5L8RJ

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Lhca1
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5l8rJ00
2WSFJ 2QSIA 4H13B 4OGQB 5KKZC 1Q90D 3C8VA 1ZRTE 2ZT9B 1S5LX 4Y28J 1JB0J 1VF5B 2E74B 2WPVB 5KLIC 2QJYC 4RKUJ 2K9YA 2WSEJ 4H0LB 5L8RJ 2E75B 3LW5J 2QJPC 2QIWA 4H44B 4KT0J 4PV1B 2YIUC 2D2CB 4IL6X 2E76B 4I7ZB 2QJKC 2WSCJ 2FYNC 2O01J
chains in the Genus database with same CATH superfamily
2WSFH 3B5NB 1KZUB 2IDBA 1ZW0A 2Q5UA 3IR9A 1JOCA 1BCCJ 1JCDA 2FYUK 1S9KD 1EXIA 1URQC 1RF0C 5GTHE 1AQ5A 2E76D 2HPCB 3E1IA 4C7RA 4EOTA 3HE4B 2Q1KA 1PL5A 2W27A 1IFDA 2QE7H 2B87B 2ZYAA 3A0BE 4BWNA 1JY3P 5KAIE 1VQOP 2L5GB 5APSA 2OYHC 5KLVG 3H1JG 1FZAA 1QEXA 1K04A 3WUVA 2JO1A 2JR8A 2Q3EA 4R4MA 5KLIC 1SQBG 2Y9YA 3D71A 2WSEJ 3L75G 3CMAP 1FJPA 3AE6C 3E1RA 1AVYA 2M5AB 2QIWA 1JM0A 1XTGB 1L0NK 3H1JE 1PPJE 4GIFA 2Q9IA 2E76B 3B5NA 5AW8B 3BRVB 5BVZA 1VQPP 2FYNC 1DEEG 1LT9A 4IL6H 3L74E 5C39A 1PP9D 1NTZK 1NTKE 4PD4E 1EDLA 2WSFJ 3CCSP 2WPRA 3CPWO 2WSCH 1NAFA 1N73A 1X22A 1VQMP 1RHZB 2JWAA 3FWNA 2WMMA 2OYOA 5KKZC 3V5BA 1L0LD 4L76A 1W2EA 1NKZB 5AW6B 2QA4P 1EZVD 3B8EB 3C8VA 2O01H 2IBZI 3L37A 3FXEA 2LXCB 3P8CD 1BE3J 3C9IA 1X8YA 2I1KA 1GZLA 3F5HA 2WT7B 1NGMB 1AQTA 1SQVE 1L0NJ 2E74B 2HFED 3L71E 4WY4C 5AW7B 3V2RA 1R5SA 2W6AA 1VQKP 1W2BO 4EIJA 1KYOE 2IYPA 4PV1C 4D6TG 1SFCD 2OTLP 2KS1A 1IFMA 1S1CX 1NTKG 3H1HD 2W6BA 3V2PA 2ZXEB 3Q5RA 2A06E 1VQ7P 1IFPA 2B88A 1SS1A 2K1AA 1PFIA 3CL3D 5AW2B 1T2KD 1OFCX 2OTKE 3EQ2A 1T6AA 2PFXA 4BRYB 2E75D 1PGJA 4YPCA 2OTJP 1SFCA 1FAVA 3CXHD 2BCCJ 4AQRD 1HF9A 2JEEA 1M1JA 3CXHH 1KC8Q 3D70A 1S3JA 3LIEA 3PRJA 1Q82Q 1PP9J 3RK3C 1IK9A 3L36A 1Q90D 3L71G 4RJTA 1NTMK 4HJGH 3TF5A 1LGHB 4OH8B 1K9MQ 1MFTA 1BGYJ 1JTHA 1LJ2A 2Q3IA 4A7PA 1RH5B 1CW5A 1SQXE 1S2EA 1GW3A 1H8AA 4IFFA 1N7LA 2BCCE 2ITAA 1AFOA 1H0TA 2WVRA 1KORA 5GTIH 3L73E 4N6JA 2YNYA 1KILE 1RE4A 1ZRTD 3OJAB 1NH4A 1N2DC 1L0ND 2V7QH 5AVSB 1PV3A 1VPCA 5AVZB 1NO4A 3KXDA 2C0XA 4PJ0E 4PD4D 3V2NA 1Q81Q 1OZHA 1WT6A 2OGUA 2W83C 5APVA 2O3JA 5M1BA 1SQPK 2PRRA 1SFCB 4TLFA 2YO3A 3WU2H 3H1KE 4XA4A 4ZMDA 1NHLA 3KZIE 1YJNP 4PV1D 2CPBA 1A02J 1AJYA 3AE8C 1VQLP 1SQVG 1S5LE 3HD7A 4W80A 3V4WA 1JTHB 3NMDA 1ZOYC 3L4FA 1N7SB 1VF5C 3CCUP 3ITKA 2P1JA 2KI7B 2UWJE 5AW5B 2HG5D 2IYOA 1KYOD 3PHLA 5H2FE 4WB4A 1H0TB 1SQPD 3MIWA 1L0LJ 2KXPB 1PPJD 5BU8B 2BASA 2B89A 3A3YB 3BRTB 3N7NA 2I8DA 1YI2P 2WSEH 2Z5IA 2YXQB 1K05A 4H0LB 2I1JA 1GD2E 1KB9H 3A0HE 3QWOC 1KQLA 4U3FE 2O01N 4GKGA 5APTA 1WRGA 1D7MA 2KUBA 2FY8A 2QJYB 1L0LE 2BEZF 2BEQD 3AEDC 3CWBD 4I2LC 4DOJA 5KAFH 2FYNB 1HUCA 1NTMJ 2G3AA 1SQXD 2IBZD 1FS0E 1ZXGA 3Q3DA 3H1HG 2JP3A 1PP9E 3IFMA 1X9VA 3JCUH 3L35A 1NTMD 2XU6A 3L74G 3G3ZA 3CCQP 1S9KE 2K9JA 1GL2C 3CX5H 1JCCA 1SQVJ 4GODA 3H1HJ 3S1KA 2Y0CA 3CX5E 3KYQA 2YKPA 3ABVC 1NAYA 1JY3N 2R32A 3O6QB 3M06A 3TNUA 1DH3A 1LWUA 3M9BA 2KIKA 1SLQA 3MZWB 3P32A 3GF3A 1LTAC 3K5BA 4KHXA 4M3LA 3SWKA 3I56P 1BSHA 1JY2P 1EDJA 2QVAA 2QG4A 2JWDA 3BCCD 2A06D 1H89A 2YKQA 1MUUA 1Q86Q 1KMIZ 2MKVA 2QJPC 1N73C 4PV1B 4IFMA 5KLVE 5KTBA 1KB9I 3GHGB 1VQ9P 2W8ZA 2O1KA 2RMZA 2YO2A 3B4SA 3V2QA 1SQBE 5APXA 3W68A 4PD4I 2Y0DA 2QJKB 4I7ZC 4JBZA 4H44D 2QJPB 1CZQA 2NPSB 1SQQK 1QGKB 4R4LA 1YQ3C 5KLVJ 3M0DC 4MN4C 4UB6H 1GU5A 1DIPA 1NTZJ 1BE3G 1JY3O 2ZFCA 1AVOA 1SQXG 2V4HA 2G8YA 2VRSA 2WZ7A 3G9RA 3PTZA 2KOGA 3SFEC 1LWUB 2Q6QA 3TNUB 3CCEP 3MUDC 4OGQD 4U3FG 2H43A 1NOHA 2AEMA 3SWFA 1SQQE 1URQD 4AUWA 1AA0A 3CI9A 1NKNA 3NTNA 5DJUB 4RKUJ 2Y9ZA 1Q7YQ 1KILB 3KZIH 5KKZB 3WU2E 1SQBK 1URQA 3H1KD 3VMXA 2POHA 3A2AA 2E74D 3H32A 3B71A 3MGNA 1Y47A 1FDMA 2RH0A 3H1KJ 5KLVK 3NFQA 1OW7A 2HODA 2K3RA 2JKVA 3IF4A 3AE2C 1GDTA 2NPSA 1UIXA 3L70J 2QSIA 5B5EE 1M7LA 1KFNA 1FZGA 2FYUG 1BDCA 2FFDC 1OX3A 2XV5A 5KAFE 2CK3H 1T8ZA 3RK2B 2M3BA 5B66E 1M1KQ 3AECC 1DEBA 5AW9B 3CC7P 4GOFA 1LP1A 4C7NB 4OVNF 1ZN5A 2NPSD 1P84I 2R3SA 2WITA 2IZ1A 4I1LA 5KLVD 5B66H 3L70E 1NU1D 1QL1A 4DCKA 1N7SC 3H1IG 3V4QA 3HUSA 3RL0D 1EZVI 5B5EH 1JMMA 3KPEA 3L74D 4L74A 2W6JH 5CJ0A 2GA1A 3H25A 1VDFA 1FZEA 4W7ZA 1LTJB 2ZXXA 3QH9A 1L0LK 2KZJA 2RN0A 3MD0A 1OW6A 3FWLA 3CLQA 1SQBJ 1U7MA 2IPPA 2KNCA 3B5NC 3OA7A 4WY4B 3TGUG 3EFFK 2O01J 5CHXA 1G2CB 2D2CC 3JCUE 3RK3D 3PP5A 1JNMA 1NVOA 1QLED 4JPZB 1P84D 2Y0EA 3EFGA 1NWQA 1L0LG 2E75C 3JSVC 1OVRA 4NPEA 3BASA 3B5ND 3RL0B 2HPCA 3G6EP 3A0HH 3HE4A 1SQPG 3HRNA 1M57D 1S5LX 1OVUA 2B87A 2L91A 3L71J 3M9QA 4GDOA 4PJ0H 4DT0A 1EQ7A 3LIDA 1BCCD 1J1EC 2WPVB 1BGYG 2YMYA 3H1LD 3LW5H 1HTLC 1HVVA 1QL2A 2ZYDA 2P67A 3RL0C 1Z56A 1RE3A 1NTZG 1FZCC 1EDKA 1EZVG 1MV8A 3AEGC 1SQPE 5H2FH 1NTKD 3RK3B 4DJGA 1PGOA 3RL0g 2R3CA 1GK6A 1NTZD 2YIUC 1LTTC 1NTKJ 2D2CB 2M5AA 4XFJA 2WT7A 4I7ZB 1OXZA 3H1JD 1EXJA 3R2PA 1HJ0A 1S5LH 5AW4B 1Y8AA 2R5DA 3RBXA 1MZ9A 3GHGC 4WY4D 3CC2P 2O1JA 4U3FJ 2LR2A 1N73B 3L73G 1SQXK 3MTUE 3U59A 3USSA 1R8EA 1BGYE 1M90Q 3CC4P 2FKWB 4N3YB 3T97A 3AE5C 3TDKA 2E74C 3CX5I 1JB0J 1NTME 1YHQP 1GTWA 3E7KA 1PP9G 3HE5B 3L72G 4EYYQ 1M56D 1YYCA 1KYOH 2YIUB 3I5CA 1KQFB 2A45G 5CMZA 4D6TE 5K5GB 1VQ8P 5GTIE 3TYYA 2K9YA 2NRGA 2B9BA 2P58A 3PLNA 2CPSA 4OGQC 1YITP 3H1LJ 3CX5D 4W7YA 5CJ4A 2N1TB 1RF1B 5KJ7A 1KB9E 2OYHA 1WMKA 2DW3A 2P7JA 3HD7C 2ZJSE 4ZKPA 2QEXP 1N8RQ 3CD6P 2XDJA 3HUSC 4D6TJ 2K37A 3VOPA 1QX8A 2JDIH 5CCHA 4EI2A 1USDA 3P7KA 4IOIH 5APQA 3H1JJ 3WMM0 1SQVK 1U7JA 5AVRB 3CMEP 1KN7A 1Y9BA 1M1JB 5AVWB 1YQ4C 2YMKA 3S9OA 1IO4A 1ZRTE 1HGZA 4NPDA 3L73J 3BCCJ 2C0WA 3CCJP 2OYIC 2KSJA 1Q2NA 2PGDA 2IZ0A 1JMBA 3FXDA 2K88A 3L75E 2P10A 2D2CD 3GLMA 1NTKK 1NTZE 1LTJC 1ZLLA 1PGQA 1MFZA 3TSIA 3GW6A 3L71D 1NJIQ 3KQGA 1T3JA 4JQ0D 4XE5B 3G4SP 2C9LY 2FXOA 1U57A 4IFDK 2M0BA 1L0NE 4YXDC 4Z1MH 1BGYD 1LT9B 1SQQJ 4YTPC 2FBWC 1BSNA 1PPJG 3HTKB 3M9HA 2M8RA 4H0LD 4HKZH 3RK2D 3VMYA 5GTHH 5KJ7C 1JEKA 3G71P 1J2JB 4O9BA 1N7SD 3TK1A 2E5YA 1M1JC 2ZVNB 5BU5A 1L4AD 1YIJP 3AEBC 1OIPA 3KDPB 1L0NG 2H8PD 3Q5PA 1ZP0C 4UB6E 3L75D 3A7OA 2V7QJ 1J1DB 3H1ID 1LTSC 2J59M 4Y28J 3H1IJ 2QM8A 1P84E 1S72P 3R4YA 2IBZG 1J1EB 1IZNB 1N7SA 3P8CE 3CXHE 3GF7A 3A5TA 1JO5A 1BE3E 4JYBA 4RESB 2FYUE 3SWYA 1E5WA 1EZVE 1VQ4P 1YTZI 2XZRA 3F89A 3H1LE 2GUVA 2ZT9D 2KS1B 4QMAA 1VQNP 3EWKA 2KZIA 2N1TC 3S4RA 3ZDMA 3II6A 1JY2N 2WPSA 4H0LC 2WTYA 2N9BA 2R5BA 1OMIA 1RE3C 3HTKA 1FE6A 3L70G 4LC1A 5KAIH 1FZCA 1K8AQ 2N9YB 1RE4C 3JC22 4BRYA 2HLOA 5CBOA 4C46A 2AEJA 2KSEA 2RKLA 2YXRB 1RQUA 2FXPA 4OWFA 2E43A 2IFMA 3VTPC 3CCLP 1H88A 5TJHA 1UIIA 3L72J 3AEAC 5AVVB 1BE3D 1MKMA 4D6TD 1A02F 2WPQA 3TGUE 2C9NY 3AE7C 1BCCG 4EDFA 2ZT9B 3Q1MA 1NU1G 2FXMA 1LTGC 3OAKA 4H13D 4N78D 1T3UA 1VF5B 1G1JA 1LT1A 2MJZA 1YJWP 1L4AC 2OQQA 3O6QA 1TU3F 4TT3H 2Z4EA 1FU1A 4PD4H 4WBAA 2XNXA 1NTMG 1OVVA 2HYNA 4IL6E 3TGUJ 1BCCE 1LNQA 5CCHD 1KB9D 3M0AA 1FZCB 3Q5SA 2BCCG 2H89C 4HH2A 5AVTB 1HH0A 1KILD 2ZYGA 2M3EA 1X0TA 1JY2O 1AV1A 1QVGO 2WQYC 2H7HA 1SQPJ 3HD7B 1RF0A 4H13B 3AE3C 4LGDE 4GOEA 5E79H 2FFDA 1GL2D 3BCCE 3CWBE 2H88C 5CBNA 3A0BH 4ZNCA 2KK7A 2PAJA 2QM7A 3AE4C 2FYUJ 2KYVA 1GMJA 1LWUC 2AEFA 2W90A 3AE1C 5E79E 3UIAA 2N1TD 5APYA 2Z5HA 3W67A 1SQXJ 2E42A 1E79H 1ZR4A 1KFMA 1L2PA 3L74J 1GL2A 1IFJA 3Q2YA 1PGPA 3CWBJ 5L8RJ 2WSSH 3V6IA 2XKMA 2P2UA 3LW5J 1OW8A 4GT1A 4UB8H 4KT0J 1LTIC 4CPGA 1URQB 3BATA 3HD7D 1NYHA 3FX0A 3H32B 4K35A 3TGUD 2QJKC 4U3FD 1RY3A 1HJBA 1LT9C 2FYZA 4YXWH 3MUDA 3AE9C 2J5UA 3GG2A 1VQ5P 5APUA 3O8ZA 2AXTH 1ZR2A 2XNDH 1IC2A 4LLHA 2FFDB 1QVFO 2KB7P 2K9JB 3RK2C 1VF5D 3H1IE 4JF7A 3M0DA 1VQ6P 1KTMA 1KD1Q 5AW3B 4Y99B 1G1IA 1NU1K 4AYCA 3P8MC 2IBZE 1NU1E 1FOSF 2SPZA 3U1CA 4UB8E 3AEFC 1LP1B 4C7NA 2QRXA 3IN6A 1L4AA 1FZFA 1SVFA 2Q7CA 1GL2B 1SQQG 3VP9A 4N78E 3H6PA 3MHVA 2JJLA 3PH0A 5APWA 2FYUD 1KYOI 1ZV8A 3CCMP 1KILC 2E75B 3GHGA 1KQGB 3N4XA 3MP7B 3PJSK 1YJ9P 1GK4A 1LTBC 3CWBG 4WY4A 2E76C 3L75J 4WWIA 5CCGA 5AVYB 2J58A 3U1AA 4HB1A 1M8OB 1G2CA 5AW0B 5AW1B 4DZOA 3RK3E 5TISH 2A45H 1K73Q 4Y99C 3L73D 4OGQB 5CCGD 4KJMA 4RO0A 1SQBD 1EDIA 3BCCG 3CCVP 2IX7C 1GW4A 1CI6A 2AXCA 4HYTB 2NPSC 1DX7A 1L4AB 2LXBA 4BXLA 3H1HE 3SSUA 1BDDA 2ZAEB 3CXHI 1HBWA 3VMAA 5TISE 4L75A 1KILA 1HGVA 1R5LA 2A45I 3RBZA 3WUUA 2ZT9C 2WWWA 3OW2O 3L70D 2KLUA 4I6MC 3NXSA 4ASWA 3C1LA 1T2KC 1ZMEC 2GUSA 3KHUA 3VYIA 1FOSE 2KP8A 1FZBA 2NZ2A 4H44B 1EC5A 1IK7A 1VL2A 1FJKA 1SQQD 2HODB 2LKMA 1SFCC 2PP6A 2R44A 3L72D 1CSBA 3M91A 2OYIB 5DJTB 3I55P 2GM4A 3H1LG 2IFNA 1XTCC 4L73A 3IAOA 1FBMA 3VMZA 1JUNA 2OARA 3D6ZA 3WUTA 3VN0A 3FGAD 5KJ7D 3GMAA 5EFWB 1CI6B 2OYHB 1NU1J 1SQVD 1USEA 4JYCA 1IFNA 3RGUA 3SFDC 3BVHA 1KV4A 4H13C 4B86A 3AEEC 5AVUB 1FDIA 1S4XA 3HUSB 3T97B 1X79B 4U7JA 2ZVOB 1DD3A 2AXTE 1SP4A 5CCHC 4K3AA 1RF1C 3HE5A 1IJDB 2QJYC 1N86A 3L72E 1RQVA 1LTJA 2BCCD 3CCRP 1J1DC 1KQSO 4WVZA 4H44C 4NPFX 1PIXA 3D6YA 4ZKUA 1YBKA 4ASVA 2HR3A 1DD4A 1OWAA 2KNCB 3H1KG 1P84H 2A06G 5AVQB 5AVXB 5KLIB 1HWTC 2OYIA 2YKOA 1W5CE 1FDOA 3VP8A 2N1TA 1IFIA 1YTZT 2E5TA 2KLVA 1PZQA 4IL6X 1GU4A 2WSCJ 1RF1A 5CCGC 1FC2C
chains in the Genus database with same CATH topology
1HJ0A 2G3AA 2IDBA 2WQYC 1EXIA 3Q3DA 2JP3A 4H13B 3AE3C 2E76D 1R8EA 1PL5A 2H88C 3AE5C 2E74C 1JB0J 3ABVC 3AE4C 1GMJA 3AE1C 1K04A 1KQFB 3GF3A 2JO1A 4R4MA 5KLIC 2K9YA 3D71A 2WSEJ 3Q2YA 4OGQC 5L8RJ 3AE6C 1KMIZ 2MKVA 2QJPC 2QIWA 1OW8A 3LW5J 4KT0J 4PV1B 1WMKA 1NYHA 4I7ZB 2E76B 2QJKC 2FYNC 3AE9C 4I7ZC 2J5UA 2WSFJ 4H44D 4R4LA 1YQ3C 5KKZC 1VF5D 1Y9BA 1DIPA 1KTMA 1YQ4C 2YMKA 3C8VA 3S9OA 1ZRTE 2G8YA 3G9RA 3SFEC 3AEFC 1NGMB 4OGQD 2E74B 3IN6A 2P10A 2D2CD 3GLMA 4RKUJ 4PV1C 1S1CX 2E75B 2E74D 1KQGB 3B71A 1U57A 3Q5RA 4YXDC 4Z1MH 4YTPC 2FBWC 1OW7A 2E76C 3AE2C 4H0LD 2E75D 1UIXA 2QSIA 1HF9A 3RK3E 3AEBC 3D70A 4OGQB 3Q5PA 1ZP0C 1Q90D 2V7QJ 3AECC 4Y28J 3R4YA 3GF7A 1KORA 1KILE 2ZT9C 2ZT9D 3H25A 3EWKA 1ZMEC 1PV3A 4H0LC 2NZ2A 4H44B 1IK7A 1OMIA 1OW6A 1VL2A 5M1BA 2O01J 2D2CC 1AJYA 3IAOA 1RQUA 2FXPA 4PV1D 3AE8C 3D6ZA 3FGAD 2E75C 3GMAA 3AEAC 1MKMA 3SFDC 1ZOYC 3AE7C 4H13C 2ZT9B 1S5LX 1VF5C 3AEEC 4H13D 3Q1MA 4GDOA 1FDIA 3T97B 4U7JA 1DD3A 1VF5B 2WPVB 2OQQA 3O6QA 1TU3F 2QJYC 4TT3H 1RQVA 4H44C 1PIXA 1K05A 3AEGC 4H0LB 3D6YA 1DD4A 3Q5SA 2H89C 3RL0g 2YIUC 1FDOA 2D2CB 4XFJA 3AEDC 4IL6X 2BEZF 2BEQD 2WSCJ 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF J;  2QSI A;  4H13 B;  4OGQ B;  5KKZ C;  1Q90 D;  3C8V A;  1ZRT E;  2ZT9 B;  1S5L X;  4Y28 J;  1JB0 J;  1VF5 B;  2E74 B;  2WPV B;  5KLI C;  2QJY C;  4RKU J;  2K9Y A;  2WSE J;  4H0L B;  5L8R J;  2E75 B;  3LW5 J;  2QJP C;  2QIW A;  4H44 B;  4KT0 J;  4PV1 B;  2YIU C;  2D2C B;  4IL6 X;  2E76 B;  4I7Z B;  2QJK C;  2WSC J;  2FYN C;  2O01 J; 
#chains in the Genus database with same CATH topology
 2WSF H;  3B5N B;  1KZU B;  2IDB A;  1ZW0 A;  2Q5U A;  3IR9 A;  1JOC A;  1BCC J;  1JCD A;  2FYU K;  1S9K D;  1EXI A;  1URQ C;  1RF0 C;  5GTH E;  1AQ5 A;  2E76 D;  2HPC B;  3E1I A;  4C7R A;  4EOT A;  3HE4 B;  2Q1K A;  1PL5 A;  2W27 A;  1IFD A;  2QE7 H;  2B87 B;  2ZYA A;  3A0B E;  4BWN A;  1JY3 P;  5KAI E;  1VQO P;  2L5G B;  5APS A;  2OYH C;  5KLV G;  3H1J G;  1FZA A;  1QEX A;  1K04 A;  3WUV A;  2JO1 A;  2JR8 A;  2Q3E A;  4R4M A;  5KLI C;  1SQB G;  2Y9Y A;  3D71 A;  2WSE J;  3L75 G;  3CMA P;  1FJP A;  3AE6 C;  3E1R A;  1AVY A;  2M5A B;  2QIW A;  1JM0 A;  1XTG B;  1L0N K;  3H1J E;  1PPJ E;  4GIF A;  2Q9I A;  2E76 B;  3B5N A;  5AW8 B;  3BRV B;  5BVZ A;  1VQP P;  2FYN C;  1DEE G;  1LT9 A;  4IL6 H;  3L74 E;  5C39 A;  1PP9 D;  1NTZ K;  1NTK E;  4PD4 E;  1EDL A;  2WSF J;  3CCS P;  2WPR A;  3CPW O;  2WSC H;  1NAF A;  1N73 A;  1X22 A;  1VQM P;  1RHZ B;  2JWA A;  3FWN A;  2WMM A;  2OYO A;  5KKZ C;  3V5B A;  1L0L D;  4L76 A;  1W2E A;  1NKZ B;  5AW6 B;  2QA4 P;  1EZV D;  3B8E B;  3C8V A;  2O01 H;  2IBZ I;  3L37 A;  3FXE A;  2LXC B;  3P8C D;  1BE3 J;  3C9I A;  1X8Y A;  2I1K A;  1GZL A;  3F5H A;  2WT7 B;  1NGM B;  1AQT A;  1SQV E;  1L0N J;  2E74 B;  2HFE D;  3L71 E;  4WY4 C;  5AW7 B;  3V2R A;  1R5S A;  2W6A A;  1VQK P;  1W2B O;  4EIJ A;  1KYO E;  2IYP A;  4PV1 C;  4D6T G;  1SFC D;  2OTL P;  2KS1 A;  1IFM A;  1S1C X;  1NTK G;  3H1H D;  2W6B A;  3V2P A;  2ZXE B;  3Q5R A;  2A06 E;  1VQ7 P;  1IFP A;  2B88 A;  1SS1 A;  2K1A A;  1PFI A;  3CL3 D;  5AW2 B;  1T2K D;  1OFC X;  2OTK E;  3EQ2 A;  1T6A A;  2PFX A;  4BRY B;  2E75 D;  1PGJ A;  4YPC A;  2OTJ P;  1SFC A;  1FAV A;  3CXH D;  2BCC J;  4AQR D;  1HF9 A;  2JEE A;  1M1J A;  3CXH H;  1KC8 Q;  3D70 A;  1S3J A;  3LIE A;  3PRJ A;  1Q82 Q;  1PP9 J;  3RK3 C;  1IK9 A;  3L36 A;  1Q90 D;  3L71 G;  4RJT A;  1NTM K;  4HJG H;  3TF5 A;  1LGH B;  4OH8 B;  1K9M Q;  1MFT A;  1BGY J;  1JTH A;  1LJ2 A;  2Q3I A;  4A7P A;  1RH5 B;  1CW5 A;  1SQX E;  1S2E A;  1GW3 A;  1H8A A;  4IFF A;  1N7L A;  2BCC E;  2ITA A;  1AFO A;  1H0T A;  2WVR A;  1KOR A;  5GTI H;  3L73 E;  4N6J A;  2YNY A;  1KIL E;  1RE4 A;  1ZRT D;  3OJA B;  1NH4 A;  1N2D C;  1L0N D;  2V7Q H;  5AVS B;  1PV3 A;  1VPC A;  5AVZ B;  1NO4 A;  3KXD A;  2C0X A;  4PJ0 E;  4PD4 D;  3V2N A;  1Q81 Q;  1OZH A;  1WT6 A;  2OGU A;  2W83 C;  5APV A;  2O3J A;  5M1B A;  1SQP K;  2PRR A;  1SFC B;  4TLF A;  2YO3 A;  3WU2 H;  3H1K E;  4XA4 A;  4ZMD A;  1NHL A;  3KZI E;  1YJN P;  4PV1 D;  2CPB A;  1A02 J;  1AJY A;  3AE8 C;  1VQL P;  1SQV G;  1S5L E;  3HD7 A;  4W80 A;  3V4W A;  1JTH B;  3NMD A;  1ZOY C;  3L4F A;  1N7S B;  1VF5 C;  3CCU P;  3ITK A;  2P1J A;  2KI7 B;  2UWJ E;  5AW5 B;  2HG5 D;  2IYO A;  1KYO D;  3PHL A;  5H2F E;  4WB4 A;  1H0T B;  1SQP D;  3MIW A;  1L0L J;  2KXP B;  1PPJ D;  5BU8 B;  2BAS A;  2B89 A;  3A3Y B;  3BRT B;  3N7N A;  2I8D A;  1YI2 P;  2WSE H;  2Z5I A;  2YXQ B;  1K05 A;  4H0L B;  2I1J A;  1GD2 E;  1KB9 H;  3A0H E;  3QWO C;  1KQL A;  4U3F E;  2O01 N;  4GKG A;  5APT A;  1WRG A;  1D7M A;  2KUB A;  2FY8 A;  2QJY B;  1L0L E;  2BEZ F;  2BEQ D;  3AED C;  3CWB D;  4I2L C;  4DOJ A;  5KAF H;  2FYN B;  1HUC A;  1NTM J;  2G3A A;  1SQX D;  2IBZ D;  1FS0 E;  1ZXG A;  3Q3D A;  3H1H G;  2JP3 A;  1PP9 E;  3IFM A;  1X9V A;  3JCU H;  3L35 A;  1NTM D;  2XU6 A;  3L74 G;  3G3Z A;  3CCQ P;  1S9K E;  2K9J A;  1GL2 C;  3CX5 H;  1JCC A;  1SQV J;  4GOD A;  3H1H J;  3S1K A;  2Y0C A;  3CX5 E;  3KYQ A;  2YKP A;  3ABV C;  1NAY A;  1JY3 N;  2R32 A;  3O6Q B;  3M06 A;  3TNU A;  1DH3 A;  1LWU A;  3M9B A;  2KIK A;  1SLQ A;  3MZW B;  3P32 A;  3GF3 A;  1LTA C;  3K5B A;  4KHX A;  4M3L A;  3SWK A;  3I56 P;  1BSH A;  1JY2 P;  1EDJ A;  2QVA A;  2QG4 A;  2JWD A;  3BCC D;  2A06 D;  1H89 A;  2YKQ A;  1MUU A;  1Q86 Q;  1KMI Z;  2MKV A;  2QJP C;  1N73 C;  4PV1 B;  4IFM A;  5KLV E;  5KTB A;  1KB9 I;  3GHG B;  1VQ9 P;  2W8Z A;  2O1K A;  2RMZ A;  2YO2 A;  3B4S A;  3V2Q A;  1SQB E;  5APX A;  3W68 A;  4PD4 I;  2Y0D A;  2QJK B;  4I7Z C;  4JBZ A;  4H44 D;  2QJP B;  1CZQ A;  2NPS B;  1SQQ K;  1QGK B;  4R4L A;  1YQ3 C;  5KLV J;  3M0D C;  4MN4 C;  4UB6 H;  1GU5 A;  1DIP A;  1NTZ J;  1BE3 G;  1JY3 O;  2ZFC A;  1AVO A;  1SQX G;  2V4H A;  2G8Y A;  2VRS A;  2WZ7 A;  3G9R A;  3PTZ A;  2KOG A;  3SFE C;  1LWU B;  2Q6Q A;  3TNU B;  3CCE P;  3MUD C;  4OGQ D;  4U3F G;  2H43 A;  1NOH A;  2AEM A;  3SWF A;  1SQQ E;  1URQ D;  4AUW A;  1AA0 A;  3CI9 A;  1NKN A;  3NTN A;  5DJU B;  4RKU J;  2Y9Z A;  1Q7Y Q;  1KIL B;  3KZI H;  5KKZ B;  3WU2 E;  1SQB K;  1URQ A;  3H1K D;  3VMX A;  2POH A;  3A2A A;  2E74 D;  3H32 A;  3B71 A;  3MGN A;  1Y47 A;  1FDM A;  2RH0 A;  3H1K J;  5KLV K;  3NFQ A;  1OW7 A;  2HOD A;  2K3R A;  2JKV A;  3IF4 A;  3AE2 C;  1GDT A;  2NPS A;  1UIX A;  3L70 J;  2QSI A;  5B5E E;  1M7L A;  1KFN A;  1FZG A;  2FYU G;  1BDC A;  2FFD C;  1OX3 A;  2XV5 A;  5KAF E;  2CK3 H;  1T8Z A;  3RK2 B;  2M3B A;  5B66 E;  1M1K Q;  3AEC C;  1DEB A;  5AW9 B;  3CC7 P;  4GOF A;  1LP1 A;  4C7N B;  4OVN F;  1ZN5 A;  2NPS D;  1P84 I;  2R3S A;  2WIT A;  2IZ1 A;  4I1L A;  5KLV D;  5B66 H;  3L70 E;  1NU1 D;  1QL1 A;  4DCK A;  1N7S C;  3H1I G;  3V4Q A;  3HUS A;  3RL0 D;  1EZV I;  5B5E H;  1JMM A;  3KPE A;  3L74 D;  4L74 A;  2W6J H;  5CJ0 A;  2GA1 A;  3H25 A;  1VDF A;  1FZE A;  4W7Z A;  1LTJ B;  2ZXX A;  3QH9 A;  1L0L K;  2KZJ A;  2RN0 A;  3MD0 A;  1OW6 A;  3FWL A;  3CLQ A;  1SQB J;  1U7M A;  2IPP A;  2KNC A;  3B5N C;  3OA7 A;  4WY4 B;  3TGU G;  3EFF K;  2O01 J;  5CHX A;  1G2C B;  2D2C C;  3JCU E;  3RK3 D;  3PP5 A;  1JNM A;  1NVO A;  1QLE D;  4JPZ B;  1P84 D;  2Y0E A;  3EFG A;  1NWQ A;  1L0L G;  2E75 C;  3JSV C;  1OVR A;  4NPE A;  3BAS A;  3B5N D;  3RL0 B;  2HPC A;  3G6E P;  3A0H H;  3HE4 A;  1SQP G;  3HRN A;  1M57 D;  1S5L X;  1OVU A;  2B87 A;  2L91 A;  3L71 J;  3M9Q A;  4GDO A;  4PJ0 H;  4DT0 A;  1EQ7 A;  3LID A;  1BCC D;  1J1E C;  2WPV B;  1BGY G;  2YMY A;  3H1L D;  3LW5 H;  1HTL C;  1HVV A;  1QL2 A;  2ZYD A;  2P67 A;  3RL0 C;  1Z56 A;  1RE3 A;  1NTZ G;  1FZC C;  1EDK A;  1EZV G;  1MV8 A;  3AEG C;  1SQP E;  5H2F H;  1NTK D;  3RK3 B;  4DJG A;  1PGO A;  3RL0 g;  2R3C A;  1GK6 A;  1NTZ D;  2YIU C;  1LTT C;  1NTK J;  2D2C B;  2M5A A;  4XFJ A;  2WT7 A;  4I7Z B;  1OXZ A;  3H1J D;  1EXJ A;  3R2P A;  1HJ0 A;  1S5L H;  5AW4 B;  1Y8A A;  2R5D A;  3RBX A;  1MZ9 A;  3GHG C;  4WY4 D;  3CC2 P;  2O1J A;  4U3F J;  2LR2 A;  1N73 B;  3L73 G;  1SQX K;  3MTU E;  3U59 A;  3USS A;  1R8E A;  1BGY E;  1M90 Q;  3CC4 P;  2FKW B;  4N3Y B;  3T97 A;  3AE5 C;  3TDK A;  2E74 C;  3CX5 I;  1JB0 J;  1NTM E;  1YHQ P;  1GTW A;  3E7K A;  1PP9 G;  3HE5 B;  3L72 G;  4EYY Q;  1M56 D;  1YYC A;  1KYO H;  2YIU B;  3I5C A;  1KQF B;  2A45 G;  5CMZ A;  4D6T E;  5K5G B;  1VQ8 P;  5GTI E;  3TYY A;  2K9Y A;  2NRG A;  2B9B A;  2P58 A;  3PLN A;  2CPS A;  4OGQ C;  1YIT P;  3H1L J;  3CX5 D;  4W7Y A;  5CJ4 A;  2N1T B;  1RF1 B;  5KJ7 A;  1KB9 E;  2OYH A;  1WMK A;  2DW3 A;  2P7J A;  3HD7 C;  2ZJS E;  4ZKP A;  2QEX P;  1N8R Q;  3CD6 P;  2XDJ A;  3HUS C;  4D6T J;  2K37 A;  3VOP A;  1QX8 A;  2JDI H;  5CCH A;  4EI2 A;  1USD A;  3P7K A;  4IOI H;  5APQ A;  3H1J J;  3WMM 0;  1SQV K;  1U7J A;  5AVR B;  3CME P;  1KN7 A;  1Y9B A;  1M1J B;  5AVW B;  1YQ4 C;  2YMK A;  3S9O A;  1IO4 A;  1ZRT E;  1HGZ A;  4NPD A;  3L73 J;  3BCC J;  2C0W A;  3CCJ P;  2OYI C;  2KSJ A;  1Q2N A;  2PGD A;  2IZ0 A;  1JMB A;  3FXD A;  2K88 A;  3L75 E;  2P10 A;  2D2C D;  3GLM A;  1NTK K;  1NTZ E;  1LTJ C;  1ZLL A;  1PGQ A;  1MFZ A;  3TSI A;  3GW6 A;  3L71 D;  1NJI Q;  3KQG A;  1T3J A;  4JQ0 D;  4XE5 B;  3G4S P;  2C9L Y;  2FXO A;  1U57 A;  4IFD K;  2M0B A;  1L0N E;  4YXD C;  4Z1M H;  1BGY D;  1LT9 B;  1SQQ J;  4YTP C;  2FBW C;  1BSN A;  1PPJ G;  3HTK B;  3M9H A;  2M8R A;  4H0L D;  4HKZ H;  3RK2 D;  3VMY A;  5GTH H;  5KJ7 C;  1JEK A;  3G71 P;  1J2J B;  4O9B A;  1N7S D;  3TK1 A;  2E5Y A;  1M1J C;  2ZVN B;  5BU5 A;  1L4A D;  1YIJ P;  3AEB C;  1OIP A;  3KDP B;  1L0N G;  2H8P D;  3Q5P A;  1ZP0 C;  4UB6 E;  3L75 D;  3A7O A;  2V7Q J;  1J1D B;  3H1I D;  1LTS C;  2J59 M;  4Y28 J;  3H1I J;  2QM8 A;  1P84 E;  1S72 P;  3R4Y A;  2IBZ G;  1J1E B;  1IZN B;  1N7S A;  3P8C E;  3CXH E;  3GF7 A;  3A5T A;  1JO5 A;  1BE3 E;  4JYB A;  4RES B;  2FYU E;  3SWY A;  1E5W A;  1EZV E;  1VQ4 P;  1YTZ I;  2XZR A;  3F89 A;  3H1L E;  2GUV A;  2ZT9 D;  2KS1 B;  4QMA A;  1VQN P;  3EWK A;  2KZI A;  2N1T C;  3S4R A;  3ZDM A;  3II6 A;  1JY2 N;  2WPS A;  4H0L C;  2WTY A;  2N9B A;  2R5B A;  1OMI A;  1RE3 C;  3HTK A;  1FE6 A;  3L70 G;  4LC1 A;  5KAI H;  1FZC A;  1K8A Q;  2N9Y B;  1RE4 C;  3JC2 2;  4BRY A;  2HLO A;  5CBO A;  4C46 A;  2AEJ A;  2KSE A;  2RKL A;  2YXR B;  1RQU A;  2FXP A;  4OWF A;  2E43 A;  2IFM A;  3VTP C;  3CCL P;  1H88 A;  5TJH A;  1UII A;  3L72 J;  3AEA C;  5AVV B;  1BE3 D;  1MKM A;  4D6T D;  1A02 F;  2WPQ A;  3TGU E;  2C9N Y;  3AE7 C;  1BCC G;  4EDF A;  2ZT9 B;  3Q1M A;  1NU1 G;  2FXM A;  1LTG C;  3OAK A;  4H13 D;  4N78 D;  1T3U A;  1VF5 B;  1G1J A;  1LT1 A;  2MJZ A;  1YJW P;  1L4A C;  2OQQ A;  3O6Q A;  1TU3 F;  4TT3 H;  2Z4E A;  1FU1 A;  4PD4 H;  4WBA A;  2XNX A;  1NTM G;  1OVV A;  2HYN A;  4IL6 E;  3TGU J;  1BCC E;  1LNQ A;  5CCH D;  1KB9 D;  3M0A A;  1FZC B;  3Q5S A;  2BCC G;  2H89 C;  4HH2 A;  5AVT B;  1HH0 A;  1KIL D;  2ZYG A;  2M3E A;  1X0T A;  1JY2 O;  1AV1 A;  1QVG O;  2WQY C;  2H7H A;  1SQP J;  3HD7 B;  1RF0 A;  4H13 B;  3AE3 C;  4LGD E;  4GOE A;  5E79 H;  2FFD A;  1GL2 D;  3BCC E;  3CWB E;  2H88 C;  5CBN A;  3A0B H;  4ZNC A;  2KK7 A;  2PAJ A;  2QM7 A;  3AE4 C;  2FYU J;  2KYV A;  1GMJ A;  1LWU C;  2AEF A;  2W90 A;  3AE1 C;  5E79 E;  3UIA A;  2N1T D;  5APY A;  2Z5H A;  3W67 A;  1SQX J;  2E42 A;  1E79 H;  1ZR4 A;  1KFM A;  1L2P A;  3L74 J;  1GL2 A;  1IFJ A;  3Q2Y A;  1PGP A;  3CWB J;  5L8R J;  2WSS H;  3V6I A;  2XKM A;  2P2U A;  3LW5 J;  1OW8 A;  4GT1 A;  4UB8 H;  4KT0 J;  1LTI C;  4CPG A;  1URQ B;  3BAT A;  3HD7 D;  1NYH A;  3FX0 A;  3H32 B;  4K35 A;  3TGU D;  2QJK C;  4U3F D;  1RY3 A;  1HJB A;  1LT9 C;  2FYZ A;  4YXW H;  3MUD A;  3AE9 C;  2J5U A;  3GG2 A;  1VQ5 P;  5APU A;  3O8Z A;  2AXT H;  1ZR2 A;  2XND H;  1IC2 A;  4LLH A;  2FFD B;  1QVF O;  2KB7 P;  2K9J B;  3RK2 C;  1VF5 D;  3H1I E;  4JF7 A;  3M0D A;  1VQ6 P;  1KTM A;  1KD1 Q;  5AW3 B;  4Y99 B;  1G1I A;  1NU1 K;  4AYC A;  3P8M C;  2IBZ E;  1NU1 E;  1FOS F;  2SPZ A;  3U1C A;  4UB8 E;  3AEF C;  1LP1 B;  4C7N A;  2QRX A;  3IN6 A;  1L4A A;  1FZF A;  1SVF A;  2Q7C A;  1GL2 B;  1SQQ G;  3VP9 A;  4N78 E;  3H6P A;  3MHV A;  2JJL A;  3PH0 A;  5APW A;  2FYU D;  1KYO I;  1ZV8 A;  3CCM P;  1KIL C;  2E75 B;  3GHG A;  1KQG B;  3N4X A;  3MP7 B;  3PJS K;  1YJ9 P;  1GK4 A;  1LTB C;  3CWB G;  4WY4 A;  2E76 C;  3L75 J;  4WWI A;  5CCG A;  5AVY B;  2J58 A;  3U1A A;  4HB1 A;  1M8O B;  1G2C A;  5AW0 B;  5AW1 B;  4DZO A;  3RK3 E;  5TIS H;  2A45 H;  1K73 Q;  4Y99 C;  3L73 D;  4OGQ B;  5CCG D;  4KJM A;  4RO0 A;  1SQB D;  1EDI A;  3BCC G;  3CCV P;  2IX7 C;  1GW4 A;  1CI6 A;  2AXC A;  4HYT B;  2NPS C;  1DX7 A;  1L4A B;  2LXB A;  4BXL A;  3H1H E;  3SSU A;  1BDD A;  2ZAE B;  3CXH I;  1HBW A;  3VMA A;  5TIS E;  4L75 A;  1KIL A;  1HGV A;  1R5L A;  2A45 I;  3RBZ A;  3WUU A;  2ZT9 C;  2WWW A;  3OW2 O;  3L70 D;  2KLU A;  4I6M C;  3NXS A;  4ASW A;  3C1L A;  1T2K C;  1ZME C;  2GUS A;  3KHU A;  3VYI A;  1FOS E;  2KP8 A;  1FZB A;  2NZ2 A;  4H44 B;  1EC5 A;  1IK7 A;  1VL2 A;  1FJK A;  1SQQ D;  2HOD B;  2LKM A;  1SFC C;  2PP6 A;  2R44 A;  3L72 D;  1CSB A;  3M91 A;  2OYI B;  5DJT B;  3I55 P;  2GM4 A;  3H1L G;  2IFN A;  1XTC C;  4L73 A;  3IAO A;  1FBM A;  3VMZ A;  1JUN A;  2OAR A;  3D6Z A;  3WUT A;  3VN0 A;  3FGA D;  5KJ7 D;  3GMA A;  5EFW B;  1CI6 B;  2OYH B;  1NU1 J;  1SQV D;  1USE A;  4JYC A;  1IFN A;  3RGU A;  3SFD C;  3BVH A;  1KV4 A;  4H13 C;  4B86 A;  3AEE C;  5AVU B;  1FDI A;  1S4X A;  3HUS B;  3T97 B;  1X79 B;  4U7J A;  2ZVO B;  1DD3 A;  2AXT E;  1SP4 A;  5CCH C;  4K3A A;  1RF1 C;  3HE5 A;  1IJD B;  2QJY C;  1N86 A;  3L72 E;  1RQV A;  1LTJ A;  2BCC D;  3CCR P;  1J1D C;  1KQS O;  4WVZ A;  4H44 C;  4NPF X;  1PIX A;  3D6Y A;  4ZKU A;  1YBK A;  4ASV A;  2HR3 A;  1DD4 A;  1OWA A;  2KNC B;  3H1K G;  1P84 H;  2A06 G;  5AVQ B;  5AVX B;  5KLI B;  1HWT C;  2OYI A;  2YKO A;  1W5C E;  1FDO A;  3VP8 A;  2N1T A;  1IFI A;  1YTZ T;  2E5T A;  2KLV A;  1PZQ A;  4IL6 X;  1GU4 A;  2WSC J;  1RF1 A;  5CCG C;  1FC2 C; 
#chains in the Genus database with same CATH homology
 1HJ0 A;  2G3A A;  2IDB A;  2WQY C;  1EXI A;  3Q3D A;  2JP3 A;  4H13 B;  3AE3 C;  2E76 D;  1R8E A;  1PL5 A;  2H88 C;  3AE5 C;  2E74 C;  1JB0 J;  3ABV C;  3AE4 C;  1GMJ A;  3AE1 C;  1K04 A;  1KQF B;  3GF3 A;  2JO1 A;  4R4M A;  5KLI C;  2K9Y A;  3D71 A;  2WSE J;  3Q2Y A;  4OGQ C;  5L8R J;  3AE6 C;  1KMI Z;  2MKV A;  2QJP C;  2QIW A;  1OW8 A;  3LW5 J;  4KT0 J;  4PV1 B;  1WMK A;  1NYH A;  4I7Z B;  2E76 B;  2QJK C;  2FYN C;  3AE9 C;  4I7Z C;  2J5U A;  2WSF J;  4H44 D;  4R4L A;  1YQ3 C;  5KKZ C;  1VF5 D;  1Y9B A;  1DIP A;  1KTM A;  1YQ4 C;  2YMK A;  3C8V A;  3S9O A;  1ZRT E;  2G8Y A;  3G9R A;  3SFE C;  3AEF C;  1NGM B;  4OGQ D;  2E74 B;  3IN6 A;  2P10 A;  2D2C D;  3GLM A;  4RKU J;  4PV1 C;  1S1C X;  2E75 B;  2E74 D;  1KQG B;  3B71 A;  1U57 A;  3Q5R A;  4YXD C;  4Z1M H;  4YTP C;  2FBW C;  1OW7 A;  2E76 C;  3AE2 C;  4H0L D;  2E75 D;  1UIX A;  2QSI A;  1HF9 A;  3RK3 E;  3AEB C;  3D70 A;  4OGQ B;  3Q5P A;  1ZP0 C;  1Q90 D;  2V7Q J;  3AEC C;  4Y28 J;  3R4Y A;  3GF7 A;  1KOR A;  1KIL E;  2ZT9 C;  2ZT9 D;  3H25 A;  3EWK A;  1ZME C;  1PV3 A;  4H0L C;  2NZ2 A;  4H44 B;  1IK7 A;  1OMI A;  1OW6 A;  1VL2 A;  5M1B A;  2O01 J;  2D2C C;  1AJY A;  3IAO A;  1RQU A;  2FXP A;  4PV1 D;  3AE8 C;  3D6Z A;  3FGA D;  2E75 C;  3GMA A;  3AEA C;  1MKM A;  3SFD C;  1ZOY C;  3AE7 C;  4H13 C;  2ZT9 B;  1S5L X;  1VF5 C;  3AEE C;  4H13 D;  3Q1M A;  4GDO A;  1FDI A;  3T97 B;  4U7J A;  1DD3 A;  1VF5 B;  2WPV B;  2OQQ A;  3O6Q A;  1TU3 F;  2QJY C;  4TT3 H;  1RQV A;  4H44 C;  1PIX A;  1K05 A;  3AEG C;  4H0L B;  3D6Y A;  1DD4 A;  3Q5S A;  2H89 C;  3RL0 g;  2YIU C;  1FDO A;  2D2C B;  4XFJ A;  3AED C;  4IL6 X;  2BEZ F;  2BEQ D;  2WSC J;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...