5L8RJ

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lhca1
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5l8rJ00
2D2CB 2FYNC 4PV1B 4IL6X 2QIWA 1S5LX 1VF5B 4KT0J 3C8VA 4H13B 5KLIC 2K9YA 4H44B 2WSFJ 2E75B 2E74B 4OGQB 1Q90D 2YIUC 4RKUJ 1JB0J 2O01J 3LW5J 4Y28J 2WPVB 4H0LB 2WSCJ 5L8RJ 2WSEJ 2QJYC 4I7ZB 2E76B 2ZT9B 5KKZC 2QSIA 2QJKC 1ZRTE 2QJPC
chains in the Genus database with same CATH superfamily
2KB7P 1LTBC 1GL2D 2OYIC 3HE5B 2ZXEB 3H1IJ 2RN0A 2YMKA 1OZHA 4CPGA 2E74C 5AW6B 1SQXJ 1NYHA 4BRYB 3L71G 3BASA 2D2CD 3AE5C 3Q2YA 3JSVC 1M7LA 4IL6X 1FZEA 4OVNF 2IYOA 3USSA 3I55P 4TLFA 3G4SP 2QG4A 3A3YB 1KFMA 5KLVG 1DIPA 3F5HA 2AEJA 3H1IE 3KZIH 2JO1A 1PGJA 5KJ7D 1BDDA 1ZR4A 3E7KA 2WVRA 4I7ZB 1U57A 1SQPJ 2GM4A 2AEMA 1E5WA 1VQ8P 5AW1B 1NTKK 3VMYA 3VN0A 1WT6A 2O3JA 1AV1A 2Y9YA 1PIXA 3HD7C 3BCCJ 2K9YA 2K9JB 4OGQD 2K9JA 3U1AA 2JR8A 5K5GB 2HLOA 2M0BA 2QJYC 2Y0CA 2I1JA 2RH0A 3I5CA 2M5AB 2KOGA 3P7KA 1H8AA 2M5AA 2FYNC 1LWUB 2R3SA 5AW2B 1ZOYC 1JY3N 1LWUA 3OJAB 3R2PA 1SQPE 2A06E 1S5LE 3TGUG 3C9IA 1LTJB 3RK3B 1FBMA 2Y0DA 1LTJA 3L71D 3VYIA 1VQPP 2ZYAA 2QJKC 1OVUA 3W68A 3G3ZA 3H1HG 1IFPA 2RKLA 3I56P 2G3AA 1EZVD 4AUWA 1FZBA 3K5BA 3L71J 2OYOA 3L70G 5GTHE 2O01J 2ZVOB 2B89A 3N7NA 2HPCB 4W7YA 3EFGA 3L4FA 1BGYD 3G9RA 4UB6E 1VQ9P 1GW4A 1G1IA 2HG5D 2ZXXA 1PL5A 1NVOA 1QL1A 2GUSA 5KLVJ 1YI2P 1XTCC 1M56D 1DH3A 3M9HA 5CBNA 1FZCB 1FZCA 3M9QA 1T3UA 1N86A 2IBZI 3ZDMA 1L0LD 2KP8A 1MKMA 4I7ZC 1K05A 4W7ZA 3BVHA 3Q5SA 5KLVE 1NO4A 3RK2D 3CC7P 1VF5B 3CC4P 2NZ2A 4H13D 1QX8A 2R5BA 1RQUA 1L0LJ 3H1LG 4WVZA 1CSBA 1LTAC 2JKVA 3P8CD 2O01N 1NU1D 1N7SD 1HBWA 1S5LH 3TGUJ 3CI9A 1CI6B 1LWUC 4NPEA 4MN4C 3Q5RA 3L75E 1CI6A 4EIJA 4DCKA 3H1HJ 1LTJC 3RK3C 1ZRTD 2QA4P 1P84D 2KIKA 1WRGA 1ZLLA 2BEQD 2H89C 3L37A 1KYOE 1IK9A 2E42A 2W27A 3H32B 5GTHH 1SQQK 4JBZA 3H32A 1JOCA 1EC5A 4LLHA 1IFDA 2OGUA 1L0NK 1RE3A 3TGUE 1T2KC 3VP8A 1HF9A 1TU3F 3KYQA 1QLED 3EFFK 3QWOC 1GW3A 1KN7A 3H1HE 1J2JB 3CWBD 4I1LA 2ZYDA 5DJTB 4D6TE 1NTMK 4JPZB 3L70E 2ZT9B 3PJSK 1VQKP 3Q1MA 1L0ND 4O9BA 3P32A 3H1JG 5CCHA 1ZXGA 3V4WA 4C7RA 1BCCE 3CXHE 1FZCC 1EXIA 2FFDC 3CMAP 3JCUE 3S4RA 4Y99B 1Q82Q 3A0HE 1OFCX 2K88A 1NWQA 2XNDH 1LTSC 2WSEH 1BDCA 1EQ7A 1SQVK 3H1LJ 3SFEC 4U3FD 4KT0J 1VF5C 1SVFA 3KQGA 5AW4B 2ITAA 4N6JA 2XZRA 1Q90D 1USEA 2QM8A 4GOFA 1OMIA 1BSHA 3RGUA 2R32A 1SQVD 2CPBA 3PHLA 5CBOA 2M3BA 5APYA 2IFNA 2QVAA 2HR3A 1FJKA 3PH0A 3H1LE 2W8ZA 1K73Q 2HFED 2L91A 3HE4B 3HE4A 1R5SA 1RE3C 1NTZD 4KJMA 1VQMP 3D70A 4YXWH 3H25A 1Q86Q 1AVOA 1W2EA 1PPJG 1S2EA 2RMZA 3CCUP 1NTZJ 3CCQP 3RL0D 4IFMA 1JEKA 1PGQA 1J1EB 3OAKA 1SQBE 1HUCA 3FXDA 1H89A 3CXHH 1IZNB 2ZT9C 3MGNA 2FXMA 3B5NB 1PGOA 2B9BA 3B5NA 1S5LX 1HGZA 1ZP0C 3LIEA 3A0HH 4OWFA 1LT1A 4DT0A 1ZR2A 4Y99C 3GF7A 3SWFA 2FYUG 4ZKPA 5KTBA 4GDOA 3IR9A 1HVVA 3AE1C 4R4LA 1W2BO 5B5EE 2W6AA 2Q9IA 3H1JE 3KZIE 2JWDA 1FOSE 1LTGC 3CX5I 3EWKA 4PD4E 3GLMA 2QEXP 3A7OA 1JY3O 2AEFA 3SSUA 3PTZA 1KORA 2Q3EA 5AW3B 3PP5A 4GKGA 2A06G 1YYCA 1KQSO 3HD7A 1GD2E 3GG2A 3H1KE 2J5UA 1SQXK 1RQVA 3L35A 1IC2A 1H88A 4HB1A 3WUUA 1QGKB 2A45I 1KB9I 3LIDA 2KLVA 3KXDA 3AE3C 2XU6A 3H1ID 1S1CX 3FXEA 2QSIA 3L72G 3AE7C 3AEGC 3G71P 3KDPB 4H44B 3HE5A 1IFNA 3M06A 3IAOA 4EOTA 5KKZB 1J1EC 1L2PA 2IZ1A 1YJNP 2GUVA 4BRYA 1PV3A 3V5BA 1MV8A 3B5NC 1NTKG 2Q1KA 1JY2N 1MFTA 2FYUJ 3V2NA 1PPJE 1S4XA 3L74G 1G1JA 1YTZT 2E5TA 3CD6P 1ZN5A 1FJPA 2QJPB 4YPCA 5B5EH 5TISE 1AQTA 1PP9G 4ASVA 1QVGO 2J58A 1SQPD 1GDTA 3TNUB 4PD4H 4LGDE 2YXRB 3AEEC 3BCCD 3V2QA 2BCCG 3VP9A 1EDIA 2FYUE 3WUTA 1GL2B 2P10A 3L75G 1HH0A 3VMAA 2K3RA 2KZIA 2P67A 5CHXA 3P8MC 1T2KD 3EQ2A 2VRSA 4EDFA 2C0XA 1URQD 4PV1C 3IFMA 4EI2A 4ZKUA 2P1JA 4JF7A 5AVXB 1VL2A 1YJWP 3L72J 3RBZA 3JC22 1S72P 2H43A 4L74A 3RK3E 2KK7A 2QRXA 2IDBA 2DW3A 2Y0EA 1LP1B 4L73A 5KJ7A 4D6TG 3CC2P 4H44C 2PAJA 1IFIA 1EZVI 1VDFA 1NTKJ 5KLVD 5KKZC 3PRJA 3VMXA 1BCCG 2HPCA 3L72E 2FY8A 2JDIH 3L74J 2MKVA 4IFDK 3W67A 5TISH 3AE6C 2OTJP 4H0LD 1L0LK 2QE7H 2WSEJ 1PP9J 2WWWA 3KHUA 4ASWA 1FAVA 2QJPC 4BXLA 3L75D 3O8ZA 1IK7A 2FFDB 1IJDB 1T6AA 2R44A 1NTKE 2FFDA 3G6EP 2LXCB 2BCCJ 2KXPB 1HTLC 4Y28J 1NKNA 2E43A 3L75J 1KYOD 2WSCH 1NU1K 3L74E 5AVTB 1KYOI 1D7MA 1W5CE 1GL2C 3L36A 1EDKA 1SQQG 1PP9E 1VQ4P 3E1RA 2W6BA 2FKWB 1KFNA 4EYYQ 2OYHB 4DOJA 3A2AA 3TGUD 2WPQA 5AVYB 2OYHA 1ZMEC 2R3CA 4K3AA 4GODA 2Q3IA 3H1HD 2POHA 2BCCE 1IFMA 3QH9A 1S9KE 4WY4B 2ZVNB 1YQ3C 4HH2A 4WY4A 2E5YA 1LJ2A 3L70D 1RF1B 1NTMG 2KS1B 1RF1A 1LT9C 3LW5H 2ZT9D 2KS1A 5CCHD 4C46A 3CXHD 3VTPC 4RO0A 2FYZA 4D6TJ 1P84I 3R4YA 1YITP 2KSEA 3L70J 3UIAA 2KSJA 5KJ7C 1SQBG 2IBZE 2KI7B 1BCCJ 5CMZA 5AW5B 1IFJA 3IN6A 1N2DC 2IX7C 1BE3G 3RK2B 3N4XA 1X0TA 4TT3H 2MJZA 1FZAA 5M1BA 1N7LA 5CCGA 4L76A 1OW7A 3BRVB 1JMMA 2XKMA 2B87B 3B71A 3V2RA 2Q5UA 2B87A 2E76D 4R4MA 3MD0A 2WSSH 3NFQA 1T8ZA 3CCVP 1DD4A 1N7SB 3AE4C 1NOHA 1N7SA 5APXA 1JMBA 2E75D 3VMZA 3H1LD 1RE4A 3WU2E 1LTIC 3VOPA 5AVWB 1NKZB 1SQQJ 1M8OB 2KYVA 2YXQB 1SS1A 2LXBA 3ABVC 2CK3H 3H1KG 4XA4A 3SWYA 2C9NY 2BEZF 3FX0A 3E1IA 3L73G 2OYHC 1K9MQ 1S3JA 3Q3DA 4UB8E 1PZQA 3SWKA 2YNYA 4L75A 2SPZA 1M1JB 3D6ZA 1JY3P 1KILB 1FE6A 4WY4C 4AYCA 1M1JA 1KILA 1KILE 2E74D 1SQQE 1SQBD 2W6JH 1RF1C 3S9OA 1NTZK 5TJHA 3CCMP 3B5ND 3FWLA 4DJGA 3O6QB 1SQBJ 2JWAA 3O6QA 1JB0J 2WPVB 2NPSB 2HYNA 4ZMDA 1VQNP 1BE3J 1JY2O 2NPSA 2WITA 3II6A 1KMIZ 2YO3A 1NTME 3H1JD 4KHXA 4DZOA 3RK2C 5CCGC 4H13C 1N73B 1OW8A 4U3FE 1QL2A 2LKMA 1N73A 3AEAC 4PD4D 2WSFH 2Y9ZA 3OW2O 1UIXA 1YBKA 1DX7A 3H1JJ 2A45G 1X8YA 3ITKA 1VQ6P 5AVSB 1N7SC 4B86A 3HD7D 3WU2H 1BE3E 2YIUB 1RE4C 4GT1A 4BWNA 1OVVA 3RL0g 1SQXG 1U7MA 3H1KJ 1Z56A 3CL3D 2QIWA 2FXPA 4HJGH 1BSNA 4UB8H 1ZW0A 1FDMA 2V7QH 1GU4A 4AQRD 1YHQP 3AE8C 1UIIA 1HWTC 1JCCA 1FDOA 1M1JC 1KILC 4WBAA 3TSIA 3RL0B 1FZGA 1A02J 4NPDA 3M0DC 2N1TB 3M0AA 4WB4A 2Z5HA 2N1TA 3L73E 3H6PA 2NRGA 4PV1B 2KNCB 2WZ7A 1J1DB 3M9BA 3AE9C 2KNCA 1PPJD 1DD3A 5C39A 2AXTH 1ZV8A 3KPEA 2NPSC 2G8YA 5AW0B 1JNMA 4LC1A 3D6YA 1N73C 5AVVB 3MHVA 1RH5B 3CX5E 2FYUD 2JJLA 2YKOA 4YXDC 3NXSA 4NPFX 1AA0A 3SFDC 5E79E 3TYYA 1FOSF 5KAIH 1SQPK 4N78E 1R5LA 5DJUB 2YKPA 4C7NB 4C7NA 2YIUC 1PFIA 2O1KA 4RKUJ 3Q5PA 2PP6A 2WSCJ 4ZNCA 2AXCA 3TF5A 1OX3A 2LR2A 1SFCB 3NTNA 1E79H 4I6MC 1KB9E 1EZVG 2A06D 3GHGB 1SFCA 1L4AB 1M90Q 3TNUA 3GHGA 1LTTC 1L4AA 1FS0E 3RK3D 5APWA 3MTUE 1BGYG 2Z5IA 2WTYA 1SP4A 1SQXE 2J59M 1GL2A 3U59A 3OA7A 1MZ9A 2B88A 3RL0C 3LW5J 4M3LA 1KC8Q 1A02F 2N1TC 2R5DA 1YQ4C 5BU5A 5APSA 3L72D 3B4SA 2D2CB 3HRNA 2WPRA 5CJ4A 3TDKA 3HUSB 1J1DC 2IBZG 3HUSA 3AECC 3AEFC 2I1KA 5H2FE 2C0WA 1LT9B 5KLVK 1L0LG 1Q7YQ 1FC2C 1LT9A 2UWJE 1NTKD 3MZWB 3CX5H 1G2CB 1LP1A 1OIPA 1G2CA 5E79H 3L74D 5AVRB 2JEEA 1Y8AA 3BCCE 1GMJA 4N3YB 3CCJP 1R8EA 1OXZA 1NU1G 1LNQA 1K04A 1PP9D 1KQGB 5AW8B 1VF5D 3D71A 2I8DA 4OGQB 1YTZI 2PFXA 5APUA 5AW7B 4IOIH 2A45H 1CZQA 1KB9H 2BCCD 1S9KD 1URQB 1URQA 4WY4D 1JO5A 2IYPA 1SFCC 1KQFB 5BU8B 1VQLP 3GHGC 4OH8B 1L4AC 1BGYJ 2WT7B 3M91A 3A0BE 2WT7A 1KZUB 3L71E 2O1JA 3V4QA 2IFMA 3CWBG 4JYBA 2IBZD 5AVQB 1EZVE 5KAFE 1M1KQ 1L0NG 2W83C 5GTIE 3B8EB 1BGYE 2D2CC 5CCGD 2IZ0A 2Z4EA 5B66E 5H2FH 3HUSC 2XNXA 1GK4A 4D6TD 1KD1Q 1VPCA 4I2LC 4H0LB 2P2UA 1AVYA 4YTPC 1YJ9P 2Q7CA 2FBWC 2OTLP 1Q2NA 1BCCD 1X79B 4U3FG 4HYTB 3CXHI 2WSFJ 1YIJP 4IL6E 1HJ0A 3MUDA 3NMDA 5AVZB 1NU1J 2P7JA 1T3JA 1GZLA 1L0LE 1JY2P 2HODB 2KLUA 1JM0A 1SQVG 4H13B 5BVZA 1JCDA 2HODA 1QEXA 3F89A 4XFJA 1AFOA 4UB6H 1JTHB 2OARA 1NHLA 4OGQC 2PRRA 1JTHA 3MP7B 5EFWB 3A5TA 2YO2A 1URQC 1M57D 1SLQA 1KILD 3P8CE 3U1CA 1NU1E 1Y47A 1SQQD 3A0BH 4PJ0E 2JP3A 1CW5A 1WMKA 2V7QJ 1HJBA 3WUVA 1NTZG 2O01H 1VQ5P 2K1AA 3C1LA 1ZRTE 3CWBJ 1P84E 1U7JA 1FDIA 5KAFH 1XTGB 3FGAD 1MFZA 1SQBK 2L5GB 2M3EA 1L0NJ 2NPSD 1LGHB 5GTIH 3CPWO 4HKZH 1NTMD 3T97B 2KUBA 2ZFCA 3T97A 5B66H 1HGVA 2H7HA 1K8AQ 3PLNA 1GK6A 3AE2C 1NTMJ 4WWIA 1DEBA 3CWBE 4IFFA 4RESB 1RF0A 4H0LC 3M0DA 2E76B 4U3FJ 2N9BA 3MIWA 3FWNA 1BE3D 4IL6H 1L0NE 1KQLA 2W90A 4QMAA 1USDA 2YMYA 2WMMA 2E75B 1X22A 3MUDC 4W80A 4JYCA 1KYOH 1SQVJ 1Y9BA 1JUNA 2AXTE 1GU5A 3V6IA 5KLIB 3CCLP 1GTWA 1RHZB 2XV5A 2P58A 2KZJA 3V2PA 4PD4I 5AVUB 5AW9B 2GA1A 2OYIB 4PJ0H 2C9LY 4GOEA 2OYIA 2M8RA 2CPSA 3C8VA 1KV4A 3H1KD 1EXJA 1VQ7P 1KTMA 4XE5B 2E74B 4A7PA 2WPSA 5KAIE 1SQVE 3CCRP 3L73D 3H1IG 4K35A 1FU1A 2N1TD 1P84H 5CJ0A 2Q6QA 3CLQA 5CCHC 3JCUH 3BATA 4PV1D 4GIFA 1X9VA 1NAFA 3BRTB 3L73J 1OWAA 3TK1A 2QM7A 3RBXA 1N8RQ 1DEEG 3WMM0 4RJTA 2BASA 1NTZE 1OW6A 4JQ0D 3CCSP 1NJIQ 4Z1MH 2PGDA 3AEDC 2ZJSE 4H44D 1RY3A 1AQ5A 3CX5D 2ZAEB 2FXOA 3GF3A 3CCEP 1RF0C 2IPPA 1NH4A 1AJYA 1OVRA 2E76C 5APVA 4N78D 2K37A 3AEBC 1PGPA 1NGMB 2OTKE 2ZYGA 1SQPG 3HD7B 5APTA 1VQOP 1EDJA 1MUUA 2YKQA 2H88C 2E75C 3BCCG 2H8PD 2FYUK 2QJYB 1H0TB 1QVFO 2XDJA 3IF4A 1H0TA 1KB9D 2FYNB 3HTKB 1NAYA 1FZFA 1SFCD 3HTKA 4U7JA 5APQA 2N9YB 3GW6A 5KLIC 3GMAA 1L4AD 2WQYC 2OQQA 5L8RJ 3CMEP 1EDLA 2V4HA 2QJKB 1IO4A 1Q81Q 3S1KA 1SQXD
chains in the Genus database with same CATH topology
2FYNC 3H25A 2P10A 1K04A 4PV1D 1IK7A 1KQGB 1VF5B 2NZ2A 4TT3H 1VF5D 4H13D 1FDOA 1ZOYC 1EXIA 3D71A 5M1BA 2WSFJ 3AE2C 3O6QA 1RQUA 2YMKA 4OGQB 1OW7A 2E74C 1JB0J 1HJ0A 3AE3C 4Y28J 2WPVB 3B71A 1NYHA 1S1CX 4H0LC 2E76B 2E76D 1KMIZ 2QSIA 4R4MA 2ZT9C 2QJKC 2D2CD 1DD4A 1OW6A 3AE5C 3AE4C 3Q2YA 3AE7C 4PV1B 4IL6X 1S5LX 2G3AA 4PV1C 4Z1MH 3AEGC 3SFEC 1ZP0C 4KT0J 4H13B 1VF5C 3AEDC 4H13C 1KQFB 3AE9C 3Q5RA 4H44B 4H44D 1OW8A 1VL2A 2E75B 4XFJA 2E75D 1Q90D 3IAOA 3AEAC 3GF3A 3LW5J 2O01J 4OGQC 1DD3A 3GF7A 1ZMEC 1AJYA 1UIXA 1YQ4C 1DIPA 3RK3E 2G8YA 4GDOA 2BEQD 1Y9BA 2E76C 3G9RA 2H89C 1PV3A 1OMIA 3AE1C 4R4LA 2D2CB 2JO1A 3AEBC 1NGMB 3D6YA 2IDBA 1PL5A 3ABVC 1YQ3C 4H44C 2JP3A 2BEZF 2H88C 3AECC 3AEFC 2E75C 1WMKA 2V7QJ 3EWKA 3GLMA 4I7ZB 2ZT9D 1U57A 5KKZC 4YXDC 3Q3DA 3RL0g 3SFDC 1ZRTE 1HF9A 1TU3F 1KORA 3R4YA 2D2CC 2QIWA 4U7JA 3D6ZA 1FDIA 3C8VA 1PIXA 5KLIC 2FXPA 2K9YA 3FGAD 2MKVA 3GMAA 1EXJA 1KILE 1KTMA 4OGQD 2E74B 2YIUC 2WQYC 2E74D 4RKUJ 3Q5PA 3AEEC 3S9OA 4H0LB 2WSCJ 3AE6C 2OQQA 4H0LD 5L8RJ 2J5UA 2WSEJ 2QJYC 4YTPC 2ZT9B 3T97B 1MKMA 1GMJA 4I7ZC 1RQVA 1R8EA 3Q1MA 1K05A 2FBWC 3Q5SA 3D70A 3IN6A 2QJPC 3AE8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C B;  2FYN C;  4PV1 B;  4IL6 X;  2QIW A;  1S5L X;  1VF5 B;  4KT0 J;  3C8V A;  4H13 B;  5KLI C;  2K9Y A;  4H44 B;  2WSF J;  2E75 B;  2E74 B;  4OGQ B;  1Q90 D;  2YIU C;  4RKU J;  1JB0 J;  2O01 J;  3LW5 J;  4Y28 J;  2WPV B;  4H0L B;  2WSC J;  5L8R J;  2WSE J;  2QJY C;  4I7Z B;  2E76 B;  2ZT9 B;  5KKZ C;  2QSI A;  2QJK C;  1ZRT E;  2QJP C; 
#chains in the Genus database with same CATH topology
 2KB7 P;  1LTB C;  1GL2 D;  2OYI C;  3HE5 B;  2ZXE B;  3H1I J;  2RN0 A;  2YMK A;  1OZH A;  4CPG A;  2E74 C;  5AW6 B;  1SQX J;  1NYH A;  4BRY B;  3L71 G;  3BAS A;  2D2C D;  3AE5 C;  3Q2Y A;  3JSV C;  1M7L A;  4IL6 X;  1FZE A;  4OVN F;  2IYO A;  3USS A;  3I55 P;  4TLF A;  3G4S P;  2QG4 A;  3A3Y B;  1KFM A;  5KLV G;  1DIP A;  3F5H A;  2AEJ A;  3H1I E;  3KZI H;  2JO1 A;  1PGJ A;  5KJ7 D;  1BDD A;  1ZR4 A;  3E7K A;  2WVR A;  4I7Z B;  1U57 A;  1SQP J;  2GM4 A;  2AEM A;  1E5W A;  1VQ8 P;  5AW1 B;  1NTK K;  3VMY A;  3VN0 A;  1WT6 A;  2O3J A;  1AV1 A;  2Y9Y A;  1PIX A;  3HD7 C;  3BCC J;  2K9Y A;  2K9J B;  4OGQ D;  2K9J A;  3U1A A;  2JR8 A;  5K5G B;  2HLO A;  2M0B A;  2QJY C;  2Y0C A;  2I1J A;  2RH0 A;  3I5C A;  2M5A B;  2KOG A;  3P7K A;  1H8A A;  2M5A A;  2FYN C;  1LWU B;  2R3S A;  5AW2 B;  1ZOY C;  1JY3 N;  1LWU A;  3OJA B;  3R2P A;  1SQP E;  2A06 E;  1S5L E;  3TGU G;  3C9I A;  1LTJ B;  3RK3 B;  1FBM A;  2Y0D A;  1LTJ A;  3L71 D;  3VYI A;  1VQP P;  2ZYA A;  2QJK C;  1OVU A;  3W68 A;  3G3Z A;  3H1H G;  1IFP A;  2RKL A;  3I56 P;  2G3A A;  1EZV D;  4AUW A;  1FZB A;  3K5B A;  3L71 J;  2OYO A;  3L70 G;  5GTH E;  2O01 J;  2ZVO B;  2B89 A;  3N7N A;  2HPC B;  4W7Y A;  3EFG A;  3L4F A;  1BGY D;  3G9R A;  4UB6 E;  1VQ9 P;  1GW4 A;  1G1I A;  2HG5 D;  2ZXX A;  1PL5 A;  1NVO A;  1QL1 A;  2GUS A;  5KLV J;  1YI2 P;  1XTC C;  1M56 D;  1DH3 A;  3M9H A;  5CBN A;  1FZC B;  1FZC A;  3M9Q A;  1T3U A;  1N86 A;  2IBZ I;  3ZDM A;  1L0L D;  2KP8 A;  1MKM A;  4I7Z C;  1K05 A;  4W7Z A;  3BVH A;  3Q5S A;  5KLV E;  1NO4 A;  3RK2 D;  3CC7 P;  1VF5 B;  3CC4 P;  2NZ2 A;  4H13 D;  1QX8 A;  2R5B A;  1RQU A;  1L0L J;  3H1L G;  4WVZ A;  1CSB A;  1LTA C;  2JKV A;  3P8C D;  2O01 N;  1NU1 D;  1N7S D;  1HBW A;  1S5L H;  3TGU J;  3CI9 A;  1CI6 B;  1LWU C;  4NPE A;  4MN4 C;  3Q5R A;  3L75 E;  1CI6 A;  4EIJ A;  4DCK A;  3H1H J;  1LTJ C;  3RK3 C;  1ZRT D;  2QA4 P;  1P84 D;  2KIK A;  1WRG A;  1ZLL A;  2BEQ D;  2H89 C;  3L37 A;  1KYO E;  1IK9 A;  2E42 A;  2W27 A;  3H32 B;  5GTH H;  1SQQ K;  4JBZ A;  3H32 A;  1JOC A;  1EC5 A;  4LLH A;  1IFD A;  2OGU A;  1L0N K;  1RE3 A;  3TGU E;  1T2K C;  3VP8 A;  1HF9 A;  1TU3 F;  3KYQ A;  1QLE D;  3EFF K;  3QWO C;  1GW3 A;  1KN7 A;  3H1H E;  1J2J B;  3CWB D;  4I1L A;  2ZYD A;  5DJT B;  4D6T E;  1NTM K;  4JPZ B;  3L70 E;  2ZT9 B;  3PJS K;  1VQK P;  3Q1M A;  1L0N D;  4O9B A;  3P32 A;  3H1J G;  5CCH A;  1ZXG A;  3V4W A;  4C7R A;  1BCC E;  3CXH E;  1FZC C;  1EXI A;  2FFD C;  3CMA P;  3JCU E;  3S4R A;  4Y99 B;  1Q82 Q;  3A0H E;  1OFC X;  2K88 A;  1NWQ A;  2XND H;  1LTS C;  2WSE H;  1BDC A;  1EQ7 A;  1SQV K;  3H1L J;  3SFE C;  4U3F D;  4KT0 J;  1VF5 C;  1SVF A;  3KQG A;  5AW4 B;  2ITA A;  4N6J A;  2XZR A;  1Q90 D;  1USE A;  2QM8 A;  4GOF A;  1OMI A;  1BSH A;  3RGU A;  2R32 A;  1SQV D;  2CPB A;  3PHL A;  5CBO A;  2M3B A;  5APY A;  2IFN A;  2QVA A;  2HR3 A;  1FJK A;  3PH0 A;  3H1L E;  2W8Z A;  1K73 Q;  2HFE D;  2L91 A;  3HE4 B;  3HE4 A;  1R5S A;  1RE3 C;  1NTZ D;  4KJM A;  1VQM P;  3D70 A;  4YXW H;  3H25 A;  1Q86 Q;  1AVO A;  1W2E A;  1PPJ G;  1S2E A;  2RMZ A;  3CCU P;  1NTZ J;  3CCQ P;  3RL0 D;  4IFM A;  1JEK A;  1PGQ A;  1J1E B;  3OAK A;  1SQB E;  1HUC A;  3FXD A;  1H89 A;  3CXH H;  1IZN B;  2ZT9 C;  3MGN A;  2FXM A;  3B5N B;  1PGO A;  2B9B A;  3B5N A;  1S5L X;  1HGZ A;  1ZP0 C;  3LIE A;  3A0H H;  4OWF A;  1LT1 A;  4DT0 A;  1ZR2 A;  4Y99 C;  3GF7 A;  3SWF A;  2FYU G;  4ZKP A;  5KTB A;  4GDO A;  3IR9 A;  1HVV A;  3AE1 C;  4R4L A;  1W2B O;  5B5E E;  2W6A A;  2Q9I A;  3H1J E;  3KZI E;  2JWD A;  1FOS E;  1LTG C;  3CX5 I;  3EWK A;  4PD4 E;  3GLM A;  2QEX P;  3A7O A;  1JY3 O;  2AEF A;  3SSU A;  3PTZ A;  1KOR A;  2Q3E A;  5AW3 B;  3PP5 A;  4GKG A;  2A06 G;  1YYC A;  1KQS O;  3HD7 A;  1GD2 E;  3GG2 A;  3H1K E;  2J5U A;  1SQX K;  1RQV A;  3L35 A;  1IC2 A;  1H88 A;  4HB1 A;  3WUU A;  1QGK B;  2A45 I;  1KB9 I;  3LID A;  2KLV A;  3KXD A;  3AE3 C;  2XU6 A;  3H1I D;  1S1C X;  3FXE A;  2QSI A;  3L72 G;  3AE7 C;  3AEG C;  3G71 P;  3KDP B;  4H44 B;  3HE5 A;  1IFN A;  3M06 A;  3IAO A;  4EOT A;  5KKZ B;  1J1E C;  1L2P A;  2IZ1 A;  1YJN P;  2GUV A;  4BRY A;  1PV3 A;  3V5B A;  1MV8 A;  3B5N C;  1NTK G;  2Q1K A;  1JY2 N;  1MFT A;  2FYU J;  3V2N A;  1PPJ E;  1S4X A;  3L74 G;  1G1J A;  1YTZ T;  2E5T A;  3CD6 P;  1ZN5 A;  1FJP A;  2QJP B;  4YPC A;  5B5E H;  5TIS E;  1AQT A;  1PP9 G;  4ASV A;  1QVG O;  2J58 A;  1SQP D;  1GDT A;  3TNU B;  4PD4 H;  4LGD E;  2YXR B;  3AEE C;  3BCC D;  3V2Q A;  2BCC G;  3VP9 A;  1EDI A;  2FYU E;  3WUT A;  1GL2 B;  2P10 A;  3L75 G;  1HH0 A;  3VMA A;  2K3R A;  2KZI A;  2P67 A;  5CHX A;  3P8M C;  1T2K D;  3EQ2 A;  2VRS A;  4EDF A;  2C0X A;  1URQ D;  4PV1 C;  3IFM A;  4EI2 A;  4ZKU A;  2P1J A;  4JF7 A;  5AVX B;  1VL2 A;  1YJW P;  3L72 J;  3RBZ A;  3JC2 2;  1S72 P;  2H43 A;  4L74 A;  3RK3 E;  2KK7 A;  2QRX A;  2IDB A;  2DW3 A;  2Y0E A;  1LP1 B;  4L73 A;  5KJ7 A;  4D6T G;  3CC2 P;  4H44 C;  2PAJ A;  1IFI A;  1EZV I;  1VDF A;  1NTK J;  5KLV D;  5KKZ C;  3PRJ A;  3VMX A;  1BCC G;  2HPC A;  3L72 E;  2FY8 A;  2JDI H;  3L74 J;  2MKV A;  4IFD K;  3W67 A;  5TIS H;  3AE6 C;  2OTJ P;  4H0L D;  1L0L K;  2QE7 H;  2WSE J;  1PP9 J;  2WWW A;  3KHU A;  4ASW A;  1FAV A;  2QJP C;  4BXL A;  3L75 D;  3O8Z A;  1IK7 A;  2FFD B;  1IJD B;  1T6A A;  2R44 A;  1NTK E;  2FFD A;  3G6E P;  2LXC B;  2BCC J;  2KXP B;  1HTL C;  4Y28 J;  1NKN A;  2E43 A;  3L75 J;  1KYO D;  2WSC H;  1NU1 K;  3L74 E;  5AVT B;  1KYO I;  1D7M A;  1W5C E;  1GL2 C;  3L36 A;  1EDK A;  1SQQ G;  1PP9 E;  1VQ4 P;  3E1R A;  2W6B A;  2FKW B;  1KFN A;  4EYY Q;  2OYH B;  4DOJ A;  3A2A A;  3TGU D;  2WPQ A;  5AVY B;  2OYH A;  1ZME C;  2R3C A;  4K3A A;  4GOD A;  2Q3I A;  3H1H D;  2POH A;  2BCC E;  1IFM A;  3QH9 A;  1S9K E;  4WY4 B;  2ZVN B;  1YQ3 C;  4HH2 A;  4WY4 A;  2E5Y A;  1LJ2 A;  3L70 D;  1RF1 B;  1NTM G;  2KS1 B;  1RF1 A;  1LT9 C;  3LW5 H;  2ZT9 D;  2KS1 A;  5CCH D;  4C46 A;  3CXH D;  3VTP C;  4RO0 A;  2FYZ A;  4D6T J;  1P84 I;  3R4Y A;  1YIT P;  2KSE A;  3L70 J;  3UIA A;  2KSJ A;  5KJ7 C;  1SQB G;  2IBZ E;  2KI7 B;  1BCC J;  5CMZ A;  5AW5 B;  1IFJ A;  3IN6 A;  1N2D C;  2IX7 C;  1BE3 G;  3RK2 B;  3N4X A;  1X0T A;  4TT3 H;  2MJZ A;  1FZA A;  5M1B A;  1N7L A;  5CCG A;  4L76 A;  1OW7 A;  3BRV B;  1JMM A;  2XKM A;  2B87 B;  3B71 A;  3V2R A;  2Q5U A;  2B87 A;  2E76 D;  4R4M A;  3MD0 A;  2WSS H;  3NFQ A;  1T8Z A;  3CCV P;  1DD4 A;  1N7S B;  3AE4 C;  1NOH A;  1N7S A;  5APX A;  1JMB A;  2E75 D;  3VMZ A;  3H1L D;  1RE4 A;  3WU2 E;  1LTI C;  3VOP A;  5AVW B;  1NKZ B;  1SQQ J;  1M8O B;  2KYV A;  2YXQ B;  1SS1 A;  2LXB A;  3ABV C;  2CK3 H;  3H1K G;  4XA4 A;  3SWY A;  2C9N Y;  2BEZ F;  3FX0 A;  3E1I A;  3L73 G;  2OYH C;  1K9M Q;  1S3J A;  3Q3D A;  4UB8 E;  1PZQ A;  3SWK A;  2YNY A;  4L75 A;  2SPZ A;  1M1J B;  3D6Z A;  1JY3 P;  1KIL B;  1FE6 A;  4WY4 C;  4AYC A;  1M1J A;  1KIL A;  1KIL E;  2E74 D;  1SQQ E;  1SQB D;  2W6J H;  1RF1 C;  3S9O A;  1NTZ K;  5TJH A;  3CCM P;  3B5N D;  3FWL A;  4DJG A;  3O6Q B;  1SQB J;  2JWA A;  3O6Q A;  1JB0 J;  2WPV B;  2NPS B;  2HYN A;  4ZMD A;  1VQN P;  1BE3 J;  1JY2 O;  2NPS A;  2WIT A;  3II6 A;  1KMI Z;  2YO3 A;  1NTM E;  3H1J D;  4KHX A;  4DZO A;  3RK2 C;  5CCG C;  4H13 C;  1N73 B;  1OW8 A;  4U3F E;  1QL2 A;  2LKM A;  1N73 A;  3AEA C;  4PD4 D;  2WSF H;  2Y9Z A;  3OW2 O;  1UIX A;  1YBK A;  1DX7 A;  3H1J J;  2A45 G;  1X8Y A;  3ITK A;  1VQ6 P;  5AVS B;  1N7S C;  4B86 A;  3HD7 D;  3WU2 H;  1BE3 E;  2YIU B;  1RE4 C;  4GT1 A;  4BWN A;  1OVV A;  3RL0 g;  1SQX G;  1U7M A;  3H1K J;  1Z56 A;  3CL3 D;  2QIW A;  2FXP A;  4HJG H;  1BSN A;  4UB8 H;  1ZW0 A;  1FDM A;  2V7Q H;  1GU4 A;  4AQR D;  1YHQ P;  3AE8 C;  1UII A;  1HWT C;  1JCC A;  1FDO A;  1M1J C;  1KIL C;  4WBA A;  3TSI A;  3RL0 B;  1FZG A;  1A02 J;  4NPD A;  3M0D C;  2N1T B;  3M0A A;  4WB4 A;  2Z5H A;  2N1T A;  3L73 E;  3H6P A;  2NRG A;  4PV1 B;  2KNC B;  2WZ7 A;  1J1D B;  3M9B A;  3AE9 C;  2KNC A;  1PPJ D;  1DD3 A;  5C39 A;  2AXT H;  1ZV8 A;  3KPE A;  2NPS C;  2G8Y A;  5AW0 B;  1JNM A;  4LC1 A;  3D6Y A;  1N73 C;  5AVV B;  3MHV A;  1RH5 B;  3CX5 E;  2FYU D;  2JJL A;  2YKO A;  4YXD C;  3NXS A;  4NPF X;  1AA0 A;  3SFD C;  5E79 E;  3TYY A;  1FOS F;  5KAI H;  1SQP K;  4N78 E;  1R5L A;  5DJU B;  2YKP A;  4C7N B;  4C7N A;  2YIU C;  1PFI A;  2O1K A;  4RKU J;  3Q5P A;  2PP6 A;  2WSC J;  4ZNC A;  2AXC A;  3TF5 A;  1OX3 A;  2LR2 A;  1SFC B;  3NTN A;  1E79 H;  4I6M C;  1KB9 E;  1EZV G;  2A06 D;  3GHG B;  1SFC A;  1L4A B;  1M90 Q;  3TNU A;  3GHG A;  1LTT C;  1L4A A;  1FS0 E;  3RK3 D;  5APW A;  3MTU E;  1BGY G;  2Z5I A;  2WTY A;  1SP4 A;  1SQX E;  2J59 M;  1GL2 A;  3U59 A;  3OA7 A;  1MZ9 A;  2B88 A;  3RL0 C;  3LW5 J;  4M3L A;  1KC8 Q;  1A02 F;  2N1T C;  2R5D A;  1YQ4 C;  5BU5 A;  5APS A;  3L72 D;  3B4S A;  2D2C B;  3HRN A;  2WPR A;  5CJ4 A;  3TDK A;  3HUS B;  1J1D C;  2IBZ G;  3HUS A;  3AEC C;  3AEF C;  2I1K A;  5H2F E;  2C0W A;  1LT9 B;  5KLV K;  1L0L G;  1Q7Y Q;  1FC2 C;  1LT9 A;  2UWJ E;  1NTK D;  3MZW B;  3CX5 H;  1G2C B;  1LP1 A;  1OIP A;  1G2C A;  5E79 H;  3L74 D;  5AVR B;  2JEE A;  1Y8A A;  3BCC E;  1GMJ A;  4N3Y B;  3CCJ P;  1R8E A;  1OXZ A;  1NU1 G;  1LNQ A;  1K04 A;  1PP9 D;  1KQG B;  5AW8 B;  1VF5 D;  3D71 A;  2I8D A;  4OGQ B;  1YTZ I;  2PFX A;  5APU A;  5AW7 B;  4IOI H;  2A45 H;  1CZQ A;  1KB9 H;  2BCC D;  1S9K D;  1URQ B;  1URQ A;  4WY4 D;  1JO5 A;  2IYP A;  1SFC C;  1KQF B;  5BU8 B;  1VQL P;  3GHG C;  4OH8 B;  1L4A C;  1BGY J;  2WT7 B;  3M91 A;  3A0B E;  2WT7 A;  1KZU B;  3L71 E;  2O1J A;  3V4Q A;  2IFM A;  3CWB G;  4JYB A;  2IBZ D;  5AVQ B;  1EZV E;  5KAF E;  1M1K Q;  1L0N G;  2W83 C;  5GTI E;  3B8E B;  1BGY E;  2D2C C;  5CCG D;  2IZ0 A;  2Z4E A;  5B66 E;  5H2F H;  3HUS C;  2XNX A;  1GK4 A;  4D6T D;  1KD1 Q;  1VPC A;  4I2L C;  4H0L B;  2P2U A;  1AVY A;  4YTP C;  1YJ9 P;  2Q7C A;  2FBW C;  2OTL P;  1Q2N A;  1BCC D;  1X79 B;  4U3F G;  4HYT B;  3CXH I;  2WSF J;  1YIJ P;  4IL6 E;  1HJ0 A;  3MUD A;  3NMD A;  5AVZ B;  1NU1 J;  2P7J A;  1T3J A;  1GZL A;  1L0L E;  1JY2 P;  2HOD B;  2KLU A;  1JM0 A;  1SQV G;  4H13 B;  5BVZ A;  1JCD A;  2HOD A;  1QEX A;  3F89 A;  4XFJ A;  1AFO A;  4UB6 H;  1JTH B;  2OAR A;  1NHL A;  4OGQ C;  2PRR A;  1JTH A;  3MP7 B;  5EFW B;  3A5T A;  2YO2 A;  1URQ C;  1M57 D;  1SLQ A;  1KIL D;  3P8C E;  3U1C A;  1NU1 E;  1Y47 A;  1SQQ D;  3A0B H;  4PJ0 E;  2JP3 A;  1CW5 A;  1WMK A;  2V7Q J;  1HJB A;  3WUV A;  1NTZ G;  2O01 H;  1VQ5 P;  2K1A A;  3C1L A;  1ZRT E;  3CWB J;  1P84 E;  1U7J A;  1FDI A;  5KAF H;  1XTG B;  3FGA D;  1MFZ A;  1SQB K;  2L5G B;  2M3E A;  1L0N J;  2NPS D;  1LGH B;  5GTI H;  3CPW O;  4HKZ H;  1NTM D;  3T97 B;  2KUB A;  2ZFC A;  3T97 A;  5B66 H;  1HGV A;  2H7H A;  1K8A Q;  3PLN A;  1GK6 A;  3AE2 C;  1NTM J;  4WWI A;  1DEB A;  3CWB E;  4IFF A;  4RES B;  1RF0 A;  4H0L C;  3M0D A;  2E76 B;  4U3F J;  2N9B A;  3MIW A;  3FWN A;  1BE3 D;  4IL6 H;  1L0N E;  1KQL A;  2W90 A;  4QMA A;  1USD A;  2YMY A;  2WMM A;  2E75 B;  1X22 A;  3MUD C;  4W80 A;  4JYC A;  1KYO H;  1SQV J;  1Y9B A;  1JUN A;  2AXT E;  1GU5 A;  3V6I A;  5KLI B;  3CCL P;  1GTW A;  1RHZ B;  2XV5 A;  2P58 A;  2KZJ A;  3V2P A;  4PD4 I;  5AVU B;  5AW9 B;  2GA1 A;  2OYI B;  4PJ0 H;  2C9L Y;  4GOE A;  2OYI A;  2M8R A;  2CPS A;  3C8V A;  1KV4 A;  3H1K D;  1EXJ A;  1VQ7 P;  1KTM A;  4XE5 B;  2E74 B;  4A7P A;  2WPS A;  5KAI E;  1SQV E;  3CCR P;  3L73 D;  3H1I G;  4K35 A;  1FU1 A;  2N1T D;  1P84 H;  5CJ0 A;  2Q6Q A;  3CLQ A;  5CCH C;  3JCU H;  3BAT A;  4PV1 D;  4GIF A;  1X9V A;  1NAF A;  3BRT B;  3L73 J;  1OWA A;  3TK1 A;  2QM7 A;  3RBX A;  1N8R Q;  1DEE G;  3WMM 0;  4RJT A;  2BAS A;  1NTZ E;  1OW6 A;  4JQ0 D;  3CCS P;  1NJI Q;  4Z1M H;  2PGD A;  3AED C;  2ZJS E;  4H44 D;  1RY3 A;  1AQ5 A;  3CX5 D;  2ZAE B;  2FXO A;  3GF3 A;  3CCE P;  1RF0 C;  2IPP A;  1NH4 A;  1AJY A;  1OVR A;  2E76 C;  5APV A;  4N78 D;  2K37 A;  3AEB C;  1PGP A;  1NGM B;  2OTK E;  2ZYG A;  1SQP G;  3HD7 B;  5APT A;  1VQO P;  1EDJ A;  1MUU A;  2YKQ A;  2H88 C;  2E75 C;  3BCC G;  2H8P D;  2FYU K;  2QJY B;  1H0T B;  1QVF O;  2XDJ A;  3IF4 A;  1H0T A;  1KB9 D;  2FYN B;  3HTK B;  1NAY A;  1FZF A;  1SFC D;  3HTK A;  4U7J A;  5APQ A;  2N9Y B;  3GW6 A;  5KLI C;  3GMA A;  1L4A D;  2WQY C;  2OQQ A;  5L8R J;  3CME P;  1EDL A;  2V4H A;  2QJK B;  1IO4 A;  1Q81 Q;  3S1K A;  1SQX D; 
#chains in the Genus database with same CATH homology
 2FYN C;  3H25 A;  2P10 A;  1K04 A;  4PV1 D;  1IK7 A;  1KQG B;  1VF5 B;  2NZ2 A;  4TT3 H;  1VF5 D;  4H13 D;  1FDO A;  1ZOY C;  1EXI A;  3D71 A;  5M1B A;  2WSF J;  3AE2 C;  3O6Q A;  1RQU A;  2YMK A;  4OGQ B;  1OW7 A;  2E74 C;  1JB0 J;  1HJ0 A;  3AE3 C;  4Y28 J;  2WPV B;  3B71 A;  1NYH A;  1S1C X;  4H0L C;  2E76 B;  2E76 D;  1KMI Z;  2QSI A;  4R4M A;  2ZT9 C;  2QJK C;  2D2C D;  1DD4 A;  1OW6 A;  3AE5 C;  3AE4 C;  3Q2Y A;  3AE7 C;  4PV1 B;  4IL6 X;  1S5L X;  2G3A A;  4PV1 C;  4Z1M H;  3AEG C;  3SFE C;  1ZP0 C;  4KT0 J;  4H13 B;  1VF5 C;  3AED C;  4H13 C;  1KQF B;  3AE9 C;  3Q5R A;  4H44 B;  4H44 D;  1OW8 A;  1VL2 A;  2E75 B;  4XFJ A;  2E75 D;  1Q90 D;  3IAO A;  3AEA C;  3GF3 A;  3LW5 J;  2O01 J;  4OGQ C;  1DD3 A;  3GF7 A;  1ZME C;  1AJY A;  1UIX A;  1YQ4 C;  1DIP A;  3RK3 E;  2G8Y A;  4GDO A;  2BEQ D;  1Y9B A;  2E76 C;  3G9R A;  2H89 C;  1PV3 A;  1OMI A;  3AE1 C;  4R4L A;  2D2C B;  2JO1 A;  3AEB C;  1NGM B;  3D6Y A;  2IDB A;  1PL5 A;  3ABV C;  1YQ3 C;  4H44 C;  2JP3 A;  2BEZ F;  2H88 C;  3AEC C;  3AEF C;  2E75 C;  1WMK A;  2V7Q J;  3EWK A;  3GLM A;  4I7Z B;  2ZT9 D;  1U57 A;  5KKZ C;  4YXD C;  3Q3D A;  3RL0 g;  3SFD C;  1ZRT E;  1HF9 A;  1TU3 F;  1KOR A;  3R4Y A;  2D2C C;  2QIW A;  4U7J A;  3D6Z A;  1FDI A;  3C8V A;  1PIX A;  5KLI C;  2FXP A;  2K9Y A;  3FGA D;  2MKV A;  3GMA A;  1EXJ A;  1KIL E;  1KTM A;  4OGQ D;  2E74 B;  2YIU C;  2WQY C;  2E74 D;  4RKU J;  3Q5P A;  3AEE C;  3S9O A;  4H0L B;  2WSC J;  3AE6 C;  2OQQ A;  4H0L D;  5L8R J;  2J5U A;  2WSE J;  2QJY C;  4YTP C;  2ZT9 B;  3T97 B;  1MKM A;  1GMJ A;  4I7Z C;  1RQV A;  1R8E A;  3Q1M A;  1K05 A;  2FBW C;  3Q5S A;  3D70 A;  3IN6 A;  2QJP C;  3AE8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...