5L9AA

L-threonine dehydrogenase from trypanosoma brucei.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
HMPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
molecule keywords L-threonine 3-dehydrogenase
molecule tags Oxidoreductase
source organism Trypanosoma brucei
total genus 119
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l9aA00
4H16A 1LRKA 3X2EA 3A4VA 1P1IA 1YQDA 3JQ6A 4E30A 4YBZA 3WYBA 3CH6A 2CUKA 1UR5A 4P4GA 1TT5A 2XPCA 4B8WA 4JK3A 1UZNA 2Y0EA 1LSJA 2VHYA 2VZ0A 4OSPA 2NVWA 4JXKA 1KVQA 1ZIDA 1ISMA 2OXIA 2R00A 4D7AA 3H9GA 4R5MA 1DRUA 4EJ0A 2BI8A 4RL6A 3JQBA 2HDHA 1HDRA 4E5KA 4PLVA 2HRBA 4S3MA 4JBGA 4U5QA 4NBRA 1B0AA 3BAZA 3F5QA 3WFIA 1R16A 1CEQA 1V0JA 4LISA 5JAZA 4ZICA 3WSVA 4BNYA 4BO0A 1YS4A 1X7DA 2B4QA 2AQIA 5JDCC 3L6EA 1HYEA 1KEVA 1DRVA 3GPIA 3QE3A 3ZWXA 1A7AA 3GGPA 2CNBA 1M76A 4MVJE 2BGLA 2I99A 3GF4A 5AXCA 1D8AA 1DLIA 1OC2A 2B5WA 4BO9A 3CZRA 3LZ6A 2PH3A 2IDZA 2IE0A 3W4IA 2GPTA 4QECA 2JCYA 3QHAA 3T7EA 2QZZA 1A4UA 4I08A 6LDHA 1PL8A 3QP9A 2D1YA 2W2LA 4PLYA 4W7IA 3PI7A 2NU9A 1QYXA 4LMRA 5L3ZA 5TT0A 1PJQA 4BNWA 4YT8A 5JE8A 2QRKA 2WD7A 2FWMX 1PL7A 5IN5A 2VHVA 4DLBA 1T24A 4Q3AA 1AGNA 2D4AA 3K73O 1KEPA 1P0FA 4YT4A 4IJUA 4P38A 3CINA 1NPDA 4TSKA 3TRIA 3SC4A 2GCGA 3CSDA 1DC4A 3DTTA 3OM9A 2JFFA 2O7QA 4A2CA 4NIMA 1VE9A 4J91A 1FDTA 5HTOA 1DSSG 3GT0A 3VVBA 4Z3KA 1BVRA 2DT5A 4FFNA 3FNFA 4MP3A 5DT9A 4RPGA 4WPGA 3GVPA 3INRA 3HDHA 4K26A 3RQSA 1UDCA 1B14A 4AL4A 4AFNA 4A7PA 1U7TA 3PXXA 3QV1A 4W99A 3JQGB 4PFJA 3S2GA 3MZ0A 4A10A 2O3JA 3IAHA 3ZZNA 3G0OA 2FN7A 3OP4A 1DB3A 2HRZA 4Q3BA 4W4TA 4XYEA 4FIZA 3MTGA 3ZWMA 1ZBQA 4IUYA 4O59O 1EVJA 2VUSA 4XYMA 3ABIA 4PRKA 1I01A 3TOXA 4DC0A 4XQCA 5ILGA 2FPGA 2VUTA 4DMLA 4Z9FA 5EMHA 3SJUA 1HETA 2QYTA 4CM6A 2OOSA 1HWYA 3Q0EA 3CMMA 3NX4A 2VZ8A 3H65A 1AUPA 4U0KA 5JMWA 4CLOA 1IE3A 4GX0A 4Z0HO 2ZTMA 4CODB 1P0CA 3SJ7A 4OOEA 4ND3A 5CDUA 1XWFA 2AG8A 4KZPA 3KYCA 3PIDA 3S1LA 4EUHA 4FFRA 1I3MA 3FPLA 3E1KA 2GN8A 4BNMA 2PFGA 5JS6A 1T2DA 1C1XA 4AJEA 1P31A 4KUEA 3WIEA 1XQ6A 2ZB4A 5KJFA 4RVHA 3PHGA 4UEKA 5TT1A 3AK4A 3I9OA 3NEPX 3WGYA 1MFZA 1R12A 4CUZA 4I9UA 1M6HA 3VZQA 4CR8A 3GGGA 3OQBA 1U3UA 2JL1A 2OUIA 3Q1LA 1DPGA 2WTBA 4YAKA 2A94A 3G1UA 4YJFA 3V1TC 1XU7A 1T4DA 3JV7A 1DRWA 2P68A 4L74A 1DO8A 2UUOA 4J0EA 1QYDA 5JDCA 1ISFA 4TQGA 2NQTA 1HE5A 5F1OA 4BNZA 2PY6A 3ASVA 3FR8A 1TLTA 2NTVA 4E4YA 2VQ3A 4NJOA 4D44A 3QIVA 1IHXA 4FDAA 5F21A 1WNTA 3AWDA 4AJJA 4Q3DA 5EN4A 4E31A 2XXJA 4H3VA 4UVGA 1GZ6A 4WOKA 2O23A 4B3IA 4DTIA 2AQ8A 3L4BA 3GHHA 1E3SA 3IP1A 1NX6A 3GVHA 2EJVA 2VOJA 4XRRA 2VYVA 4II3A 5J23A 5HA5A 3VPGA 2GRAA 4RVGA 4URFA 5GZ1A 1HLPA 4WE3A 5EESA 4KWHA 2J3KA 4DUPA 1YL5A 2HJSA 1HZJA 3VPHA 3ETGA 1CETA 4GWGA 2QHXA 5LDGA 1NR7A 4YJGB 3E8XA 1Q1NA 4LN1A 5JPIA 3PJFA 1HE4A 3SXPA 4JBHA 3VTZA 5L51A 4J2HA 3JQCA 1UXKA 2X0IA 3ZWNA 3TSCA 3JYPA 2ZJ1A 3MTJA 3WBFA 1G1AA 3A14A 3GN2A 3KUXA 2DLDA 2O50A 1NYTA 4F6LA 1GUFA 1XCBA 3B1FA 1EUZA 4GLLA 2LDBA 4P22A 5FYDA 3CE6A 4ZGWA 4IDEA 1V3TA 4HP8A 4MPDA 2QX7A 1YJQA 3C24A 3LT1A 4NFSA 4QT0A 4XYBA 4BO6A 3AI2A 4BNNA 4BGVA 2NU6A 3LC1O 2Y1GA 4O63O 1I36A 3KVOA 4RF3A 4RQUA 1E1MA 3GC6A 1U3TA 1I10A 2DPGA 4BIIA 5IJZA 3FI9A 4CM3A 1D7OA 2VZ9A 5MGBA 3MEQA 3DBLB 4CM5A 5B1YA 3G79A 4CLDA 3U49A 4B8ZA 4BNFA 5CHEA 5JAQA 1DDOA 3GEMA 1A27A 3Q3CA 4L75A 3GZNA 4R3WA 1LC0A 4J7UA 4EI2A 4YEDA 4GSLA 3BHIA 3FN4A 1MUUA 1FMCA 3DBRA 3HB4X 1F8GA 4LK3A 2CDCA 3ZHYA 4ALMA 2CVZA 1ONNA 5DN9A 2C5AA 3T7CA 1U2DA 3OJ0A 5DF1A 4XYLA 1EBUA 5GY7A 1TVEA 4MVJA 4UVIA 4DIBA 3AU8A 3EUWA 1I3LA 1VJTA 1VI2A 3IOYA 4HFMA 3PJDA 5HM8A 2EJWA 3GOHA 1KYQA 4GPD1 2IZ0A 3MJCA 1YB1A 5BSHA 2FR0A 1SOWA 4OKIA 4PG6A 1LEHA 1TB4A 4B4VA 4RV9A 3LF2A 3RBXA 4Z3DA 1XGKA 4Y9DA 2YZ7A 3Q11A 1P1FA 1SB9A 3I1JA 3E03A 1ZO8A 2JAHA 1PQWA 5L9AA 3I6IA 4RZHA 4WLNA 3Q9UA 4YJHB 3IKVA 4KDEA 5ADHA 1A71A 4LVUA 3PEFA 5T57A 3TZCA 4EUFA 4J1TA 3SEFA 2HMWA 2JD0A 1EEHA 4BO8A 2JHGA 3O38A 3Q9NA 5JCXA 3OIGA 4ZQBA 2HK9A 4CV2A 1X7GA 4Q9NA 2BFOA 1U7HA 3PPIA 4AVYA 4WLOA 2W2LD 1ARZA 4L4SA 4BQRA 3WTCA 1YRLA 1VSUA 1E7MA 1Y8RA 1Z45A 5IZ4A 3ENNA 1XQ1A 2C2XA 4KQWA 1T1SA 4IXTA 1UDAA 1EDOA 2GSDA 2Z1MA 4E5NA 1HSZA 3ANNA 3E9QA 2PH5A 1I8TA 4XDZA 5A03A 3K8ZA 5HBRA 4MKZA 5EIOA 2CD9A 1PJ2A 5I9LA 1XYGA 5CP8A 3JD0A 5G0VA 3V2UA 2YUTA 4NBTA 4JX8A 5IZCA 4W6ZA 1SBYA 2OORA 3MCVA 4WCFB 2V6BA 4R1NA 2FSVA 4ZQGA 1X0VA 4YA6A 1W73A 4XEHA 4OXNA 3PYXA 3G17A 2AMFA 2F00A 3HE3A 4IQ0A 1YDEA 5I9MA 4A03A 4J0FA 4RDHA 1EK5A 2GZ3A 3G1TA 2Y68A 4XD2A 2DAPA 2P4QA 1JAXA 4UVHA 4JGBA 4AG3A 1VKOA 4J7XA 5G0TA 4AJNA 4QQRA 3ETDA 4PZCA 4YRDA 4A27A 2J5QA 2B35A 2QZ9A 1DIRA 2BELA 4HNHA 4IQGA 4L0QA 4O6VA 3BMOB 3LC7O 3V1YA 3WLEA 1Q2XA 2PKQP 5A9TA 4DA9A 3AFNA 4BNHA 1PGNA 1DAOA 1KC3A 3N74A 3GA0A 4XKJA 3DOCA 5A5EA 2Q4BA 4GX2A 5CAEA 1ML3A 5B4UA 1NASA 1JAYA 1BDMA 3IKTA 2JJYA 3ORFA 4JNKA 4EJ6A 2EW2A 5CEJA 2X5OA 4IQ8A 3PYMA 5CDYA 3SLKA 2P9GA 4R51A 1ZK0A 2FRDA 5DBFA 4HV4A 1DC6A 4LW8A 2J5KA 1DAPA 2NSDA 5L7YA 3HDYA 1KEUA 1GV0A 1MX3A 1WZEA 3WQRA 5JW6A 3WIDA 4ZRMA 3PDJA 3DL2A 5EPOA 5FEUA 3PJGA 1CF2O 4I5GA 3U0BA 3P2OA 1JKJA 3DHEA 4HY3A 1BRMA 4I9NA 2RBEA 1JDJA 2GASA 3DFZA 1PJCA 3OA2A 3DAGA 3EGOA 4ALLA 2FZWA 3ZW9A 3QRWA 3GZ4A 1DHRA 4D46A 2V6GA 2ZIZA 4R3NA 1RM4A 1PJLA 2GN6A 2VYVD 4PLHA 2RAFA 4ALJA 3RC9A 1MXFA 2YYYA 4U6QA 1K6IA 1H6CA 3DBHB 4DL9A 4D42A 1EMDA 2GO1A 1GQ2A 3K92A 1RKXA 2Y1OA 3IL2A 1E7QA 1BXKA 2X23A 3UKOA 2OO5A 2GF2A 3BYZA 5L7TA 5KJEA 5BT9A 4N5MA 3OICA 2E49A 2IYPA 1K6XA 1C0KA 1NNUA 1WMAA 4E12A 1EQ2A 1QG6A 1T26A 1QV7A 3B70A 4UULA 3WQSB 3WMXA 3GHYA 2HCTA 3Q2IA 3ZWWA 5KVQA 3COSA 3ONFA 3BXXA 3VZPA 2IRWA 3KOUA 4RPJA 4BV8A 1VJ0A 4MDHA 1VSVA 2X9GA 1ADCA 1JKIA 1R4NB 1V35A 3AY7A 4TZKA 5T6BA 4CM9A 1ZSVA 2PNFA 3N7UA 2JAPA 5IAAA 1HTBA 4TWRA 5HWSA 1E7YA 2C7GA 2HLPA 5U9CA 1I2CA 4RJTA 1ZEMA 1NBOA 2X8LA 2EG9A 1DIHA 4MIEA 3ZV3A 1QYWA 1F8FA 4OL9A 4OSOA 4UUNA 5ENDA 3VTFA 3VAZA 3WGGA 3D7LA 3BTUA 3MOGA 3U09A 1OC4A 2Q2QA 3WNVA 1A5ZA 3LF1A 1AN9A 3P7MA 4ZQEA 5I7EA 3D1LA 3PFWO 3AUUA 4IXWA 1E7WA 4XWYA 3BTOA 5COAA 3TJRA 2YJZA 2WJPA 3WDSA 4YYZA 2WEKA 1BDBA 4WLUA 3OQ1A 1S6YA 3I52A 3JQGA 4B7XA 3TZKA 2X22A 2PD6A 5G0UA 2BGKA 2JCVA 3ZWAA 4UUOA 2POQX 4BO7A 1N92A 1CJCA 3DOOA 2O4CA 3RKUA 1ULUA 3JQ7A 1R0SA 1ONOA 5G2OA 3PYLA 4DYVA 1JN0A 1WPQA 5L4NA 4CQMD 3GMDA 2O48X 2NVUB 1E6EA 3DZKA 4GKVA 4L9RA 3L4SO 4YQYA 4U6SA 3U4CA 4CLXA 4CR6A 2Q46A 1LLCA 3WWZA 4RCVA 4DRYA 4MVJI 1LSOA 5BNFA 1AXGA 4I5FA 5IG2A 3F47A 3GG2A 5L45A 1AHHA 2GERA 3ST7A 3LC2O 3LDHA 2TMGA 1EBFA 4QFCA 4XGKA 4YRBA 2VNAA 3LSYA 3UW3A 2VRBA 5EJ2A 3RI3A 1QYCA 1M75A 4J2OA 3GAZA 4FOSA 4UEJA 1EK6A 2ZCVA 4QX6A 4FD3A 1NQOA 1BW9B 1UUFA 2DBZA 2EERA 2PA3A 3B20A 4TRNA 2JFHA 1GPDG 1D1TA 5A4DA 2BF7A 1YKFA 3JYLA 3I83A 2AQKA 3KV3O 1PGOA 1VRWA 2VWHA 4Z0TA 5JFOA 3BIOA 3MJSA 5COBA 1YVEI 5JLAA 3NT4A 1HYHA 4XA8A 5TLSA 1YQGA 2YHIB 2GGSA 1HXHA 4D3SA 1SCUA 3JQEA 2G0TA 1JW9B 4BNVA 3LLVA 5A9SB 3KHUA 4EGFA 2X4GA 1NVGA 3GNQA 4HXYA 1CQJA 4IJWA 1NVMB 3OFSA 4LVCA 1R6DA 1GQQA 4NBWA 3TWOA 4IZHA 3RFVA 3DZFA 4XB1A 2IZ1A 1N1EA 4BNGA 4RDIA 2O2YA 3VPFA 2FR8A 4DQVA 3ANLA 1I5RA 2BHLA 1DC5A 3MWDB 3N58A 2B69A 1O5IA 2GN4A 1HZZA 1L7DA 4YJGA 5H82A 3W8FA 4ESOA 3C7AA 3E5RA 3LLSA 3UAGA 4TMFA 2NVBA 2W8ZA 2ZJ0A 4J43A 1I2ZA 1E7SA 1EFKA 3I4CA 2PWZA 1K89A 3ON5A 3QVXA 2Y99A 3VOSA 4BKQA 1GV1A 2CF5A 3F1LA 1DIBA 1D1SA 1XIVA 3VZRA 5JC8A 1E1LA 4UUPA 2CFCA 3I9NA 4BB5A 5KKCA 3OH8A 1ZH8A 4WCFC 1PQUA 5BSEA 4AJKA 3KRTA 4J9VA 4E0BA 3QW2A 3IUPA 3V2GA 3QWBA 5DCYA 4WLFA 1B15A 4U0JA 4QO8A 3ZV6A 3QJ5A 3QWHA 4FQ8A 3BMQB 4HADA 3ZW8A 4M86A 3OJOA 1T2FA 4HNGA 2I3AA 2P9CA 2XAAA 4IGEA 4BNXA 3VZSA 1IPFA 3DXFA 3IC5A 2ZQYA 1U8XX 2H1SA 4YAJA 4TVOA 5GZ6A 3TL3A 1OOEA 1FF9A 3GQVA 1FJHA 2DQ4A 1KOLA 1N1GA 1OMOA 1ENYA 4IJKA 4YAGA 1ZK3A 1GTMA 1SC6A 3C85A 1KBZA 2ZB3A 2W90A 3ZN2A 1HE3A 4G65A 1BXGA 5G0SA 4Z9XA 4DQXA 3K9QO 1FK8A 3WOHA 5BNIA 1HEUA 2NACA 5B12A 4CMBA 4PLFA 1WDKA 1R4MB 3PTZA 4LGVA 4BS9A 1N5DA 3UN1A 2WSBA 3AM3A 1VLLA 4ND4A 1H94A 4WNCA 3H8VA 3IMFA 1HDOA 4E5YA 3RJ5A 3RD5A 4BL5A 4R01A 5I7FA 4PG4A 1U9JA 3DAPA 3DQPA 3JQ9C 1MP0A 4D3FA 4XZ3A 3BZUA 1B3BA 1U5AA 5TRTA 3JQFC 1P33A 2X1HA 3M6IA 2OBNA 4D3DA 1BMDA 4GSKA 4FFPA 2E6UX 2RHRA 3HUDA 1V9LA 1CERA 1NWHA 3WB9A 1VPDA 3PLNA 3ZU5A 3TN7A 1GEEA 3HDQA 4PCVA 4CQLB 4U7WA 2HUNA 4MVJM 1JVBA 3U4DA 3K96A 3TZQA 2AXQA 2J3JA 7ADHA 1O95A 1X1EA 3F4LA 5A3JA 1OBFO 2VTDA 1RM3A 4YJHA 3FD8A 3H6KA 1F0YA 1LRLA 1XA0A 4IPTA 2YFHA 5CPFA 5HRUA 4GMGA 4BB6A 1WWKA 4YR9A 4CPDA 1X14A 4NBUA 1W4ZA 4FJ0A 3LU1A 4HFNA 1BG6A 4CM9D 1PWZA 3O26A 1E3WB 3ONEA 4I5DA 5AYVA 5TQVA 3HSKA 4TVBA 1ZVMA 3AW9A 4AJHA 4B4OA 4BGEA 1JKFA 3E82A 4NZ9A 2VWQA 2OBYA 1F12A 2NNLD 3UGKA 5TSDA 5ICMA 4CM7A 1F14A 1QORA 3HN7A 1KETA 1YBVA 4I5EA 3SBOA 1W8DA 2G5CA 4CMIB 3JYNA 3INTA 4HFRA 4PZEA 1S7CA 3OMLA 4WJZA 3HDJA 4Z0PA 1PJSA 3MJVA 4G5HA 4HUJA 3H4VA 3LK7A 3DC2A 4CMGA 5BNTA 3H3JA 3A06A 2YV1A 2D0IA 3GFBA 4R69A 3E9NA 3FR7A 4L4RA 4WLVA 3VVCA 2OFPA 1E6WA 1YH3A 1L7EA 1U1IA 2ZATA 3OHSX 1JWAB 4DXHA 2VHXA 1PWXA 3QWAA 4RF4A 3IQDB 2OZPA 2Y67A 1O94A 2PZKA 1SMKA 3W8DA 5TJ9A 4M49A 3PDUA 2HMVA 2AE1A 4FFLA 4N18A 4CLHA 5CG2A 4IBOA 4JJFA 5ITVA 4L76A 4Z6KA 1GAEO 1A9YA 4RVUA 3EVNA 3D5TA 4DVJA 2WYWA 1E1NA 1U2GA 3ZH2A 5TF4A 5F5LA 1LU9A 2BH9A 5F3RA 4C7JA 3RUHA 1G0OA 3RUIA 4MKXA 1ULSA 3IJRA 1LDMA 1Y9AA 1XDWA 2C7VA 2O7SA 3RUDA 2O3TA 3O03A 1KERA 4WEQA 4DIOA 4BNTA 1BHSA 3RVDA 1NXQA 5A1TA 3BMOA 1YOVA 1UAGA 2QIOA 3BMCA 3GR6A 5HS6A 5T67A 1YBAA 4G2NA 3TL2A 4Q3CA 1A4IA 2J3HA 3WG9A 1ZK1A 3VH2A 1I0ZA 5KIAA 3KLMX 3DONA 1PJ3A 3ZGYA 2HMTA 4E2YA 1ENOA 2Z5LA 2I5PO 3AOEC 4YT5A 1MB4A 4JCOA 4P4LA 3KB6A 4RGBA 1PR9A 3EHEA 3AFMA 3GDFA 1YXMA 4J4HA 4D45A 2B4TO 4J3FA 3WGIA 1B8VA 2G17A 1H2HA 3MJEA 2AEFA 4F45A 3S2FA 4UUMA 1EQUA 1N7HA 1RJWA 1YB4A 4NFHA 1DC3A 5DBIA 2Y0DA 3DBVO 4GLOA 1TT5B 1YL6A 1PGPA 3JD3A 2AA3A 3WMWA 3IS3A 1PQPA 4MVJG 5U1PA 1FDSA 1WDMA 2QYSA 3RU9A 2Q49A 3WS7A 1ORRA 1UDBA 3F6YA 3OBBA 2HO5A 4ILKA 4GL4A 4CUJA 1LI4A 3GPDG 3OEYA 1NQ5A 3VHRA 2FSSA 4GX5A 3JQ8A 1N2SA 4RF5A 3EMKA 3WWYA 3F4BA 3GDGA 1GD1O 2ZYDA 5DOVA 4E2ZA 3RUAA 3STHA 2AHRA 3QVOA 3DBHA 1X15A 1PS8A 4B4UA 4NMHA 4UVDA 2BFMA 1UH5A 3DR3A 4NFYA 1W0CA 2PLAA 1U8FO 3KYBA 4J4BA 4PLWA 4RVSA 4YXFA 2OP1A 3Q6IA 3JD4A 1YQXA 1EE9A 3RUFA 2Q50A 1YE3A 3D3WA 1GUYA 4OHUA 2JHFA 4JP3A 2J3IA 4AJOA 1ZKMA 1Z7EA 4MINA 4J90A 2O3SA 2X86A 5TS3A 2E48A 2VYNA 3G3EA 1FDWA 1XKQA 3WGQA 3KSDO 2AW5A 1P3DA 4NQZA 2W98A 1PS9A 2P2SA 3FBTA 1C0PA 1H6BA 3QQPA 1YJ8A 2FHSA 3DFUA 2X6TA 3EY4A 2HQ1A 2A4KA 2GNAA 5ER9A 3D4OA 4CQMA 3SC6A 5ITWA 2DTXA 2EKQA 4M87A 2DM6A 3ZNQA 4EZBA 4NJMB 2Q2VA 2VT3A 5C7OO 5C37A 1JA9A 1GYRA 3NTRA 4II2A 1MC4A 4QO7A 3RWBA 4C4OA 4KQXA 3JQAB 5JMPA 4IS3A 4YRAA 3GNTA 3UCEA 5DNAA 3JCZA 4BO4A 3FPCA 1QSGA 1ZW1A 1KY5A 4Q3NA 3U62A 4N54A 3PWZA 2Q4EA 2NLOA 3H9JA 2X0NA 3ZHBA 1M2WA 5DCWA 3NGLA 4OO3A 3FNHA 2ET6A 3B1KA 4BMVA 4DIFA 3V1UA 4E6PA 1UP4A 4RQTA 4A5OA 1JVSA 1DXYA 1E0DA 1EVZA 2Y1FA 4DPLA 3C3XA 3GUCA 3QWFA 2Y93A 4IM7A 1DFHA 5KWEA 2WE7A 3TFQA 4S1VA 2ZCUA 3OECA 1IZ0A 5BQFA 1U3WA 2HK8A 4XIYA 2EP7A 2VHZA 2YQ5A 1C3VA 1RM5A 4OJNA 1EVYA 4D43A 5BSFA 4H15A 1LDBA 5K6AC 4L4XA 4TRMA 2DBRA 2PK3A 1O89A 1QP8A 3NDIA 4NDNE 1T2AA 1U4OA 4MJLA 3IDSA 2J8ZA 4KUGA 3L07A 4J16A 1T2CA 4QUKA 1PU2A 1C1XB 2X58A 1Z82A 5G4KB 4CLRB 4YACA 3WJ7A 4K1LA 1PSDA 5A3VA 4BGIA 4M55A 4XJSA 1XELA 2VWGA 3WTBA 4Y67A 2NWQA 3V2HA 4CM8B 1PZGA 3R0IA 4HFJA 4BO5A 5ICSA 3HN2A 3RJ9A 2G82A 3QVTA 4OM8A 3SX2A 4BV9A 1UXHA 2D5CA 1H0KA 4YVFA 5KVCA 1PGJA 1BWSA 3GVIA 1L1FA 4DBVO 2E82A 3RAJA 3GGOA 1D4FA 2X5JO 2PGJA 3R3JA 5DDIP 1ZZEA 3C8MA 2GDZA 3GDOA 2YHIA 3WNQA 1E3EA 3ZI0A 2W2KB 2FMUA 2V6MA 5A05A 5JCJA 3R6DA 4EJMA 2Q45A 5T64A 4GI2A 4AJ2A 4CM4A 3PWKA 5TJHA 1RYEA 5KJ6A 1ADGA 1BGVA 3QA9A 3RUCA 3F9IA 1FXSA 3DZJA 1AE1A 4PIVA 3RC2A 4A73A 3WGZA 3BA1A 2HK7A 2IEBA 2D2IA 3ONDA 3M2PA 5A5FA 1BXZA 4FC6A 4XB2A 4INAA 4CMCA 4XQEA 1MG5A 1Y6JA 2P91A 1IB6A 3L6DA 1NAHA 4Y8VA 5FF9A 4NHEA 4BKPA 1B26A 3H5RA 3PHLA 4IZIA 3KYDB 1Z74A 3RU7A 3TNLA 4LCEA 3HFSA 3OJEA 4R5HA 3W6ZA 4CMEC 3VPXA 3BMNB 1GADO 3RKRA 1SB8A 3C7CB 4H7PA 3GEDA 1EUCA 2OMEA 3ADOA 2I3GA 2Q1UA 3H3FA 1LLUA 1YO6A 4ITUA 4BKRA 4BMNA 2B83A 4RZIA 4PLGA 3GY0A 1YBMA 1O6ZA 3NTQA 3L9WA 4TKMA 3NKLA 3RASA 4YB8A 3EDMA 1WDLA 3RROA 5JY1A 3TDKA 1O0SA 3PVZA 1D3AA 1Y8QB 1E7RA 1J6UA 1UZLA 3NV9A 4NBVA 2AE2A 2B0JA 2BKAA 4PG5A 3BMQA 3MJTA 3QVSA 5AXBA 3VH3A 5JYEA 4PRLA 2I76A 3INGA 3M2TA 4WLEA 2PTGA 4NNJA 4YPOA 3RCBA 2GN9A 1IULA 2EW8A 1VJ1A 2C82A 4FFMA 3QLJA 3D3EA 4LMPA 4BNLA 4GVLA 1ZMTA 5IDYA 2EGGA 5AOVA 5GZ3A 5BSGA 4PG7A 1E5LA 3ROKA 3S2IA 3ZWCA 2EV9A 2EHDA 1YGYA 5FI5A 3T4EA 3UXYA 3VKUA 5C7LO 4FN4A 3HB5X 1R37A 3PGJA 4IMPA 2EXXA 1LDGA 2C20A 3ASUA 1ZFNA 1LTHR 3FTNA 3MOIA 1ENZA 4BKUA 1J0XO 3F46A 2NU8A 3JQDA 2V6FA 3WX0A 5KKAA 1T2EA 2X5KO 1TEHA 4BUCA 5K0ZA 4ALIA 1CQIA 2NU7A 1MA0A 5KOIA 1V3UA 2NM0A 3AI3A 2CZCA 1P9LA 4FGSA 4JJGA 1H9AA 4IJVA 2RHCA 2WMDA 2CVOA 1UP6A 1Q0HA 1I32A 1E5QA 4OXYA 3NUGA 1DFIA 1I30A 3DMTC 3RBVA 3WR5A 2WE8A 4ALKA 4J1NA 1ID1A 3GLQA 8ADHA 1H93A 4R9RA 2X0RA 1TA4A 5TC4A 3L0DA 4NPCA 4U8GA 2VYND 1LX6A 2Q1TA 2P5YA 2R00C 4FCCA 3ZNPA 4NK4A 3C1OA 4LSWA 3ZHXA 4F6CA 1P1KA 4FBGA 4MVJH 2C5EA 1HRDA 1ISJA 5FWNA 1ZJZA 2V65A 2C54A 3BHMA 1RM0A 2NADA 3LT4A 1HF3A 2YFQA 1KVRA 4R41A 3EW7A 1E3IA 4JROA 4NU6A 1GYPA 2I65A 4KTVE 3E6AA 5EQFA 1B3RA 4CMAA 1EDZA 3MJ4A 1PL6A 2ZTLA 2AEMA 1CYDA 4BO1A 1KC1A 3ENKA 3JD2A 4I8XA 1NR1A 1HL3A 1NFFA 4J1QA 3D0OA 2AQHA 1EUDA 4HKTA 4KOAA 3IUSA 1KS9A 4CL8A 1VL0A 2FPIA 4EBFA 3BTSA 4PLPA 3K2EA 2OL4A 5DOZA 1HSOA 1O9BA 4ZQHA 1V8BA 4R9SA 1ZJYA 2WYVA 3GAFA 1P1JA 1DOHA 3NAQA 3GRPA 3FNGA 3RC1A 4NK5A 2JFGA 4DGSA 3KLPX 4KWIA 1NHWA 3H9UA 2VNSA 4WKGA 1MG0A 3L6OO 3HG7A 2BGMA 4E33A 4OKNA 5AXAA 5TGDA 5CDGA 2Z1NA 3S8MA 1HE2A 1OI7A 1B8UA 2XXBA 3JYOA 4FB5A 4P4NA 3U3XA 4DMMA 1WAMA 2B37A 4YJDA 4WOJA 4DBZA 4NH4A 3AM5A 4B3JA 3PJEA 4WEOA 1FDVA 5KJCA 1Y5RA 2Q1SA 4IDCA 4YCAA 4CMJA 2BFAA 1UXIA 1GFSA 3PHIA 5ENVA 3UHAA 3PHJA 4CL3A 2DFDA 5I7SA 1PEDA 2H9IA 2UVDA 4JN6B 4PLZA 4A0SA 4DQUA 1HT0A 2JD1A 1NVTA 3CIFA 3UUWA 4BVAA 3DTYA 2GUGA 4IIVA 1GCUA 1MXHA 5IXYA 1PZEA 2HKIA 1E3LA 4CV0A 4Y6PA 3FSRA 4D0RA 1DJNA 4PGFA 5IXSA 1B8PA 1X13A 3I23A 3KBOA 4FJ2A 1I33A 4L8VA 4RPHA 3ZNOA 5THQA 3I9KA 5I7VA 2BI7A 4MOWA 1IUKA 1LUAA 3PQDA 4WGGA 5CPBA 3FCOA 3RBZA 2XOXA 2EP5A 2EGHA 3KEQA 3ITKA 1I3KA 3RFXA 2NTJA 3PRJA 3ZV5A 3DMTA 3PK0A 4EUEA 2NUAA 3RSHA 2J5RA 4ZVVA 1PIWA 5JCJD 3O4RA 5F5NA 1IOLA 4ZQFA 2UAGA 1B16A 5A02A 1T25A 1E6UA 3U9LA 3OETA 5KCZA 5JO9A 1ISHA 1Q7CA 2CDAA 3NT5A 3DHYA 1CWUA 1YONA 2WDZA 5AXDA 5JDIC 4J9UE 4ALNA 5I9NA 1AHIA 3ITDA 4NG5A 3AY3A 3H9EO 1ISGA 3W4JA 4D0SA 4WK6A 1KY4A 3DBLA 3IJPA 3I9MA 2V7PA 2ZYAA 1N9GB 3CEAA 4R1UA 1OFGA 2O2SA 4GX1A 3CTMA 3WQQA 1ZUD1 3CMCO 4XGNA 4DC1A 4DREA 5EL0A 3NDJA 2ILTA 1TT7A 4EITA 2DUWA 1SNYA 4FS3A 1H9BA 2I67A 2VT2A 2FOIA 1PJBA 3NJ4A 4DPMA 1WLYA 4LSMA 3PHHA 4XCVA 5TIIA 2CSUA 4IDFA 1GDHA 3PLRA 2HAEA 2QG4A 3L4BC 2JKVA 1QKIA 5BR7A 2VRCD 4O1MA 3TF5A 1GQYA 1SZJG 4N5NA 1K0UA 4Q39A 4Q3EA 3U4HA 1ZXBA 3UICA 4DLLA 3M1LA 3TPCA 2W4QA 1R0KA 2NTNA 2ZTUA 4NU5A 1R66A 1SOVA 3R1IA 1P74A 3S55A 3HJAA 1FDUA 3QY9A 3MWEB 3UOGA 3U5TA 3M1AA 3UFXA 3CUKA 4KMSA 5L95A 4MO2A 1LNQA 4J4TA 1NPTO 1DHTA 1JU9A 4NJMA 2VN8A 4YAEA 1M67A 1Y1PA 3HFGA 2O4UX 4I1IA 4RLSA 3KSUA 1GYQA 3OQ6A 3T4XA 4EYEA 5DBGA 1KVUA 3D5QA 1ONPA 3JQAA 2JCXA 4UEOA 4BQPA 1C1DB 4DYDA 1M6WA 5DCUA 3E9MA 5JSFA 2DTEA 2PD4A 4R4JA 4RVDA 2BMAA 5HS4A 1QXSA 1RPNA 3TOZA 2RH8A 4ZA2A 1QLHA 2I9PA 2UUPA 1LDNA 1V3VA 2I66A 1P1HA 1HYGA 3NT2A 3WYEA 2P4HX 3ZU4A 4BHTA 2FP4A 1UJMA 3O8QB 1XU9A 5C3MA 1JLLA 4MP6A 4CMHA 3ZDFA 4LRTB 4FR5A 2YY7A 3PIIA 3NRCA 1AXEA 1F17A 1NWCA 3JQ7B 4IDAA 5G4LA 4GWKA 1J49A 1DIAA 2QW8A 1CIVA 2PKQO 5TX7A 4PG8A 1PJTA 4J1SA 3GVCA 3F1KA 4ND1A 1Y7TA 4AJLA 4QFDA 1ADFA 2PKRA 3PFFA 4WCFA 3OJFA 2VWPA 3DZHA 3P2YA 2X9NA 3ICPA 4XQ9A 1UXGA 1CRWG 4XJTA 4IINA 4CUKA 1LC3A 4E5PA 4XR9A 1Q7BA 1P1RA 3UCFA 5G4KA 2Q3EA 4CLRA 3GNSA 1LQTA 5JDIA 3B6ZA 5G0WA 2I6TA 1M66A 3C1AA 1PR3A 4CM8A 3GMSA 4KDFA 1KVTA 3ROMA 4ZJUA 1TI7A 4IDGA 2P9EA 3K5PA 3CKYA 3KXDA 5KVSA 3PZRA 2IXBA 4WNIA 2EF1A 3DB2A 5C7IO 1GPJA 5I8WA 4IDDA 3V5NA 4K6FA 1H6DA 4FFOA 5H83A 3KETA 2ZYGA 3KEOA 4RORA 2EIHA 5L7WA 5IFLA 2A35A 1Z75A 4OIMA 3OIDA 4OYRA 2W2KA 4JBIA 1NHGA 4KTTE 4O0LA 3ZU2A 5KVVA 4M1QA 3DZGA 3OA0A 3GUYA 3JQ9A 4MIYA 1HDCA 3WICA 1MC5A 3D64A 1SPXA 3JQFA 1UXJA 1EZ4A 2PR2A 3PP8A 2O3RA 4FGWA 3CXRA 4JJIA 1E3JA 3LT0A 3X2FA 4XDYA 3DZBA 4M89A 2YQ4A 5IDQA 1T1RA 2H6EA 1VKNA 4GMFA 3EVTA 1G0NA 5LCXA 1MLDA 3H7AA 1J4AA 2Y1EA 1DFGA 1GL3A 3KYDA 2Y1DA 4YTEA 3GFGA 3FWNA 1ENPA 5H81A 2CY0A 3BMNA 4DPKA 5JO0A 1U3VA 5L53A 3FF4A 2IYOA 1U4SA 1EE2A 1K3TA 2WM3A 4HWKA 4K28A 2LDXA 2O3UA 3ROPA 1NPYA 5IZCC 2D3TA 3IP3A 1LBEA 1XHLA 1QMGA 2C59A 2CF6A 4ZRNA 3WBBA 4GGPA 1P45A 1Z73A 3OEWA 3ZWYA 4F46A 1E92A 5F1PA 1Y8QA 2Y66A 3WGTA 3K31A 2RIRA 3TQHA 1NM5A 3LQFA 3ZHZA 1BVUA 3DAFA 4XRGA 2WD8A 4JP2A 3ANMA 4E13A 5CDSA 2PZMA 5B37A 3V8BA 1JWBB 3VDQA 3RUEA 4L73A 5ER6A 4K6CA 4PLCA 1WVGA 2DPHA 1ZSYA 3HZZA 4HBGA 2C29D 4LCJA 5IF3A 3KO8A 3W6UA 5A04A 2G76A 4E2WA 2DBQA 1CDOA 3BHJA 3S2EA 1LDYA 1BXGB 1E1KA 5DULA 4OMUA 1R4NA 1YB5A 5EINA 3WJAA 3ZNNA 2R2GA 4OH1A 1J5PA 5JNLA 4AJIA 1PS0A 4WECA 4AJPA 1NQTA 3DOJA 3FBGA 4BNJA 2DFVA 1K2WA 3I3OA 3PQFA 4R16A 1ZEJA 2WD7B 3C7DB 1QV6A 2IEDA 3FNEA 4R1SA 1LQUA 3AJRA 1GR0A 2Y0CA 2YDXA 1GZ3A 2PZJA 4FPXA 5GMOA 4MVJP 2H63A 1T4BA 1DEHA 1VL8A 2ZQZA 4P8RA 5JAMA 5L4LA 2FR1A 1X1TA 4DLAA 4J7CA 1SO8A 3W4KA 5MDHA 2D8AA 3DWFA 3RIHA 3UF0A 4B3HA 5FFFA 5CEEA 5L4SA 3K2BA 1I24A 3HNPA 3HWRA 4K9DA 4BOYA 1XLTA 1NQAO 1SEVA 1PZHA 3OJLA 2NV6A 3ADPA 3OSUA 5KTKA 1GZ4A 3PWSA 2ZKLA 1ZK2A 6ADHA 3VH4A 4R54A 4ZU3A 1MGOA 1XSEA 1BTOA 1DIGA 2VTEA 3NGXA 2RCYA 3QWIA 1NFQA 3AOEA 3UVEA 1LLDA 3GN1A 3QSGA 3GRKA 1ZK4A 9LDTA 2TMDA 3FWZA 2Q1WA 4TROA 2Y1CA 3AU9A 4M54A 3VDRA 4B7UA 4UREA 1MV8A 5ES3A 2NVUA 4CLOB 2YDYA 3NDRA 2HSDA 2WYUA 1B7GO 4GGOA 5KJ1A 3RC7A 3EYWA 2GD1O 2B4RO 4HX5A 4RPLA 3A28A 2NQ8A 3KYCB 3G49A 2X0JA 3I4FA 4GBJA 3LT2A 3JQAD 4ONEA 4LRSB 2OHXA 5T8KC 4GH5A 3JD1A 1WW8A 2IODA 1QLJA 3BTVA 3B1JA 3I9JA 3VPSA 4BGUA 3I6QA 2E4AA 3ZU3A 2C2YA 4I9HA 5COQA 1VM6A 1BW9A 4E32A 1RYDA 3ICCA 2YV3A 1H5QA 5AVOA 1Q7GA 1WZIA 5JBIA 1GU7A 1PX0A 2DVMA 2QRJA 1A72A 4N7RA 1EFLA 5CEFA 5AQ1A 1ZSNA 2FPPA 4YJFB 4IDBA 5A06A 3WXBA 1LDEA 1GEGA 2BRUA 2JD2A 3WGOA 1ISIA 4OOFA 1PJ4A 3I9LA 3L77A 4B79A 2F1KA 2YHUA 4PVCA 3SLGA 1Z7BA 5DP1A 3I5MA 3H5AA 1QRRA 4ZD6A 1QR6A 1IZ9A 3WYCA 1R0LA 2GLXA 4EEXA 3LVFO 5A9SA 3AUTA 3DO5A 3NTOA 1Q0QA 2IZZA 1VL6A 1XG5A 4YQZA 2Z95A 1DBVO 4IIUA 2EEZA 4TZTA 3VKVA 3NJ8A 2A9FA 3HADA 1YOVB 8LDHA 3BMCB 4KUHA 5CFZA 1GY8A 2PD3A 4QTZA 3U4IA 1C14A 4Y6SA 4GKBA 4J49A 4CM1A 2GYYA 2QRLA 5DP2A 3DZIA 1SAYA 3AUSA 5I8ZA 1PZFA 2DBVO 1I3NA 5T5QA 1IHYA 3W8EA 3GK3A 2DU8A 2CMDA 5TNXA 1Z6ZA 3RFTA 5A9RA 4B4WA 1EVIA 2AG5A 4GVXA 1IL0A 1MFPA 5IDWA 1E77A 2GR9A 4RVFA 3Q2KA 1IPEA 2YW9A 1ZNQO 4RO0A 3KM0A 3EAGA 4JLWA 3F3SA 2DUUA 1KIFA 3AM4A 1PTJA 1RWBA 2PGDA 2UV8A 3ZWOA 4WASA 2HJRA 2X7HA 2Y05A 1UZMA 3EZLA 4XGIA 3QVWA 5CDTA 4E21A 3KTDA 1LXCA 2BFPA 2VRCA 3LYLA 4CJXA 4QEDA 2UDPA 2PGLA 5EERA 3W1VA 4OXKA 4YAIA 4QSMA 5JC1A 5LC1A 1U5CA 1N8KA 3HHPA 2VOEA 4GAEA 2VHWA 3JQ8B 4AJ4A 4PZDA 4NR0A 4FOOA 3E18A 4Y6RA 4PLTA 1WXDA 1QYVA 4OGWA 1JTVA 4CV3A 2G1UA 1U28A 1Q0LA 2BLLA 3GZNB 1LJ8A 4Y98A 4R68A 1F06A 3GEGA 3TZHA 1OZAA 4G81A 1N9GA 4O5OA 4TKLA 4Z9YA 4FW8A 5K6AA 3DBRB 3ZWBA 4NI5A 1OAAA 4TRRA 4BNKA 2ZB8A 2GZ2A 3D3WB 1NFRA 4W9NC 4BMSA 4F3YA 2SCUA 4TRJA 4IY1A 2EKLA 1R4MA 4R1TA 1O8CA 1XR3A 3ETEA 4JIGA 4E3ZA 5C5IA 4AJ1A 1B2LA 5THKA 5JY6A 5T8KA 1X0XA 3KZVA 4W82A 5LDHA 2ZK7A 3GVXA 4M8SA 4MIOA 4WUVA 3ZWPA 4XIJA 1ADBA 1SEPA 5JYDA 4UAGA 3PQEA 3UH1A 5ILOA 3L9XA 4E2XA 1KEWA 2A92A 1YL7A 1G6KA 1C0LA 3CZMA 2RH4A 2X9VA 3EK2A 1LRJA 4OAQA 4YDRA 5JAIA 2ZB7A 4CQMB 1NAIA 4XYGA 3TFOA 4E5MA 1YWGO 3A1NA 3H2SA 4EDFA 5B4TA 4IGFA 3WLFA 4FJ1A 4CQLA 1IY8A 2CVQA 4JQCA 3C1TA 4B7CA 4BNIA 5KNLA 1JQBA 2DC1A 2P5UA 1HLDA 4D41A 1HDYA 3NYWA 4YWJA 5U4QA 1A7KA 2DTDA 1TXGA 7MDHA 5F1KA 1K6JA 1Y81A 3JQBC 2YV2A 4WCDA 5DZSA 2WWRA 4MKRA 2O3QA 1ZXLA 4XR4A 3FHLA 4XQGA 3P5SA 1C1DA 2EWMA 1LSSA 4GQAA 1E3WA 5EQDA 3ZWVA 2OP0A 3VH1A 1WP4A 4OQZA 2EKPA 2FY8A 3AY6A 4X54A 3A9WA 4ID9A 1R15A 4IS2A 4MVJD 1Y8RB 4MVJF 2AEJA 1HDZA 2VCYA 1YDWA 3CPSA 1A9ZA 1IYZA 2C0CA 3ROQA 1W6UA 3O8QA 4A26A 2FZEA 4CMIA 4ND5A 3VC7A 1Y9EA 3EZYA 3H9QA 4PN3A 2R6JA 3KSZO 4XX0A 5IN4A 4ZN6A 4OQYA 2VUUA 4CMEA 1XEAA 2Q99A 4ND2A 4J6FA 4YT2A 3ZCXA 3DEYX 5B4VA 1P44A 3DHNA 1HDGO 3WSWA 4D79A 1H6AA 4CV1A 3GH3A 1HDXA 2PZLA 3K6JA 2B36A 4BKOA 1HKUA 4ZHSA 4RLHA 4BO3A 3AOGA 3F5SA 2J6IA 3OF2A 4IMRA 2HMSA 1C0IA 1P77A 4FC7A 2D5AA 3E5MA 3GG9A 3O9ZA 4N5LA 2D59A 5JXWA 4EEZA 1K5HA 2ZTVA 3AUAA 4RF2A 1PGQA 2HU2A 5CG1A 3ULKA 1VC2A 3H2ZA 2XF8A 1NP3A 1V6AA 3JSAA 3D4NA 3H5NA 1X7HA 2E37A 4QXMA 4BO2A 4CMKA 4CLEA 2GZ1A 3DMYA 4C7KA 2H5LA 3ZV4A 1NTOA 1I2BA 1GCOA 3JTMA 5K9ZA 1LA2A 1Y5MA 3OIFA 4ROSA 2HMUA 4UVEA 3DDNA 4MP8A 1LLQA 4KP7A 3P19A 2OGUA 3TZ6A 3WFJA 2DKNA 5L40A 1UAYA 2BD0A 1GUZA 4W9NA 4DWVA 2IXAA 3IIEA 9LDBA 1WMBA 3D4PA 2QQ5A 4RPKA 2CDBA 3UCXA 4AICA 4BNUA 5IDXA 4EW6A 3FTPA 1BSVA 2B5VA 4CM4B 3JYQA 2UYYA 3FRJA 2Q2WA 1DJQA 3K30A 1H2BA 1ZMOA 3HQ4O 3PGXA 1KVSA 3R3SA 4W7HA 5FI3A 3WGHA 4CR7A 3EC7A 3SVTA 1DLJA 2C07A 1ZCJA 1N7GA 2PV7A 4FSHA 4PVDA 3AI1A 3E48A 3PZBA 1UP7A 1LSUA
chains in the Genus database with same CATH superfamily
3VYTB 3AWIA 3FWKA 4EOGA 2WIFA 3R5TA 2H1WA 5CU7A 4B6OA 5HUQA 1L0BA 4G0XA 4Q4DA 5DEIA 1YQDA 3A6GA 4LYDA 2QORA 3JQ6A 3AFIA 4R31A 1SQ6A 3WYBA 2CYAA 4YLEA 2QQEA 4P4GA 5IMSA 3LGXA 1RWPA 3QFCA 3NHPA 1FP7A 2B8EA 2WSSD 3ZE8A 4ECEA 1JIUA 4JXKA 5BN1A 1R5BA 2AK2A 2PEZA 4MUGA 4F5DA 1MT3A 1NVEA 1CQXA 4YRFA 1A76A 3IT3A 2BI8A 2HCRA 3HWX1 2WTXA 4G0ZA 2X14A 4RL6A 1T15A 4BLWA 4FM9A 4P35A 2BPOA 5I9SA 3X3HA 2AUMA 2HDHA 1HDRA 4H3HB 3SKVA 2MYPA 3UJ3X 4E5KA 1H3FA 4S3MA 1FUKA 5JS7A 1VIAA 5ALRA 1Z62A 5D8DA 1SPBS 2GBLC 3WFIA 3TNFA 4B81A 5HJ2A 1R16A 1GAJA 3IH5A 5FV7A 2VSQA 4S12A 1VDZA 4KQGA 4KX3A 2YASA 1A3CA 1ND5A 3GZJA 2XCUA 3UJ9A 2C5HA 1DJOA 3L93A 1V5FA 4BMPB 5LOVB 2CXHA 5TPWA 4BO0A 1IWOA 3Q85A 2P3QA 1S0UA 1RZVA 1UKBA 3KQPA 4DR5B 1HYEA 2ACVA 1DRVA 2O0KA 3CU5A 4NCHA 3GGPA 5AKJA 3ZWXA 1NJGA 1U02A 1U2GC 4K9NA 1RLOA 1F4LA 1JZQA 2X15A 2G63A 4H0CA 5LKAA 2ZB2A 4L8YA 3QX8A 3GV0A 4B84A 1OU0A 2PUDA 2MSKA 2MSDB 1D8AA 1TVCA 4Z4GA 3SZMA 1OC2A 2B5WA 2DQYA 3DZDA 4BLSA 1YA6A 1ID8A 3LBAA 3CF4A 1EFUA 1RQGA 4BFZA 1URPA 2PH3A 4IMJB 3TM5A 1L5VA 5J4LA 1ILEA 2BFEA 4B2YA 1GZ5A 4OXXA 5HJEA 3S2YA 1OZGA 4N0EA 3T7EA 2XDYA 5CH8A 1KFKB 3KR2A 3ND9A 4R2IA 3TJMA 3JZMA 3O2JA 1JIKA 3QP9A 2D1YA 3I39X 3K9LA 2QVZX 4OHWA 4PLYA 1QWSA 2HN9A 2PJUA 4RY9A 2P1DA 4A92A 3AUJB 4LMRA 2PEYA 4DXAA 4F06A 5KU7A 1PJQA 4K6HA 3FA2A 5JE8A 2WD7A 1AHPA 2QSYA 2VHVA 1EIZA 3T9EA 5CX1B 1UKEA 1USWA 2N1BA 2JKYA 1ODSA 1U9YA 2FUG1 3FNRA 3EFOB 3WWDA 4CTOA 4ZI7A 1T8RA 2AZTA 2G1JA 2J5BA 1I7NA 4YT4A 3SX0A 4YAFA 5F3WB 4G0UA 1IOWA 2BM8A 2WSIA 1CNMA 1QM5A 4TSKA 1HE8B 4GPEA 4TV9A 5BV0A 1RJGA 4OLFA 2JLAA 4PHGA 4F3KA 1MC8A 2FPSA 2GK4A 4ZT5A 3TTTA 1U1FA 3SK0A 3WRYA 3EXFB 1NUTA 4B3CA 1JBKA 1GGHA 2ZDQA 3IRUA 4GQBA 1DSSG 4CF5A 3OQIB 1QCCA 1EXNA 2BM1A 4M8IA 1M2NA 3A4YA 3FNFA 4HEJA 5E0OA 4WPGA 3INRA 3AC0A 1KXZA 2J87A 3UAOA 4AFNA 5ERXA 1JYFA 3QV1A 3OKAA 2GAJA 3DLHA 1CUCA 3MZ0A 5A4FS 4KFTA 4PO1A 1LZLA 2FN7A 3G0OA 3OP4A 2GEFA 4Q3BA 2WHRA 4XYEA 1V6CA 1K8QA 4ZJPA 3MTGA 2F3TA 4V0OA 5B3KA 1JAIA 1EVJA 1W19A 4RK0A 4XYMA 1D7AA 2JAOA 1PFKA 3JAKA 3KG2A 4PRKA 4B8WA 3K15A 4DC0A 4XQCA 4C22A 4Q9DA 2RARA 5DX1A 3WLLA 3DMRA 2XH8A 3L79A 2AEEA 4MQLA 5B1DA 3HCOA 3PL1A 1HETA 2YOFA 1GAWA 1P6XA 1JEYA 3IXLA 4IHAA 1OI4A 1KAHA 2WNHA 2Z5GA 4M0CA 3BRWA 2QUKA 3NX4A 4G5GA 3O82A 4AY4A 1RRFA 2JFXA 2XXAB 4K7JA 1PD0A 4FCVA 1AUPA 3OQNA 4L8LA 1NVBA 3COYA 5DLEA 3A05A 1GAXA 2HNBA 2D7DA 4F3TA 9GPBA 4YRGA 1H2XA 1XV5A 3A6HA 4ND3A 3QEKA 1NI4B 2VJMB 4JI5B 2AG8A 3BH7A 3KYCA 4D8VA 4EABA 1NONA 3PIDA 3S1LA 1FTSA 4FFRA 1U5BB 3FCSB 4G41A 3NIBA 1OCEA 2RKBA 2GN8A 1N5KA 2ZE5A 3QBVA 4I4IA 3SBEA 4BNMA 1T2DA 1H23A 4EAAA 1P31A 3EXIA 1L6RA 1XQ6A 1YQUA 3PHGA 3H1FA 1II0A 5CW1A 2ZWPA 5HNKA 1Z0AA 3GNLA 1F2VA 2GSWA 5KNDD 5FBLB 1CYEA 4D9KA 2OFWA 4RCYA 1SHTX 3F3MA 2GBLA 4DLPA 2LXNA 1WE2A 4I9UA 4V3BA 1QCDA 5EIWA 1LTKA 3SHOA 2IYSA 3OQBA 3HYTA 3V8RA 1QGOA 2G5GX 5EA2A 1DPGA 2A94A 3E9CA 4YJFA 2IYLD 1NQVA 5AH0A 2OD2A 5HIMA 1T4DA 3ZHTA 4JVSB 4D9CA 4HUQA 1FU4A 3TAUA 2VF4X 3DNPA 1ISFA 1O3YA 3L82B 4TQGA 4X00A 5F1OA 2PY6A 2ODEA 1J7KA 5IANA 2VQ3A 4PIPA 2VC2B 4D44A 4MUXA 4FDAA 2H2DA 4B83A 3HVHA 4F12A 3OM1A 4F4FA 1QANA 3KLNA 4RQAA 2GESA 4E1AA 4E31A 1KHTA 5E3IA 5D5PA 2I7TA 4ZVMA 3CA8A 1W76A 2PMBA 2ZU0C 2PQ2A 3R9KA 4C0KA 3VSAA 2AQ8A 1KGDA 3L4BA 1JF8A 4HX2A 2OE2A 4BJHB 1NXSA 2EJVA 2ZYIA 2J9ZB 1MCZA 2QMOA 4XRRA 1KO7A 1EFAA 1MIOA 1VLJA 4MUJA 4X1KB 2Q3MA 2X6QA 1K0FA 2WMYA 4M0PA 1AVTA 4RVGA 5FKJA 5EESA 4E7PA 4EL5A 1HZJA 5ULLA 3TLGB 3ZEAA 4YUYA 2QHXA 5LXTB 1YV9A 2HTEA 1BIFA 2ANCA 2WVHA 2P4UA 1PEKE 2Q4OA 4UU1A 5HP4A 4E1BA 3D0RA 1O0BA 4A8HA 3QNWA 4L3WA 5NLLA 5I4KA 5FUXA 1TC1A 2GKSA 2XYHA 3OZSA 3HJTA 4JJ8A 2RBGA 4WV3A 4RD2A 1KJYA 4P5PA 4AZ0A 2ZJ1A 3I0ZA 3JTEA 5E6SB 3WBFA 4DIDA 2GFIA 1I7DA 4JFRA 3TYXA 4C4SA 4F6LA 1W59A 1PHRA 1NF9A 1XCBA 1EUZA 3B1FA 4ASUA 4K3UA 2GZMA 1ECCA 5G40A 4TL7A 3BOSA 2H5EA 3SMQA 1YJQA 1RKQA 2JGNA 4MRPA 3O6VA 2DERA 3RVQA 2JI4A 5BWCA 3AI2A 3VNRA 1QO9A 1TRHA 4JKOA 1JFFB 2JIBA 1C5KA 3A7EA 3L0SA 4BU1A 1SCDA 3LC1O 2Y1GA 4MWSA 4EPRA 4ZYLA 4ID3A 2OEPA 1GKLA 1IRXA 2I7XA 3AEYA 3GFVA 3Q6MA 4IEIA 1E1MA 4RF3A 2PVCA 4CKEA 3M5CA 1DVRA 1U3TA 2KS6A 3MWJA 2A58A 1VHJA 5DFAA 3SF0A 1QBGA 1L7VC 1XO1A 5BV8A 2NVOA 4Z9AA 4EY8A 2R7KA 5IJZA 3FI9A 3OM8A 2GFQA 3IXMA 4RTPA 4HAYA 2FLWA 2A9KA 3DBLB 3WAKA 2XEDA 3B6MA 3G79A 1WP9A 4M9RA 1KDZA 1U4NA 3D31A 3LLCA 2R62A 5E8RA 1A27A 4R3UC 5AR1A 2H08A 3Q3CA 5MGNA 4YEDA 3WLMA 1QH8A 2EX0A 4DCJA 1L1EA 4S0XA 2XVAA 2AKYA 3FPAA 1MBZA 2NZVG 2QTCA 3OX4A 1PG0A 4D6YA 1DIOB 3ZHYA 4CEJB 2CDCA 4DMKA 2GM9A 4MKFA 1U2SA 5AIAA 2MDTA 1XALA 3T5AA 2EFJA 3GRRA 2VRNA 4FX5A 4ZOBA 3B8EA 4QOEA 5DN9A 4AX4A 1ECLA 1U0GA 1W1IA 1EJ2A 3OJ0A 2DFPA 2P4SA 3V8NA 3WBJA 2X42A 3USZA 4DIBA 1TJ4A 1MVLA 1C7IA 4MVJA 5DHUA 3AU8A 4G1FA 3IOYA 1VJTA 1VI2A 3QEMA 1ZUIA 3PJDA 1ZYUA 4GPD1 1LWOA 1KH3A 1IUPA 1QWOA 3GFQA 3MJCA 1R7RA 2VSYA 1YIOA 4LNHA 5K2MA 2A14A 4PG6A 2KM1A 3WLTA 6YASA 1KOFA 5B7NA 1TFRA 3LF2A 5AKEA 3BL5A 4ZXFA 2FH5B 4AWBA 2V6IA 3VUEA 1P1FA 4WERA 5BN3B 5GVRA 2O8EA 1CUAA 4W8HA 4ZHQA 1FPQA 3JR3A 1YFLA 3ORRA 4DV4B 1ZHFA 2Y4NA 2R5FA 1BCSB 4AKEA 4C06A 3AHFA 3CLKA 3EIQA 1TJPB 5K3FB 3VO9A 3A3PA 1TIKA 3FDXA 3IQWA 3PEFA 5CURA 5FUMA 4BVGA 4EUFA 3TZEA 5JHHB 4MQFB 4HWPA 1LPPA 2JD0A 4BNDA 2UUCB 5JCXA 4GKKB 3BXPA 4AECA 4LZJA 4ZQBA 4F4DA 2RE8A 5HMMA 4IV5A 4CV2A 4ARUA 3T1NA 4WLOA 1ZGCA 1BWPA 5AOAA 3RT1A 4D97A 1L3IA 2WAYA 2W6ID 3GL9A 1XCOA 1WV0A 3UT5A 4DA4A 1FMFA 2O8VA 4OU4A 2RHDA 5MN5A 1POWA 2X3UA 1E96A 1X9HA 4B6GA 3IE2A 1CB0A 4F1JA 1LF0A 2IA5A 1GUAA 3QUTA 4KCGA 3CKKA 4TWZA 4XPIB 3HVKA 3WKDA 1EDOA 4R71A 5F23A 3TSOA 3AHDA 4FLFA 3RWMB 2WF9A 5A03A 3AEKA 1H8EA 3K8ZA 4TV9F 2GPBA 1KP3A 2G09A 5EIOA 4LOHA 5BNWA 2CD9A 2XB6A 2MSEB 5I9LA 3WK5A 1G2IA 3AF2A 1XYGA 1G6Q1 4BMZA 1CR0A 1D4AA 3JD0A 2Z4TA 4RZ2A 5G0VA 1IZZA 2QE6A 3AX6A 5FO1A 4NBTA 2HDWA 2IHYA 3T06B 4NZNA 2OORA 4WCFB 4OMFG 4CEHA 3A3OA 4PYLA 1JG6A 5TGZA 5J59A 3NFRA 4ZQGA 4XGRA 4UXJA 2P0AA 4YA6A 5KYWB 4RZUA 1G3QA 2UZ1B 1XF1A 2V54A 4CIAA 2MSCB 3A4MA 3UTCA 4QKQA 1E6MA 1ESDA 1VE1A 1G5RA 2AMFA 3WB0A 1J25A 2I62A 1PE0A 3HK2A 2J46A 1GZ7A 1ZNWA 1YBFA 3QMVA 1JHVA 4J0FA 4NPHA 3CB4A 1EK5A 3G1TA 5HDBB 5BO5A 2AXNA 3CXUA 1I7LA 2P67A 2JK1A 4RK4A 1WS6A 1NBIA 2NO9A 3E9RA 3LAWA 1VKOA 5LQRA 2PJDA 2Z9BA 2ZUCA 3OHPA 1F51E 3ETDA 1NXWA 3MRSA 4FW9A 4KXWA 1YAJA 1TCVA 2NZ2A 2QZ9A 2A9JA 3GEPA 4YRJA 4A27A 2GPNA 4A6PA 3U6BA 3K5HA 7REQA 2PSHA 2ZI9A 4L0QA 4JLMA 1ODKA 4FS8A 1TCUA 1I2DA 3CX4A 3V1YA 3QJYA 4J2TA 4B0PA 2OAP1 3WA6A 1H2EA 1JBQA 1Z88A 2DCMA 2QN3A 4X24A 1DAOA 1IOZA 1FQKA 3GA0A 3K3PA 4XCQA 4BNHA 5I7UA 1MAVA 5JAOA 3DLPX 2ZWMA 3HKEA 1DDIA 3KOZA 4QJIA 1WSWA 5FPQA 4UXHA 3F98A 3G5LA 3ORFA 4G26A 1NY5A 2EW2A 1AKUA 1A98A 5AFSA 4Q4LA 4GMKA 2O2HA 4R51A 3A1CA 3D7NA 4K2AA 2FRDA 3HKDB 3V1KA 4B3GA 4H18A 4V2UA 4ZT3A 3PENA 1GV0A 1MX3A 1WZEA 3TXAA 5JW6A 2X2EA 1SHJA 3GEHA 4G01B 3TO5A 5EPOA 1WHSB 1G21E 1FTWA 3CZCA 1Z6PA 2JF0A 4P9NA 4PCLA 2G5PA 4Y9TA 2PUWA 1T9AA 2NXWA 1NQXA 4NYMQ 3U0BA 3P2OA 4F0JA 3DHEA 4BWYA 1ZX1A 5JRZA 2NYVA 4ANFA 3ZY4A 2GASA 2NX2A 3SS8A 4N0PA 3BB3A 3DAGA 3QFFA 2FZWA 2JH8A 4MW6A 4AQ7A 3H04A 3I2FA 1DHRA 1ESEA 4G9EA 3P32A 4D46A 1VZ3A 3G9XA 2ZIZA 5FBHA 1TAHA 2AIRA 2EJBA 4FDMA 3E4DA 4KQJA 1GA4A 2I6UA 4PLHA 1E2GA 1QONA 2RAFA 3MCTA 4G0PA 3CUVA 4ALJA 2AJ8A 3BIJA 1NN0A 2ZRHA 5SZKB 3RC9A 3SF8B 4A6XA 4JUDX 3V4FA 5ITZB 4OHMA 5ADWA 2H2AA 2GN2A 4F7DA 3BK1A 3IIIA 4LTMA 4KR9A 5TVGA 3FB4A 5KKNB 2ZDHA 4GKAA 4FYPA 3VHLB 1KO4A 4BRUA 5JSQA 1WDTA 2WBLC 2ES4A 1KFCB 1P0QA 2GF2A 2OO5A 2XQIA 5AVQA 4EVQA 4N5MA 2YIDA 1BJKA 1RBQA 3OICA 2E49A 4KIGA 3ZUPA 1VSQA 3ZHVA 3IDOA 4AUKA 4E12A 1W581 1XPUA 4LTDA 1N5OX 1EQ2A 2GJKA 1XZKA 1QV7A 2P2NA 4CG3A 2XZLA 3WMXA 3Q2IA 3ZWWA 2D0OB 2GJ4A 5ALOA 1W75A 4EKNB 3NTUA 5KDOA 3VKHA 2YVQA 4RPJA 1RLIA 4YDHB 4L8FA 3KQWA 3R6GA 2X3FA 2EKBA 4DDMA 3FPBA 2P77A 1VSVA 2X9GA 3ZGOA 4UBMA 5EJ7A 1R4NB 1WCIB 4EZEA 3R5XA 2X19A 1QGAA 3ELUA 1DRJA 3CEJA 4URWR 5BT8A 1ZSVA 3I42A 2HQOA 1IOVA 2JAPA 2R1VB 1TDJA 3B1XA 3QMMA 2ZSUA 3ZJUA 3BXFA 1E9AA 2HLPA 1Z2PX 4RS3A 4LZZA 4IGIA 4KWEA 1BDHA 1TQDA 5EKUA 5I01A 2FEKA 4XSHA 1TKAA 3RVDA 1U2RA 3NNNA 2E9SA 1TCBA 4JIMA 4CTJA 3DG9A 1E32A 1J23A 1KDOA 1GIAA 5DM4A 3RF6A 1EVLA 1OAKA 2GEVA 3OIWA 7REQB 1E2HA 5JPCA 4GG1A 4ZFNA 4DILA 2OA0A 3VAZA 1ZICA 3AR7A 5AHWA 1ZGAA 1Z5GA 4Z49A 4MCIA 3U09A 1OC4A 1TTQB 2NG1A 3QKIA 2WKRA 1KRXA 1DTEA 1N5LA 2X8BA 2QRMA 1RZRA 2VJPA 1K7CA 3EXFA 1L4NA 4I6JA 4ZKEA 3KVNA 1HTWA 3BTOA 2AJTA 3OQIA 5FCDA 4A0GA 2VHCA 2UYOA 3LYHA 3QFRA 4AY2A 5GM1A 1JR2A 3FUVA 1XXHE 3WDSA 1MDBA 4DG5A 4BEJA 4GP7A 4X1YB 5EWMB 3MGKA 1QIDA 1T10A 3HV2A 4KB5A 3ACBA 1G9XA 4C2TA 1QKKA 1W0KD 2PH1A 3I52A 4BGDA 2PD6A 5G0UA 4YQFA 2NSJA 2ZYRA 1PFQA 2CZQA 4FQ5A 2VAPA 3GCGA 3HY4A 5EPEA 3CSSA 1DAEA 3H8SA 4EX7A 4BO7A 1KEZA 1TYCA 4R8VA 1N92A 3UHJA 4Q4CA 5T6MA 3G8BA 4DYVA 4CI9A 3NB0A 2WILA 5L4NA 5AKYA 4CQMD 4ZHQF 4YQEA 1C9KA 5J2TB 3WLIA 4CETA 3FHOA 4CLXA 1BGWA 3BWMA 3WWZA 4ZTBA 4QQKA 3DFFA 4GWLA 5BNFA 4XIGS 5JZSA 2WQ7A 1JFSA 3SLRA 5FL7A 3GG2A 3LDGA 5GJBA 3QPVA 2GERA 5DNEA 4KO1S 2VJMA 4L85A 1EBFA 1U5BA 4Q9AA 4YRBA 2VNAA 5AVSA 3PR3A 4GEKA 3UENA 3AL2A 1QYCA 5CXXA 2QZ4A 3T1OA 2R47A 4DM7A 1O96B 3GAZA 5KREA 4X7RA 2XUKA 4UEJA 4HRXA 3RGGA 3UYLA 1UUFA 4TRNA 1AIPA 1F2TA 2PA3A 2R8OA 4FZVA 1YKFA 1CUSA 1XZGA 3KZNA 1K8YB 2XHEA 1TK2A 4B33A 4DNPA 2FEPA 2VWHA 4HS4A 4Z0TA 3ZJTA 4IG4A 1PT9A 3BIOA 4KQEA 4DUZB 2YWHA 5COBA 1WX1A 1P5ZB 1KF0A 3NT4A 4AF8A 4DM4A 3B51X 2QVLA 2EZ8A 1WZUA 1T0PA 5KEIA 3NTVA 3P4UA 4OB8A 1DQRA 1JAZA 2YHIB 4XGQA 4YO8A 1QX3A 1HXHA 5SY4A 3FCAA 3SJZA 3DOEA 5LLDA 4LHXA 3JQEA 1H5UA 3CLTC 3C3BA 1JW9B 4Q9IA 3LLVA 4BNVA 4A82A 1RRVA 1U90A 1JEEA 4EGFA 3A9TA 1RQPA 1E69A 5JHGB 2WLSA 2K6GA 2VCEA 4LVCA 3CZ9A 3RVMA 3WKBA 1BHO1 1OX5A 1B8NA 1Y8AA 2BKXA 2WR8A 3DZFA 4BNGA 1DTWB 2WINI 4PS0A 2YS7A 4RDIA 5KOJB 3O8CA 4DLSA 1E1RD 4P84A 1G17A 2C0QA 3KJIA 4RZSA 2ZZNA 3OTQA 1QFSA 2BT4A 3W1EA 1N6NA 4QBIA 2C42A 4YAOA 1B2RA 2JFQA 3LTNC 1M8PA 1SVKA 1DC5A 2BHLA 2R6GA 4LYEA 2WT4A 4Z3OA 4BZXA 1JP7A 1PR5A 1S8FA 1EXDA 5LXTA 5E4YA 4MWCA 5H82A 3W8FA 3ESRA 5HG0A 4DCPA 2OK8A 4GIBA 5I8PA 3IAAA 4TMFA 1P6QA 1OIVA 1WW3A 4QFMA 1ZWLA 1PUXA 2NVBA 4KXYA 5B6IA 3KPUA 4NFHA 3C48A 3TUIC 1EFKA 4BKQA 3H2IA 1N6IA 3VOSA 2EU8A 1L4YA 1IUOA 2CF5A 2VPYA 5B3JC 2JGJA 2QX6A 5E6SA 3E35A 4G3XA 3TBKA 4HB4A 3NCTA 4P4UA 3KJFA 3DV2A 2HRQA 4QRIA 4WCFC 3OVMA 3T34A 2AX4A 1PQUA 2EIXA 3WK4A 4J9VA 1V5WA 1UFOA 1TKBA 2Y27A 4LBYA 3QW2A 3RJTA 3U3KA 3FCEA 4M0LA 4ZOAA 2RGXA 3DTVD 4NJEB 1W36D 1FFWA 4C4YA 5K3DA 1UBHS 1JFFA 3DEIA 4UMFA 1LFAA 1HNNA 3VSCA 1GTSA 3QJ5A 2EARA 4HLUA 4UCQA 3ZW8A 1ZN7A 5H9WA 2W2PA 3ZK8A 1T2FA 4PCAA 1Y3DE 4HNGA 2P9CA 3ZDDA 1TK9A 3DL7A 3IC5A 3PR1A 5KYTA 1M8GA 1QBKC 3DMGA 5HIAA 1M2JA 3GQVA 2LW7A 1OFIA 2DQ4A 2OCXA 2V98A 1DV2A 1LQ2A 1OKKD 1DU4A 1OMOA 1KOLA 4YUWA 3DP7A 1AV7A 4YO7A 2GB4A 2X0KA 1W49A 4LJ9A 4AS2A 2F3PA 4NDAA 4YAGA 1NOJA 2C4MA 4M0KA 4MDEA 1KMHA 3E3AA 3ZN2A 1HE3A 4Y7CA 4G65A 2MSWA 1TX4B 1MHPA 2JBAB 2OD7A 4F96A 2CL6X 2WM2A 3WOHA 4WBNA 1NVXQ 3M70A 3ZYZA 4CEJA 1XAHA 1ONBA 1NIJA 4JYMA 4PLFA 2V8BA 4ZO7A 4RADA 4ZQIA 1IQRA 1OGIA 3HDTA 4LGVA 4MYRA 3THSA 3W9SA 1FDOA 4BS9A 4PPNA 1OBHA 4LJKA 4EG3A 3STUA 4LHVA 4IZ6A 1BS9A 4M0DA 4PNPA 3H8VA 2OLEA 4BE4A 4Z7JA 5JASA 3BMXA 2MIIA 2I71A 4OHVA 4R01A 2BVNA 4BL5A 2NU8B 5I7FA 3KJQA 4OA5A 3SQNA 1U9JA 4LV8B 3JQ9C 4N40A 4YK7A 2IPLA 4DDWA 5EI5A 1NLZA 1IJKA 1VE5A 1KPIA 1CQIB 1P33A 1P5FA 5FYQA 1AKVA 3M6IA 3A6FA 3LWDA 2C7RA 4G24A 5BWMA 1N77A 3IT0A 1BMDA 2FU5C 4GSKA 3V4OA 3HUDA 1NWHA 3ZZTA 5LOVF 4GBGA 4DFDA 3UK1A 2VJNA 3K8QA 3D3KA 2XKJE 3Q3GE 1GEEA 4KQMA 2H2WA 2PS1A 5DHAA 5BN3A 4DR4B 2PHZA 2IEYA 1GA6A 4MVJM 4RMGA 1XX6A 2FFAA 4KQFA 4HH3C 3K70C 4B46A 7ADHA 1BCSA 4HYTA 4ZAZA 2IHNA 1X1EA 4GXQA 1W0JD 1T13A 3F4LA 3LWZA 4D4IA 3EIHA 5K3FA 2KQUA 1XA0A 3A7DA 4IPTA 2PV0A 4PSKA 5CPFA 1NLUA 4K86A 1T2NA 4MQFA 3FXAA 4BB6A 1BD3A 1WWKA 4QUEA 2EBHX 1U2QA 2RFLA 3ZH9B 4C6HA 3LH5A 4CPDA 4NBUA 2Q4TA 8MHTA 4FJ0A 4MH0R 4I5DA 3OF3A 1S2IA 4N3CA 3AP3A 2AFHA 3DHWC 1ZVMA 1VYHA 4QHTA 1ACLA 1RWVA 2W6NA 3E82A 1Y9DA 4NZ9A 3KQHA 5GINE 2OFOA 3UGKA 1GSIA 5EUQB 3QPWA 1B00A 4WA8A 2ZS8A 3EIOA 1J2RA 3LL4A 3V8PA 4Q48A 4CFSA 1DINA 1ECJA 1KETA 1YZHA 4I5EA 1HC7A 4EMTA 4BMYA 2ZXUA 3RB8A 1ZAKA 3EIXA 3JYNA 4QGHA 3INTA 1NM5C 3HEBA 4WZZA 3OMLA 1NOKA 4WJZA 2Z83A 3IDFA 4XPIA 4NHOA 3H4VA 5AUOB 5HTKA 1Z2AA 1PT6A 4CMGA 3M81A 4QYTA 4AG6A 2Q27A 1GZUA 4QVGA 3V4LA 4YX9A 2VQEB 2QZJA 2OGTA 3EVZA 4Q1EA 5DTEA 1NW3A 3GFBA 2FPIB 4JZKA 4ZO6A 5CA0A 1YRWA 1WHTB 3FR7A 5EGSA 3VR6H 3FPFA 1I4DD 3B48A 1YH3A 4INZA 2IZOA 1R0BA 1TEZA 1JWAB 1NMEA 2B8WA 3IQDB 2Y67A 4C7VA 4AZTA 4C07A 3E61A 2ARKA 4A1OA 1SIWA 5E2BA 1YTUA 3W7VA 3F2VA 2F59A 3NHAA 4KBGA 3LCRA 2YMLA 3DKRA 2DPLA 3ZDCA 3R3WA 2UZ1A 3LP6A 4D25A 4CKCA 1JH9A 5ITVA 2XYRA 1GAEO 2GJSA 1EWKA 5SY6A 1XNQB 4EWLA 3EVNA 4MV9A 3RRJA 4DVJA 2WYWA 3ZQ4A 4R1QA 1UEXC 2FK7A 5F5LA 3KCQA 1VMKA 3L8MA 1NLFA 3GELA 1DKLA 4D9IA 4DN6A 1ICIA 4OB7A 3UBMA 4EECA 5JNWA 1N5RA 1E4VA 1DEAA 1KH2A 1JGTA 3FYCA 3IJRA 3PPWA 1F38A 3GJZA 4GPAA 4BVHA 4Z4EA 2VBIA 1HEYA 4LJYA 1H66A 3FLEA 1J33A 4FKMA 2QWXA 1NRXA 2YTZA 3N0RA 3KK0A 3O03A 2PT6A 4PWZA 1QHHB 3BF8A 2FRXA 4BNTA 2FF5A 3D6UA 2L18A 2DPYA 4D8YA 5ES4B 4C0XA 1AKRA 5IJ0B 3LKZA 1JA0A 1UAGA 1SQFA 1NDQA 5T67A 4G2NA 4RSMA 1WXQA 2YY6A 3QK7A 5EMLA 2FN8A 3B5EA 3KKLA 2MMCA 2G4CA 3S27A 3WG9A 1C9YA 2WP0A 5AW7A 1TMYA 2WQ6A 1DQSA 1GPYA 1I0ZA 4LJ4A 1PJ3A 2BZ0A 5KMGB 1KDTA 1K98A 4V0MA 2Z9CA 1PNVA 1TMOA 2I5PO 2J7KA 2QL7A 4QXPA 5AHOA 5GVSA 1SXJD 4JCOA 4P4LA 8AT1A 4IIJA 3ROZA 1RE0A 2BR4A 2G36A 1RR6A 3QLUC 1B4DA 2R1TB 4LF5B 4L7VA 3KL2A 3BD9A 4O2BA 4DCGA 3GDFA 3S8EA 1BYIA 4KGZA 3KBBA 4J4HA 3SDSA 4CDMA 4D45A 4MV0A 2OGSA 5AJXA 2PH7A 2FLKA 1Q19A 1Z3CA 3MJEA 3BFVA 4ZOLB 2G3YA 1N9KA 1DARA 2ZT7A 4MLCA 3GRVA 1EQUA 1N7HA 1XD2A 3O4FA 3SQLA 1P2TA 4EM6A 2Y0DA 3DBVO 4HZUB 4I36A 4AMVA 1PGPA 4I9GA 5EGNA 2AA3A 3RHFA 2ZBVA 2HLDA 4GP9A 4DCCA 2FVYA 3SXUB 5LYJB 2QRHA 1IBMB 1UDBA 2HO5A 2Z2YA 4OY3A 3DJFA 4F5WA 4CUJA 1V16B 1LI4A 2B25A 4L8WB 4OHFA 1L5NA 2FSSA 5CLGA 1CUEA 5AJWA 3MGAA 1QFXA 2YRXA 2FDXA 1CB7A 4E2ZA 3RUAA 3SF8A 3L6CA 5HQJA 2AHRA 2ZUDA 3QVOA 1QVAA 2RK4A 5ITZA 3MINB 5HCIA 5TGTA 1ZH4A 1X70A 4B4UA 1GFWA 1ZHHA 3PNYA 4NFYA 2VDLB 5F7ZA 5LXTF 1P9OA 3KYBA 2Z6UA 1NUUA 1BVHA 2DP4E 4JJKA 4RVSA 1YZFA 4I5IA 1O6CA 3IA7A 2OP1A 1YQXA 2INGX 1GAQA 3GCXA 4L6IA 4C87A 1N2CA 3KXKA 4XB6B 2Q50A 4JUBA 1WVMA 3D3WA 2FPOA 2GAOA 3I09A 5B1SA 5KYYB 4OHUA 2JHFA 2IBMA 1OILA 2FQXA 1QUEA 2C3YA 2IU6A 4G97A 3KT8A 1GLGA 5FUBA 2X86A 4PX5A 4R81A 1VPVA 2E48A 3TCNA 4EGQA 4HR7A 4FNAA 4A91A 3KSDO 3EA0A 2AW5A 4TGLA 1P3DA 1Z6TA 4KRGA 5ALMA 4P4TA 1WKBA 1NP7A 1HRKA 1Z0UA 1XC7A 3HXTA 1RKBA 1S7GA 3D8BA 1YT5A 1MF7A 1WKCA 1YJ8A 2EVWX 2ZBFA 4H27A 4EI9A 2X6TA 4XUCA 3EY4A 2XT9A 3URKA 2HQ1A 3T3DA 2A4KA 2GNAA 1JV2B 1D9ZA 3E58A 5K51A 2R1VA 1MJHA 1VRVA 2H1LA 1RBMA 2HF9A 5ECWA 4M2LA 4EI7A 3AIOA 2IHTA 2JGDB 1QB7A 2HV9A 3NRBA 4NP6A 3SC6A 2B6HA 2LTAA 1PKXA 3DE3X 3CRW1 3IODA 1BHJA 4NJMB 2Q2VA 1YULA 4C4OA 1C7RA 5C7OO 3TMAA 2W5UA 1FU7A 4JYPA 1DBWA 1MC4A 3A6LA 3H9CA 4XQ0A 2O52A 4QO7A 3KPJA 1T36B 1D1PA 2H4XA 3JQAB 3KJXA 3MTEA 3ORSA 4RKYA 3GNTA 3GQBA 5CYPA 5ILQA 1K1EA 3Q3EA 3FGPA 4WBNF 2ONKA 3OFJA 5BR8B 1TUBA 1C0EA 4Q02A 3U62A 2WUVA 2Z8XA 3MK31 2Q0QA 3DM5A 3PWZA 5DLPA 4AYWA 3H9JA 1GKYA 3USES 1M2WA 2QLFA 1AZTA 4EG0A 1N8NA 3NGLA 3CRQA 2ET6A 4OO3A 1CUYA 1E1YA 2KWIA 3B1KA 4L6CA 4LV6A 5TPZD 4BMVA 1KAOA 1KI2A 4FYKA 3V1UA 2YOHA 4RQTA 4E6PA 5EMNA 5C4IA 3IOMA 1BMTA 2B2XA 2NPFA 3P71T 1B0ZA 4WVLA 4R7GA 4DPLA 1TYZA 3D2CA 1A8UA 2XUJA 2Y93A 4IM7A 3VSBA 5I4CA 5KWEA 4RE5A 3NXSA 3RGWS 3SZGA 3TFQA 4UHDA 2IWHA 1QHIA 4N7BA 3IVRA 3ZHRA 4CF6A 2ZCUA 3K9CA 4N3GA 1AK9A 2QL5A 3ISTA 4O33A 2OBXA 4NZOA 4L5IA 1IZ8A 1Z8NA 3PB3A 3ZBPA 4D9GA 3CCBA 4BVBA 5I7RA 4YUZA 1T0BA 5CT4A 3L7YA 4C0JA 4Y7DA 4NH0A 1SXJE 5BSFA 4H15A 4U63A 2C2WA 5J2TA 1OH8A 4OP1A 1VXOA 1J09A 2BC9A 4UHKA 4WRRA 2NV2B 3I34X 3UXHA 1GGEA 2IFTA 3A4LA 4MW2A 2CDNA 5L3QB 2CHQA 2XWBF 5K5EA 3ZVRA 4MJLA 3O4HA 2FSPA 4FGLA 4RIEA 1T2CA 2JGRA 2PSDA 4QUKA 1PU2A 4S0ZA 4KDCA 1Z82A 2PZFA 1B73A 4CLRB 3I30X 2IIPA 1XUOA 2ZBGA 2VXBA 3BKXA 4K1LA 5FTJA 1UPXA 4NC9A 1ZLYA 2DECA 2ZE7A 5DGDA 4C1BA 2ZPTX 4G36A 5AESA 2VWGA 2K7FA 2H1FA 3HJGA 1FP4B 3V2HA 4CM8B 1UT5A 1AQIA 1PZGA 3R0IA 4BFWA 1DT5A 5KDDA 2Z4RA 4RCZA 3K4QA 3MJFA 5DM60 4XTRA 3MFYA 4Y2GA 2I2FA 3LWNA 1KZ1A 3JVUA 4DJDC 3M33A 5BYBA 3QXXA 2YJ4A 3ILXA 1Z28A 3H7IA 3T9CA 5GGXA 2X5JO 5F2NA 3B6EA 1CR4A 5LR6A 5DDIP 4I55B 4I1PA 1H3EA 3GDOA 3SSOA 2YHIA 4GRIA 3LDUA 3WMGA 3FUCA 4EB8A 5CCBA 2EC5A 3QKTA 1KEEA 2XZDA 3V1LA 3OIUA 4ZKDA 5JCJA 2ODTX 3LCVB 2A67A 2OD9A 3CTPA 5IDVA 4MR7B 4ZYTA 1BGVA 3U4MA 1L8OA 2AMYA 2R4TA 1LD3A 1Y9ZA 5DXJA 3CH4B 3F9IA 2H0RA 3EH1A 4RH3A 2E5LB 3NC4A 2V0NA 2GEBA 1DTWA 2IEBA 3KJHA 1PW7A 4L5YA 2KJQA 1A9OA 3SN6A 5A5FA 4FC6A 2WZCA 1YZ3A 2Q5FA 4DKJA 5ARCA 5MN4A 4XQEA 5FF9A 1Y6JA 5C8XA 1IB6A 2CN1A 2QRUA 2AH5A 3LBNA 3NG1A 4JBWA 5L3RA 4A15A 2P41A 6ABPA 1CQWA 1TA9A 3AKZA 4IZIA 4U4AA 3U44B 3KYDB 3WK8A 4BZQA 2QOEA 3RU7A 3EZ7A 1E9EA 3KUDA 3WV4A 2WWTA 1O97D 3BWEA 3H42B 1TZBA 3UJPA 2PKEA 3NFYA 4JXJA 2PA0A 2QTAA 4KAXA 4QXAA 4CMEC 5L3SA 4BNZA 2E5WA 4EO4A 1EXVA 1WF6A 4G86A 4M21A 3S6JA 1P62B 3GRUA 3IT2A 3MNFA 3AP2A 1C7JA 1YO6A 2BP7B 1PW5A 1Z0KA 2WF5A 2DHCA 3U6KA 3MWFA 1R5NA 2B83A 4DEVA 1C8LA 1N2BA 4PLGA 1W25A 2PLWA 2DFTA 4MUFA 4MGYR 3SI7A 1TJ3A 2Y76A 3GJ3A 3M4XA 1DDGA 5IJAA 5JY1A 5GPBA 2HYDA 1Z4NA 4MWBA 5M04A 2ZULA 2NSYA 2JCGA 2PUHA 3IYLW 3QEJA 4BP1A 3WZMA 5TS2A 4IIJF 3ZWQA 1UZLA 3JRWA 3LW8A 3VR3A 2AE2A 1FYWA 3ACCA 1R0WA 2HPVA 2ZBQA 3MJTA 5HF6A 3WDKA 2POCA 5AXBA 1MJNA 4D6XA 3VH3A 1SQ0A 1XVTA 3YASA 4DNOA 4Y0AA 2Q0HA 2O2ZA 3T4PA 4DUGD 2PTGA 4NNJA 1OV4A 5IJWA 4FX2A 4G25A 3EYAA 4KXQA 2GN9A 3R44A 3U4AA 5BSVA 2WKSA 2C82A 1WUIS 4FFMA 3QLJA 2HT6A 2HHAA 4GLBA 3I1FA 4CIDA 4GVLA 3SHFA 5BVGB 5K8CA 3LE8A 2EGGA 4N65A 5GZ3A 7AT1A 2PUAA 2EV9A 2JBAA 3F9RA 5B2EA 1YGYA 5FI5A 4RACA 1K88A 4O8CA 4LOJA 3UXYA 4EYSA 1V41E 3HB5X 3O3CA 2W2OA 2VP2A 5KX5A 1CF4A 2C20A 1ZFNA 4L95C 3OZVA 2D7JA 1ZRMA 4RJIA 4S35A 5A0VA 3MOIA 5FP0A 4BKUA 3RIYA 3CR8A 2JK0A 1J0XO 3B2EA 2NU8A 3WX0A 1CNFA 4P7GA 1T2EA 1U0OC 1TRKA 1KMQA 3ANYB 1TEHA 3SCZA 5DIFA 4QPCA 1GTZA 2GDJA 1CQIA 4BP9A 1BKDR 5KOIA 1K08A 2QG9A 1V3UA 3MQFA 1F0NA 2CZCA 4FGSA 4MKIA 2QRVA 2CXSA 3T3OA 3TUZC 2QDXA 4CF3A 1NJ8A 2CVOA 2YWGA 1UP6A 4H0NA 4RIIA 3RVSA 1A5TA 1M54A 5IF9A 1E5QA 5BN4B 1X87A 3A6DA 4M6WB 4QLOA 1UMBA 3RBVA 3WR5A 1JXAA 1EBBA 2MYNA 3F5FA 2QVGA 3A6KA 1TA4A 5TC4A 1IC6A 4G85A 1YVPA 4U8GA 1ODLA 2Q1TA 3GEIA 3IPYA 3B8HA 4L78A 2R00C 3ZNPA 2YR0A 1OPXA 4CIVA 3ZHXA 2VQFB 3AYZB 4F6CA 2G08A 3PNSA 4F72A 5IT5A 1P1KA 2FZVA 2VI5A 4PXYA 2AZDA 3EX7C 1CDEA 1ISJA 4CCSA 4QGAA 1PWYE 4Z8YA 4AY3A 1M2HA 2V65A 1WM1A 3NATA 1RM0A 1YK0A 1UFVA 4KPUB 1L7XA 1NQWA 2YFQA 1EEXB 1KVRA 3ANSA 2V59A 3HRHA 3WSTA 4JROA 2XT6A 3RS0A 3JARB 1POXA 2FW8A 3CBGA 3E6AA 3I28A 5KZMB 5KQSA 3CVYA 3Q15C 5EXPA 4UQLA 3RS4A 1JT9A 1EDZA 1TW2A 3OQOA 3UMVA 1E4EA 1F20A 4G5QA 4LYYA 4EYGA 1CYDA 1ONSA 3ENKA 3JD2A 3M5DA 4YNBA 4PICA 2NT3A 1W29A 1NR1A 3AJ9A 1OROA 1FLDA 1OYYA 1WUYA 1CY7A 1YDGA 4RKWA 1VL0A 4Q7EA 2FPIA 4PLPA 4W1RA 5C4GB 1E2PA 2H29A 1IIBA 4JSYA 4EVRA 5LQJA 3BH0A 4TTIA 3U26A 3N75A 1C41A 5FH9A 3HEAA 1YF3A 2I29A 4R9SA 1ZJYA 3K7EA 4OJYA 4F92B 4LYAA 3EFHA 5B7PA 3FNGA 2Q3BA 1WXHA 1VFNA 5IEJA