5L8RJ

The structure of plant photosystem i super-complex at 2.6 angstrom resolution.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
42
structure length
42
Chain Sequence
MRDLKTYLSVAPVASTLWFAALAGLLIEINRFFPDALTFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the plant photosystem I supercomplex at 2.6 angstrom resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Lhca1
total genus 12
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5l8rJ00
3C8VA 1S5LX 2QIWA 2WSFJ 2K9YA 2E76B 2QJPC 4I7ZB 4H13B 2E75B 4H44B 2QJKC 2WPVB 4H0LB 4IL6X 5L8RJ 4OGQB 4Y28J 2QSIA 2O01J 1ZRTE 3LW5J 2D2CB 4PV1B 2YIUC 2WSCJ 1VF5B 5KKZC 1Q90D 5KLIC 4RKUJ 2FYNC 2QJYC 2E74B 1JB0J 2ZT9B 4KT0J 2WSEJ
chains in the Genus database with same CATH superfamily
1AV1A 2WPQA 1BCCG 1USEA 4RO0A 2JP3A 1GMJA 1BE3D 2M3EA 1L0LJ 2R3SA 3H1LJ 4XE5B 3GW6A 4GIFA 2K88A 4JF7A 1ZLLA 2OYHC 2YO3A 1VL2A 2ZYDA 1L0NJ 1UIXA 5APVA 5AW5B 4ZKPA 1FAVA 5CCGD 3NTNA 1SQVJ 1S72P 1KV4A 2OYHB 5AVRB 1KILE 1CSBA 2YNYA 2PGDA 3FWLA 4I7ZC 5AW1B 4EDFA 2B89A 2FYUK 3KPEA 3KZIE 2QJPB 5APXA 2NPSC 3E1RA 3TGUG 1KD1Q 5KLVE 2N1TD 1NTMG 5B66H 5KJ7C 3WUTA 1GTWA 1BGYJ 2WSSH 2WVRA 3L74G 1J1DB 2ZAEB 3D6ZA 2ZT9D 1D7MA 2KLUA 2O01H 1QL1A 3QH9A 1DIPA 1PPJG 1IC2A 1ZMEC 4XA4A 1NTMJ 1R5LA 3HD7D 4PD4D 1PPJD 1RHZB 5GTHH 2W6JH 1EZVG 1JTHB 4OGQC 1S5LH 3CPWO 2D2CD 4PD4E 3RK3E 1L0NK 2IBZI 1LNQA 4IL6E 2C9NY 3TYYA 1KYOD 1S4XA 2OARA 1KQSO 5AVZB 1FZFA 1IFDA 3RK2D 5B5EH 3H6PA 4NPDA 4D6TJ 2WQYC 1RQVA 2JKVA 3AEEC 4PJ0H 3L70E 2XV5A 4L76A 4W80A 1SQXE 4DJGA 2B87B 2YKOA 1GU5A 4D6TG 1CI6A 4L74A 4GOEA 1PGOA 3CD6P 1LJ2A 1OX3A 1S3JA 1FZGA 1FJPA 1SQVE 3H1HJ 1JO5A 3L71E 2C0XA 2IBZG 4D6TD 3LIEA 2AXCA 2FBWC 2FYUD 3L72E 3M91A 2KSEA 3H1IG 5AW9B 1T6AA 2W8ZA 2JDIH 2M8RA 1SQXD 3HTKB 1BGYE 4LC1A 4Y99B 3TGUJ 3B5ND 4U3FJ 3VMZA 3Q5SA 3GHGC 2V7QJ 1M1JA 2LXCB 3VMYA 1T3UA 1IK9A 1N73A 1LTBC 2AEMA 1PFIA 1BE3J 1K05A 1Q2NA 1FC2C 1EDJA 1L4AA 5AW7B 2QJKC 3LIDA 3MHVA 2Y0CA 1L0LG 2QSIA 1J1DC 2IPPA 3RBZA 1OVRA 1QEXA 1VF5D 1E79H 1W5CE 4GODA 3M0AA 2D2CB 1EDLA 3H1KG 2HPCA 1KILC 1WT6A 2OGUA 4GDOA 1JY3O 1LTIC 1NTKE 1YTZT 1N73C 1LTJB 2Q3IA 4GT1A 3Q2YA 1Y9BA 2PAJA 1JCCA 1OW8A 1QX8A 2W6AA 3FXDA 3CXHH 3AE8C 3GF3A 3LW5H 1Q81Q 3G3ZA 3L73J 2GM4A 2SPZA 2G8YA 3O6QB 1BSNA 3H1HE 1L4AB 1S5LE 5APWA 3C9IA 4KT0J 3L74D 3L72J 1KB9I 1NTZE 2CK3H 2ZYAA 1FS0E 1SQBJ 2IBZD 4ASVA 1VQMP 1RF0C 3HUSA 1AQ5A 3OW2O 1IFMA 3BVHA 1N7SB 4IFFA 1NTKG 1RF1B 2OYIA 4C7RA 1FZCB 3JCUH 1SQQG 3L74J 3SFDC 2O01J 4OWFA 4H44D 3GG2A 1U7MA 2NRGA 1X8YA 3U59A 4DZOA 2N9YB 3PRJA 3CWBJ 2N9BA 3H1KJ 3EFFK 1RE4C 2FYNB 1LT9C 1NU1D 3JC22 4PV1C 1YYCA 2UWJE 4H13C 3H1JJ 1USDA 1KB9D 2WSFH 4LLHA 5KLIC 2ZT9C 2A06G 1RF1C 1KORA 2FYNC 1NU1E 5B66E 5GTHE 1PP9E 1FDOA 3CMAP 3M06A 3RL0g 5DJUB 2RH0A 2N1TB 1QLED 1GL2D 2DW3A 3MIWA 4I6MC 3G6EP 2E42A 3AE9C 3C8VA 3AEGC 2ZVNB 3VP9A 2WSFJ 1FJKA 3ITKA 5AVXB 1VQ6P 3P8CE 3RBXA 2E75B 1MV8A 3MUDC 4N3YB 1KYOH 4WVZA 3TGUD 3AE3C 5CCHC 4DCKA 2A45G 4OGQB 3T97A 5APYA 1K9MQ 2AXTE 4EOTA 1CI6B 2K37A 3EFGA 2KI7B 1N86A 2E74D 2YIUC 4C7NA 1EZVI 3TF5A 3L75J 3O6QA 3HE4B 1HGZA 1YQ4C 2FFDB 1IFIA 3N4XA 1N7SC 1JOCA 1YTZI 3GF7A 1A02F 1H0TB 2HODB 5H2FH 3WU2E 5AW6B 1NTMD 1HWTC 1GW3A 1KYOE 1UIIA 2O3JA 3NXSA 4JPZB 3L75D 4YPCA 4RJTA 2ZJSE 2E5TA 3CCMP 1FZCA 1SQQE 1PPJE 2G3AA 5M1BA 1FDMA 1GK6A 1BDCA 3G71P 3CCRP 2Q5UA 5KJ7D 1SQQD 5APQA 1NTME 4WY4D 1VQ4P 3CCEP 2H7HA 1HBWA 1EZVD 4PD4I 1T8ZA 1PGJA 5CMZA 2YKPA 1N73B 2WPVB 2E43A 1LTJC 1BGYG 2FY8A 2CPSA 3HE4A 2FFDA 1NTKK 5KAIE 1W2BO 2WPSA 3FXEA 1L2PA 1SQPK 2L5GB 2QG4A 1LTGC 4U3FG 2QJKB 1NO4A 1AA0A 1MKMA 2H89C 3MUDA 1KQFB 3SSUA 3TNUB 3V2NA 1AVYA 4D6TE 3D71A 3TDKA 1LTJA 2V7QH 1YQ3C 2J59M 2HR3A 1LT9B 2A45H 1OFCX 1SQXJ 3H1JD 3RK3C 2NPSB 3CCLP 3CC7P 2W83C 2BCCE 3WUVA 2B87A 1PP9G 2KSJA 1DD4A 2ZT9B 1DEBA 3PHLA 4YXWH 1OZHA 1BE3E 3IFMA 3PTZA 5AW0B 4A7PA 2YXQB 2ZFCA 3BCCE 1L0ND 3U1AA 1KQLA 1N7SA 1L0LD 4U7JA 3ABVC 3PJSK 2OYIB 4U3FD 1KMIZ 2ZYGA 4RESB 1XTGB 3D70A 2ZXXA 3AEAC 4H0LD 2AEJA 5KKZB 1S9KE 1PGPA 1EZVE 2FXPA 3H32A 1RE4A 2I1KA 4H44B 4OVNF 3CCUP 4IL6X 5CJ4A 2AEFA 3P32A 4UB8E 2K9JB 1N7LA 1J1EC 3MD0A 3PLNA 3V5BA 1L4AC 2PRRA 2R5DA 3RGUA 2XNDH 2R5BA 3RK2B 1GDTA 4W7YA 4EIJA 1JY2O 2IYOA 4LGDE 3CXHI 3L73E 4N6JA 3Q5PA 3PP5A 2WT7B 1PIXA 3HUSC 3TSIA 2JJLA 5KAFH 1T3JA 1ZV8A 1SFCB 4UB8H 2QJYC 4JBZA 3MZWB 5EFWB 2HPCB 4IL6H 4WWIA 1QGKB 1SFCC 3V2RA 4PJ0E 1YI2P 1KILD 3H32B 1IFPA 1NTZD 5APUA 1LP1B 1T2KD 2BASA 4KHXA 1KB9E 1P84D 1SP4A 2NPSD 3V6IA 5CBOA 3CX5H 1ZXGA 1IZNB 1NAYA 1YHQP 2XDJA 3A0HE 2MKVA 3CXHD 3H1KE 3V2PA 3B8EB 3BCCG 1RF0A 1GU4A 1NTZJ 1EDIA 1DX7A 1VQ7P 1EXIA 2HLOA 1ZN5A 5CJ0A 1BCCJ 3H1KD 3L36A 2R44A 1LT9A 3SWFA 3CWBG 2E74C 2NPSA 1NWQA 3KZIH 1PGQA 1OXZA 3M0DA 4O9BA 1M57D 3HD7B 3FWNA 4N78D 1IO4A 3L73G 3KQGA 3VTPC 4OGQD 5CCGA 4C7NB 1MUUA 1DD3A 2Q3EA 5BVZA 4R4MA 3OA7A 1JCDA 4AUWA 2YKQA 1N2DC 4H44C 2V4HA 2IFNA 4JQ0D 3CLQA 4MN4C 4N78E 1NGMB 1LWUC 4HJGH 2FFDC 1KN7A 2QIWA 1NKZB 3CCSP 3H1ID 1YIJP 4PV1D 3I55P 1URQB 2PFXA 1JMBA 1XTCC 1KFMA 2KS1B 4H13B 5AVSB 3L71D 3SWYA 5TISH 3CC2P 1L0LK 1BE3G 3VP8A 2N1TA 2YMKA 3L75E 1VQOP 4ZMDA 2O1JA 2H43A 1WMKA 2I8DA 3H1LD 3TNUA 3M9QA 4EI2A 1IFJA 1URQC 3A5TA 4JYBA 1M1KQ 4IFDK 1U7JA 3B5NC 5TISE 1P84H 2JEEA 2Q9IA 2FXMA 1VQNP 1JMMA 1Q90D 4U3FE 1R8EA 3H1JG 1X79B 1JY3P 3EQ2A 3CX5E 3RL0C 3M0DC 4CPGA 1X22A 1URQA 2FYUE 2Q1KA 3L72D 3V2QA 1SQBD 1X9VA 5AW4B 1AVOA 3HD7C 3AE4C 5BU8B 1N8RQ 1LWUA 1HVVA 1P84I 1R5SA 4L75A 5H2FE 3OJAB 1U57A 3BATA 1OW6A 4BWNA 2O01N 5AW2B 3CCVP 1SQQJ 2E76D 3NFQA 1NTKJ 2QRXA 4HKZH 4H0LB 1GK4A 2JWAA 4I2LC 3H1HD 3BCCD 3B71A 3N7NA 2L91A 1NU1G 3AEBC 5AVYB 3Q5RA 3IR9A 1A02J 2POHA 1L0NE 2XKMA 3BRTB 2BCCJ 5TJHA 1Q82Q 2ZVOB 3AEFC 1LTAC 1M1JC 1H8AA 2FXOA 3BCCJ 3R4YA 2QM8A 3MTUE 4R4LA 3NMDA 2WITA 3KHUA 3CCJP 3CC4P 3HUSB 4IFMA 4UB6H 1M8OB 1WRGA 3TK1A 1KQGB 4GKGA 3UIAA 2IBZE 2B88A 2M3BA 3U1CA 1PL5A 2C9LY 2LR2A 1KILB 5CBNA 4HYTB 4C46A 1HTLC 2WMMA 2XU6A 3H1IJ 2E5YA 3HE5B 3HRNA 5KLVD 5K5GB 2W27A 3AE7C 1KB9H 1NHLA 1VF5C 4WY4B 3H1HG 4B86A 3I56P 4HH2A 2RKLA 3HD7A 4M3LA 1RQUA 1FBMA 2RN0A 3RL0B 3OAKA 4PD4H 1GL2C 3L73D 1QVGO 1NOHA 4WB4A 1LTTC 1EC5A 1SQVD 2HG5D 1IJDB 2BEZF 3AE1C 3CXHE 3P7KA 5APSA 5KKZC 1RF1A 2MJZA 2OYIC 5E79H 1PP9D 2W90A 3MP7B 1VQ8P 1JB0J 1Z56A 2J58A 2WZ7A 2Q7CA 4YXDC 1FZCC 2WTYA 1KILA 1AFOA 4GOFA 3P8MC 4AQRD 1Y47A 4WY4A 5KAIH 3CMEP 2IDBA 2KS1A 1G1JA 3A3YB 1BDDA 2K9YA 2P58A 3KYQA 4HB1A 3HTKA 3PH0A 3S9OA 3CCQP 2XNXA 1NTZG 1LGHB 3VOPA 5KLVG 2P1JA 1M1JB 1SQPD 3C1LA 3L35A 4IOIH 3B5NB 3WU2H 3IF4A 5BU5A 2QJYB 1CW5A 1NTKD 3P8CD 5KLIB 1SFCD 2WSEH 2HFED 3GHGA 1VPCA 1QL2A 1ZW0A 5KLVK 2VRSA 4PV1B 3H1IE 3VYIA 2B9BA 1H89A 4WBAA 2HODA 2IZ1A 2WSCJ 2A45I 4H13D 2KLVA 1VQPP 3BRVB 2WWWA 1SQVG 2K9JA 2JR8A 2Y0DA 3L70D 3S4RA 1BCCE 1RY3A 5B5EE 1KTMA 1GZLA 2YO2A 3CWBD 1VQ9P 5CHXA 4UB6E 3CI9A 1L0LE 3QWOC 1NVOA 3GMAA 3H1LE 2PP6A 1KYOI 2KP8A 3SWKA 3W68A 3W67A 1M56D 1FZEA 2A06E 1NTMK 2J5UA 2P2UA 2WSEJ 1ZRTD 3D6YA 4JYCA 2KOGA 1S5LX 2M0BA 1RE3C 4K35A 3B5NA 4BXLA 3F5HA 4OH8B 2N1TC 2P10A 1FDIA 1NAFA 2QA4P 1YITP 1VQ5P 1NTZK 2I1JA 2GUSA 4TLFA 5GTIH 1LT1A 3M9HA 2WSCH 2H88C 1Q7YQ 2GA1A 1FOSF 2XZRA 3ZDMA 3CX5D 3MGNA 4BRYA 1ZOYC 5APTA 2A06D 1LP1A 2LXBA 2YIUB 1M7LA 2E75C 3RK3B 4XFJA 2KXPB 3FGAD 2AXTH 2P67A 2JWDA 1DH3A 1SQVK 2Y9YA 3I5CA 1N7SD 3A2AA 3L71G 3L74E 1GW4A 4I1LA 2R32A 3B4SA 4DOJA 2KZJA 5GTIE 1ZR4A 2D2CC 1NJIQ 2KIKA 1RH5B 1SS1A 2K3RA 3S1KA 3L70G 3AEDC 4RKUJ 1W2EA 5KJ7A 1JEKA 3RK2C 4AYCA 1FZBA 5KTBA 1K73Q 1G1IA 1MFZA 3CX5I 1SVFA 1URQD 5CCGC 1Y8AA 2O1KA 5C39A 4WY4C 3HE5A 4BRYB 1AJYA 1IFNA 2QJPC 1PP9J 3V4QA 1SQPG 1P84E 1MZ9A 4I7ZB 2OYOA 3WUUA 1OVUA 1Q86Q 1JY3N 2Z4EA 4Z1MH 1GL2B 1JNMA 3RL0D 2QM7A 1SQPJ 2KZIA 3LW5J 4W7ZA 5KLVJ 1YJNP 2H8PD 3IN6A 2CPBA 1TU3F 2OQQA 4EYYQ 1SFCA 5AVWB 2OYHA 1VF5B 1NYHA 5AVVB 1HH0A 3M9BA 1S2EA 4L73A 4ZKUA 5CCHD 1KFNA 3RK3D 1X0TA 1L0NG 3TGUE 3Q1MA 1T2KC 1OW7A 2E76C 1VQKP 3L70J 5AW8B 3USSA 3JCUE 3V4WA 3A0HH 4TT3H 3IAOA 3H1LG 1S1CX 1JTHA 1SQXK 1SQBG 1HJ0A 3KDPB 2WPRA 3L71J 3L72G 5E79E 1H0TA 4H0LC 1E5WA 2HYNA 1OWAA 1SQQK 1GL2A 1JY2P 1J2JB 2E76B 3CL3D 4ZNCA 2OTLP 2M5AB 2FYZA 2LKMA 1G2CB 1SQBK 1NKNA 1J1EB 1SQXG 2R3CA 2Y0EA 2YXRB 4YTPC 2KNCB 1GD2E 2IX7C 4ASWA 1JY2N 1L4AD 1LTSC 1PV3A 2Z5IA 2FYUG 1LWUB 3WMM0 1HF9A 3AE6C 1BGYD 3II6A 4DT0A 3G9RA 2Y9ZA 1OVVA 1PZQA 4KJMA 1K8AQ 2KB7P 2NZ2A 2IFMA 5DJTB 3GHGB 2KYVA 2OTJP 3JSVC 3L4FA 3KXDA 1SQPE 1NU1K 1ZR2A 4Y99C 1CZQA 1YJ9P 1YJWP 3VMXA 2W6BA 3A0BE 3R2PA 1RE3A 2GUVA 2RMZA 3A7OA 5AVUB 5KAFE 3SFEC 1DEEG 3BASA 1KZUB 1OIPA 2ZXEB 2IZ0A 1FOSE 1ZP0C 3AECC 2BEQD 2KUBA 3K5BA 1G2CA 2FKWB 3L37A 5AVQB 1HUCA 2KNCA 3EWKA 1M90Q 3A0BH 3VN0A 1FE6A 1KC8Q 1BCCD 3AE5C 3Q3DA 5CCHA 2YMYA 1MFTA 2QVAA 5AVTB 1IK7A 4K3AA 1EDKA 1EQ7A 1YBKA 2C0WA 5L8RJ 2BCCD 4Y28J 1SQBE 3VMAA 2E75D 3H25A 1ZRTE 3H1JE 1JUNA 3AE2C 2IYPA 1JM0A 1BSHA 2Z5HA 1AQTA 1NU1J 3E7KA 1QVFO 3O8ZA 4NPFX 1FZAA 3GLMA 1FU1A 2FYUJ 1K04A 5AW3B 2K1AA 1HJBA 2Q6QA 1S9KD 2OTKE 2QEXP 1H88A 1VDFA 2KK7A 2JO1A 3CWBE 3FX0A 1HGVA 2ITAA 2M5AA 1NH4A 1EXJA 2E74B 2WT7A 1OMIA 4NPEA 3E1IA 2BCCG 3L75G 1VQLP 4QMAA 3G4SP 1SLQA 3T97B 2QE7H 3F89A 2P7JA
chains in the Genus database with same CATH topology
3AE9C 3C8VA 3AEGC 1S5LX 2QIWA 2WSFJ 2JP3A 1GMJA 4PV1D 2P10A 1FDIA 4H13B 2E75B 1VL2A 2H88C 3AE3C 1UIXA 2YMKA 1ZOYC 4OGQB 2E75C 1WMKA 4XFJA 3FGAD 1KILE 4I7ZC 2E74D 2YIUC 3O6QA 1YQ4C 2D2CC 3GF7A 1Q90D 3D6ZA 3AEDC 2ZT9D 4RKUJ 1DIPA 1R8EA 1ZMEC 2G3AA 5M1BA 3AE4C 4OGQC 1AJYA 2QJPC 2D2CD 1U57A 3RK3E 1OW6A 4I7ZB 2E76D 2WPVB 4H0LB 4Z1MH 3LW5J 3B71A 3IN6A 2WQYC 1RQVA 3AEEC 1TU3F 2OQQA 3AEBC 3Q5RA 1HF9A 1MKMA 1VF5B 1NYHA 2H89C 1KQFB 3AEFC 3Q1MA 3D71A 3R4YA 1OW7A 2E76C 1YQ3C 2FBWC 4TT3H 3IAOA 4R4LA 1S1CX 1DD4A 2ZT9B 1HJ0A 1KQGB 3Q5SA 4U7JA 2V7QJ 4H0LC 3ABVC 2E76B 1KMIZ 1PL5A 3D70A 4H0LD 3AEAC 4YTPC 1K05A 2FXPA 4H44B 3AE7C 2QJKC 4IL6X 1VF5C 1PV3A 2QSIA 3AE6C 3G9RA 1VF5D 1RQUA 2D2CB 4GDOA 2NZ2A 3Q5PA 3Q2YA 1Y9BA 1PIXA 2BEZF 3AE1C 1OW8A 3GF3A 3SFEC 5KKZC 3AE8C 2QJYC 1JB0J 1ZP0C 4YXDC 3AECC 2BEQD 2G8YA 4KT0J 2IDBA 3EWKA 2K9YA 3AE5C 3Q3DA 3S9OA 1IK7A 2MKVA 5L8RJ 3SFDC 4Y28J 2E75D 1EXIA 2O01J 1ZRTE 3H25A 4H44D 3AE2C 4PV1B 2E74C 2WSCJ 4H13D 3GLMA 3D6YA 4PV1C 4H13C 1K04A 4OGQD 5KLIC 2ZT9C 1KTMA 1KORA 1DD3A 2FYNC 2JO1A 4R4MA 1EXJA 1FDOA 2E74B 1OMIA 3RL0g 3GMAA 4H44C 2J5UA 1NGMB 3T97B 2WSEJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8V A;  1S5L X;  2QIW A;  2WSF J;  2K9Y A;  2E76 B;  2QJP C;  4I7Z B;  4H13 B;  2E75 B;  4H44 B;  2QJK C;  2WPV B;  4H0L B;  4IL6 X;  5L8R J;  4OGQ B;  4Y28 J;  2QSI A;  2O01 J;  1ZRT E;  3LW5 J;  2D2C B;  4PV1 B;  2YIU C;  2WSC J;  1VF5 B;  5KKZ C;  1Q90 D;  5KLI C;  4RKU J;  2FYN C;  2QJY C;  2E74 B;  1JB0 J;  2ZT9 B;  4KT0 J;  2WSE J; 
#chains in the Genus database with same CATH topology
 1AV1 A;  2WPQ A;  1BCC G;  1USE A;  4RO0 A;  2JP3 A;  1GMJ A;  1BE3 D;  2M3E A;  1L0L J;  2R3S A;  3H1L J;  4XE5 B;  3GW6 A;  4GIF A;  2K88 A;  4JF7 A;  1ZLL A;  2OYH C;  2YO3 A;  1VL2 A;  2ZYD A;  1L0N J;  1UIX A;  5APV A;  5AW5 B;  4ZKP A;  1FAV A;  5CCG D;  3NTN A;  1SQV J;  1S72 P;  1KV4 A;  2OYH B;  5AVR B;  1KIL E;  1CSB A;  2YNY A;  2PGD A;  3FWL A;  4I7Z C;  5AW1 B;  4EDF A;  2B89 A;  2FYU K;  3KPE A;  3KZI E;  2QJP B;  5APX A;  2NPS C;  3E1R A;  3TGU G;  1KD1 Q;  5KLV E;  2N1T D;  1NTM G;  5B66 H;  5KJ7 C;  3WUT A;  1GTW A;  1BGY J;  2WSS H;  2WVR A;  3L74 G;  1J1D B;  2ZAE B;  3D6Z A;  2ZT9 D;  1D7M A;  2KLU A;  2O01 H;  1QL1 A;  3QH9 A;  1DIP A;  1PPJ G;  1IC2 A;  1ZME C;  4XA4 A;  1NTM J;  1R5L A;  3HD7 D;  4PD4 D;  1PPJ D;  1RHZ B;  5GTH H;  2W6J H;  1EZV G;  1JTH B;  4OGQ C;  1S5L H;  3CPW O;  2D2C D;  4PD4 E;  3RK3 E;  1L0N K;  2IBZ I;  1LNQ A;  4IL6 E;  2C9N Y;  3TYY A;  1KYO D;  1S4X A;  2OAR A;  1KQS O;  5AVZ B;  1FZF A;  1IFD A;  3RK2 D;  5B5E H;  3H6P A;  4NPD A;  4D6T J;  2WQY C;  1RQV A;  2JKV A;  3AEE C;  4PJ0 H;  3L70 E;  2XV5 A;  4L76 A;  4W80 A;  1SQX E;  4DJG A;  2B87 B;  2YKO A;  1GU5 A;  4D6T G;  1CI6 A;  4L74 A;  4GOE A;  1PGO A;  3CD6 P;  1LJ2 A;  1OX3 A;  1S3J A;  1FZG A;  1FJP A;  1SQV E;  3H1H J;  1JO5 A;  3L71 E;  2C0X A;  2IBZ G;  4D6T D;  3LIE A;  2AXC A;  2FBW C;  2FYU D;  3L72 E;  3M91 A;  2KSE A;  3H1I G;  5AW9 B;  1T6A A;  2W8Z A;  2JDI H;  2M8R A;  1SQX D;  3HTK B;  1BGY E;  4LC1 A;  4Y99 B;  3TGU J;  3B5N D;  4U3F J;  3VMZ A;  3Q5S A;  3GHG C;  2V7Q J;  1M1J A;  2LXC B;  3VMY A;  1T3U A;  1IK9 A;  1N73 A;  1LTB C;  2AEM A;  1PFI A;  1BE3 J;  1K05 A;  1Q2N A;  1FC2 C;  1EDJ A;  1L4A A;  5AW7 B;  2QJK C;  3LID A;  3MHV A;  2Y0C A;  1L0L G;  2QSI A;  1J1D C;  2IPP A;  3RBZ A;  1OVR A;  1QEX A;  1VF5 D;  1E79 H;  1W5C E;  4GOD A;  3M0A A;  2D2C B;  1EDL A;  3H1K G;  2HPC A;  1KIL C;  1WT6 A;  2OGU A;  4GDO A;  1JY3 O;  1LTI C;  1NTK E;  1YTZ T;  1N73 C;  1LTJ B;  2Q3I A;  4GT1 A;  3Q2Y A;  1Y9B A;  2PAJ A;  1JCC A;  1OW8 A;  1QX8 A;  2W6A A;  3FXD A;  3CXH H;  3AE8 C;  3GF3 A;  3LW5 H;  1Q81 Q;  3G3Z A;  3L73 J;  2GM4 A;  2SPZ A;  2G8Y A;  3O6Q B;  1BSN A;  3H1H E;  1L4A B;  1S5L E;  5APW A;  3C9I A;  4KT0 J;  3L74 D;  3L72 J;  1KB9 I;  1NTZ E;  2CK3 H;  2ZYA A;  1FS0 E;  1SQB J;  2IBZ D;  4ASV A;  1VQM P;  1RF0 C;  3HUS A;  1AQ5 A;  3OW2 O;  1IFM A;  3BVH A;  1N7S B;  4IFF A;  1NTK G;  1RF1 B;  2OYI A;  4C7R A;  1FZC B;  3JCU H;  1SQQ G;  3L74 J;  3SFD C;  2O01 J;  4OWF A;  4H44 D;  3GG2 A;  1U7M A;  2NRG A;  1X8Y A;  3U59 A;  4DZO A;  2N9Y B;  3PRJ A;  3CWB J;  2N9B A;  3H1K J;  3EFF K;  1RE4 C;  2FYN B;  1LT9 C;  1NU1 D;  3JC2 2;  4PV1 C;  1YYC A;  2UWJ E;  4H13 C;  3H1J J;  1USD A;  1KB9 D;  2WSF H;  4LLH A;  5KLI C;  2ZT9 C;  2A06 G;  1RF1 C;  1KOR A;  2FYN C;  1NU1 E;  5B66 E;  5GTH E;  1PP9 E;  1FDO A;  3CMA P;  3M06 A;  3RL0 g;  5DJU B;  2RH0 A;  2N1T B;  1QLE D;  1GL2 D;  2DW3 A;  3MIW A;  4I6M C;  3G6E P;  2E42 A;  3AE9 C;  3C8V A;  3AEG C;  2ZVN B;  3VP9 A;  2WSF J;  1FJK A;  3ITK A;  5AVX B;  1VQ6 P;  3P8C E;  3RBX A;  2E75 B;  1MV8 A;  3MUD C;  4N3Y B;  1KYO H;  4WVZ A;  3TGU D;  3AE3 C;  5CCH C;  4DCK A;  2A45 G;  4OGQ B;  3T97 A;  5APY A;  1K9M Q;  2AXT E;  4EOT A;  1CI6 B;  2K37 A;  3EFG A;  2KI7 B;  1N86 A;  2E74 D;  2YIU C;  4C7N A;  1EZV I;  3TF5 A;  3L75 J;  3O6Q A;  3HE4 B;  1HGZ A;  1YQ4 C;  2FFD B;  1IFI A;  3N4X A;  1N7S C;  1JOC A;  1YTZ I;  3GF7 A;  1A02 F;  1H0T B;  2HOD B;  5H2F H;  3WU2 E;  5AW6 B;  1NTM D;  1HWT C;  1GW3 A;  1KYO E;  1UII A;  2O3J A;  3NXS A;  4JPZ B;  3L75 D;  4YPC A;  4RJT A;  2ZJS E;  2E5T A;  3CCM P;  1FZC A;  1SQQ E;  1PPJ E;  2G3A A;  5M1B A;  1FDM A;  1GK6 A;  1BDC A;  3G71 P;  3CCR P;  2Q5U A;  5KJ7 D;  1SQQ D;  5APQ A;  1NTM E;  4WY4 D;  1VQ4 P;  3CCE P;  2H7H A;  1HBW A;  1EZV D;  4PD4 I;  1T8Z A;  1PGJ A;  5CMZ A;  2YKP A;  1N73 B;  2WPV B;  2E43 A;  1LTJ C;  1BGY G;  2FY8 A;  2CPS A;  3HE4 A;  2FFD A;  1NTK K;  5KAI E;  1W2B O;  2WPS A;  3FXE A;  1L2P A;  1SQP K;  2L5G B;  2QG4 A;  1LTG C;  4U3F G;  2QJK B;  1NO4 A;  1AA0 A;  1MKM A;  2H89 C;  3MUD A;  1KQF B;  3SSU A;  3TNU B;  3V2N A;  1AVY A;  4D6T E;  3D71 A;  3TDK A;  1LTJ A;  2V7Q H;  1YQ3 C;  2J59 M;  2HR3 A;  1LT9 B;  2A45 H;  1OFC X;  1SQX J;  3H1J D;  3RK3 C;  2NPS B;  3CCL P;  3CC7 P;  2W83 C;  2BCC E;  3WUV A;  2B87 A;  1PP9 G;  2KSJ A;  1DD4 A;  2ZT9 B;  1DEB A;  3PHL A;  4YXW H;  1OZH A;  1BE3 E;  3IFM A;  3PTZ A;  5AW0 B;  4A7P A;  2YXQ B;  2ZFC A;  3BCC E;  1L0N D;  3U1A A;  1KQL A;  1N7S A;  1L0L D;  4U7J A;  3ABV C;  3PJS K;  2OYI B;  4U3F D;  1KMI Z;  2ZYG A;  4RES B;  1XTG B;  3D70 A;  2ZXX A;  3AEA C;  4H0L D;  2AEJ A;  5KKZ B;  1S9K E;  1PGP A;  1EZV E;  2FXP A;  3H32 A;  1RE4 A;  2I1K A;  4H44 B;  4OVN F;  3CCU P;  4IL6 X;  5CJ4 A;  2AEF A;  3P32 A;  4UB8 E;  2K9J B;  1N7L A;  1J1E C;  3MD0 A;  3PLN A;  3V5B A;  1L4A C;  2PRR A;  2R5D A;  3RGU A;  2XND H;  2R5B A;  3RK2 B;  1GDT A;  4W7Y A;  4EIJ A;  1JY2 O;  2IYO A;  4LGD E;  3CXH I;  3L73 E;  4N6J A;  3Q5P A;  3PP5 A;  2WT7 B;  1PIX A;  3HUS C;  3TSI A;  2JJL A;  5KAF H;  1T3J A;  1ZV8 A;  1SFC B;  4UB8 H;  2QJY C;  4JBZ A;  3MZW B;  5EFW B;  2HPC B;  4IL6 H;  4WWI A;  1QGK B;  1SFC C;  3V2R A;  4PJ0 E;  1YI2 P;  1KIL D;  3H32 B;  1IFP A;  1NTZ D;  5APU A;  1LP1 B;  1T2K D;  2BAS A;  4KHX A;  1KB9 E;  1P84 D;  1SP4 A;  2NPS D;  3V6I A;  5CBO A;  3CX5 H;  1ZXG A;  1IZN B;  1NAY A;  1YHQ P;  2XDJ A;  3A0H E;  2MKV A;  3CXH D;  3H1K E;  3V2P A;  3B8E B;  3BCC G;  1RF0 A;  1GU4 A;  1NTZ J;  1EDI A;  1DX7 A;  1VQ7 P;  1EXI A;  2HLO A;  1ZN5 A;  5CJ0 A;  1BCC J;  3H1K D;  3L36 A;  2R44 A;  1LT9 A;  3SWF A;  3CWB G;  2E74 C;  2NPS A;  1NWQ A;  3KZI H;  1PGQ A;  1OXZ A;  3M0D A;  4O9B A;  1M57 D;  3HD7 B;  3FWN A;  4N78 D;  1IO4 A;  3L73 G;  3KQG A;  3VTP C;  4OGQ D;  5CCG A;  4C7N B;  1MUU A;  1DD3 A;  2Q3E A;  5BVZ A;  4R4M A;  3OA7 A;  1JCD A;  4AUW A;  2YKQ A;  1N2D C;  4H44 C;  2V4H A;  2IFN A;  4JQ0 D;  3CLQ A;  4MN4 C;  4N78 E;  1NGM B;  1LWU C;  4HJG H;  2FFD C;  1KN7 A;  2QIW A;  1NKZ B;  3CCS P;  3H1I D;  1YIJ P;  4PV1 D;  3I55 P;  1URQ B;  2PFX A;  1JMB A;  1XTC C;  1KFM A;  2KS1 B;  4H13 B;  5AVS B;  3L71 D;  3SWY A;  5TIS H;  3CC2 P;  1L0L K;  1BE3 G;  3VP8 A;  2N1T A;  2YMK A;  3L75 E;  1VQO P;  4ZMD A;  2O1J A;  2H43 A;  1WMK A;  2I8D A;  3H1L D;  3TNU A;  3M9Q A;  4EI2 A;  1IFJ A;  1URQ C;  3A5T A;  4JYB A;  1M1K Q;  4IFD K;  1U7J A;  3B5N C;  5TIS E;  1P84 H;  2JEE A;  2Q9I A;  2FXM A;  1VQN P;  1JMM A;  1Q90 D;  4U3F E;  1R8E A;  3H1J G;  1X79 B;  1JY3 P;  3EQ2 A;  3CX5 E;  3RL0 C;  3M0D C;  4CPG A;  1X22 A;  1URQ A;  2FYU E;  2Q1K A;  3L72 D;  3V2Q A;  1SQB D;  1X9V A;  5AW4 B;  1AVO A;  3HD7 C;  3AE4 C;  5BU8 B;  1N8R Q;  1LWU A;  1HVV A;  1P84 I;  1R5S A;  4L75 A;  5H2F E;  3OJA B;  1U57 A;  3BAT A;  1OW6 A;  4BWN A;  2O01 N;  5AW2 B;  3CCV P;  1SQQ J;  2E76 D;  3NFQ A;  1NTK J;  2QRX A;  4HKZ H;  4H0L B;  1GK4 A;  2JWA A;  4I2L C;  3H1H D;  3BCC D;  3B71 A;  3N7N A;  2L91 A;  1NU1 G;  3AEB C;  5AVY B;  3Q5R A;  3IR9 A;  1A02 J;  2POH A;  1L0N E;  2XKM A;  3BRT B;  2BCC J;  5TJH A;  1Q82 Q;  2ZVO B;  3AEF C;  1LTA C;  1M1J C;  1H8A A;  2FXO A;  3BCC J;  3R4Y A;  2QM8 A;  3MTU E;  4R4L A;  3NMD A;  2WIT A;  3KHU A;  3CCJ P;  3CC4 P;  3HUS B;  4IFM A;  4UB6 H;  1M8O B;  1WRG A;  3TK1 A;  1KQG B;  4GKG A;  3UIA A;  2IBZ E;  2B88 A;  2M3B A;  3U1C A;  1PL5 A;  2C9L Y;  2LR2 A;  1KIL B;  5CBN A;  4HYT B;  4C46 A;  1HTL C;  2WMM A;  2XU6 A;  3H1I J;  2E5Y A;  3HE5 B;  3HRN A;  5KLV D;  5K5G B;  2W27 A;  3AE7 C;  1KB9 H;  1NHL A;  1VF5 C;  4WY4 B;  3H1H G;  4B86 A;  3I56 P;  4HH2 A;  2RKL A;  3HD7 A;  4M3L A;  1RQU A;  1FBM A;  2RN0 A;  3RL0 B;  3OAK A;  4PD4 H;  1GL2 C;  3L73 D;  1QVG O;  1NOH A;  4WB4 A;  1LTT C;  1EC5 A;  1SQV D;  2HG5 D;  1IJD B;  2BEZ F;  3AE1 C;  3CXH E;  3P7K A;  5APS A;  5KKZ C;  1RF1 A;  2MJZ A;  2OYI C;  5E79 H;  1PP9 D;  2W90 A;  3MP7 B;  1VQ8 P;  1JB0 J;  1Z56 A;  2J58 A;  2WZ7 A;  2Q7C A;  4YXD C;  1FZC C;  2WTY A;  1KIL A;  1AFO A;  4GOF A;  3P8M C;  4AQR D;  1Y47 A;  4WY4 A;  5KAI H;  3CME P;  2IDB A;  2KS1 A;  1G1J A;  3A3Y B;  1BDD A;  2K9Y A;  2P58 A;  3KYQ A;  4HB1 A;  3HTK A;  3PH0 A;  3S9O A;  3CCQ P;  2XNX A;  1NTZ G;  1LGH B;  3VOP A;  5KLV G;  2P1J A;  1M1J B;  1SQP D;  3C1L A;  3L35 A;  4IOI H;  3B5N B;  3WU2 H;  3IF4 A;  5BU5 A;  2QJY B;  1CW5 A;  1NTK D;  3P8C D;  5KLI B;  1SFC D;  2WSE H;  2HFE D;  3GHG A;  1VPC A;  1QL2 A;  1ZW0 A;  5KLV K;  2VRS A;  4PV1 B;  3H1I E;  3VYI A;  2B9B A;  1H89 A;  4WBA A;  2HOD A;  2IZ1 A;  2WSC J;  2A45 I;  4H13 D;  2KLV A;  1VQP P;  3BRV B;  2WWW A;  1SQV G;  2K9J A;  2JR8 A;  2Y0D A;  3L70 D;  3S4R A;  1BCC E;  1RY3 A;  5B5E E;  1KTM A;  1GZL A;  2YO2 A;  3CWB D;  1VQ9 P;  5CHX A;  4UB6 E;  3CI9 A;  1L0L E;  3QWO C;  1NVO A;  3GMA A;  3H1L E;  2PP6 A;  1KYO I;  2KP8 A;  3SWK A;  3W68 A;  3W67 A;  1M56 D;  1FZE A;  2A06 E;  1NTM K;  2J5U A;  2P2U A;  2WSE J;  1ZRT D;  3D6Y A;  4JYC A;  2KOG A;  1S5L X;  2M0B A;  1RE3 C;  4K35 A;  3B5N A;  4BXL A;  3F5H A;  4OH8 B;  2N1T C;  2P10 A;  1FDI A;  1NAF A;  2QA4 P;  1YIT P;  1VQ5 P;  1NTZ K;  2I1J A;  2GUS A;  4TLF A;  5GTI H;  1LT1 A;  3M9H A;  2WSC H;  2H88 C;  1Q7Y Q;  2GA1 A;  1FOS F;  2XZR A;  3ZDM A;  3CX5 D;  3MGN A;  4BRY A;  1ZOY C;  5APT A;  2A06 D;  1LP1 A;  2LXB A;  2YIU B;  1M7L A;  2E75 C;  3RK3 B;  4XFJ A;  2KXP B;  3FGA D;  2AXT H;  2P67 A;  2JWD A;  1DH3 A;  1SQV K;  2Y9Y A;  3I5C A;  1N7S D;  3A2A A;  3L71 G;  3L74 E;  1GW4 A;  4I1L A;  2R32 A;  3B4S A;  4DOJ A;  2KZJ A;  5GTI E;  1ZR4 A;  2D2C C;  1NJI Q;  2KIK A;  1RH5 B;  1SS1 A;  2K3R A;  3S1K A;  3L70 G;  3AED C;  4RKU J;  1W2E A;  5KJ7 A;  1JEK A;  3RK2 C;  4AYC A;  1FZB A;  5KTB A;  1K73 Q;  1G1I A;  1MFZ A;  3CX5 I;  1SVF A;  1URQ D;  5CCG C;  1Y8A A;  2O1K A;  5C39 A;  4WY4 C;  3HE5 A;  4BRY B;  1AJY A;  1IFN A;  2QJP C;  1PP9 J;  3V4Q A;  1SQP G;  1P84 E;  1MZ9 A;  4I7Z B;  2OYO A;  3WUU A;  1OVU A;  1Q86 Q;  1JY3 N;  2Z4E A;  4Z1M H;  1GL2 B;  1JNM A;  3RL0 D;  2QM7 A;  1SQP J;  2KZI A;  3LW5 J;  4W7Z A;  5KLV J;  1YJN P;  2H8P D;  3IN6 A;  2CPB A;  1TU3 F;  2OQQ A;  4EYY Q;  1SFC A;  5AVW B;  2OYH A;  1VF5 B;  1NYH A;  5AVV B;  1HH0 A;  3M9B A;  1S2E A;  4L73 A;  4ZKU A;  5CCH D;  1KFN A;  3RK3 D;  1X0T A;  1L0N G;  3TGU E;  3Q1M A;  1T2K C;  1OW7 A;  2E76 C;  1VQK P;  3L70 J;  5AW8 B;  3USS A;  3JCU E;  3V4W A;  3A0H H;  4TT3 H;  3IAO A;  3H1L G;  1S1C X;  1JTH A;  1SQX K;  1SQB G;  1HJ0 A;  3KDP B;  2WPR A;  3L71 J;  3L72 G;  5E79 E;  1H0T A;  4H0L C;  1E5W A;  2HYN A;  1OWA A;  1SQQ K;  1GL2 A;  1JY2 P;  1J2J B;  2E76 B;  3CL3 D;  4ZNC A;  2OTL P;  2M5A B;  2FYZ A;  2LKM A;  1G2C B;  1SQB K;  1NKN A;  1J1E B;  1SQX G;  2R3C A;  2Y0E A;  2YXR B;  4YTP C;  2KNC B;  1GD2 E;  2IX7 C;  4ASW A;  1JY2 N;  1L4A D;  1LTS C;  1PV3 A;  2Z5I A;  2FYU G;  1LWU B;  3WMM 0;  1HF9 A;  3AE6 C;  1BGY D;  3II6 A;  4DT0 A;  3G9R A;  2Y9Z A;  1OVV A;  1PZQ A;  4KJM A;  1K8A Q;  2KB7 P;  2NZ2 A;  2IFM A;  5DJT B;  3GHG B;  2KYV A;  2OTJ P;  3JSV C;  3L4F A;  3KXD A;  1SQP E;  1NU1 K;  1ZR2 A;  4Y99 C;  1CZQ A;  1YJ9 P;  1YJW P;  3VMX A;  2W6B A;  3A0B E;  3R2P A;  1RE3 A;  2GUV A;  2RMZ A;  3A7O A;  5AVU B;  5KAF E;  3SFE C;  1DEE G;  3BAS A;  1KZU B;  1OIP A;  2ZXE B;  2IZ0 A;  1FOS E;  1ZP0 C;  3AEC C;  2BEQ D;  2KUB A;  3K5B A;  1G2C A;  2FKW B;  3L37 A;  5AVQ B;  1HUC A;  2KNC A;  3EWK A;  1M90 Q;  3A0B H;  3VN0 A;  1FE6 A;  1KC8 Q;  1BCC D;  3AE5 C;  3Q3D A;  5CCH A;  2YMY A;  1MFT A;  2QVA A;  5AVT B;  1IK7 A;  4K3A A;  1EDK A;  1EQ7 A;  1YBK A;  2C0W A;  5L8R J;  2BCC D;  4Y28 J;  1SQB E;  3VMA A;  2E75 D;  3H25 A;  1ZRT E;  3H1J E;  1JUN A;  3AE2 C;  2IYP A;  1JM0 A;  1BSH A;  2Z5H A;  1AQT A;  1NU1 J;  3E7K A;  1QVF O;  3O8Z A;  4NPF X;  1FZA A;  3GLM A;  1FU1 A;  2FYU J;  1K04 A;  5AW3 B;  2K1A A;  1HJB A;  2Q6Q A;  1S9K D;  2OTK E;  2QEX P;  1H88 A;  1VDF A;  2KK7 A;  2JO1 A;  3CWB E;  3FX0 A;  1HGV A;  2ITA A;  2M5A A;  1NH4 A;  1EXJ A;  2E74 B;  2WT7 A;  1OMI A;  4NPE A;  3E1I A;  2BCC G;  3L75 G;  1VQL P;  4QMA A;  3G4S P;  1SLQ A;  3T97 B;  2QE7 H;  3F89 A;  2P7J A; 
#chains in the Genus database with same CATH homology
 3AE9 C;  3C8V A;  3AEG C;  1S5L X;  2QIW A;  2WSF J;  2JP3 A;  1GMJ A;  4PV1 D;  2P10 A;  1FDI A;  4H13 B;  2E75 B;  1VL2 A;  2H88 C;  3AE3 C;  1UIX A;  2YMK A;  1ZOY C;  4OGQ B;  2E75 C;  1WMK A;  4XFJ A;  3FGA D;  1KIL E;  4I7Z C;  2E74 D;  2YIU C;  3O6Q A;  1YQ4 C;  2D2C C;  3GF7 A;  1Q90 D;  3D6Z A;  3AED C;  2ZT9 D;  4RKU J;  1DIP A;  1R8E A;  1ZME C;  2G3A A;  5M1B A;  3AE4 C;  4OGQ C;  1AJY A;  2QJP C;  2D2C D;  1U57 A;  3RK3 E;  1OW6 A;  4I7Z B;  2E76 D;  2WPV B;  4H0L B;  4Z1M H;  3LW5 J;  3B71 A;  3IN6 A;  2WQY C;  1RQV A;  3AEE C;  1TU3 F;  2OQQ A;  3AEB C;  3Q5R A;  1HF9 A;  1MKM A;  1VF5 B;  1NYH A;  2H89 C;  1KQF B;  3AEF C;  3Q1M A;  3D71 A;  3R4Y A;  1OW7 A;  2E76 C;  1YQ3 C;  2FBW C;  4TT3 H;  3IAO A;  4R4L A;  1S1C X;  1DD4 A;  2ZT9 B;  1HJ0 A;  1KQG B;  3Q5S A;  4U7J A;  2V7Q J;  4H0L C;  3ABV C;  2E76 B;  1KMI Z;  1PL5 A;  3D70 A;  4H0L D;  3AEA C;  4YTP C;  1K05 A;  2FXP A;  4H44 B;  3AE7 C;  2QJK C;  4IL6 X;  1VF5 C;  1PV3 A;  2QSI A;  3AE6 C;  3G9R A;  1VF5 D;  1RQU A;  2D2C B;  4GDO A;  2NZ2 A;  3Q5P A;  3Q2Y A;  1Y9B A;  1PIX A;  2BEZ F;  3AE1 C;  1OW8 A;  3GF3 A;  3SFE C;  5KKZ C;  3AE8 C;  2QJY C;  1JB0 J;  1ZP0 C;  4YXD C;  3AEC C;  2BEQ D;  2G8Y A;  4KT0 J;  2IDB A;  3EWK A;  2K9Y A;  3AE5 C;  3Q3D A;  3S9O A;  1IK7 A;  2MKV A;  5L8R J;  3SFD C;  4Y28 J;  2E75 D;  1EXI A;  2O01 J;  1ZRT E;  3H25 A;  4H44 D;  3AE2 C;  4PV1 B;  2E74 C;  2WSC J;  4H13 D;  3GLM A;  3D6Y A;  4PV1 C;  4H13 C;  1K04 A;  4OGQ D;  5KLI C;  2ZT9 C;  1KTM A;  1KOR A;  1DD3 A;  2FYN C;  2JO1 A;  4R4M A;  1EXJ A;  1FDO A;  2E74 B;  1OMI A;  3RL0 g;  3GMA A;  4H44 C;  2J5U A;  1NGM B;  3T97 B;  2WSE J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...