HHSA 2ZEJA 1REGX 1XBWA 1YZ7A 1XERA 4NEZA 2W4DA 3CDWA 1WC5A 4DV0J 5HMZA 2VC1A 3EICA 4FDFA 4UOHA 3U1LA 5EX3A 1UETA 1Y5IB 2IVFB 3OL9A 1LK7A 3JQJA 2HHWA 4ZVRB 5HL7Q 4GO5X 2U2FA 3MXHP 4YR2A 2CDRB 3AY0A 1U2RA 2CA9A 4NMLA 1DLOA 4WCEQ 2DGVA 1N56A 1S49A 2YNHA 5GAEU 1NJXA 2CNOB 4CO3A 2GV1A 1F9EB 3D66A 4OJHA 3A4TA 4FKXA 4DX7A 3D4JA 3EE3A 2ZFHA 4ZPVR 2C2MB 1WWHA 2V50A 3E01B 3OTDA 3CCES 3NBPB 4TU7A 3JSYA 4OHVA 1V5VA 2VH7A 4ZS6A 4USJC 3BYRA 1HLWA 1GK8A 4C11B 4CM2A 1VBKA 2KJVA 2EG2A 2BJ7A 2MGZA 4J9UE 3W2WA 1S6QB 3G96A 2ASDA 1HHTP 3PIPQ 2OUGA 2GHWA 4J9PA 3R5JB 1S9GB 1TK0A 4N8NA 1MU2A 3OUYB 1YBAA 4WKRA 3IG1B 3JSMA 3MR7A 3C15B 4C8OA 3EJMA 4DN0A 1RTHA 2MB0B 1C1CA 1TL1A 1DHMA 4DV3F 3DLHA 2FHMA 2FQQB 4GKKJ 1BWEA 3OL7A 4PG7A 5CYMA 1JLEA 1U6BA 1RAOA 4DSKA 1SJ3P 3QO9B 2PMHA 4M5LA 1HR0J 5IQQA 1P1LA 2DGQA 4LVOP 4WXOA 2KT3A 4CT8A 2BJ1A 5C24B 2BUNA 4ZVOB 2KM8B 1Q4RA 4HYKA 1HPZA 2AEMA 3HM9A 2CNNB 2SXLA 3AHPA 4O3PA 3BN4A 1HL6A 5LJ3Y 2Q1LA 3ILIA 3AD8C 1FD2A 1U1MA 2B8PA 3S8SA 3FEZA 4WK3A 3EZOA 4TY8A 2ZOGA 2VFSA 4OI3A 5J2MA 3FDSA 1U1KA 5IWAJ 2MZTA 3DLEB 1K0TA 4DLEA 4DX5A 1U6FA 5HO4A 1A6LA 5LMUF 1FX4A 3JQMA 2ZVIA 2W7PA 1S72S 4A47A 4F4XA 4R5PA 2BXJA 4FS1A 4FVCA 2YKQA 3NCQA 2YNFA 4NMXA 1Q8BA 1X9MA 2FGOA 2P2CB 4ELVA 1WDTA 4WIQA 4PYDA 4KSEB 5DGBA 1OO0B 2VFUA 2C42A 2A1BA 3I0SB 2P9EA 3GJTB 5GAGU 4G1QB 4KKOA 3R1LA 3GPAA 4USKA 4I56A 1Y3KA 3GG1A 3TANA 2MXYA 2HNYA 2O5DA 3UCZP 3CCSS 2EKNA 2DRBA 1R0CB 4YQWA 4OX8A 3MM5A 1AZSA 3VALA 1U1LA 5DETA 1ICEB 3US5A 2W24A 3HKZD 4X65J 2RHQB 2YBVA 1IJEB 3LP2B 1DARA 1G6BA 3NLCA 3OTOF 2BQUA 2MJNA 1VBZA 2D3ZA 1NJZA 4NEYA 2CDQA 5LM7E 1WEYA 4DUTA 4KTQA 5AE1A 3DFEA 3DM2B 2GA7A 4PG5A 4UF4A 3CC7S 1H2UX 3CJKB 2ZNYA 3PM9A 3M2UB 1SJRA 2VPWB 3W64A 3I96A 1F60B 3TUIC 1R43A 2XMVA 4FXVA 3CMES 3ZTRA 1WKLA 2VZ9A 1LQ9A 4E0DA 2HWTA 1MWZA 2F4FA 3PX4A 3C6TA 1M5PC 1UJ6A 1XNRF 3GIRA 1TTHB 3KXDA 1FJ7A 2W8KA 2B6AB 3MZIA 1M5SA 4PZVA 4P7VA 3L3CA 5G4DA 2V8GA 3OSPA 3HX9A 2R2SA 1KVIA 1T3OA 1FRLA 4LSZB 2GS8A 4LF4F 4ZIWA 3J80Y 1JLBB 2ERRA 2JHEA 4JYAF 2NR0A 2HURA 2BQ3A 3G8TA 2QLJB 2EG1A 3E01A 3RU0A 1QVGR 2AX0A 3LA0A 3NBPA 2VL1A 1XMOF 4F2SA 2RJZA 4C11A 1NCLA 3G8QA 5HSPA 5F8NA 2CPIA 1UEUA 2OFHX 2NPIA 2M88A 1IJFB 2JWNA 4URSA 3OLAA 2HHHF 3TOQA 1HW9A 3ZNUA 1G2EA 4X4UA 1S1WB 3O1LA 1YJUA 2POKA 3SBMA 4F4KA 3OUYA 4L74A 3GIIA 1S4EA 4CNYA 5C25B 3QMQA 5DQIA 4WXWA 3PFOA 5C2GA 4J37A 2QA2A 5JVHQ 3C15A 2DO4A 4YN3B 1FRKA 2YX7A 2IRXA 1RDRA 1SL0A 2B9EA 1DQ8A 4UT4A 4JB8B 1SB6A 4PYAA 4FYDA 1PJ5A 3EXCX 3TA1A 5JUMA 1S1TB 2GNKA 3QO9A 1RTIA 3ILJA 2VQFJ 2XS2A 4MYUA 4ZOSA 1JXLA 3MI7X 4LVNP 3N01A 2BJEA 5C24A 2CVIA 3JYTB 3KLEB 1S6OA 4YHHF 5H9FK 2IRYA 3KTQA 1YLXA 3EUNA 3CT9A 2XZDB 2MMYA 1VK8A 2RKIB 4Y2IA 3PY8A 2DISA 3IR6B 3VGVA 2GZOA 1Z1ZA 5E3RA 4NXNF 4LBIA 2C22A 2RDIA 1C0UB 2PI4A 2CZVC 3CCTA 3M8PB 1N52B 1NH7A 2V8DA 5KTQA 1KEKA 1B64A 1T11A 3DDKA 1JLCB 5ETVA 2NUHA 3PKMA 3BEGB 4PRFA 1NK9A 2LMIA 3KHGA 3NS7B 3I0SA 4G1QA 3R5DA 2E7VA 3TJAA 2VBYA 3QZ8A 3PJXA 2MKYA 3ZZYA 4DR6J 4IQMA 1S1UB 1VQPS 3Q24A 1FHTA 7FDRA 4EZ6A 4WTYA 1H74A 4H4OA 5L1JA 3LP2A 3MCNA 3MM6A 1IKYA 2EFGA 3VAMA 1YJTA 2XZTB 2H5EA 3GSIA 2ZZMA 3OVAA 6FD1A 2HQGA 2E7XA 3DM2A 4M5DB 1TQLA 3VAHA 4USIA 4NCBA 2OSQA 3PR5B 5D4NA 2KXNB 2RNEA 1SQFA 4ES1A 4DL6A 3B6BA 3FGVA 1RAFB 4ZVGA 2ZWOA 3KUEA 4Y2AA 2KTQA 5AXNA 4ES3A 4ERDA 4LF4J 3N6LA 3HPOA 2NZCA 2B9XA 4NA1A 5LXRA 1GT8A 1HQEB 2E9RX 5B0FA 3IBWA 2YX4A 1WI6A 2O01C 1WHWA 4QW8A 2IRUA 4AT1B 1WC3A 4YB1P 3S1TA 3CMQA 2XGPA 3JSBA 1RSCA 2QLXA 4FF2A 4AL7A 1AUSL 3AOAA 1RP5A 3ADAC 1R8AA 3W1YC 2E44A 2QO3A 4LRFA 3HK2A 4E2FB 3RB0A 5HQLA 4HACB 3QNWB 1LV5A 1TAQA 2D41A 2Y8YA 2DCUB 1BMQB 3V6JA 3BBFA 1UKUA 1MMNA 3HF5A 3MEDB 1X4EA 3TZXA 1KQFB 3A8IA 3LQVA 3B8HA 2LDYA 3SZ2A 1S1WA 1UWBB 3HCXA 5C25A 1BQXA 1X9WA 6AT1B 2RD5C 2VG7B 1CJKB 2Z2YB 5AE3A 4YOEA 4A8SA 1DJ0A 4M5JA 1NUEA 4OYXA 2LP4A 4C9DA 2RRAA 4CLUA 2A18A 3K5MA 1S6PB 3MR3A 1CQNA 1I94F 3T19A 1FRXA 2NYHA 4CO5A 1FXLA 2HFNA 5L39A 3ZZUA 3JYTA 1XNQJ 4H54A 2CPHA 1WOSA 5JJBA 3SFUA 4OX9F 3IN5A 4J9QA 4IUFA 3BQ2A 4PR6A 5GAGI 2RKIA 3J81j 4UOGA 4P71A 3DLKA 4CZCA 3EPGA 3G6XA 1VQ5S 1IUJA 4RPFA 3CJ8A 5F3TA 2FJXA 3HHLB 4XO0A 3CTRA 4UUXA 2FZKB 4TVAB 1C0UA 3TEGA 3HMJG 4MK8A 3M8PA 4PG6A 1AXQA 2CQCA 4DFPA 2KH9A 2VV5A 5H9FJ 1PGZA 1JLCA 2R7WA 2OPPB 3KLIA 2VPZB 2B5JB 2V34A 1NM2A 4YB6A 3G6VA 3MAAB 4YS2A 1U09A 1WDDA 4TN2A 4OFZA 2FDNA 1FXRA 3BS9A 4M5HA 1HWUA 1N5YB 4NZ0A 4O44B 4DUYJ 4RW4B 3N79A 2BRLA 2B43A 3TVZA 4IO9Q 1S1UA 3P8BB 2FJVA 1NDLA 1LWCB 2HW3A 3D3BJ 1RBLA 4DU8A 3BKFA 3P5BP 4ED7A 2J0WA 3LP0B 1A7GE 3CCRS 4K4VA 2CJKA 4EWTA 4M5KA 1FDNA 1SI9A 2WOMB 3OR2A 3BGRB 1HWJA 1N36F 4TXSA 3RB4A 5F3ZA 1M5KC 3NCPA 2VA3A 5IM0B 2OMOA 4F25A 3GP9A 3THPA 6FDRA 1NZAA 2QYGA 1AYEA 4M5DA 4I1TA 4K59A 4RWWA 3MR6A 3KNGA 4I68A 4HEA9 4M95A 4OZLA 5D77A 3R3TA 2ZDOA 3DOKA 2GVDB 2AJ1A 5GAHI 2MHNA 5M2RA 2R7VA 1DTTB 3FEYB 2COLA 4DV4J 4LR8A 4KO0B 4ZCMA 2AF6A 1Q5VA 1HQEA 3H2UB 3TVKA 3UPFA 2YWEA 4JI0F 2FC8A 2EC0A 4FYYB 1VRUB 2X3DA 1E6VB 1KFDA 1VQYA 1JIHA 4RLEA 1IN0A 2XLKA 2DY9A 2W25A 4DXLA 4OZJA 1HBMB 3CIMA 3M1VB 2YKAA 5A0YB 3TQ1A 2U1AA 3O8WA 1K1SA 2DHXA 4DR3F 3IFEA 1KSPA 2UV8G 2CQGA 3TUZC 1L3UA 4DQQA 4HACA 4NL5A 3O3LA 5K8NA 2ZH5A 2HZCA 4OLPA 3Q23A 2V4QA 4PWUA 3M05A 4ECQA 2NZ4A 2AKWB 2FPHX 4P9SA 4I2PB 4N7TA 3KJFB 4GKJJ 1UWBA 2X3GA 3M7VA 2C2DA 2WW8A 3K8WA 4X62F 4DV6J 3QT5A 3DN9A 4CTAB 2VG7A 2HQFA 3TW0A 2ZZTA 1CJKA 1BQNB 1ZM4A 3KWMA 5B08A 2RS2A 2Z2MA 4LF5J 4KY3A 3MPUB 1P1TA 1LW0B 4XDDA 3HVAA 3K5OA 4ZLJA 4P2SA 3TZYA 2WSEC 2IPOB 2IBOA 3EYZA 2QN6B 3SDEB 2Q66A 2XCPA 1VFJA 2QIFA 4U7UK 3DNCA 2DNHA 4KHPF 5KT2A 2BM1A 4KH1B 1C1BA 2P5VA 2XS7A 4GC7A 1ZAWA 2KRBA 4LMZA 4EYHB 1Y3JA 1S97A 3NMRA 5KG4A 2V8VA 2I1RA 3BQ1A 4F0KA 3RUBL 3VWSA 4K4YA 1SL2A 3PJ9A 2N3LA 3HHLA 2V9WA 3BR8A 1H2VZ 2NXUA 1ZA1B 2EEYA 3SXLA 5ETPA 4DF4A 4ED4A 2ZM6F 4K4TA 3BBCA 4CM0A 5K8PA 4E8UA 5A8KB 1VMBA 2JDJA 1D8YA 2M9KA 3W62A 4QWCA 1P6TA 1P27B 5C7PA 2OPPA 3S7RA 2B5JA 1N5TA 4PWDB 1Q5YA 1R0AB 5ITHA 4W98A 4BBYA 2D9PA 3V6DA 5E3AA 3BKUA 1JMTA 1N8RT 2G9OA 3VAKA 2XI2A 1VCTA 2F8MA 4DL0C 3T9NA 1YIJS 1CEZA 3H59A 2AGPA 4O44A 4RW4A 4HDGA 1CC8A 1SC6A 2VODA 1S99A 1NB7A 2K06A 2XC9A 2OEKA 2V2KA 1LWCA 2LQ5A 2VKRA 4ZCLA 4NYOA 1WELA 3A8EA 4B3SJ 4ZK7M 2ZVSA 2WVBA 3LP0A 2BVZA 2KG1A 2WOMA 3BGRA 3AB2B 5AT1B 5M2UA 2FHJA 3MR5A 4J9OA 4DCPB 1TFWA 3NNHA 3JQKA 5IM0A 3F73A 1X4FA 5DM6Q 5L1KA 1DQ9A 1WHYA 1L3SA 2MZ1A 4K50A 5KT3A 4N41A 4WZQA 2M4MA 3JSRA 4CLKA 1G1XA 5KFDA 1LEOA 3R7SB 4FS2A 1N88A 1VLOA 2MQNA 4R25A 3V5RA 2I5JB 2GVDA 2B0GA 2AQ4A 2CQDA 2PEBA 1UA1A 1DTTA 1V6HA 3GCWP 3MTJA 1TL7B 4KO0A 2B3TB 2UUBJ 4K0KF 1VIOA 2OSRA 2HFOA 3V4IA 2GX8A 1T9UA 3EZ5A 3HSZA 4IH6A 1KLMB 3H42A 1VRUA 1E6VA 1W7WA 3D5MA 3DLBA 1WF0A 3G86A 5DZ7A 3PO4A 2F65A 2R8IA 9ATCB 4EGLA 2E1CA 1OYEA 3DCAA 4RUHA 1HBMA 4P2XA 3LWMA 5A0YA 3J7ZT 1KR4A 1FE0A 1R8PA 3I87A 4KPCA 2RHSB 2D74B 2YQ0A 4F8RA 4O3NA 1RCOB 3MOJB 2R8KA 1WSVA 2UXDF 4B9VA 2CXEA 2GW8A 3Q22A 3I82A 2RUGA 4I2PA 2HRYA 1H38A 3OFEA 2H48B 1E6YB 1HNWF 4B17A 1J5OB 5HP1B 4CTAA 3I9V9 3WBZA 3VZHA 4ECWA 3VGSA 2KXHA 3SCJE 1J5EF 3A3NB 1SJ4P 4KHPJ 1LW0A 4PG8A 5KFZA 3P5TL 3T1HJ 3BKTA 4OZ0A 1X4DA 2N82B 4QZVB 3SDEA 4DQIA 2QJ3A 4JI8F 2ZH7A 4IYQA 1FX2A 2CADA 1KC8T 4FN5A 4O0NA 2JC0A 4NZ6A 5DDRC 2K3KA 2E9ZA 2HK2A 2YKOA 4Q7AA 2HKEA 1WG5A 2B4VA 5EUHA 1D0EA 3TAMB 4MKYA 4ZVUB 2OHDA 2RILA 2IDLA 1JLFB 1EHWA 2CPYA 1K1QA 1LNQA 1ZBTA 2HWIA 2JLGA 3C14B 2MEWA 2Z2ZA 5CCMA 3H4BA 1KOOA 2B51A 2YY3A 4DU7A 4IFYB 3H25A 3FSIA 2E5LJ 2VG6B 4C48A 1I5OB 5A8KA 4KGZB 2R7RA 1Q7LB 1N33J 1RT6B 2FHJD 2VQEJ 3CE8A 3CDBA 2MSSA 4PWDA 4HT5A 2IJNA 1R0AA 1H7XA 2RH3A 3B4MA 1BQMB 4USVA 3UD3P 1OJ4A 3P4UB 1T7PA 1RAGB 4ZPBA 2OJ3A 3JTPA 4QWEA 3ENAA 1Z2LA 1S1VB 1JXVA 3GWCA 2OAUA 1VRTB 4WBFA 5GVQA 2OPSA 4DV1J 5RUBA 2GQQA 4CH7A 2FIUA 3EGNA 2R7OA 3R5BA 1YVFA 1PBUA 4FKYA 3UVJB 3BH6B 1Q8IA 4AYBD 1UW4A 2DR7A 1NLKL 2N7CA 4ZVHA 2J0SD 1S12A 1GMVA 4U8VA 3B54A 3BO4A 1CG2A 3M9NB 1XIQA 2HVHA 1KVJA 5LT5A 1XR6A 2DGXA 2UV8A 3TJ9A 2F3JA 2CUYA 2I5JA 1U8WA 4JI2F 4IR1A 3CJ3A 1TL7A 1D9AA 3FMBA 4JV5J 5HMYA 5THWA 1UFWA 4YFUA 4TU9A 3A3OB 3KLHB 3HO1A 1PAUB 3G82B 3L4BC 1KLMA 2NXEA 3CD5A 5KFKA 4H4KA 1MNEA 3RYLA 1R6VA 1MMDA 4WP9A 1ZAVA 1X4HA 2RQ4A 3I4PA 2ZWPA 1RTJB 1B0PA 8RUCA 4OJGA 2MZQA 2FHOB 3H2VE 2XHWA 2A2CA 3A8KA 2ZBIA 2VBWA 4NWBA 4CNZA 3QJJA 3DRRA 4YDXA 4WFBQ 2ZHAA 5ETSA 3C8YA 1S9FA 2WRMA 1HMVB 3T5KA 2CPDA 1RT2A 2PD1A 1C4CA 4WK1A 2WK4A 4L6V3 2CWKA 2HEKA 2LQBA 4HL9A 2H5IB 4KQZA 3BBBA 4J9LA 3HP6A 1SC4B 2V5HG 1VIXA 3FK4A 4HLBA 1J5OA 5HP1A 3KHLA 2H51B 2JEIA 3GONA 1RBOB 4DPXA 2BKNA 1TUVA 4HHJA 1S10A 3I32A 3RB3A 1F5BA 1T03B 1HYSB 1WOPA 3OW2R 4KYZA 2GCFA 2YNIB 3AH6A 4CP5A 3VV2B 2OELA 3I5BA 3BPDA 1MN9A 2DR8A 3A13A 3IWNC 3PHTA 4EI2A 2W4CA 4NXMF 2L9WA 3KLGB 4H4MB 1JLFA 4Y6IA 1TKZB 3KJQB 3PNIA 2ZBCA 1JQGA 3CCJS 3OXGA 5E3CA 2ZH4A 1JJ4A 5ETRA 1Y0HA 2YXLA 2R9LA 4V1Ak 4IFYA 3HFKA 1YTYA 2BKPA 3TRGA 4NRUA 4DR4F 1B7YB 3VAGA 2FD2A 3W2VB 1RT6A 1NHKL 2IVYA 1B4SA 3WC2A 2O67A 3QAUA 4GVBA 3NL0A 5CQGA 3I0RB 2CQ1A 2B4OA 2MKJA 1EX8A 1BQMA 1A9NB 1N54B 2VFRA 4NCGA 2K8GA 2VBZA 2MJUA 4OYMA 2BEFA 4UQGA 4CDIA 1NK5A 2B4PA 3ISND 2BRKA 2PMZD 3K5NA 1RWXB 5I3UB 2R8JA 4C8NA 2NXJA 1VRTA 1HD1A 1X4CA 3Q8PB 3CMAS 3GV8B 1RGVA 1S1XB 3PRBA 5HVFA 1KHWA 2GQCA 3RAXA 4LSNB 4P2FA 4LFBF 4CLYA 2ROPA 2AGOA 4B9LA 3I31A 2WHOA 4DR1J 4HTIA 4M1KA 2J5AA 5HLFB 4DL3A 2F4VJ 2BABA 3NGDA 1HBNB 4FYVB 1NHVA 4CLFA 2IYGA 1OY6A 2XYGB 5DZ6A 5CYJA 3FBCA 4IRCA 2O66A 5E5NA 3HZEA 2ZBPA 2OTJS 5J1EA 2J7KA 4X4PA 4LF7J 1X5PA 2L48A 3TJ8A 2G0IA 3D0HE 2KG0A 3BZQA 2ZJQQ 2UXBF 4QQBA 4RU2A 2DRDA 1QSYA 3SV4A 5KFUA 4ETZA 1YG0A 3G82A 2ATLA 3E3XA 4C0BA 1AT1B 5LMNF 1OY8A 4JI5F 2ZBRA 2B8QA 1F3VA 1IR0A 1NSKL 3BGFA 3CCZA 1RTJA 2D3UA 2R8HA 2WB1D 2QLBB 2XTJP 4PG4A 1N32J 2HGMA 3AQOA 2KU7A 3GU0A 3JAMU 1WNEA 2UUAJ 2ILYA 1HMVA 2W9AA 3OFHA 1HI8A 2M70A 1IBMF 2JOQA 4EMDA 1WF2A 4QPTA 4K4SA 1EB0A 4LF1A 5KFIA 4ATNA 5BYQA 1YJRA 4J7CA 2DHSA 3BDPA 2GQ2A 4UY8T 3Q0AA 3T5JA 1V3SA 3H7HB 5LOQA 3VCDA 3UNGC 1NPPA 2BOAA 2JRSA 3MCSA 2GMHA 3AOBA 4ZDNA 4L3KA 4YEAA 4I2QB 1WC6A
chains in the Genus database with same CATH topology
1XWLA 2OFHX 2ZE2A 4LQ3A 4WF9Q 1HYSA 2NPIA 2XNQA 4WFNQ 5J2MB 2MPUA 3VF0B 3H20A 2J6TA 2MSTA 4NCGB 4C7QA 2M88A 1IJFB 3UFCX 2JWNA 3T6BA 4URSA 2YNIA 3PXGa 3UDLA 2R7QA 3QWPA 1U47A 2KZMA 3OLAA 1L3TA 2E7WA 4KHMA 2HHHF 2L41A 3TOQA 1HW9A 1G2EA 1XK8A 4X4UA 1S1WB 4J9SA 1D9DA 3O1LA 1YJUA 1XR7A 2POKA 3N4WA 5U47A 5BYSA 3FSYA 3I56S 4F4KA 3OUYA 2RU9A 4A8YA 3M6VA 4R5PB 3GIIA 4CNYA 3GB0A 5C25B 4GC6A 3QMQA 4G1IA 5DQIA 1N0VC 2KHDA 3PFOA 4WXWA 2BW2A 3SFGA 5EWFA 2DNQA 4B02A 2YNFB 1S6UA 3ENQA 2QA2A 4J37A 5JVHQ 2YH0A 4OHYA 2IC3B 3HHLC 4MKBA 4K5SA 2DO4A 3MUMP 2FVCA 1FRKA 2YX7A 3IO1A 4QIFA 4IG3B 2DNMA 3GFHA 5IWAF 2IRXA 1RDRA 1SL0A 3M30A 2GJ2A 1B0VA 1DQ8A 3KLGA 4BHQA 1Y7PA 4DF8A 5KFGA 2E29A 1UMJA 1SB6A 4H4MA 4FYDA 2ABYA 3QAEA 1TKZA 5CD4H 1EP4A 3NCRA 5CA5A 3V6KA 2AYGA 3EXCX 4D3HA 3TA1A 2F8HA 3MFIA 4NOHA 1WACA 5JUMA 3P96A 2CJQA 1S1TB 4HH0A 4IKAA 4OI1A 4WFXA 2GNKA 1OPIA 1W25A 2OKQA 3QO9A 1RTIA 1IKXA 4OI4A 5EGYA 3ICLA 3MMCB 5FJ4A 2XS2A 4XPCA 1X9SA 4MYUA 4ZOSA 1JXLA 1P9QC 3MI7X 4F3OA 2CPXA 3J7Z5 2J8AA 3IAM9 2GO9A 3NS5A 2Q3PA 2OPQA 1R8HA 4GMKA 4LVNP 5F9LA 5KFFA 1S7HA 1Q53A 3N01A 5B0AA 4ALZA 2BJEA 2C28A 1NK0A 2ZKTA 1RTDA 3DLGB 5C24A 2KFYA 2O1PA 2CVIA 4FBTA 4QU6A 3JYTB 1UAWA 3KLEB 1S6OA 3M2VA 3W2VA 4YHHF 4IFVB 3UE2A 3QIPB 1B0TA 4IOAQ 3DYAB 2IRYA 1U6ZA 5CHCB 3KTQA 3OFGA 4NX9A 4DR1F 3EPIA 2BE2A 1PSDA 2LXIA 3EUNA 3CT9A 4LSLA 1F0XA 5F9NA 4F4WA 2BBEA 4RX6A 5J1EB 2MMYA 3TI0A 3FRYA 3MMJA 2F4VF 1VK8A 3THTA 2HGLA 1HNVB 2XEXA 5KFHA 2CYYA 4W90B 2RKIB 2IJFA 4Y2IA 4EEYA 1Y5LB 3MEDA 2W7OA 3PY8A 1R7IA 2GO8A 3QIDA 3EXYA 2DISA 2FJBB 2HAIA 3FCHA 3IR6B 3UQSA 1Z1ZA 2LLZA 5D3GA 1VLYA 5E3RA 1C0TB 4I6YA 3EGZA 1QM9A 4NXNF 2DR5A 4DWIA 4IG0A 1Q1KA 4C8MA 4KV8A 3GILA 2C22A 3MFHA 5KFRA 4X65F 1KD1T 2RDIA 2RU3A 1C0UB 2ZH8A 4WFAQ 2PI4A 1WG4A 2CZVC 3CCTA 2DGTA 3M8PB 4LF7F 2L9DA 1N52B 1NH7A 2J0QD 5I3UA 2P6SA 2V8DA 5KTQA 2JX2A 5F8MA 2ALZA 4URGA 4DLGA 4GO7X 3M8QA 3OPKA 1KEKA 4PQAA 5FIIA 1B64A 2FJEB 4M63A 3J81Y 3P3DA 2J6SA 1S1XA 2K1RB 2XO7A 1Y9OA 4ICLB 3GE9A 3MM8B 3DDKA 1JLCB 1S9EB 5L9NA 1FESA 2NUHA 4J9NA 5DLFA 3PKMA 3BEGB 4ILMA 4PRFA 1NK9A 4IO1A 4OV1A 2QMXA 2LMIA 1RI7A 3KHGA 1ZZNA 4LSNA 2AYMA 2CQPA 4WKYA 3I0SA 4N76A 3LAMA 1RISA 4G1QA 3PV8A 4NZ7A 3R5DA 3C6TB 3ZZ0A 4DOZA 1S6PA 1MROB 3FZ2A 4DBQA 1FD8A 4C4WA 3MHYA 2HQIA 2VBYA 2YKMA 5LSRA 3QZ8A 4WIIA 4ZMMA 5HLFA 2FLPA 2XMKA 2CPEA 3PJXA 3GYNA 3QJLA 3VR1A 2RDJA 3SCIE 5F0WA 3ZZYA 4MK7A 3BM7A 2RT3A 4ID5A 3PW2A 1FXDA 1QJHA 1FRIA 3RBDA 1X0FA 2BZ2A 2VFVA 1JLAA 4IQMA 4EUVA 1S1UB 5DM7Q 1KHVA 4DEZA 4DFMA 4X84A 3HVTA 1VQLS 4C2MA 1VQPS 1D8ZA 4WU3A 3Q24A 3MM9B 4DS4A 3ITHA 5A6PA 1N32F 1VQ6S 7FDRA 1FHTA 2QA4G 2NLWA 4O23A 4OZ1A 3G71S 4EZ6A 1VQSA 1HBUB 3QYYA 4WTYA 1YI2S 4H4OA 1TKXB 2J9DE 2DGOA 2Q43A 4AXIA 2VPYB 3CDEA 2UUAF 1XMBA 5L1JA 2ZOFA 3TP2A 3MAHA 2E1AA 3LP2A 3MM6A 5KFSA 4X66F 2V4JB 4XK8C 4Q5VA 2DK2A 1IKYA 1FKAF 3K0JA 3K57A 2EFGA 4F26A 4KB7A 4OX6A 1YJTA 4C0HA 3VAMA 2H5EA 4XPEA 1O8BA 2M5YA 2FVSA 1HQUB 2VPXB 4I7FA 2ZZMA 2LQJA 4ECXA 3OVAA 5HBMB 6FD1A 3H4DA 1M5OC 3DC2A 1HNXF 2D7SA 1CVJA 3ZZPA 3LO3A 2Y1RI 3FFIB 2E7XA 5FLXY 3OR1B 3J7YU 2RRBA 1ZYQA 5KFCA 3DM2A 4M5DB 4Y0FA 1TQLA 4LFAF 4RUCA 3VAHA 3PJWA 3O6QA 5E2QA 3X3UA 4USIA 4Y65A 1NO8A 4NCBA 2OSQA 3I9ZA 1JNRB 4OHWA 5AE2A 5FDLA 1VQOS 3V4MA 1FKPA 3PR5B 2ZE2B 3K7RA 2XMMA 5D4NA 1CC7A 2HGNA 3T1AA 1R6YA 1S77D 4DFJA 2KXNB 2X1AA 2JZ5A 1QUVA 2RNEA 3CJ0A 4USHA 4DR2F 4A46A 3DRPA 4ES1A 4DL6A 1TAUA 2N7YA 5HMXA 5GADU 3FGVA 4ZVGA 2XY6A 3NWGA 3N5BA 2LXUA 4MAKA 4Y2AA 2KTQA 5AXNA 4ES3A 4ERDA 3KKFA 1RT3A 1FJCA 3N6LA 5B0GA 2AGQA 3UW1A 1W2BR 3LWLA 4NLUA 3W3SA 4KFBA 4OZ5A 2VD3A 4ZP9A 3HPOA 5DGAA 2GGPA 2J7WA 1ZZFA 2B9XA 3T3FA 4Q8EA 1RQ0A 3HI9A 2HS0A 5KT7A 1WF1A 5SZTA 4CIOA 4QYRA 1VHFA 1KTVA 4NA1A 4P7TA 4QIEA 2A10A 1N5YA 2R8JA 3L7PA 5LXRA 1GT8A 3D0GE 1HQEB 3PX0A 1HD1A 1SH2A 4RNHA 2E9RX 3MMBB 5B0FA 5C42B 3V6HA 4X4VA 2FC9A 4FF4A 3IBWA 3BB5A 3CDUA 2MQPA 2YX4A 2CQ2A 4OJ1A 3PW4A 1WI6A 4P6QA 3D54A 1NJWA 2DGSA 2O01C 2XMTA 4Y28C 5L9XA 2DT9A 4KAIA 3R5AA 2MYFA 1WHWA 5L8RC 3RW6A 4QW8A 1FDBA 3H5UA 2IRUA 4YB1P 5K5MA 4WFZA 3FVYA 3S1TA 2CKWA 4ECTA 1UVJA 3DLJA 3IRWP 2ZDPA 1RTIB 1UJ4A 2UVWA 1LWFA 3D1HA 2XGPA 1PC4A 3JSBA 1MWYA 2KJWA 4EO6A 4AQYF 3ETOA 2QLXA 3BDEA 3KLVA 3V81B 1RT7A 3M6WA 1K9MT 2UU9F 4FF2A 3CJ2A 3U02A 2YKNB 2ZJRQ 1OS5A 4AL7A 2YWHA 3B4DA 2C2RA 1SL1A 3IRXB 1RP5A 2CJBA 5KFEA 3W7BA 2G13A 1RT5B 2DPIA 2KZZA 1BD6A 1YGYA 3TYTA 3G6ES 1R8AA 3NAIA 4DV5F 2E44A 2ZOMA 2QO3A 4F2RA 4HKQA 3NNAA 2ZHBA 3HK2A 5B0EA 3RB0A 5DDOC 2OPRA 4ZA1A 3JAMY 1LV5A 2JEGA 4PQUA 2EFNA 2VQFF 1TAQA 2D41A 3UCGA 5LJ5Y 2DCUB 2BANA 4AE5A 1WEXA 3DOMA 4HTJA 3V6JA 1ZOTA 2DTJA 1UKUA 1MMNA 3HF5A 4TU8A 2DCLA 3MEDB 1K73T 3CO9A 1X4EA 1SUQB 4DX8H 1H2TZ 3T1YF 3MAQA 2B7BB 1KQFB 2EPIA 3CUNA 3M9OB 2RF2B 2R7XA 3LQVA 3PX6A 2PN6A 4LIRA 1HFEL 2XWXA 4UW2A 3R27A 1UL3A 4U6PA 3B8HA 4KV8B 3H5XA 2CPJA 2LDYA 1HARA 2PO4A 3SZ2A 3RRGA 3OVBA 4FNIA 1S1WA 4RKUC 4EO8A 4DQPA 1UWBB 2VG5B 3CWJA 4I4BA 2KFNA 4NYPA 4F4ZA 5C25A 4A8KA 4V19J 2XLIA 3VQTA 5BR8F 2W9BB 1VQ4S 1BQXA 3D2WA 3HVWA 4DV7F 1X9WA 4NLWA 2RD5C 2IC3A 2VG7B 3E51A 4RW7B 4Q44A 3C66A 4IG3A 5AE3A 4ILLA 4YOEA 1Q78A 3BSCA 5HMWA 3N9UC 4TQRA 2F8EX 4ZPCA 4A8SA 1DJ0A 2C3UA 2XSJB 2V0NA 2OD6A 2X1FA 4C9DA 2RRAA 3K5MA 2A18A 2EK1A 3UCUP 1GX6A 4UUWA 2W8LA 4B9MA 1OIAA 2A2DA 2DNLA 4FBUA 4CT9A 5F8IA 1S6PB 1TR0A 3OTEA 1CQNA 3MR3A 4PKDB 1I94F 2YKMB 4R8UA 1U1PA 2DNNA 3LOUA 2R2UA 3JTNA 1NK7A 1S0NA 3T19A 3FNNA 4YR3A 5L1LA 1FF2A 1FRXA 2PE8A 3SSRA 4CO5A 1LXJA 3K5PA 5A2QY 3Q8QB 1FXLA 4WZMA 2HFNA 5L39A 3M1VA 1KFSA 4CCHA 2J9EA 3CCVS 3ZZUA 2DNRA 2QYCA 1IKWA 2ZD1B 3DLGA 3TNVA 2KI2A 1VBYA 3MEKA 3JYTA 1S0MA 3OVSA 2AP6A 2R7SA 4H54A 2CPHA 4QIWD 3M2RA 4IFVA 3CC2S 5JJBA 4W92B 3SFUA 4JV1A 3DYAA 1X7VA 3K2YA 4OX9F 3RRHA 2IFXA 4DJBA 1LOUA 2OP5A 3IN5A 3BO2A 4OI2A 2E5HA 4C8KA 2KHCA 4J9QA 3IWLA 3G4SS 4IUFA 3BQ2A 4NLGA 4H4OB 5I4MA 4PR6A 5GAGI 2HWHA 2XZWA 1HNVA 3MPVA 5CCLA 3CIZA 2RKIA 3MM6B 4DR5F 1FRMA 4DR6F 4ECSA 2FTRA 4IH5A 2JEJA 2MQOA 1IKYB 2R2RA 3DLKA 4CZCA 3EPGA 2GMJA 3G6XA 2PIIA 1VQ5S 1IUJA 2ASLA 4C97A 3QWUA 4J9KA 2M3DA 2FGCA 5F3TA 1C0TA 1KS2A 1KTQA 1SJ1A 2FJXA 4EZ9A 3HHLB 4BC7A 4XO0A 1UFLA 3CTRA 4UUXA 3P49B 1KN6A 4N5SA 3VAFA 1YJ9S 2CIMA 2VB6A 1R8CA 5GMKa 3ULHA 2BDPA 5DLGA 4DQRA 4K4XA 2XSFA 1C0UA 1FCAA 3HMJG 1F5AA 2DD8S 4MK8A 4DPOA 1SKRA 1QSSA 2LA6A 1GH8A 2AJQA 2CQIA 2EVZA 3M8PA 2DITA 4PG6A 1RA7A 5F8LA 1AXQA 2CQCA 3RW7A 4DFPA 3MGJA 3M9MB 1U48A 5FDLB 4A8WA 1FKPB 2KH9A 2VV5A 5H9FJ 1PGZA 4L72B 4FVMA 1BQNA 3FSXA 4FXDA 4NLSA 1JWWA 4ICLA 1Y4ZB 3MM8A 1JLCA 1S9EA 5E7OB 2M0GB 2R7WA 3VZIA 1VOMA 2OPPB 4DSIA 1MSWD 4ES2A 3AQPA 3KLIA 2VPZB 2B5JB 4DR7F 3HHLD 3Q8SB 2VONA 5F0UA 2JH3A 3OL8A 4YB6A 2KB2A 3ZFVA 3G6VA 1U09A 2HIQA 2NS1B 3N28A 4TN2A 4EFAC 4OFZA 2GGPB 1EETB 4YB5A 1JLGA 3C6UB 2HHSA 2KVIA 2FDNA 4ECRA 4OI0A 2VOPA 2W4PA 2CG4A 3MOZA 1FXRA 3BS9A 2M7SA 3GIMA 4ED1A 4A4JA 5MAOA 1HWUA 2FHKA 1N5YB 4NZ0A 1ZM2A 4RBTA 2ZZNA 1JKHB 1XC9A 4O44B 1FK9B 3PFEA 3FZBA 3D1OA 3LAKA 4RW4B 1U1OA 3N79A 2QZ8A 3TO8A 4K5RA 2BRLA 5KG2A 2B43A 2MKKA 3TVZA 1HNZF 4IO9Q 1S1UA 2Q6BA 3TVYA 5DDQC 2FJVA 2DH9A 4F4YA 1LWCB 2HW3A 5CH7B 2XB2D 5LSLA 1FNMA 5DG7A 4ED0A 2FB0A 5T7LB 3MM9A 4HI1A 4ED7A 1HBUA 2XI3A 3B82A 2J0WA 3N6NA 1TKXA 3FQLA 5DG8A 2VOOA 1LWFB 3LP0B 3AJ1A 1A7GE 3DU6A 1KQKA 3CCRS 4K4VA 1LW2B 2K7JA 4NRTA 4NLVA 4EWTA 2CJKA 1NRKA 3TAQA 4MKAA 2IAJB 2V4JA 4QW9A 1FDNA 5D4PA 2MKIA 1SI9A 1TZ0A 2HS4A 2WOMB 4N56A 3T5HA 3OR2A 4EBCA 1D3WA 3BGRB 4H4KC 1HWJA 5GAHU 3NMAA 4X4OA 4CO0A 1N36F 2B56A 1HQUA 2DJWA 4TXSA 2JFKA 5DRKA 3RB4A 2KRRA 5F3ZA 2IBKA 1M5KC 3NCPA 5HBMA 2VA3A 1GTHA 2XWYA 5IM0B 4F3QA 2OMOA 3QGPA 4F25A 3K8VA 4WJBA 3THPA