5L9AA

L-threonine dehydrogenase from trypanosoma brucei.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
HMPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords L-threonine 3-dehydrogenase
total genus 119
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l9aA00
3PJFA 4IJVA 1E3JA 4MJLA 1KEPA 3UICA 1EK6A 5JPIA 2Y05A 5TSDA 1DBVO 2AG8A 2C7GA 1T1RA 3O9ZA 4M87A 4ILKA 2XXJA 1ZK1A 2BHLA 1C1DB 2ZB4A 5EESA 2ZQZA 4DQUA 4HFRA 3WLFA 1F14A 2HU2A 3EMKA 4CR8A 5IG2A 5C5IA 4QTZA 3L6OO 1EK5A 1EMDA 1QRRA 4PLFA 3DQPA 4BNHA 3PXXA 2ILTA 4R1TA 4AJNA 1NAIA 2HK9A 4IQ0A 1I2ZA 2QW8A 4B7UA 4MVJP 2NTNA 2HMUA 3OHSX 3KO8A 3I9KA 5EQFA 2E82A 2VCYA 5JBIA 2G17A 3QWIA 4J4BA 4DC0A 5J23A 1DIRA 4NNJA 5KVQA 2NV6A 1UDAA 4F45A 1G0NA 1G0OA 1NM5A 1ML3A 3ONFA 5HTOA 4OQZA 4J0FA 3EK2A 3LLVA 2X9NA 3QVSA 2AMFA 3HUDA 2AE1A 4D3FA 2ZTUA 2DFDA 4CMEA 3RBVA 1E6WA 2GUGA 4Z9XA 4ZRNA 4I9HA 3OEWA 2B4QA 4UREA 3ANMA 2C29D 4WECA 3IAHA 1X0XA 2D0IA 4DPKA 1I2BA 1ISGA 4XQ9A 1SEVA 4GAEA 3UH1A 4JP2A 3TNLA 4HNHA 1UUFA 5HS4A 2IDZA 3AY7A 3HG7A 4PFJA 5ENDA 3F4BA 4WLEA 3SX2A 2Q1WA 2VHXA 5COQA 2NVUA 3JQ7B 1BSVA 2QZZA 3AI1A 3BTUA 4GX0A 1LEHA 3QVXA 1T4DA 4ID9A 1E3IA 3W4IA 1WPQA 4TKLA 5L45A 1MG0A 4NBRA 4JNKA 4OSPA 1KERA 1QYVA 3OQBA 1PGJA 5TIIA 5A3JA 3FSRA 2YV3A 1UP7A 2DTEA 3F6YA 2X6TA 1A4IA 4TRNA 3WMWA 2IEBA 4XQEA 3UFXA 3ASVA 1CJCA 1PR3A 3OF2A 2ZQYA 1ZXLA 3SLKA 2X0RA 2PLAA 1CQIA 1UJMA 4YWJA 1P1JA 4Z0TA 4E6PA 1VKOA 1WLYA 1ZW1A 1Y8RA 4ONEA 4OXNA 4DGSA 3ZHZA 5GMOA 2VUUA 3DZHA 5K6AA 5DOVA 1SB9A 3M2TA 5H83A 1TLTA 2Q50A 4CMIB 4CLRB 5EERA 1Y5MA 1ZEMA 3PYLA 2C2YA 3GFGA 3B1FA 3H9QA 2IZZA 4BNNA 5JW6A 2OUIA 1OC2A 1ORRA 1KIFA 5IXSA 1I3NA 1HKUA 1AN9A 4TKMA 3ORFA 3EY4A 2FMUA 3TDKA 4DXHA 3ZWNA 3MJVA 1TXGA 4FFNA 2FR1A 2X9VA 4RJTA 1DC3A 1SO8A 1A71A 1VJTA 4CLRA 5TJ9A 5IN4A 1DRWA 2Q45A 4PLZA 1M6HA 2DU8A 3DEYX 1CRWG 2HAEA 2GZ3A 2FOIA 2IE0A 5COBA 5JC8A 4F46A 2J8ZA 3AY3A 1F12A 1MX3A 3OIGA 4O0LA 4UUOA 3PRJA 5TQVA 4ALNA 4B3JA 2C07A 1O0SA 1ZEJA 4XYGA 2FY8A 5BNTA 3ZV3A 4H16A 1ISIA 3BHIA 3D4OA 4XIJA 2VWHA 2GN8A 3O8QA 1GZ3A 1SOWA 1E3SA 2X22A 1JA9A 1QKIA 3WG9A 5THKA 3KLPX 3PI7A 4RL6A 2E49A 1I24A 2PR2A 1GADO 4E0BA 1C0KA 4D3DA 4WK6A 5KCZA 1C0PA 4RCVA 1GZ4A 4IQ8A 1A4UA 3G1TA 3DO5A 4K6CA 4HNGA 3M6IA 4L74A 4NJMA 4LISA 4XJSA 4AJOA 9LDBA 3PFWO 9LDTA 4MIYA 5A05A 4BKRA 4Q9NA 2O7SA 3LVFO 1LTHR 4G65A 4AJ4A 3RU7A 3TFQA 4PZEA 2UDPA 1J5PA 3DMTA 1YE3A 1P33A 1IOLA 3TWOA 1OZAA 2FSVA 1FDSA 4OAQA 1O8CA 2GNAA 3S2IA 4R69A 4CLOA 1EVZA 4WEOA 1VRWA 4OOEA 4RVDA 1E7QA 2ZJ0A 2CZCA 3U4IA 2VWQA 3A4VA 3OQ6A 3VVCA 1DJQA 2HRZA 2X7HA 5JAQA 4AJKA 2GPTA 3IC5A 5G4LA 3RC7A 2VTDA 5A02A 4XGNA 3WQRA 5IZ4A 1HDYA 1R4NB 4Z6KA 1U8FO 1J49A 1SOVA 3PVZA 4EUEA 4PZDA 1EEHA 4RQTA 5F1OA 5B1YA 1XA0A 4FOSA 3L4BC 4UUPA 4XGKA 3V5NA 2XAAA 2CDAA 1ZZEA 1JKJA 3TZKA 4ND1A 1BHSA 4KTVE 5DP1A 3WBBA 2DAPA 2P68A 4ALKA 4WJZA 4CM9D 1DRUA 1H93A 4DIFA 3INGA 2ZB7A 2XXBA 2RHCA 5G0WA 3CKYA 4ZU3A 4QSMA 2EW2A 4R54A 1N1EA 3AW9A 4JGBA 4BIIA 1V8BA 1LC0A 1OC4A 2GYYA 4UEOA 3KEOA 2GZ2A 1YOVA 4BNJA 3M1AA 5A03A 4BMNA 1P0FA 3H3FA 4YXFA 4OGWA 3ZNNA 1YKFA 1V0JA 4D46A 2BKAA 4U0KA 3U0BA 1YO6A 4WASA 1GPJA 3RKRA 1NQ5A 3JQAD 4BGUA 3KBOA 3BMCA 2BLLA 3GHHA 3KYCB 3OQ1A 4FPXA 4GLOA 4IJWA 1LDEA 3WQQA 1B15A 2IEDA 3RFXA 5IFLA 4IINA 4BNXA 1DIAA 3HZZA 4UEJA 4RF2A 4J2OA 4PN3A 1ZMOA 4Z0HO 4ZICA 1IL0A 1K6IA 3GRPA 1HTBA 2V7PA 3WSVA 1XR3A 5K0ZA 2YQ4A 5F1PA 4JBIA 3NTQA 4CM8A 3ANLA 3DZJA 4IGEA 2HMWA 1QLHA 1KOLA 4Z9YA 4IDDA 1HETA 3C1OA 3LU1A 3MOIA 5C7IO 4WPGA 4TRRA 1Y81A 4EJ6A 1MXFA 5BNIA 1MFPA 4CQMA 1PL8A 1QMGA 1YJQA 2O50A 3JD1A 5EMHA 4TZKA 3HE3A 5JYEA 2HUNA 3W6UA 4DIOA 1KY5A 1LA2A 4GI2A 2O3JA 3GEMA 2FPIA 3K2BA 3SJ7A 2OZPA 3RVDA 5IDQA 1JKFA 2X58A 1K6JA 2AEMA 2PTGA 1K2WA 1P31A 2EGHA 1CQJA 2EKLA 2FPGA 5IDXA 1ZBQA 5JAMA 1GQQA 1GQ2A 3DBVO 1QV7A 3VPSA 1DPGA 2HMTA 4C7KA 1TB4A 4CMKA 8ADHA 2GR9A 4D45A 4MIEA 1Z75A 2JAHA 1LNQA 3ROKA 3FD8A 1S6YA 1YQXA 2Y1OA 4TMFA 2OORA 3AOEC 3HDHA 1KVTA 3RBXA 5LDGA 4JQCA 3S2EA 1HDZA 2DPGA 4W7HA 2C2XA 4ALLA 1UXHA 3DOCA 2PKQO 2CUKA 3SJUA 2AQHA 4DLBA 1ADFA 1EUZA 1EDOA 5CEEA 4HUJA 1BG6A 2ZCUA 4I08A 1GV0A 2VTEA 1PS0A 2PGLA 3DWFA 2AEJA 3I9JA 3KSUA 3JYLA 2VRCD 1HDGO 1JVSA 3ZV4A 3JQAB 1XEAA 3MWDB 4F6CA 3C8MA 4MVJA 4J9UE 3R0IA 4TRMA 3DHNA 4OL9A 5EINA 3COSA 4TRJA 3DXFA 4FSHA 5L4SA 3H2ZA 2O3SA 1CIVA 4OH1A 3DAGA 5HS6A 3NGLA 4Y8VA 4RDHA 1PZGA 2GN4A 2EWMA 1GU7A 2Z1MA 3G49A 4K28A 2W2KA 1U2DA 1U7HA 3JD3A 1ENPA 1UDBA 5DBGA 1VJ1A 1FDVA 1X1EA 1Y6JA 2HCTA 3JQ9C 3QQPA 4LCJA 5B4UA 3CMCO 1TA4A 4FJ0A 3JQBC 3N58A 1EZ4A 4K6FA 4XYBA 2NVWA 2C0CA 2BFOA 4XWYA 4CM3A 5B4VA 3HN2A 4B4UA 4AJ1A 1LSOA 4PGFA 1GV1A 5CDSA 4KP7A 3RUDA 1YBMA 3D64A 4JLWA 5DT9A 5L7TA 4CL8A 1O6ZA 4A03A 2BGLA 5F21A 3AFMA 4BNKA 4R41A 4CM4B 5IXYA 1W0CA 1NQOA 3TL3A 4LMRA 3VHRA 1T2FA 3C3XA 1MV8A 2NNLD 1BVRA 4JBHA 3TZQA 2W90A 2YFHA 3OJLA 2EKPA 5FI5A 4JN6B 4FCCA 3MTGA 3WWYA 3K5PA 1GUZA 4BQPA 4FJ1A 4DPLA 1KC1A 3AM4A 4KUHA 2ZJ1A 1WDKA 2CMDA 4YT8A 3QW2A 3FRJA 2I76A 4Y6RA 2H63A 4A27A 4CM4A 3DTTA 4EJMA 3VPXA 2ZB8A 3PJDA 3PPIA 4YVFA 1DEHA 1MP0A 3ZI0A 3E48A 4NQZA 2QRLA 3L07A 4W4TA 1NVTA 1KY4A 4BO2A 1RYDA 2GD1O 3HHPA 3AOGA 2UYYA 4BNGA 3AU9A 4IS3A 3Q11A 2P4QA 4MVJF 4BMSA 3GVPA 2QRJA 1LUAA 4FN4A 1WZEA 4LW8A 2B4TO 1YGYA 2CF5A 2QG4A 5COAA 3CIFA 1B14A 1IHYA 3ZU4A 3TZCA 1R0KA 1HEUA 4QO8A 1I8TA 1TI7A 3U62A 3OA0A 1NFFA 1LQTA 1R12A 3NT5A 2Y99A 3HQ4O 1J4AA 4K1LA 5DOZA 5A3VA 2Q2VA 3QJ5A 4ZA2A 1P0CA 3FR8A 2EEZA 2R00A 3OFSA 4URFA 4ND5A 3VZSA 4IIVA 3OJ0A 4HADA 4R9RA 1KVQA 2BF7A 3I4CA 1DHTA 4NPCA 1C1DA 2YQ5A 4CUZA 5I7EA 1FJHA 5DCUA 5DDIP 3DBHA 3E5RA 4INAA 2RBEA 4PRLA 5GZ3A 3RUAA 4L76A 2HK7A 3C7AA 3MCVA 4PLGA 1GDHA 4RPHA 2DUWA 4IZIA 4XRRA 4J2HA 5KNLA 4GGOA 1PZEA 3DL2A 1YQDA 4WNIA 5U1PA 1NXQA 3QRWA 4E5MA 4J49A 3RC9A 1EQ2A 2VYVD 4J7CA 5IF3A 2X0JA 4WGGA 3HFSA 3GGPA 3IJRA 4C4OA 3S2GA 3O4RA 3WIEA 1F8FA 2I6TA 1KEVA 4RORA 4Z9FA 1SC6A 4M89A 1YXMA 4J1NA 1DC6A 2V6MA 4U8GA 1KVRA 1DAOA 4NU5A 4CMAA 2XF8A 4NBUA 1H6DA 1NPTO 4W9NA 3FHLA 2WDZA 3MJCA 4QFDA 4DBZA 2ET6A 3LT4A 3K30A 5DBFA 5KJEA 4R1UA 3M1LA 1ZK3A 3OETA 3V2HA 1U3UA 2DPHA 2I9PA 3HNPA 3ZWYA 4NI5A 5JY6A 1SPXA 4RF5A 5IZCC 4IDBA 4P8RA 2BH9A 1B8VA 3T4XA 2EP5A 1Y5RA 2Q4BA 2FSSA 3IOYA 3I9NA 1YOVB 3FTNA 2WWRA 3ON5A 1I01A 3ZCXA 2PZJA 3L0DA 1KETA 2EERA 4WCFC 5EL0A 2OO5A 4XB1A 3A9WA 3UCXA 4BO6A 1DIGA 1MB4A 1WNTA 1Q0HA 4IDGA 3W6ZA 2W2LA 3V2GA 3GPDG 2D59A 1LDGA 3CUKA 3HDJA 3L9WA 1RWBA 5CFZA 1L1FA 3QHAA 1C14A 5T5QA 1HE2A 4XYLA 3DFUA 1U7TA 4A26A 1R16A 3G0OA 2PD4A 2EV9A 4L4SA 4B4OA 3AI3A 4GKBA 1SBYA 3MJSA 2C20A 3ZV6A 4MKRA 3EHEA 4OYRA 1WMAA 1RM5A 3PGXA 1MC5A 3V2UA 2NU7A 1KS9A 3TOZA 5MGBA 1R6DA 3R3SA 4EDFA 1PR9A 3L4SO 1ZO8A 4FS3A 1K89A 1XCBA 3OBBA 4BNYA 4L8VA 3RFVA 2DC1A 3WGGA 2EJVA 1DXYA 4NIMA 4NZ9A 2B5WA 2GN9A 4YACA 3ZWPA 3LC1O 2PZMA 3L4BA 4HV4A 1HZJA 2BGKA 3LQFA 4QECA 3EVTA 1EUCA 1U8XX 1N1GA 4Y9DA 5JDIC 1PGOA 3INTA 5JE8A 4IMRA 3GNTA 1IUKA 3LZ6A 5KJ6A 3GEDA 2C7VA 2Q3EA 4JP3A 2Z95A 3CMMA 1ZK4A 1ZFNA 3E18A 4XCVA 5LC1A 1HRDA 4PG4A 1H5QA 4R1NA 2I66A 3L6EA 1ISJA 2O3UA 4PG8A 3K92A 4DQXA 3ZW8A 3UGKA 2OXIA 1ULUA 5IN5A 2AQIA 5FYDA 5C3MA 1O5IA 3NJ4A 3V1YA 2E37A 3UUWA 4J7UA 5ICMA 4WCFA 4R3WA 3SXPA 4LVUA 1N2SA 1W4ZA 4PRKA 3FI9A 3BTSA 1I3MA 4HFNA 3D3EA 5HM8A 4ZD6A 2RCYA 3ETEA 2JAPA 4E5KA 4HXYA 1WDLA 4YR9A 4BKOA 2F1KA 3T7CA 2VT2A 4D43A 4BNLA 2F00A 2ZCVA 2WE7A 3GFBA 4R5HA 1N9GB 4E3ZA 3WJAA 4NBWA 4W99A 3QWFA 3JQ8A 3PP8A 5F5LA 4J43A 4BMVA 4QO7A 5BSGA 3EZLA 3CXRA 4MVJE 2FP4A 4BNMA 1NR1A 1WXDA 3RUEA 3VDRA 4FJ2A 1XLTA 1PL6A 1R15A 3S1LA 5CG2A 4BB6A 5L51A 4R01A 1B16A 1U2GA 1YL6A 4IDEA 2O7QA 4DREA 5A4DA 4IGFA 4J91A 4A7PA 4BO9A 5EPOA 3BMCB 3KYCA 2Y1EA 4KUGA 2WTBA 3AUUA 2OBNA 4O1MA 3FTPA 1YRLA 4E5NA 3MEQA 2FPPA 3B1JA 1PWXA 4RZIA 2FRDA 3TRIA 2O3RA 1LXCA 2YYYA 4M86A 1XWFA 1TT5B 3PWSA 1XKQA 1MA0A 1T2CA 1AHHA 2JD1A 3LDHA 3KM0A 3HB4X 3BMNA 3VH2A 2VYNA 1T24A 5I9MA 1DC4A 1XIVA 4DC1A 3JYQA 3K31A 1Y8RB 4IDCA 1I10A 2W4QA 3PYMA 1F17A 3UCFA 3DR3A 4OXKA 4GBJA 1B2LA 3WICA 2PWZA 1EBFA 2ZIZA 4Y67A 1R0SA 3RUFA 2YZ7A 1R4MA 1QR6A 2P2SA 3B1KA 1SEPA 3E1KA 4N18A 2CFCA 1T25A 1BVUA 1Q7GA 2JCXA 4OKIA 3JYOA 3TPCA 3VPHA 5ADHA 2P4HX 4IS2A 3BMOB 5CHEA 4CM7A 3H8VA 1NAHA 1F8GA 1P1FA 2QRKA 5TT0A 4XRGA 5BQFA 3G3EA 2DBQA 1E3WB 3TZHA 3FNHA 3CZMA 3FCOA 1BW9A 4RPLA 3E6AA 3SVTA 4FGSA 2HRBA 5IDWA 3BAZA 4MIOA 3VPGA 1X15A 4RPKA 5BSHA 3DOOA 4TSKA 3NTOA 4PLVA 3ULKA 3BHJA 2FHSA 1IZ0A 1Z82A 3D0OA 4QUKA 3IDSA 2YDYA 4DVJA 3HDQA 1LQUA 4NBVA 3PFFA 4YRAA 3BYZA 4QQRA 2H1SA 1A9ZA 1FF9A 3Q6IA 1PJTA 3VTFA 1YWGO 3GOHA 2IXBA 1Y9EA 2NQTA 4M49A 4CM8B 2ZB3A 1RKXA 4UULA 2H5LA 3O38A 3GN2A 5JCJD 3F5SA 3KLMX 4OKNA 1YJ8A 3P2YA 3DOJA 3PQFA 4LVCA 4I1IA 3BTVA 1NFQA 2J3JA 5KVSA 2QX7A 3NX4A 4KDFA 1A27A 3VVBA 3DC2A 3EAGA 1Z73A 2RHRA 1XU9A 4LK3A 3ZW9A 5CG1A 3VKVA 5G4KA 5TC4A 1WDMA 1O94A 2Y1CA 3GQVA 1GZ6A 4NJMB 4BGVA 2RH4A 2VUTA 1BXKA 2HMVA 1QORA 3JQFC 3U4CA 4BNFA 4M55A 3E5MA 5CAEA 5C37A 1DDOA 4L9RA 4RLHA 4YJFB 4BS9A 4CQLA 2TMDA 4ZRMA 2E4AA 2ZYAA 3HSKA 4YJGA 5ENVA 3ZU5A 1QYCA 1KYQA 5JMWA 2HK8A 4QT0A 2JL1A 4WLVA 3EVNA 4UVEA 1DAPA 4Y6PA 3KRTA 3KYBA 4P22A 4QXMA 3WTCA 1QSGA 1PJSA 4AJPA 1MUUA 5FF9A 1NQAO 3KVOA 3U9LA 2IODA 5JFOA 4MVJH 3WGIA 1ZJYA 2QIOA 3ZU3A 1SZJG 1X14A 2FZEA 4EJ0A 3PLNA 4R16A 3ROMA 2Y0EA 3FBTA 4YJGB 5HRUA 5AQ1A 3DZKA 4YAKA 1E6EA 3CE6A 2HJRA 5CDUA 1R66A 3RAJA 3VAZA 5T67A 4BNVA 3EW7A 2Y1FA 5ICSA 4DRYA 1YB5A 5BT9A 3PQDA 2I67A 4YT5A 5L4NA 3QWAA 4BO1A 5ITWA 4JJGA 4CJXA 1AE1A 4II3A 5AXBA 2OFPA 2BFPA 2D4AA 3UKOA 3VOSA 1LJ8A 4CV2A 3H2SA 4YDRA 1K5HA 5HWSA 2CDCA 2PY6A 1BWSA 1VLLA 4KZPA 4CMJA 3JQCA 2AA3A 4H15A 4XYMA 5DCYA 1U9JA 1E3LA 2VZ9A 4OOFA 1FXSA 1GPDG 4NFHA 5DCWA 1DLJA 2X0NA 2YDXA 3C85A 1J6UA 3WMXA 3PQEA 5DN9A 4E12A 3ZWVA 1FDTA 3NUGA 3U4DA 4ALJA 2VRBA 1NBOA 3OIFA 4I5FA 3TN7A 3FNFA 3GMDA 1CF2O 1P1HA 2FR0A 3PHJA 5KWEA 5KTKA 1HF3A 3WGYA 2JD0A 1JVBA 1PJBA 4BKUA 1C1XA 2GSDA 4DMLA 1U5AA 4HY3A 3WOHA 2EW8A 4BGEA 1SCUA 4PG5A 2JFHA 4JX8A 2OOSA 2J3IA 4MP8A 4BV9A 2NACA 1P45A 1TEHA 4MKZA 3ZHXA 2EKQA 5A5FA 1M6WA 2JKVA 3PTZA 5KVVA 3K2EA 3L9XA 1PS8A 4ITUA 4ZHSA 2Y93A 4B4WA 3NAQA 2BFAA 2EGGA 2E6UX 4PVDA 3WNVA 4YT2A 4A2CA 1BRMA 1WAMA 5FFFA 2BGMA 2Y1GA 3CZRA 2Y67A 4H3VA 3BHMA 4W9NC 1QYXA 1WVGA 5B12A 4B8ZA 4YAIA 3FWNA 4QFCA 4E5YA 1KEWA 2QZ9A 2X4GA 4PVCA 2O3TA 3UF0A 2BRUA 3WGHA 3PHGA 4CR6A 3FWZA 3I52A 3LLSA 4KTTE 4DUPA 3JQ6A 1DO8A 1IPFA 1N7HA 1LDYA 5L7YA 3ZWBA 3JQGA 4MKXA 3QLJA 4R68A 2P5YA 1GUYA 4WKGA 2PKRA 3OECA 1ZK2A 1OFGA 1OAAA 1T2DA 1U3TA 2EIHA 3MJTA 1GEGA 3OH8A 1KEUA 4ZN6A 3PJGA 5CP8A 1B8UA 1XHLA 3G1UA 2DTXA 2YV2A 1K3TA 1PJLA 3KETA 3T4EA 3BA1A 1LC3A 4NU6A 4UEKA 1D8AA 3B20A 3GDOA 4OM8A 2SCUA 5G2OA 2J5KA 4DPMA 4XQGA 3RQSA 4OSOA 4Q39A 2E48A 3RU9A 1MG5A 3VZRA 2OGUA 2DKNA 4CR7A 4RV9A 5JCXA 2TMGA 1P44A 3QWHA 3JTMA 2X8LA 1LRKA 3GVHA 3WDSA 1EDZA 3CPSA 4J4TA 4CMHA 3IKTA 2QQ5A 2JFFA 3E9QA 5U9CA 3D4PA 4A0SA 3GUCA 4CMIA 5FWNA 3OJEA 5I9LA 2BMAA 3TL2A 3LT0A 4EEZA 3ASUA 2QYTA 3LYLA 3FPCA 3DHEA 2W8ZA 2NU9A 4GQAA 1AUPA 4O59O 3WXBA 4BNTA 4P4NA 3JQAA 4QX6A 1XSEA 1A7AA 1Q7BA 4YAJA 3Q2KA 4RF3A 2D8AA 2P9EA 3JSAA 3ROPA 2Q1UA 1YVEI 1E7SA 1Z7EA 1UDCA 5JCJA 3DAPA 4GLLA 4DIBA 3DZGA 2WYUA 2J6IA 1R4MB 1W6UA 2YJZA 2BI8A 1SB8A 1NFRA 1UZLA 2G76A 3RUIA 1VL8A 1ZVMA 1T2EA 4Q3DA 3F46A 1QG6A 4B3HA 1RM4A 2JJYA 1DJNA 1H6AA 3H5NA 3JD4A 5JAIA 1Y7TA 6ADHA 4GH5A 4G5HA 2PGDA 4LCEA 2VT3A 3AY6A 4BNZA 3CH6A 1R0LA 1GL3A 3KOUA 3UCEA 2AXQA 3ZGYA 3EGOA 4N5NA 1WW8A 4ZQEA 4UVHA 2DBZA 4XR4A 5C7OO 3PJEA 1UZNA 1EE9A 4BO4A 4MINA 2GRAA 1BDBA 1E1MA 3I9MA 5ER6A 1GQYA 3HWRA 5BNFA 1Z74A 3GGOA 2FWMX 2I65A 4LSWA 5TT1A 4UVDA 1A5ZA 3V1TC 1NVMB 1BXZA 1ONNA 4BB5A 4MDHA 2OP0A 3D4NA 5AXAA 3RSHA 4YJHB 1Y8QB 1I32A 1OBFO 4YRBA 4ND3A 4RQUA 3HADA 2PA3A 3RC1A 4L75A 5CDGA 1ULSA 2UV8A 2GDZA 3AUSA 4IM7A 4GL4A 1ZSNA 2IXAA 1QXSA 3A1NA 4BO0A 2ZTMA 4U5QA 4D0RA 2V6BA 1BW9B 4OO3A 2VZ0A 3UW3A 2RAFA 2V6FA 5IJZA 1Y8QA 2BFMA 1LSJA 4WOKA 1LSSA 4X54A 2VUSA 1PEDA 4CM9A 1O9BA 2IZ0A 1H2HA 5AXCA 4JJFA 4WOJA 3GA0A 1PX0A 3PHLA 2Q2QA 1PZHA 4NH4A 4OXYA 4PLTA 3MWEB 1B3RA 4RO0A 3B70A 5AXDA 1ADBA 2H9IA 1QV6A 3C7DB 3QY9A 4Y6SA 4B8WA 2B4RO 1V35A 1AXGA 4YAGA 1VL6A 5ITVA 1GUFA 3LC7O 4F3YA 1GD1O 4CL3A 1X7DA 5JY1A 3ITKA 3NTRA 4XB2A 1GCUA 4GKVA 4KMSA 3GG2A 5JSFA 1HZZA 3BMNB 3GT0A 4PLHA 5TJHA 1E0DA 3GN1A 5KIAA 4CQMD 1VI2A 3ZWOA 2DLDA 1PJQA 4FFRA 4RVGA 1T26A 3O26A 2NSDA 4AJ2A 2AHRA 3Q9UA 2DT5A 3WIDA 5JS6A 1UZMA 4GWGA 2GZ1A 1N5DA 4XDZA 4CMEC 3O03A 3RWBA 3AU8A 1JTVA 3P2OA 5I7FA 4BKPA 4XA8A 3MTJA 1IZ9A 4E2WA 4Q3AA 4D79A 1E3WA 3GY0A 3ZHYA 1ZK0A 1ENOA 4H7PA 4PLPA 1DC5A 4A5OA 3ZV5A 4FFPA 2JFGA 1NASA 2GO1A 2JHGA 3AI2A 3ONDA 4BKQA 4PIVA 2YHIA 3JCZA 4HP8A 2GLXA 1GYRA 2GN6A 3ICPA 4W82A 4J1SA 3OSUA 2PD3A 3NGXA 3QE3A 3JQDA 4CUKA 1T1SA 4OMUA 1FDWA 1PU2A 3TJRA 4O6VA 1EBUA 1IB6A 4AG3A 4DWVA 2G1UA 2P9CA 3FPLA 4U0JA 4YQYA 4XDYA 4HKTA 2D5CA 1H2BA 4IXWA 4YPOA 2PH5A 4YCAA 5A9SB 1DOHA 3VKUA 1LI4A 3WB9A 2CD9A 3V8BA 3WR5A 2OL4A 4NK4A 4S1VA 3ZWXA 1U5CA 5F5NA 5KJCA 3E9MA 4J6FA 1PWZA 2AQKA 2Q46A 4R1SA 3H5RA 1NQTA 3WSWA 1PL7A 2BD0A 2IYOA 2X5OA 2JHFA 3WFIA 4CQMB 2NQ8A 2PFGA 5L4LA 4RVUA 5TNXA 5AYVA 3RIHA 1BXGA 2AE2A 3ZWAA 1X13A 3WTBA 4E13A 1HWYA 1U4SA 2ZK7A 4BOYA 3TF5A 4IDAA 3QA9A 4CV3A 4D42A 1XU7A 4WNCA 2PGJA 3IUSA 1I3KA 3H9JA 4BVAA 4E2XA 2WYWA 4L4XA 3NDJA 4E30A 4W7IA 1YDEA 3F1KA 3OEYA 1G1AA 1ID1A 3C1TA 4YA6A 4AFNA 3PYXA 3RASA 4BO3A 4DYVA 1I36A 1V6AA 1MGOA 3MJEA 3BTOA 4A73A 1AXEA 3UHAA 3RC2A 4ALMA 3JQBA 1UR5A 3U49A 1M67A 4LRTB 3LF2A 5A04A 3I5MA 2FN7A 4B79A 4HX5A 4FFLA 2WSBA 4CUJA 1N92A 3DMYA 2VWPA 4FD3A 1T4BA 4E33A 1JQBA 2HQ1A 3RBZA 2R2GA 5G4KB 1E7WA 3F3SA 3KB6A 1ONPA 4UVGA 4E31A 4IJKA 4IIUA 2HSDA 4PLYA 4BGIA 4DL9A 1Y1PA 3K9QO 2VHVA 2Y0CA 3EC7A 4AVYA 3DBHB 1ISMA 2CNBA 2IZ1A 4ND2A 4E32A 3ZWCA 4CM5A 1C0IA 1HDCA 3RD5A 1YQGA 1LU9A 5KKCA 4J7XA 4MPDA 1HSOA 3DDNA 2GERA 3OM9A 1PSDA 4GX1A 4MP3A 1RM0A 2WJPA 4N5LA 2DUUA 3JQ7A 4Z3DA 2XOXA 3L77A 4FGWA 4LGVA 1D3AA 4NG5A 8LDHA 4KDEA 3Q0EA 2PNFA 4B3IA 1Z6ZA 4TZTA 3AM5A 3ZNPA 1JLLA 2X9GA 2YY7A 3ZNOA 1LRJA 3PZBA 1XG5A 3ENKA 3WGOA 3K6JA 4CLOB 3LF1A 4WEQA 1DIBA 1ADGA 3VPFA 1EFKA 1XELA 5G0VA 1LDNA 4HBGA 3ST7A 4ZVVA 4FB5A 3WX0A 1KC3A 4KWIA 2V65A 2CY0A 4NMHA 4I5DA 1V3TA 1O95A 2PV7A 3S8MA 1NVGA 5JMPA 4XQCA 5HA5A 4EBFA 3S2FA 3HN7A 1E5QA 2FZWA 2YFQA 3AM3A 2VYVA 4G2NA 3JYNA 4FIZA 5T6BA 3DFZA 4ZQHA 3WJ7A 5EN4A 2YHUA 3I1JA 2O2YA 3U3XA 4FDAA 2CSUA 3U4HA 5F1KA 4ALIA 4ZQFA 4Q3NA 4NJOA 4ND4A 3L6DA 2PK3A 2UUPA 3FNEA 1JKIA 4J0EA 1HT0A 5I7SA 5LCXA 1HDXA 1Q7CA 3GAZA 3Q9NA 1RYEA 1GTMA 3DBRA 1VSVA 4D41A 2VWGA 1ONOA 1HE5A 2W2KB 3FBGA 3GZ4A 3A14A 3AK4A 3ETGA 3CSDA 7MDHA 3AOEA 4R5MA 3WNQA 4BO5A 5I7VA 2PH3A 3GZNA 1U4OA 4D0SA 2A4KA 1H6CA 3D3WA 4PG7A 2VZ8A 4W6ZA 4OIMA 1D4FA 5JAZA 1C1XB 3PHHA 5CDYA 1J0XO 2WM3A 2J5RA 4MVJD 1NR7A 1V3UA 1W8DA 1JAXA 2CDBA 4QEDA 4EUFA 1B0AA 1ISFA 1JAYA 1VSUA 1NNUA 2Y1DA 3DBLA 5JC1A 1FDUA 1I3LA 4E4YA 1LX6A 3T7EA 1PIWA 1I2CA 3I9LA 3U5TA 5JYDA 2XPCA 3Q1LA 1GEEA 3EZYA 3R6DA 5H82A 5TF4A 1PJ2A 5LDHA 5L9AA 4CQLB 1B8PA 3F1LA 5CPFA 2Q2WA 2EP7A 1UP4A 4R51A 5KJ1A 1JU9A 1PGPA 3DBLB 4CV0A 3GVXA 1MLDA 2VQ3A 5JO9A 1Y9AA 7ADHA 4RPGA 4UAGA 4PZCA 2LDXA 2C59A 3GMSA 3JQGB 2X86A 1NTOA 4U7WA 2VNAA 1Q0QA 2AG5A 4DYDA 2IYPA 5TLSA 1NP3A 4ZQGA 3DB2A 1VKNA 5IDYA 2YW9A 4IQGA 1UXJA 2DBRA 1AGNA 5EQDA 3I83A 3KSDO 3ETDA 1DFHA 2HO5A 2VOJA 3ONEA 3PZRA 4GMGA 5C7LO 2FR8A 4XD2A 1U3VA 4B7CA 1X7HA 5JLAA 1PS9A 2VYND 2H6EA 1RM3A 1R4NA 1XQ1A 4N5MA 1IPEA 4IPTA 5GZ1A 1ARZA 3IUPA 2I3GA 4TVOA 3JD0A 1F0YA 1B26A 3CTMA 3GR6A 1NPDA 3GEGA 3GC6A 4DTIA 1P1RA 4XZ3A 2OP1A 2C54A 4EITA 4ROSA 3ZNQA 1AHIA 1P77A 2EXXA 1DFIA 1DLIA 4PG6A 4AICA 4LN1A 3ADPA 1E7RA 3K73O 3KHUA 1YB4A 4D7AA 3C1AA 4C7JA 3H6KA 4TQGA 3OP4A 1EVYA 4WLUA 2OMEA 2CF6A 2O3QA 2DM6A 2Y0DA 4II2A 3E82A 4FC6A 4KQWA 1IE3A 3SBOA 4YB8A 2JCYA 3ANNA 2J3HA 5JNLA 3IS3A 1NHWA 3VTZA 3AWDA 5BSEA 1SMKA 3LSYA 3GNQA 4LSMA 3AUAA 3E03A 4J4HA 3RUCA 4FBGA 4ZGWA 3TOXA 1I33A 2WE8A 4YBZA 4CLXA 3U09A 5I8WA 2WD7A 4YTEA 5FI3A 2X1HA 5ILGA 1M2WA 3V1UA 2O4CA 4O63O 1TT5A 1GY8A 4UUMA 2PZLA 3MJ4A 4YYZA 3NDIA 4CM6A 5T57A 4ZQBA 1HSZA 2I5PO 5L53A 3NJ8A 3WYEA 1PGQA 1P3DA 3ROQA 1HE4A 3I4FA 5DNAA 4PLWA 4MVJM 4BNUA 4TWRA 1YONA 2YV1A 1B7GO 3LT2A 1VJ0A 3QV1A 4FFMA 2IRWA 2VHYA 2O23A 1PQUA 4BO8A 4R9SA 2Q49A 3UN1A 5K6AC 4JCOA 3E9NA 1P1KA 4Y98A 4YRDA 2G5CA 1T2AA 1L7DA 3EDMA 3FR7A 3GDFA 2EHDA 4AJJA 1H6BA 1VE9A 4RVFA 1RPNA 4RPJA 4UVIA 2GASA 2Z1NA 2JCVA 4R4JA 3GZNB 2ZATA 1WWKA 1EE2A 4BNWA 1MXHA 3JQ8B 4BV8A 3NRCA 4TVBA 1D1TA 5B37A 1JN0A 4GX5A 5MDHA 3P5SA 5DF1A 1QP8A 2DFVA 3DHYA 3OIDA 2EF1A 2NTJA 5K9ZA 5G0UA 5CEJA 3SC4A 3F4LA 1KVUA 1E6UA 3CINA 1X1TA 3UOGA 2GGSA 5BSFA 3ICCA 3VH4A 1V3VA 4EZBA 5IZCA 4JJIA 4NK5A 1HLDA 1L7EA 4IZHA 4Q3CA 3OMLA 3I6IA 2CVOA 1E1LA 3AFNA 4BL5A 3VH1A 3QVOA 3DZFA 3PLRA 4CMGA 5BR7A 1P9LA 3KZVA 4U6QA 1P1IA 2NVBA 4WUVA 2RIRA 2VNSA 2NU6A 3ADOA 3JD2A 2X5KO 1NWHA 3INRA 3UVEA 1VM6A 3OA2A 1LBEA 5DP2A 5JXWA 1VC2A 3IJPA 3WGZA 1EVJA 4RGBA 1XGKA 1ZNQO 1LLUA 3BMQB 3I9OA 1N7GA 3H9UA 5KOIA 3QIVA 2PZKA 1NHGA 5L7WA 4CLEA 5JO0A 4YT4A 5H81A 3K96A 3LT1A 2CVZA 4XGIA 1UH5A 4AJLA 3H7AA 1JWBB 1H9AA 5A06A 1U28A 3W8EA 1G6KA 5KVCA 1M76A 3VC7A 4EW6A 4DBVO 2D2IA 3WWZA 3CEAA 1KBZA 3H3JA 5EIOA 6LDHA 3BMQA 2R00C 1X0VA 3PWKA 5TRTA 3W4KA 4CPDA 5FEUA 1XDWA 3D5TA 3IIEA 1Q1NA 3G17A 1WZIA 3MOGA 4P4GA 2GCGA 3AUTA 1WP4A 3EYWA 4J16A 3IP1A 2VHWA 4OHUA 3ZZNA 2YUTA 3OJFA 2OBYA 3ZN2A 2I99A 3H65A 1LDMA 3M2PA 5ES3A 2POQX 2P91A 3STHA 4CODB 5GY7A 3WGTA 5CDTA 2O2SA 4K9DA 5TX7A 3N7UA 2YHIB 1PTJA 4NDNE 5A9SA 4WLFA 2ZYGA 1NX6A 2Q4EA 1Z7BA 3EUWA 3KTDA 3A28A 5G0SA 4DMMA 4N54A 2X5JO 4IBOA 3KSZO 3F9IA 3O8QB 4K26A 4U6SA 3D1LA 3P7MA 1MFZA 3IP3A 1H94A 1PGNA 1YH3A 1U1IA 3WQSB 2Y68A 3GK3A 3X2FA 4WLNA 1W73A 2Q99A 1GCOA 1TVEA 2Y66A 1NPYA 3DAFA 3H5AA 4FC7A 4CLDA 3QSGA 4AJHA 3JQEA 4RDIA 1BXGB 3FNGA 3GHYA 4IXTA 2B83A 1Q0LA 1N8KA 3IL2A 1ZJZA 2HJSA 4XX0A 1WMBA 3WBFA 1PJ3A 3X2EA 5T8KA 3JV7A 3GAFA 4FQ8A 1H9BA 4DLLA 1R37A 2DBVO 2LDBA 2NADA 3DONA 4IY1A 3GPIA 1E3EA 4MVJG 2J3KA 5JDCA 4CV1A 1JDJA 1MC4A 5TGDA 2ZKLA 2GF2A 1Q2XA 1I0ZA 1PJ4A 1VPDA 1ZKMA 3ABIA 1EVIA 4YEDA 5DULA 4EEXA 4JIGA 4BNIA 2BI7A 2NLOA 3KEQA 4I9NA 4RLSA 1UP6A 4FR5A 1ENZA 2HDHA 1YBAA 3NV9A 3JQ9A 1GR0A 5L40A 1LLCA 5IAAA 4BHTA 3FN4A 3N74A 4UUNA 1YS4A 4S3MA 1GYPA 2DVMA 4XYEA 4GVXA 3SEFA 4B4VA 3W8FA 4RVHA 2AQ8A 3E8XA 4GX2A 1E1NA 5EJ2A 3MZ0A 1QYDA 1D7OA 1FMCA 3HFGA 1PQWA 1CDOA 4MOWA 3UXYA 3W4JA 5L95A 1CETA 1S7CA 4FOOA 4GSKA 5L3ZA 2NU8A 4WCFB 4E2ZA 3ZDFA 2VHZA 3DMTC 4F6LA 4I5GA 2NWQA 4YQZA 1E5LA 4J1TA 4J90A 3WYCA 1E7YA 2EG9A 3ENNA 2R6JA 5AVOA 3RKUA 1HLPA 3GDGA 4D3SA 1LLDA 3Q2IA 1E7MA 1B3BA 2WYVA 3H4VA 3JQFA 3SLGA 2J5QA 5ILOA 5U4QA 1DSSG 3PEFA 1OI7A 1HYGA 3OICA 3UAGA 2JD2A 3TSCA 3PDUA 4N7RA 4J9VA 3BMOA 2ZYDA 1E77A 2B35A 1KVSA 3HJAA 4XIYA 3ZH2A 1UXKA 2D5AA 3DBRB 1EQUA 2B0JA 3GUYA 3KXDA 3ZU2A 1E92A 2A94A 4L73A 4YJDA 1XYGA 4AJIA 1O89A 1CERA 2V6GA 4NBTA 5T8KC 1UAGA 3QVTA 4NFSA 3C7CB 3ZWMA 4EI2A 4MVJI 1EFLA 2OHXA 3NT4A 4EYEA 3QWBA 2UAGA 1PZFA 3PK0A 1Z45A 2D1YA 2UUOA 1HDRA 1M75A 2Z5LA 4JK3A 4GPD1 4I9UA 4J3FA 4O5OA 3RFTA 5T64A 4ESOA 3I3OA 4IMPA 1JW9B 1ZH8A 1K6XA 2A9FA 1HXHA 4DA9A 4E21A 1N9GA 3BXXA 1M66A 3B6ZA 5A1TA 5A5EA 2AEFA 1F06A 4BO7A 2B37A 2B69A 1BMDA 2I3AA 4HFMA 4AJEA 3KV3O 1LLQA 4WCDA 2QHXA 4WLOA 1ZSYA 1UAYA 1I5RA 1DIHA 4P38A 3H9GA 3VZQA 4BQRA 3LC2O 5HBRA 3D5QA 1RJWA 4Z0PA 2A35A 4JXKA 2HKIA 2DTDA 3NDRA 3IQDB 3W8DA 3G79A 1P74A 4G81A 2AW5A 4GGPA 3KYDB 1K0UA 4NHEA 2NM0A 5I9NA 1YB1A 4JBGA 1OOEA 3IMFA 3BZUA 4ZJUA 4J1QA 1A9YA 2ZTLA 3NYWA 5JDIA 5DZSA 4JROA 2CVQA 1BGVA 4FFOA 1HYHA 1HYEA 2G82A 3TQHA 5TS3A 1HDOA 3TZ6A 1XQ6A 3D3WB 1X7GA 4R3NA 4CMBA 4MO2A 1QYWA 3HB5X 2NTVA 1HL3A 1VL0A 2VN8A 2ZTVA 3SC6A 2Q1TA 3BIOA 4KQXA 4LMPA 1YBVA 1TT7A 2W2LD 3GGGA 3GVIA 3IKVA 1ISHA 4IUYA 1DHRA 1BTOA 5JDCC 3QVWA 4XJTA 3HDYA 1U3WA 4BUCA 3NEPX 1A72A 1C0LA 4PCVA 4CM1A 3PHIA 4Q3BA 3PDJA 4XEHA 3ZHBA 1PQPA 3P19A 1FK8A 4KOAA 5KKAA 1ZCJA 3LK7A 3F47A 3TFOA 3DZIA 2O48X 2P9GA 3ITDA 3H9EO 2PKQP 1LRLA 5DBIA 4EUHA 3PGJA 3PWZA 3AJRA 3S55A 1D1SA 2X0IA 4DQVA 1IHXA 3VZPA 4GWKA 1DRVA 3K8ZA 5GZ6A 2HLPA 5A9TA 1DB3A 4A10A 4CLHA 4KUEA 4M1QA 3KUXA 3W1VA 3WYBA 1ADCA 2HMSA 3DZBA 5G0TA 3QP9A 1GYQA 1UXGA 2DQ4A 4KWHA 4B7XA 4LRSB 5B4TA 4OJNA 2P5UA 4E2YA 4NFYA 1EUDA 5I8ZA 4I5EA 4RVSA 2NVUB 2RH8A 1GFSA 2A92A 1YL7A 4IDFA 3I6QA 4CMCA 3GNSA 4L4RA 1ZMTA 4D44A 4HFJA 4GMFA 1ZSVA 1UXIA 3RI3A 2W98A 3GLQA 4PLCA 3I23A 2BELA 4YJHA 1SAYA 4E5PA 2EJWA 1V9LA 2G0TA 3RROA 1ZUD1 3F5QA 3R1IA 4I8XA 4Q3EA 1IULA 3VDQA 2D3TA 1H0KA 1BDMA 3FF4A 4XR9A 1CWUA 3WGQA 3WS7A 1JWAB 2WD7B 2C5AA 4GSLA 2X23A 1YDWA 4M8SA 4YJFA 5AOVA 1GAEO 3DTYA 1OMOA 3RJ9A 5A9RA 3GRKA 1A7KA 1LSUA 4WE3A 3OJOA 3JYPA 3GVCA 4AL4A 4DLAA 4XKJA 2UVDA 2B5VA 4GVLA 2B36A 1HE3A 4OQYA 3RCBA 4MP6A 3NT2A 3NKLA 5CPBA 1NWCA 2VRCA 1SNYA 2WD8A 3A06A 1LDBA 1ZXBA 2WMDA 3ZWWA 2NUAA 3PIDA 3VH3A 4L0QA 1NYTA 5F3RA 3Q3CA 4NR0A 5ER9A 4HWKA 4P4LA 3GG9A 1DFGA 3RUHA 5CEFA 4RF4A 1IY8A 1E1KA 2VOEA 3GF4A 1QLJA 1YL5A 2Q1SA 4RZHA 3PIIA 1CEQA 5KJFA 2O4UX 4FW8A 3R3JA 4M54A 1C3VA 1PJCA 1ENYA 3C24A 4TROA 1I30A 2C5EA 5THQA 2PD6A 3WFJA 3WLEA 4IJUA 2WEKA 4Z3KA 3GH3A 1CYDA 3KYDA 2QYSA 2C82A 4EGFA 1IYZA 4YAEA 3D7LA 1ZIDA 3RJ5A
chains in the Genus database with same CATH superfamily
4FKZA 2GNPA 2HV9A 2ADOA 3KQSA 3PJFA 2C9DA 4P92A 1E3JA 3WDLA 1KEPA 1IM8A 3IQIX 1MF7A 3O8CA 3SEZA 3ZXYA 2WC1A 5C0OE 1GQRA 2XXJA 4JUDX 1ZK1A 3B89A 4MGHA 5CNMA 2BHLA 2P0AA 3PVSA 3RM3A 3T9CA 2ZB4A 1OAKA 2H9AA 4MGZR 3VU9A 5EJMA 4DQUA 1FE8A 5F7ZA 3EMKA 2ZUBA 1SKMA 2ZRGA 4WZAB 1FLDA 3EXHC 4AMYA 2QRHA 1R8QA 1VYVA 1JFRA 1M0SA 4K9KA 2GWRA 4QAJA 1TO2E 4BNHA 3IRUA 2A33A 2QRGA 2HK9A 2YOGA 2LCQA 2IH2A 5JHGB 4Q00A 4Q9IA 3O1JC 4Z4FA 3P9IA 1ZM2A 2NTNA 2VZLA 4ZJYA 4EECA 1VL1A 2MCFA 1PX2A 1QIGA 5EQFA 5EG5A 4EDHA 2VCYA 2IBSA 2NX2A 2V9ZA 5E1BA 1X38A 1DIRA 1J8QA 2C2KA 1GZDA 2Q3LA 4L2IB 4C87A 5E95A 1J2YA 2P3SA 1KS2A 4F45A 4Z49A 4D9HA 1E8MA 1G0NA 1ML3A 4IOKA 2VJDA 3WRXC 1CY7A 2B7BA 3U7FB 1FVOA 1PT7A 2NUPA 2HSEA 3EK2A 2CJWA 4FQ7A 4KWCA 4IDPA 4GIBA 2I4IA 4WADA 4K1XA 4D3FA 2ZTUA 2DFDA 1ORWA 4I55F 5CURA 3KQNA 2Q0SA 1VGRA 3ONVA 4ZRNA 4MW7A 4GI5A 4AMZA 1QBKC 4I9HA 3OEWA 2B4QA 4JJEA 4M2LA 4Q03A 2OCGA 1T4CA 3JQQA 2AKEA 2COUA 3BICA 4ZANA 3OPQA 3B52X 3AEKB 3IAHA 3DM5A 3PFNA 4A8TA 4DPKA 3I62A 1SEVA 1BCRA 1AQYA 1PNQA 4QOIA 3GCGA 1Z6GA 3SN6A 3SNHA 3UH1A 2X6QA 3TNLA 1ISSA 4DB2A 4MQFB 3PGA1 1AB5A 2R7NA 4HO1X 3MCZA 3QMMA 4HNHA 4MKGA 1UUFA 2Z9CA 1T4GA 2IDZA 3AY7A 2O1XA 4HN4B 1DQNA 3F4BA 1F3OA 1MPTA 4A6PA 5BQ3A 1LTKA 4P31A 1L4UA 5COQA 3SX2A 5CFNA 4N0MA 4OUDA 1I14A 2CHGA 2J33A 4GX0A 3PUIA 4ZAFA 5JZMA 2VF7A 3TLGB 2UUBB 3CEPB 1JE1A 3G13A 1J07A 5AKHA 3SICE 3AHCA 1JQ5A 4MLPA 2GCPA 3JYHA 2IIPA 3UA3A 3MWLA 4NCIA 3UPDA 1XD9A 2REOA 4UM8B 4C0KA 1WPQA 4YRIA 4EGAA 4TKLA 3WB0A 5L45A 1UMBB 3OZGA 5C8VA 3MXTA 1AK2A 2YXLA 1RQLA 3FM9A 4JNKA 3T3MB 3LFUA 1QYVA 3KTAA 3HKEA 3NWOA 2GILA 4X7PA 16PKA 5DXAA 4DSAA 5TIIA 3H11B 2NU6B 4YQFA 3FSRA 4ZCTA 3L01A 4HAUA 2X6TA 1A4IA 2CL6X 4ZVLA 2WJVA 3UBTA 2V1UA 4CEIA 4B76A 4B5LA 4DCGA 3OE7D 5LSAA 3OF2A 4QBGB 3USES 2RGUA 2BGWA 2UYGA 3IT0A 4UQPA 1QTQA 2J0EA 1EP2B 4HVCA 4NLLA 3SSAA 2FG7C 3W2IA 2DECA 5DTRA 4AZ3B 1JFTA 3TEMA 3UXHA 3UJPA 2FF7A 2VUUA 3T95A 3IPYA 5DOVA 5KTNA 4JT2A 3H8SA 3GH1A 4HUQB 1UBMS 1ZJ5A 2L0XA 4DZRA 1ZEMA 3PYLA 4I4LA 2WWHA 4PO8A 4UD6A 4KQGA 4Y1RA 3WNCA 4BX3A 1K1EA 4ZOBA 1ZIXA 4NARA 4QD3A 1V39A 3UWPA 5KNCA 4GP6A 1VCHA 1YZHA 2G77B 2O2DA 3OOWA 1BS2A 1OC2A 2OUIA 3OPYB 5E1MA 1KBOA 2CXRA 3R8XA 5I4CA 1G6Q1 2G72A 1RLJA 4P3NA 4QHSA 2WZCA 3I6ZA 4H1UA 3R76A 2XDQB 3EF0A 4U9HS 5C8ZA 2Q3JA 2JI9A 1Z2OX 4C7VA 1LS1A 4FFNA 2VTBB 2XRFA 1S7GA 1JEOA 3TNDA 5C1OA 3JR3A 5AW9A 1VJTA 4CLRA 4UE3S 5TJ9A 1DRWA 2BL4A 3ACBA 1CC1S 1M6HA 2BLNA 2WUFA 4D9NA 1V25A 2WJGA 2IE0A 2HAEA 1E6LA 4EI9A 1Y3BE 3AY3A 1PV4A 3FGPA 4X63A 3OIGA 2ZUDA 5HUJA 4YLYA 3MIIA 4H6VA 1PT5A 1YDFA 2IYLD 5TQVA 2QW0X 2AT1A 1IVSA 3I9V6 1ZEJA 4DSTA 3L7OA 1QP7A 4ZK2A 3ZV3A 5F52A 1NW9B 1L7MA 3M81A 3O8QA 3VR6H 1HZZC 4JT9A 3W5VA 3M9XA 4JFRA 1L9XA 3FMGA 5GV8A 2I55A 2RKOA 1QKIA 1YULA 4QHTA 5THKA 1NN3A 5A71A 1YZGA 5EKUA 4LFCB 4E0BA 1C0KA 3N7AA 2OHOA 1KSJA 4IRMA 4D3DA 4MUAA 4W1SA 2OGTA 3DFMA 3CSUA 3NU1A 1QGAA 4C6TA 2ZWIA 1RLTA 2HT6A 3CZ5A 4NX2A 1EB9A 3DO5A 1L5GB 1S9HA 5K51A 4DA7A 2FN9A 4L74A 4XJSA 4JLPA 4LISA 4NJMA 3SMVA 1FNCA 3PFWO 3V8PA 4AJOA 4QUHA 2CZGA 4MIYA 3VX3A 5KI6A 1VHDA 3K09C 1K27A 2P5SA 3RU7A 1HKHA 3D54D 2HJ9A 3KQHA 3DWGA 3LZCA 3OIWA 2UDPA 5ICFA 5KTTA 4MKFA 1FU7A 3OO1A 5FT9A 1VIVA 1SHKA 2PT5A 2WKSA 2E5FA 1OZAA 3AVTA 4OAQA 4BMDA 1VDMA 4HRAA 3S2IA 4ATNA 2WDPA 2FK8A 5LP1A 4FCVA 1MB2A 1HFEL 1R0XA 2VDUE 4ZCLA 3VVCA 1FFWA 2XQVA 2X7HA 4BU1A 2AK3A 2JK0A 4A8HA 3IC5A 5G4LA 4WA7A 1YR6A 1N0VC 2VTDA 4LJKA 5LQAA 4XGNA 4LXYA 1HDYA 3L6RA 1WU8A 3EUEA 2OQRA 4Z6KA 5AVSA 4RD4A 3GBPA 2H52A 1E2IA 3SBEA 3HTXA 4EUEA 2Z98A 4WKBA 3TUIC 4OX9Y 1ORTA 3LX6A 4LJ9A 3UAZA 2NO6A 5B1YA 1NUPA 4NH0A 1J8VA 2P2DA 2DCMA 3QKTA 4Q1VA 4XGKA 1BU5A 1ZZEA 3U7QA 3TZKA 4KTVE 5DP1A 4ALKA 1DRUA 1H93A 3INGA 1W36D 5IUJC 2XXBA 2RHCA 3FUVA 4E88A 2VFAA 1H2YA 1MU0A 2EW2A 4QSMA 4R54A 4LRXA 1N1EA 4RH0A 1T0IA 5D51S 1UJ6A 3WNBA 1E2KA 1SXHA 1KFBB 3ZCPA 1MO2A 3PE6A 2GYYA 3O94A 1SHLA 3MMXA 4BNJA 4RTPA 5CCEA 2ZUUA 1IU9A 1C1YA 4Y9RA 1NXXA 4F4DA 5A03A 1SCNE 1QS0B 2C98A 2CYBA 4JWKA 4YXFA 4M1YA 3ZNNA 4G0QA 4U1RA 1AQ6A 2QTZA 3RPEA 1Q6ZA 1RDFA 2L18A 1R8XA 2P3QA 4EG0A 3TRKA 4HL6A 1RZRD 1YO6A 4WASA 2HTFA 2QYHA 3QEOA 4W8OA 3OX3A 2LR0A 3KBOA 3RK1A 3Q7QA 4MQ4A 2WMYA 3T34A 1SR8A 3H2JA 3QU5A 4A6EA 1U5BB 4M0KA 1EFRD 4UZEA 4ZICA 3VSAA 3I8SA 1IL0A 1IK4A 1DKNA 4K03A 1SVMA 2ZRCA 1QYIA 1ZI8A 1XR3A 1Z88A 2WSSD 3BKXA 3QEMB 4KODA 4X7BA 4A6XA 5KQRA 4O3MA 2JAWA 3CWCA 3M83A 4OXQA 4RJKA 5KTOA 2MYNA 4Z9YA 1G4UR 1Q0ZA 4IDDA 3LU1A 3UV6A 4ZYLA 1EK1A 2KQUA 1Y81A 4KFRA 1QQAA 5D3ZA 1W5SA 4EJ6A 5BNIA 1MFPA 1E2DA 4KO1S 1BD3A 1PVDA 4MUEA 4UDOA 5GQSA 3HJBA 4LJSA 5IJAA 2HUNA 1T34A 2GSWA 3VPBA 2XITA 2VP5A 1FSFA 1MJFA 1NMZA 2O3JA 2OV6A 2JGDA 1BA2A 2O54A 1C4KA 1GZHB 4YRTA 1RKUA 1TU0A 2FPIA 4AK9A 1RXIA 3SJ7A 1NY6A 4P36A 2P9TA 1AM4D 5IDQA 2OC9A 1N2JA 1CE8B 1F2UB 1IY0A 1SCJA 2PX6A 1K2WA 1P31A 2FPGA 2EKLA 3IOMA 3V8MA 1ZBQA 2NU8B 4GXRA 1KJYA 1M6EX 4LTMA 4YDSA 3QOWA 1Y5LA 4HGYA 5FB3A 4LE2A 4ZV7A 4LUCA 1UBRS 2ZPTX 3IDZA 4MIEA 4U39A 1Y8CA 7YASA 1Z75A 4XUDA 3FD8A 5AW6A 4JI7B 1PFYA 5DB4A 3AOEC 3HDHA 1KVTA 5BMVF 1PD1A 1T0PA 4UAUA 5LDGA 1P9OA 3BF7A 4JQCA 5AICA 1U0HC 1SG9A 1W4CA 2F7SA 2OHIA 4ALLA 5DU2A 3LE8A 3LQQA 3LUAA 1KAHA 3P26A 1B43A 2CUKA 2NXJA 4DLYA 4G1BA 3U31A 4F3CA 1Z22A 1KP3A 4X6LA 2FZGA 3TTVA 5BWOA 5IF9A 4G4JA 4HUJA 1VZ2A 1Q12A 4I08A 2VDNB 5GTDA 1WXFA 1G5FA 2ZSUA 3DUWA 3OTQA 3ZE1B 3I9JA 2YY5A 2PUAA 2WWYA 1M54A 1HDGO 3LPNA 4Z7QB 2UZ3A 2Q2OA 1G3MA 1MAAA 1GP2A 1LWNA 3EXHB 3EXIB 4F6CA 4MVJA 4TRMA 1JLSA 4OL9A 3COSA 1IM2A 1BVHA 1TAQA 3G85A 4WNYA 5L4SA 1YZQA 4LX0A 3H2ZA 2O3SA 1CIVA 1NL3A 2AZMA 2R1UA 3CR3C 3DAGA 3E9EA 4IO0A 2H2AA 2CXHA 2FCRA 2GN4A 3O3NB 4JHXA 2XHZA 4RD0A 1KE1A 2EWMA 1NVBA 2Z1MA 4Q4DA 2ZYHA 4IDQA 3VOBA 1NG9A 1S0UA 3JD3A 1ENPA 1UDBA 1FFAA 2YNMD 3DLPX 4IIDA 5ALXA 3ROGA 1Y6JA 1XJWA 3V6LA 3NNNA 3IE1A 1JUDA 1BDHA 2AKAB 3CN9A 3VVMA 3G82C 3N58A 1WBJB 3FCSB 1VE3A 2JIOA 1L4KA 3OLQA 3RANA 4TL9A 2NVWA 3M34A 4XWYA 3EXEA 2Q3DA 3O95A 1UBSB 4ED9A 2HI0A 3P0IA 1C2TA 4KP7A 3IP9A 1V9SA 2OK8A 3KU4A 5DT9A 5EP4A 3RUDA 3BWBA 1NVEA 4HYQA 4DWOA 3DE3X 3FVWA 2XMSA 1K5DA 2BGLA 3B3GA 2ZR8A 3I6MA 4IIYA 3P9NA 5ECYA 5F21A 3VI4B 5IXYA 1EXMA 1CP3A 1NQOA 1Q22A 2P4SA 3EVZA 1I2DA 3E7DA 4LMRA 2Q7OE 3FROA 3TL3A 2QT0A 2FSIA 4X97A 1GPUA 1J2JA 2FYTA 2OXRA 2XSZA 3N2ZB 3ITNA 3R0JA 4HDMB 2CNDA 5HRAA 2YFHA 4CN9A 1ZDMA 4D5EA 2L17A 4YP0A 4HNUA 2HMYB 1RZVA 1WL8A 4X1IA 5HIMA 1QPZA 3L7CA 3LP6A 1WQ4A 4O2AF 2FW9A 3SYRA 3CLUC 1XFAA 3A7DA 3D6AA 4KUHA 1GGKA 4ND7A 1SU4A 3NP7A 2QT1A 4CKWA 1TQ2A 4CM4A 3OIYA 5G41A 4FYJA 4IEFB 3X43A 4EJMA 3ORSA 3DDCA 3LY5A 5CLGA 1DBPA 1R3UA 1XMOB 1FS5A 1L7RA 1QTRA 1R00A 3C2QA 3AHHA 4W5RA 2ZB8A 1US8A 2OSVA 5EZSA 3PPIA 4NZZA 4Z99A 5EMJA 1MP0A 3B60A 1ZMBA 4NQZA 2AV6A 2QRLA 3L07A 4RH3A 4W4TA 2IHUA 1NVTA 2PVSA 1G4HA 4MS1A 3SZOA 4BDTA 2ZVPX 3NVKI 1RYDA 2VBCA 2AJDA 4LYFA 4POAA 4PWYA 1XU4A 1FYEA 1Z62A 4IIJB 5LA6A 1JG4A 4WOCA 5J9FA 3HHPA 3REFA 2PL3A 3H05A 4RULA 1NQVA 4MVJF 3IB3A 4GM1A 1A8QA 4X85A 3GVPA 3ZVLA 1V1MB 3GLGB 2JAOA 4LNAA 4Q1DA 1YGYA 4OXIA 1XPOA 2C1ZA 5ULLA 1IHYA 1IIBA 1K75A 4KSCA 4HLUA 3B6MA 1X1RA 2XKAA 4M22A 4R2IA 3U3MA 3AUYA 3ZU4A 5LYJB 4ERNA 421PA 5CFQA 2PMWB 5BSTA 3U62A 1D4ZA 3N2GB 4X8MA 3UHFA 4G4GA 1LQTA 1R12A 4IXMA 5DOZA 2XDAA 5AP9A 3JU3A 2A9RA 3L8DA 1ZRHA 1P0CA 4ZDWA 2AR7A 2G07A 2UVQA 5K3CA 1RHRA 2QN6A 3VTKA 1UQTA 2WRZA 4HH0A 4URFA 5HOEA 2J48A 5FJJA 3OJ0A 1C3EA 3LK6A 2A0FA 3I4CA 4KR7A 1UKBA 4CG1A 5AW4A 1R7RA 3LCUA 1X7ZB 4TL6A 2AZDA 1AOXA 3N0TA 1JSXA 4RD2A 5DLQC 1W5EA 3E0QA 4EF5A 5DCUA 1I6WA 2I87A 4INAA 5GZ3A 2RBEA 4B71A 4BVFA 4R6WA 1BXRA 4R3UC 3U81A 2HK7A 2X42A 3IAUA 4PLGA 1D2GA 1GDHA 4DR6B 2DUWA 2QSZA 2VDJA 4OQ4A 5JI2E 1G6HA 1SELA 1IPHA 1JR3D 3HP4A 3SKXA 1ZMXA 3D59A 1GNTA 4Y7DA 4GZLA 1PZEA 3AFGA 13PKA 1YQDA 3W5BA 4HDRB 4JQSA 2AMLA 4J49A 4CKBB 1XTPA 1XTKA 1Q92A 2X0JA 3U13A 2AN4A 3HFSA 3IJRA 1OE0A 4ZV4A 3VOAA 4BKOA 3BCRA 2BTOA 1TZ2A 1F8FA 4NE7A 3RYFA 4UEWA 2OM2A 3EBOA 3GP3A 3HFRA 3LRXA 3N76A 5KYYA 1YXMA 1F8XA 4V0SA 2ZJ2A 4U8GA 2YRXA 5FULA 6NULA 2OHJA 1ULZA 2G36A 3V7WA 4XX1A 5F4ZA 4NBUA 2XZTA 5K0FA 2ACEA 3QXSA 2VK8A 2OAEA 3FHLA 4W9NA 3NAGA 1OPRA 3RGWS 4QFDA 1GDTA 4XSGA 4FYMA 2ET6A 4GMKA 3FVVA 4P58A 5H4HA 1V5IA 1ZK3A 2VQFB 1U7WA 2GZSA 3PUHA 3V2HA 2E9SA 4JKIA 2I9PA 4XIFA 4XFKA 4DJTA 1SK9A 1SPXA 3EGXA 3O73A 4IICA 5I7HA 5IZCC 1OZGA 4IDBA 2P2CA 4KMMA 4US1R 3UJNA 2GD2A 5TVKA 3ZKAA 4MHTA 1YTUA 3VV3A 4OA5A 4R8RA 5INTA 1E61A 4G4IA 4B7ZA 3B12A 2PMBA 1IHDA 1Q0RA 1YOVB 2JZNA 2WWRA 3VR3D 3ZCXA 4D8TA 2PZJA 3KZMA 4KJXA 1XNQB 2V1XA 5J3JA 5EL0A 3FHCB 4WN9B 4BO6A 1FPQA 1DWOA 2OYSA 5CVUA 2VK2A 3QXJA 3RYCA 1WNTA 1Q0HA 1SIWA 4RQAA 2BC9A 4G63A 1GNVA 3H0KA 5FNVF 4AECA 3K2IA 4XDHA 3L9WA 4ZOQI 5CFZA 1ECCA 4DR7B 1W4RA 5EXXA 4GOKA 3Q1KA 2EU8A 2XODA 3Q3JB 4WXEA 4XYLA 2Y0BA 4BMYA 1RWMA 3B85A 2Q1XA 2I4LA 1BEEA 2Q07A 2WG2A 3DYBA 2QPTA 1CQZA 3G0OA 3GRVA 2Y2UA 4FHFA 4L4SA 5D5PA 3VU1A 3AI3A 4RHYA 4B4OA 5EJ8A 5I4BA 2WU1A 1SBYA 2QLNA 1XN1A 2C20A 3ZV6A 3LAWA 4ZOLB 2CVHA 1THZA 3EHEA 1OF1A 1N0HA 5LQRA 3EPHA 1XXLA 3GRUA 4EFLA 5KTMA 1RACA 3V2UA 4EW2A 3UYLA 4G0OA 1DG9A 4PZPA 1U2TA 2H4JA 4NBNA 4M1MA 3SGLA 2OZKA 3M6XA 5MGBA 4HPXB 2F3QA 5ALMA 3L4SO 4UUQA 3TJZA 1K89A 4BNYA 1WXGA 3WLOA 3IEMA 2HSJA 3RFVA 1K8ZB 3CURA 4BVKA 3GLHE 3NXSA 4M36A 4MTLA 5LKAA 2B5WA 5DTQA 3NQ41 1RHQA 4DABA 5EC8A 1T2UA 3HCNA 3LC1O 2L2QA 1IOVA 3L4BA 1D6SA 2CLFB 2VDWB 4A8JB 3G2KA 1K8QA 4WAUA 4V0KA 1U8XX 2BZSA 1QIKA 1UXOA 4BWGA 4LF5B 2W2NA 3BK7A 3JVDA 3C4VA 1NW3A 5I7UA 1IUKA 1TTPB 4QGGA 4I5IA 4PHHA 2JAXA 5ARDA 2IITA 5LC1A 2OG2A 3CMMA 1ZK4A 1ZFNA 3A26A 4RAOA 4U6NA 5SZHB 3DEHA 1ODSA 1JEAA 1ISJA 1UPTA 2O3UA 5CLFA 3CF2A 4W8GA 3UGKA 4WFJA 3WNZA 2Y1LA 4B45A 4M0PA 3UMYA 2J3DA 1U3DA 2ORWA 1QYRA 3EZFA 4H77A 3REQB 4NZPA 5KCMA 4MARA 5FPKA 5ENZA 5JHHB 4D81A 2GBLA 1DQRA 2E37A 3UUWA 5ICMA 1G2IA 1NKVA 4KXNA 4FW9A 4WCFA 4R3WA 3SXPA 3KAJA 1PJZA 3NXKA 2HLNA 2BTEA 4ZO8A 3FI9A 2VDVE 3M9LA 4OQDA 3F0TA 3D8RA 2C5FA 3IOEA 3D3EA 5EFOA 5IM5A 2WIAA 2ID8A 2ONKA 2Z9BA 1X9GA 3BDIA 4C08A 3EC2A 1N2EA 4QU9A 4URYR 3EXAA 2JAPA 3HBFA 4EG1A 2YZ2A 1SCAA 3K5IA 4HR7A 3FCAA 2W00A 3O2QB 4ARCA 4BNLA 1W581 5F12A 3AKEA 3KKPA 2H2IA 2F00A 2ZCVA 2WE7A 2CD7A 3G8YA 3AUXA 3GFBA 4JJZA 1N9GB 4E3ZA 2VPZA 3EEBA 4ZI7B 3BCUA 3BJEA 2DR2A 3RHZA 4NBWA 1KFEB 3QWFA 2ZSJA 3COYA 1IZ7A 4Q7QA 3N8GA 5BSGA 2NMVA 1ZAKA 1GRVA 1CNFA 1NR1A 3GZTB 4KN9S 2YXNA 3LQYA 4BX9A 5LIPA 1EVLA 3L7NA 1PL6A 4AX4A 3TIFA 4DXDA 4B2PA 3QEAZ 2BGIA 2FDCA 5CG2A 4BB6A 4R01A 4MPJA 3TSAA 3KE8A 5KC9A 1B16A 3QNWA 1VSTA 5EOVA 3MD0A 3W6NA 3KHSA 1U81A 2XCSB 4A7PA 3I64A 2OPHA 5DM1A 3FZQA 2MSCB 5BN4B 1YFZA 2F1RA 3AG5A 3OUUA 4O4IF 5BURA 2ZU0C 4CKCB 4O1MA 1JZTA 5IT5A 3JTEA 1GAWA 1V7PC 1YRLA 2R8RA 5LUAA 2JG3A 4E5NA 1ZJ6A 1DEOA 4U8HA 4RBNA 1QDUA 4UBJA 2GN2A 1V3QE 1WPRA 2O3RA 1FP4A 3JQPA 3UT6A 3B9QA 2CFSA 2VXYA 5ALKA 5D6OA 1T2CA 1I0IA 2OB2A 2O0JA 3BMNA 2IV2X 1S96A 5JUWA 2VYNA 3QLUA 2RG1A 1M34B 3CR8A 3H4TA 4HYTA 4QU0A 4KPUB 4DC1A 2Y1XA 3JYQA 1Y8RB 1I10A 1QK3A 2W4QA 3F2IA 2AFHA 3PYMA 4XASA 5ALRA 4GL2A 2QI9F 4GBJA 5E2IA 1B2LA 5CFLA 1JQLB 2CHUA 2QN2A 2YIDA 5C1DA 2YZ7A 4GDFA 1ULHA 2G7MC 3FDZB 1DTWB 3FTEA 5CCDA 1GPKA 1BMFA 1BVUA 1GLVA 1P9RA 1VBKA 4IIGA 3VPHA 4FE4A 2GVZC 5CHEA 4B33A 4BFSA 4PYLA 1F8GA 2QRKA 4I9FA 1ZOPA 4BCDA 2ZBPA 3H5OA 2W2TA 3U6KA 4GNKA 4JZKA 1P7PA 3G3EA 1G8SA 2PRYA 2AFIB 4HGOA 4LZPA 1A8IA 3E6AA 4C5CA 1RYYA 4QPPA 4FGSA 5IDWA 4PX9A 3VPGA 4JR1A 5CA1F 1X15A 3CRVA 3CFYA 3HPRA 3DOOA 3GLFB 2PBRA 1DEKA 3NTOA 1FYVA 1LK5A 1WB6A 2VYCA 3LCMA 3S27A 3MSCA 3W6PA 4U9IS 4QUKA 1ZNZA 2CFIA 3IDSA 3MMPA 4DVJA 3GFVA 3ZD9A 2W22A 2VK1A 1RJ9B 1AS3A 3IUYA 1LQUA 2P9YA 4NBVA 1EWRA 4QGFA 3EDRA 2IXEA 5KAPA 1URPA 2I03A 1UBGA 2LD4A 1YQUA 4I3FA 2QU8A 1OASA 5EA2A 1MOPA 4RH1A 4ES6A 4CIYA 1YWGO 3GOHA 2IXBA 1Y9EA 2QPLA 4M49A 4YQEA 3S7ZA 1ECFA 1O0BA 1RKXA 4EG6A 4QULA 2NTEA 4ZVTA 3O38A 1VHWA 2WHYA 2WYHA 5BQPA 3TE7A 3W9YA 5IHXA 1HE8B 4UU0A 2I2DA 4OKNA 1R64A 1W93A 3DOJA 3PQFA 4V3BA 2XADA 4ZAXA 1F48A 2IIQA 4LVCA 5NLLA 3ZGLA 3LLUA 5KVSA 1NVXQ 3TLMA 3NX4A 4R0MA 4H31A 2FG5A 4MZDA 1NSYA 2FQQA 1XDBA 3BB3A 4MR7B 3RVSA 1E2LA 5CG1A 3VKVA 4FT4A 5TC4A 4DCTA 4UMVA 2PN1A 3LGAA 2PCLA 1UMCB 621PA 1D07A 1H1DA 2Y1CA 2OO3A 2X3UA 4BGVA 4V0RA 2C5GA 1X80A 1BXKA 1IWPB 1TCBA 3ND7A 3DD5A 3LCVB 4G4SO 1TD9A 2XUIA 5JZ9A 3C74A 2OQIA 5JH7B 4BNFA 3JQFC 4L9SA 1QGOA 1S2MA 4PYIA 1T9KA 4YCJA 3E5MA 3A4TA 2FX5A 3OFVA 2C3OA 4L9RA 4RLHA 3GFRA 3KXKA 4BS9A 5JISA 4Y1GA 1ZRSA 2ZSKA 3P9SA 4Q01A 1K7XB 4O33A 5EWMA 2BEWA 3RSCA 2G83A 2ZYAA 3QBVA 4XGRA 4UJ3A 1Z2PX 2C97A 2VXBA 1C30A 3JASB 4ZQCB 3TSWA 1BHQ1 1H8ED 1KI8A 3PNYA 3IAS1 3BGDA 3EVNA 1DAPA 5DGIA 4MRNA 4M4SA 1U65A 2A3NA 3MTBA 4COOA 4BFVA 3OZ7A 4DLZA 4QXMA 3LTEA 1YCGA 1QSGA 1UK7A 4AJPA 1XEWX 5E3JA 4BYGA 2BBSA 1WOMA 5JFOA 1Z4LA 1N6NA 2VPXA 1SBQA 3KEMA 3E3MA 3QKRB 3Q6NA 4JBNA 3ZU3A 1OLUB 2JGKA 1J0CA 4EJ0A 1T36A 4R16A 4OGKA 3AV0B 2M6RA 1QVVA 1A9OA 2Y0EA 1XZGA 2O7RA 4YK7A 5EXEA 4FOTA 3R5JA 2A1IA 1DT5A 5EE0A 5AQ1A 1T0UA 1YQ9A 3UM9A 2XCTB 3ENZA 2X3FA 5J4LA 1B42A 3CE6A 4BLQA 3YASA 1A7JA 1X8JA 4RY8A 4Z86A 1L0BA 2QMEA 3G0GA 4AWXA 2ZVDA 3N8KA 3I2FA 1P9NA 3COJA 3HU2A 4U9UA 2KW5A 3ZY5A 4BC1A 5BT9A 4XEUA 4UQLA 4YT5A 3T9AA 4FFWA 1T5DX 4EG5A 2VQSA 1JXQA 3NG1A 4PZ0A 4BO1A 1YHYA 4CJXA 5JSZB 3K0AB 2HA2A 4II3A 5AXBA 2XUPA 1M2GA 1P17A 4KG7A 2BFPA 3CEJA 4B3XA 2WAYA 2FQ1A 2WTXA 1OX4B 2Q0QA 2QLFA 2YJNA 4TTRA 2FPUA 5HZMA 1I7QB 5LU9A 2BN4A 3LNTA 2PY6A 1VBFA 2J3LA 2OBLA 4KZPA 5FFNA 3U61B 1QRSA 1FRFS 1W85A 1EWYA 2AA3A 3LCJA 4I0WB 4Q19A 1XCLA 4EAAA 1FS4A 2WHQA 3BEOA 1U9JA 4LRWA 5DCYA 2VZ9A 2NZYA 4OOFA 5FTWA 2MTBA 2X0KA 1TO6A 1JKJB 4B09A 4UXHA 5G53C 3C85A 3ADDA 5FL7A 1R0RE 1U2ZA 1SCBA 2DPXA 1IC6A 1NT4A 2PX4A 3TQCA 1CUCA 1QJ4A 4M8LA 3U4DA 3IIMA 2VRBA 3HFJA 3T1QA 4JBLA 1H22A 2H1RA 1VSQA 5E6SA 1ZD1A 1RZUA 3GMDA 3L0PA 2HA7A 4FNMA 4IJQA 4V0LA 3M6VA 5JQGA 5K03A 2FXVA 3NCTA 3WGYA 1JVBA 1RS0A 1PJBA 3VMFA 3Q10A 4C7BA 5DK6A 1QIDA 1U5AA 3AVQA 2AUMA 1QUEA 2CW5A 4HY3A 3QFTA 1UDRA 4OLBA 2LKDA 2UYOA 3K6RA 4AZ3A 4OQQA 2JFHA 3OOHA 5CUQA 4ZTBA 1JMVA 3I2IA 3MJDA 4MROA 5DYWA 2JEOA 1FDIA 2NACA 4X1YA 4TTQA 4MKZA 3GJ3A 3NBZC 3NB0A 4C06A 2EKQA 2EYUA 3DE6X 3E4DA 5DYIA 5A5FA 3I5AA 5KVVA 2ZUFA 1D6JA 4ZHSA 3CLUD 1UDWA 4O1HA 2Y93A 4OPMA 4CKBA 3O5AA 3NHZA 4X7MA 4XLTA 1DUIA 4HMPA 3RC3A 2VH5R 1BRMA 1WAMA 3I1YA 2Y1GA 3CZRA 3HXTA 1PJRA 4RZXA 1O0CA 3M7IA 3SHQA 3GLUA 1Z38A 3R5FA 5BSRA 1LH0A 3D7KA 3R74A 4E5YA 3QU4A 2O3TA 3PX7A 4CKYA 1IHUA 4GGMX 2QUHA 2F6RA 1II8B 5CT6A 1VMDA 1XEWY 1QC5B 3LLSA 4X6UA 5HFJA 3F71A 3JQ6A 1DO8A 5L7YA 1LDYA 3IKLA 5BN1A 5I48A 5DGCA 1USIA 5KREA 1MO4A 1GUYA 2BZGA 3RV4A 1Q6YA 3TRHA 1GPBA 5LXTA 3UAVA 1XKLA 1ZK2A 2O8EB 4HQKA 1T2DA 2EIHA 2YN4A 3VR1A 1ZVKA 5SY4A 3HJUA 4RTNA 2WVGA 3OQNA 2Q5IA 3VNRA 2CJFA 3IEUA 4WUTA 1XHLA 2CMGA 3L82B 3LHFA 3NEYA 4OGLA 3V7NA 4B83A 1DQZA 1GOTA 1K3TA 2DTXA 2WFLA 4G1FA 2BFEB 3BA1A 1EUDB 4PZUA 1J9ZA 3T1OA 2ZRPA 2DJIA 3DULA 5LYYA 1B74A 3HGTA 2WUEA 3K9BA 3RYCB 1AKVA 3KELA 4OM8A 2J5KA 3AR3A 3R3HA 4XQGA 4OSOA 2XKBA 4MVCA 2E48A 4Q39A 3RU9A 4F8YA 4RGYA 1KFCB 3ZHCA 2DKNA 5F7XA 3F3YA 1UPCA 1P44A 1QIEA 2TRSB 3T94A 5BWBA 1RRFA 3GPLA 2W6QA 3VKGA 1GUAA 1DJLA 1N1DA 1V1RA 4UKDA 4XOUA 1KNXA 4GWLA 1J42A 4DDTA 1USUA 1V45E 3LGSA 2HGSA 4EZIA 4F72A 1U94A 3KXIA 4HDCA 3L46A 2HU8A 3D4PA 3GUCA 5FWNA 3H9CA 3OJEA 5I9LA 4WBXC 3ZDZB 1GG9A 3OOJA 3V32A 4DXAA 5DMXA 4LXXA 3OSZA 2QYTA 3LYLA 1T36B 2YHBA 1OU0A 1KFKB 3FPCA 1JXOA 4GQAA 2I1QA 2EQ5A 2IC5A 1AUPA 3CIOA 3NHFA 1A9SA 2G1AA 3T06B 4BNTA 4F91B 3JQAA 4PAGA 5JWRA 4YHBA 3Q2KA 1NLZA 1YV9A 1EGVB 5HKAA 3JSAA 3B3QA 4BEBA 3ROPA 2J31A 4DWJA 5JLJA 5BQOA 3WC4A 4L5IA 2I1VB 2Q1UA 1YVEI 8ADHA 4WDQA 2HO4A 1O96B 3ZCUA 2UYCA 4YUZA 4YDHB 3BIWA 1W6UA 1ZD4A 4BAZA 1CS0B 2JLQA 3GLHB 3A8TA 2BI8A 3WMGA 4YRGA 2XQKA 3LQ4A 1L8XA 3RUIA 3E8MA 3R7AA 3TOSA 2A5GA 1RM4A 5LP6A 1ESDA 3HVIA 4MR8A 1XA3A 5JAIA 3BGSA 4G5OA 1KHHA 3PNKA 2NZ2A 2PIDA 3URKA 3OZCA 2FVXA 2IUYA 2PGDA 4URZR 4IJ5A 3SZLA 2JPDA 4F9GA 4RJLA 1H2XA 4U02A 4PR3A 3E2MA 4ADSG 1TADA 1GG8A 2Y4OA 3LVRE 3IURA 5BSVA 4LHYA 5AOBA 4PGMA 5T3YA 4DEVA 4OJTA 5K0BA 4O08A 2UU9B 1UBKS 4BO4A 4QXRA 1DX4A 4X44A 4MYHA 1E1MA 3M5CA 1DRKA 1SC9A 2W2MA 4KU4A 1M1YA 2KSQA 5FNVA 4EX6A 2RG7A 4JLAA 5ARCA 1QO7A 2F2TA 2HA0A 2EFHB 1QG4A 1A5ZA 3PQ3A 3R9IA 3O4HA 3SLRA 3EGXB 1YD7A 1BXZA 2FXIA 3IBCA 4BYMA 3EYAA 1XL1A 3RSHA 3V1MA 4AZ0A 2RGAA 3NAZA 3S6JA 3C6ZA 2IZOA 1P5ZB 4R2HA 4YRBA 5JAPA 4ND3A 4RQUA 3AUFA 2PA3A 2QTNA 2DHDA 2EX1A 4TKVA 4BZPA 3A9TA 5LWQA 1Z0IA 3I3SR 3K5HA 3SYLA 5A2QA 4KR6A 3FFAA 3QYAA 4Y2YA 5EE3A 5EIXA 4KKVA 1FLNA 4ZI7A 3BXEA 1KK0A 4UDXX 1D2MA 1ZG3A 3K53A 3UMVA 4BO0A 4U5QA 1XQYA 3FPKA 3HN6A 4LNUB 4QXPA 3RABA 4TLMB 1LSJA 4H6PA 1EBBA 2YINC 4KN8A 1PEDA 1J24A 2LCFA 4C0BA 6CHYA 3U6BA 3A9SA 5IU6A 4F04A 2J3QA 4GP7A 3S44A 2JFUA 5WRFA 5IKEA 3MGKA 2WNIA 4H08A 1A9RA 1OFUA 3PHLA 4PLTA 2Q2QA 4OXYA 4RO0A 2GFIA 4F2HA 3MWEB 5KNCD 3B70A 3KLBA 2NZ8A 1Z68A 3N0RA 1OXVA 5ANRB 2EFYA 4LZAA 1KMHA 3WSTA 5K45A 2ODPA 1ULTA 5HJEA 2FK7A 4F06A 3GFOA 3NVMB 2JBHA 2VC2B 1Z83A 2LRHA 2TECE 3SCZA 2O0LA 2NT3A 1KWKA 3A9RA 2WA1A 1DGQA 1SN7A 1X7DA 4EHLA 3AP3A 4IWXA 2ORED 4MUGA 1TVKA 3TD9A 3ZBUA 3N2EA 4UFOA 3H86A 1XTRA 1BQEA 1MTZA 2IIBA 4AZVA 1Q1BA 1YJCA 5JSFA 4UDYX 5LNK1 4FGJA 2C92A 2I62A 1E0DA 3GN1A 2AOXA 2UKDA 3HXLA 3Q72A 5AHXA 3TAHA 3TPFA 1T9BA 3IEIA 3JXEA 4JJKA 4CQMD 4NU8X 1PJQA 5LOVF 2C2MA 3VA7A 2CLHB 1XLWA 4DLTA 2WWFA 3OZIA 4AJ2A 3CH7A 3ZHOA 4ARBA 1XFDA 1E96A 1RTKA 3GJRA 2BW0A 1N5DA 1SCQA 2OZLA 4PFQA 4CMEC 5JSQA 3EGWA 3RWBA 3AF1A 3VYTB 4OFZA 4XCXA 1S4QA 1VJCA 2FJ0A 1AG9A 1O77A 4NESA 4H3SA 4RDCA 4ZOCA 5FWDA 5AM2A 2PTHA 3KQTA 3AB7A 4NZNA 4XA8A 5GJVC 3P2IA 3CZ9A 3D4IA 3KOWA 3AESA 4QBTA 4W1QA 3WRYC 4O2BF 1IZ9A 5C18A 5LM3A 4YJ2F 1CEYA 2XUHA 2YC4C 3BHNA 1IQ0A 3GY0A 4AN1A 3HI6A 3IIJA 4MUKA 1ZK0A 1ENOA 2OKGA 2H1FA 4TVKA 5L3SA 3OPYA 4OP1A 1LPBB 4OGFA 1XPRA 2JFGA 2FPLA 2GO1A 2JHGA 1GXSB 1ZINA 4RKRA 3EG9A 2JRLA 4HSGA 4UCQA 4ZYYA 1IMOA 4BKQA 1YVRA 1D6MA 1H23A 2C5BA 2XE4A 4HP8A 3PQ2A 4PTZA 3T7RA 2RGEA 4B3TB 1KJ8A 4DSNA 4OH1A 2GBGA 1QHXA 3EUFA 1SIOA 3M4JA 4MLZA 2GXSA 4CUKA 3T5BA 3ABZA 1FDWA 3IERA 3K1ZA 3VO8A 4O6VA 5BN3A 4J0DA 3KTAB 4GYWA 1ZWLA 3AEUA 1F4VA 2WIJA 4AG3A 2P9CA 1VYUA 4ZJPA 2QTWB 3GT4A 3SHOA 1G8AA 2FSHA 3RFFA 1WSDA 2D5CA 3N2IA 2G1PA 4IXWA 1FQOA 4MR8B 2ZETA 4YPOA 4TMTA 2HX1A 1BOOA 2GM9A 2Q6LA 1J5XA 2XY4A 3OQHA 4LXUA 2BBOA 5FYQA 1NV9A 2G4VA 4YCAA 4EUKA 5A9SB 1THMA 3BRSA 4D26A 5FJIA 5EUBA 3WB9A 3PXDA 2H57A 4NK4A 4RTRA 4UTPA 1UK8A 2I6XA 3ZWXA 4DMFA 1N36B 1WEHA 3E9MA 3FVQA 5IK2A 2OORC 1U1EA 2CHVA 4JLNA 4R1SA 4EQ6B 2GDJA 3IPAA 5A4IS 3S7TA 3WSWA 1XZNA 3L8ZA 1QRDA 2IYOA 2IOQA 3G8BA 4RTLA 3V4RA 1X1SA 2BDEA 1P4AA 3QFSA 4EX7A 1RMYA 1QU2A 1P2UA 3VI3B 4CCYB 4EJSA 2J9YB 2XMPA 2L42A 5HXAA 5IMSA 3WYGA 1GRRA 1VHTA 3B6JA 1O5OA 2HZBA 5AYVA 1XMIA 1RJDA 5A2GA 5A6VA 2ONCA 1BXGA 4NYJQ 4OI4A 1CZUA 5CLQA 3RIHA 4GZ3A 1HWYA 3C5WP 4BOYA 1JFLA 3QUBA 4K2AA 1V6CA 4IDAA 1A2KC 3TF5A 2ZI7A 3R7FA 5CNIA 4AQDA 4UNRA 3RUPA 1TM2A 1OGYA 2QMZA 4R6XA 4ARZA 1QUFA 1BU8A 3HGQA 1JIQA 1FUYB 5J2TB 4WNCA 5DM4A 1P0MA 2F8MA 2Z43A 2J3EA 3IUSA 4RD1A 4EZEA 1M34A 3B8HA 3AP1A 4J07A 3UBMA 4ECEA 4UM9B 4W7IA 3F1KA 3WRYA 5REQA 1WHTB 2KE5A 2BMDA 3HACA 3L0BA 3RASA 5DX0A 1EYZA 2VEOA 3OQIA 3NALA 2JASA 3NIWA 3TD2A 4D8YA 5IT0A 2VK4A 3ZQUA 3JQBA 3A1CA 1UR5A 1Y6QA