5L9AA

L-threonine dehydrogenase from trypanosoma brucei.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
321
structure length
321
Chain Sequence
HMPRVLVTGALGQIGTDLSLALRDKFGADSVLVSDVVEPGAKHPLAGLKGVEKLDCLDSNGFEKLVKEFKPTWMYHLPAIMSVRGEAEPDLAMDINVNTTRYALELARKYNIRIFIPSTIAAFGDKCGKTMTKDDTIMNPSTVYGVTKVYTELLGTWYRQKYGVDFRSVRLPGIISAATLPGGGATDYAIHMYHSALLQKKCVCPVLPYESLPMMYMPDTLNSLVKIMEAPLEKLTRTVYNITGFSFSPSELRFSIERCTDRTIEVEYVEGPAQKIANSWPDSLDDSNARNDWGHQVKYDIDMMSEDMLRQIPILHGLPSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-threonine 3-dehydrogenase
publication title Structure and function of L-threonine-3-dehydrogenase from the parasitic protozoan Trypanosoma brucei revealed by X-ray crystallography and geometric simulations.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 119
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 1.1.1.103: L-threonine 3-dehydrogenase.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5l9aA00
1PQPA 1GADO 3WLFA 4GBJA 4BGEA 5JDCC 4IMRA 3TOZA 4BIIA 4R5HA 5DCWA 3JQBC 4DBZA 3C8MA 3N7UA 3MJ4A 3WFIA 2I99A 3HFSA 2WYVA 3GDOA 1DC4A 1PSDA 1GDHA 1T2DA 4MP6A 5C7IO 3KRTA 4O1MA 3WQRA 2XXBA 1GQ2A 1PGOA 2AXQA 3WG9A 2RBEA 4NFYA 4MDHA 3DEYX 4DLLA 4YQZA 5ENVA 4II3A 2G5CA 4DIFA 2H9IA 4KUGA 4GSLA 4ZQHA 3SXPA 4EYEA 3RD5A 1EVJA 1E6UA 4I5DA 1PZFA 4PLVA 4YYZA 3TZKA 3MCVA 4OHUA 4BNIA 5KNLA 2J6IA 1IPEA 1NPTO 1PJ3A 1EBUA 1HYHA 1JAYA 1LSUA 2VYNA 3DTYA 3FBTA 4G81A 3V2GA 4E2XA 1B0AA 2I65A 4RZHA 5CDGA 2B4RO 5KVSA 4BNGA 1KEPA 1CYDA 3WS7A 4J49A 4DPMA 1KYQA 1ENPA 3WXBA 4CUZA 3BHIA 4RVFA 2CF6A 4R41A 4GPD1 2B5WA 3WNQA 4HUJA 4ZQBA 3UW3A 1NVTA 1E1NA 4YT2A 4XWYA 3VVCA 4XQEA 4CLRA 4MKXA 3WGHA 4XZ3A 3Q2IA 3WGOA 3MJCA 4DA9A 1GYPA 4Y6RA 4Z9XA 1CDOA 3CMMA 3K73O 3E18A 1O89A 2C7GA 1ULSA 1YOVB 2ZYGA 4GGOA 2X0NA 1LLUA 3MEQA 3K2BA 4OIMA 4IZHA 3DZKA 4BKPA 2X8LA 3JD4A 5COAA 2QHXA 3HUDA 3JYOA 2BGKA 2GN4A 2WD7A 4YT4A 3HN2A 4I9NA 1U8FO 4WECA 3K30A 2H1SA 4YEDA 3GEGA 4HFNA 2HO5A 5DOZA 1QXSA 5EQDA 1FDUA 1HWYA 1AUPA 2EJVA 2RH4A 4QEDA 5G0TA 4DVJA 2WTBA 1JWAB 3AY7A 3K5PA 3PLRA 4XYLA 1GTMA 1F12A 5TQVA 4ZQFA 2DU8A 1E6EA 1NQ5A 3ETEA 1VL8A 5JAZA 3F1KA 4X54A 4HFMA 1LBEA 4ZVVA 1UP6A 5TSDA 5ITVA 5EQFA 3NT5A 1TEHA 4OXNA 3EC7A 1H6CA 4D44A 1TT7A 5F5LA 1EQ2A 5A03A 1D1SA 2DVMA 4MKZA 4J1NA 3GG9A 2DPGA 1I36A 2YW9A 3JQ8A 5KCZA 4ZICA 4L4RA 3T7EA 2QW8A 4PCVA 4RGBA 1IE3A 3GHYA 4W7IA 3IL2A 2VNSA 4WCFC 3FN4A 1ISGA 4FIZA 1KIFA 4TKLA 4D0SA 1Y7TA 3WB9A 4AG3A 4Q3NA 2AE1A 4XRGA 1LI4A 3ASVA 1JLLA 2Y0DA 1AE1A 4Q3EA 3ZWBA 4BHTA 1SNYA 5GZ3A 2YHUA 3OQ1A 3D4NA 4EI2A 5JY6A 5COQA 4LSWA 4R9RA 4BNKA 1NNUA 5K0ZA 4QXMA 5IZCA 3C1TA 1YO6A 1EMDA 3AUUA 3AU8A 4WGGA 5JE8A 4DLAA 5JO0A 3E03A 3ZDFA 1ISJA 4J9UE 4YJFB 3K2EA 3AM3A 2VRCD 4FFOA 1HSOA 2P4QA 5EPOA 4ND1A 1E5QA 4B4UA 1MB4A 1I3MA 1JWBB 1PWXA 4B4WA 5T64A 3PWZA 2GNAA 2V6MA 4R4JA 4LVCA 1XR3A 4M54A 1V6AA 1X15A 2NTJA 3ABIA 1DO8A 3OFSA 3H9EO 4OGWA 1WMAA 3JV7A 3D5TA 4J2HA 5DULA 5T57A 5I9MA 4DBVO 5K9ZA 5IAAA 2ZQYA 4XYMA 4CQLB 1EFKA 4M87A 1XIVA 4PVDA 4RPGA 3I5MA 4HADA 2HMVA 4OQYA 3R3JA 1YOVA 3JQ7B 3CINA 2OZPA 4CMJA 1KC1A 4BKQA 3RUCA 4L74A 3FCOA 4EBFA 5T8KC 3JQBA 4CMCA 3DZIA 2FN7A 1YBVA 2C82A 1YH3A 3PJFA 1UZMA 1KY5A 2WM3A 2EP5A 2NACA 3KLPX 3NX4A 4YCAA 2X23A 3U4HA 1PGNA 4WCFB 4WOKA 4NFSA 2IEDA 2CZCA 4IDBA 5BNFA 2NV6A 4YR9A 2Y1EA 3G0OA 3IJRA 3ANNA 5HBRA 3FHLA 4W99A 1CETA 3TZ6A 1OMOA 1GV1A 3PHLA 5L7YA 2ZIZA 2DUUA 3O9ZA 2J5RA 4EGFA 2VOEA 2NWQA 5AYVA 1LSOA 4GX1A 1C1DA 3AOGA 3TDKA 3JQAD 4J7XA 4E2ZA 4D45A 4S1VA 3PPIA 1AGNA 1YBAA 4GX0A 3OIGA 1D7OA 1LTHR 2BLLA 1P1JA 1Z82A 3DMYA 3VC7A 1I33A 1Z7BA 2JFFA 1PWZA 1XEAA 5COBA 3VZRA 2EW8A 4IQ0A 5TGDA 1BVRA 2FPPA 2DFDA 5JBIA 3BMOB 3RI3A 5ITWA 1LRKA 4FR5A 3WGQA 4WLEA 6LDHA 2OGUA 1RWBA 1MA0A 3MZ0A 4J3FA 4EW6A 1E1KA 4QECA 3LVFO 2EKPA 2HU2A 3I83A 4RVSA 4E5PA 2DFVA 2GCGA 1NR7A 4FC7A 1R6DA 3ZCXA 3M1AA 4PLZA 5GMOA 4GQAA 5CHEA 4DWVA 2PGDA 2DBVO 3FWZA 1WXDA 5A06A 2AG5A 4YT5A 4BKOA 3JQGB 3RC7A 2Y99A 3EVTA 2XF8A 3NYWA 4KMSA 3RC1A 3L6OO 5HS6A 2ZTMA 1BMDA 4CL8A 1NHWA 2X4GA 4B4OA 2XPCA 3SLKA 4Q3DA 3RUHA 2BKAA 2X5KO 3JD1A 1F0YA 4Z0HO 3UCXA 1E3WB 4E2WA 4J0FA 4R01A 4TMFA 1N7GA 4B79A 4ZRNA 3GR6A 5EIOA 3WGZA 1Z45A 1LDMA 2JJYA 2VOJA 3L4BC 2FPGA 4CQLA 2POQX 1O95A 4NI5A 2JHFA 4A5OA 4CLEA 3MTGA 1HL3A 3AI1A 3JTMA 1WVGA 4U8GA 4GSKA 1EFLA 2X5JO 4FC6A 3RJ5A 3VPGA 1PJBA 4HKTA 2WYUA 1Y8RB 3BMCB 4BVAA 5L9AA 3K92A 3ZU3A 3H9GA 4U7WA 2PD3A 1BRMA 2ZB7A 1XG5A 4J1QA 4WCFA 2GGSA 1ENZA 1UJMA 1PL8A 4BNHA 1UDAA 3SEFA 2DQ4A 1VL6A 1KOLA 4BGIA 3BHMA 3I9JA 3ICPA 4PLHA 4BO2A 3LQFA 4K1LA 2G76A 4NBWA 3GZNA 4JGBA 4L4SA 2PTGA 5G0UA 3H65A 1AHIA 5AVOA 1M2WA 3CTMA 1QR6A 3WOHA 4JJIA 4R16A 2AE2A 4BO7A 4EUFA 4YAIA 1PGJA 2DUWA 4XYGA 1BW9B 1QORA 4EJ0A 1ZSNA 2E6UX 4FB5A 3QIVA 1VL0A 1YXMA 3H6KA 4YQYA 4J2OA 4CLHA 4R51A 4A27A 4KOAA 5DZSA 3ZV5A 4OSOA 1NQTA 4JBIA 3A14A 4IJUA 1A4IA 3OJEA 3BMOA 2PK3A 4GKVA 2EJWA 2PD4A 4QUKA 4AJOA 1X0XA 2DAPA 3SBOA 1H9BA 3U4DA 1DIHA 5TRTA 1KBZA 2CUKA 2W8ZA 1ZMOA 3RC9A 5G0VA 1XQ6A 2PH5A 3OQBA 3JQCA 4NJMB 1H0KA 5BSHA 4CMIB 1PJ2A 1YDEA 4MVJE 4D79A 5IDQA 1DAPA 4IJVA 3PI7A 3JD3A 4MIEA 1DRVA 3BA1A 3DXFA 4IZIA 4BL5A 1KVRA 2WDZA 3PGXA 4WCDA 5AQ1A 4URFA 3PQEA 3T4XA 4YT8A 1YONA 4YVFA 3JQGA 4ZQEA 3GT0A 5T8KA 3QWBA 4RQUA 1UXJA 3TQHA 1UR5A 3AUTA 3JD2A 4KQXA 1QLHA 3GHHA 4MVJG 2X9GA 3N74A 5G4LA 2FRDA 3ZNPA 2VWPA 4L76A 2O23A 1GYQA 3NT2A 2A92A 3RC2A 1L1FA 3E82A 5BNTA 3ZWWA 1ZXBA 1E3WA 1PZGA 2I3GA 1D8AA 2BELA 2FOIA 4RPKA 4YRDA 3PJDA 3GPDG 4LCEA 4IY1A 2C2YA 4CR8A 1DJNA 3GGPA 4M86A 4CV2A 2J5QA 1C0KA 1P77A 2B83A 4J4HA 4NMHA 4BB6A 2ZTVA 3GA0A 3I9MA 4XYBA 1P1IA 2Y1DA 4TRMA 5TS3A 1Z6ZA 2EERA 5DNAA 1Y8RA 3BMCA 5KVCA 1NBOA 3A28A 4G2NA 3FNHA 3OETA 1EVYA 4CLOB 1LSSA 1O9BA 3SC6A 3HHPA 3JQEA 4I9UA 1EUDA 3DB2A 1B26A 3GF4A 3KSDO 1NQAO 1IPFA 2FSVA 1ZFNA 2GSDA 4NBTA 2FSSA 1EK5A 3MWEB 1T26A 2P68A 3P19A 4E3ZA 1PJCA 5I8WA 4WLUA 3GVCA 1NVGA 3T7CA 3I6IA 5A5EA 5BSEA 5I7VA 1P1HA 1CF2O 3AY3A 4OXYA 3BXXA 1RM5A 1V8BA 1XWFA 3I52A 4Z0PA 5KVVA 3GAZA 3E9MA 4CV3A 3VTZA 5HRUA 3R1IA 4DQVA 1BW9A 2YV2A 3CUKA 4YJHA 3DHNA 2V7PA 1K0UA 1WDMA 3WQSB 3HSKA 1DIBA 3UICA 4XGKA 2B69A 3UKOA 1ISFA 3OH8A 3HN7A 2Y05A 1XQ1A 1W73A 1B7GO 1BDBA 5IFLA 3PQDA 4IUYA 2WEKA 2R2GA 3NDJA 1DFIA 1MG5A 5I7FA 3VTFA 4CL3A 4NNJA 4CR6A 4E5KA 3DWFA 4GI2A 1ZEJA 2Y67A 2HMSA 3BAZA 1BXGB 3GH3A 4NJMA 2I9PA 5L4NA 4CUJA 4CMIA 2J3KA 4RVHA 3OSUA 2Q46A 5DDIP 4MVJM 3L4BA 2GLXA 3HZZA 1GQQA 2ZJ1A 1GYRA 1T24A 3PYLA 1GEGA 1VJTA 3ITDA 3K9QO 2JCYA 3RUDA 2QRLA 1HE4A 2BMAA 2BGLA 3VPFA 4UUMA 3OMLA 1XELA 5EMHA 3PWSA 3ETGA 3VPHA 3NDIA 2C07A 5JAQA 4F46A 2A94A 5CG1A 1PU2A 3UH1A 4G65A 1W8DA 5T67A 4ROSA 1TT5A 1Y9EA 2Q1WA 1A4UA 5A04A 1HETA 3MTJA 4XJSA 4B7XA 1WAMA 1DRUA 4XB2A 3E9QA 3BMQB 1ZSYA 3B1JA 3DDNA 5THKA 5HM8A 4XQ9A 3VZPA 4IGFA 4JK3A 4XKJA 2O3RA 3AFNA 5IDYA 4K26A 2F00A 4FOOA 4I5FA 4W7HA 3R6DA 3ROQA 1YE3A 1MFPA 4CLDA 1J4AA 3KYBA 4BO1A 1VPDA 4C7JA 3GLQA 4WJZA 3DZGA 2DC1A 1WDLA 4CJXA 2JAPA 3U3XA 1E77A 1GZ3A 3GG2A 4EEXA 4Q9NA 5DBGA 3O8QB 4GAEA 2UDPA 1Q0HA 4OYRA 1SC6A 1E3EA 4Q3BA 4OXKA 3DZBA 4WLNA 1Y9AA 4QFCA 1PR3A 3PHHA 3DZHA 4XGNA 4LVUA 4GL4A 4HP8A 5JXWA 5JLAA 3RFXA 5ENDA 3VZSA 1ADFA 1N7HA 3D1LA 3KV3O 3CE6A 4JBGA 4IDFA 1YB1A 2V6BA 4BQPA 4J43A 3QY9A 1NASA 5JY1A 3QA9A 4R1NA 1YQGA 2BFPA 4TROA 1EVZA 2B36A 1VKOA 5MDHA 4ZN6A 1HXHA 4R1TA 4KTVE 4P4GA 1QLJA 3BTOA 3F6YA 2GZ2A 4ZJUA 3F46A 5HTOA 2B37A 3AM4A 2DBQA 3Q3CA 1LQTA 2VUTA 3ZWVA 4CPDA 1UUFA 4RF2A 1PGPA 4RV9A 4FD3A 4BUCA 3ZU4A 3JYPA 5FEUA 5HWSA 1GV0A 3WGTA 3KHUA 1S7CA 3VKVA 1UDBA 3QVTA 5LDHA 5G4KA 5JFOA 1GUZA 3AUSA 1BXGA 1TB4A 1Q7CA 5U9CA 4YBZA 3FTPA 5CEEA 1QYWA 1DFGA 4GVXA 1HF3A 3PLNA 1GFSA 2A35A 3F4BA 4IDCA 4OKNA 2EEZA 3PDJA 5AXBA 4IIVA 2WD7B 3P2OA 4DL9A 3GDGA 4OO3A 2OP1A 3QWFA 5ILOA 3DOJA 5L95A 1E3LA 3CPSA 5F1PA 5U1PA 4N54A 4J1TA 4ZA2A 1P31A 1YWGO 2WD8A 4M89A 5DBFA 2AQKA 4OMUA 1E7MA 3ZHBA 2O3TA 1NM5A 2HK8A 2E4AA 1Y5MA 3G49A 1IHXA 1IL0A 3RUAA 1DB3A 1ZBQA 2QG4A 5L51A 1DHRA 2DTEA 3BMQA 1ZJYA 4PVCA 3INRA 3H5AA 2OFPA 2Q49A 4E21A 4BNNA 4FJ2A 2F1KA 3ENNA 3A1NA 4AVYA 4DIBA 3G17A 2X5OA 4LN1A 4MVJH 2XAAA 5A9SA 4XA8A 3JQ8B 4EUEA 2QIOA 4O5OA 2OMEA 3KYDA 3D0OA 4DC0A 4KQWA 2PNFA 1EK6A 2ZK7A 3W6UA 1EBFA 1N2SA 3PHGA 3O8QA 1WPQA 2QZ9A 4J91A 5C37A 2VZ9A 3LLSA 3NAQA 3S55A 2PGLA 1R16A 3EZLA 1ZUD1 2Y1GA 4IM7A 3RSHA 5L4LA 2NU7A 1CQIA 3QWAA 4WNCA 2DPHA 3DHEA 4PG4A 2CF5A 5IXSA 3PZRA 1ENOA 3GRPA 4JIGA 3RCBA 4UVIA 3I4CA 4MIOA 4DMLA 1ULUA 1PS0A 1UXKA 4LRTB 3F1LA 3PGJA 3GMDA 3GVHA 3ON5A 4H16A 3WX0A 4JJFA 4BNMA 2BH9A 4XR9A 5IF3A 4U6QA 4PRKA 1SEVA 4FCCA 3C7DB 1R37A 2OO5A 3GVPA 1I01A 3PHJA 1JTVA 1UZNA 2NTVA 4MJLA 3GGOA 3WMWA 4M8SA 3WYEA 2WWRA 4EITA 1IYZA 3NTQA 2HMUA 2LDBA 2VHWA 4RL6A 2ZTLA 3UGKA 1ZXLA 1DSSG 2ZCVA 2Y66A 2X0RA 4RORA 1DC6A 3OEWA 3OJLA 1B8VA 2YQ5A 3C85A 3I1JA 4NK5A 2NADA 2ZTUA 4PZCA 4XCVA 3MOIA 3ZHXA 4XYEA 4CM9D 1IZ0A 4PFJA 4NBRA 4WOJA 1WWKA 1B8UA 2E49A 2NVUA 2E37A 2O2YA 3DO5A 1YB4A 3DBHB 3H5RA 1E3IA 3AWDA 5A9TA 1J49A 1I3LA 1PGQA 4CM8B 2X7HA 2PWZA 2FR0A 3DONA 5FFFA 3WMXA 5JC1A 4IBOA 3LLVA 1FDWA 5GZ1A 2CDCA 4HWKA 1PJTA 1LU9A 5DP1A 3RASA 1U2DA 4IXWA 1PX0A 4UEJA 2HK7A 3NRCA 4YAGA 4WUVA 2HJSA 3E5MA 3FNFA 3EY4A 5JAIA 3F3SA 1ADBA 2BFMA 3U9LA 3FRJA 4ILKA 4R68A 1U3TA 3LT0A 5BQFA 2RCYA 2PR2A 1G0OA 4L4XA 1C1DB 4CQMA 5AXDA 3S1LA 4I5GA 5DT9A 3KEOA 2FPIA 1GUFA 4W9NC 3L07A 4INAA 3C7CB 4NPCA 3RBZA 1VI2A 4GX5A 4BS9A 3PXXA 2RHRA 7ADHA 3E5RA 3KBOA 2A9FA 3AFMA 5DCYA 2SCUA 1L7EA 1A27A 1FK8A 4Y9DA 4YDRA 4MVJI 3F47A 3WGIA 2O4CA 1E5LA 3KM0A 4NU5A 1UZLA 1TLTA 3WWYA 1OBFO 4DPKA 3AK4A 3OIFA 1KC3A 1BVUA 3L9WA 3O38A 4WLOA 3CMCO 2I3AA 1SO8A 3V2HA 2X1HA 1R0LA 3EUWA 3ITKA 3B70A 1NVMB 1Y1PA 4RDHA 3NJ4A 4XIYA 2NU9A 3GPIA 2QX7A 3I3OA 4UUPA 3H9UA 3ZWXA 3LDHA 1WZEA 5IJZA 4AICA 3PFFA 3JSAA 3MWDB 3W4KA 3LC7O 1DC5A 3JYLA 1HDZA 1FDSA 3Q1LA 5DP2A 3CH6A 1NTOA 2P9CA 3H9QA 4J7UA 3TZCA 1MXHA 2VYVD 3RWBA 2X9NA 1M66A 1ZO8A 2O7SA 4FFMA 3UF0A 3P7MA 1T2EA 1SPXA 2NQ8A 3EYWA 3F5QA 4R5MA 3NJ8A 3U09A 4PGFA 1O8CA 3P2YA 2W2LA 3KVOA 4PZDA 3QQPA 1OC2A 3C24A 1H6DA 2H6EA 5DF1A 4E5MA 1GL3A 2JAHA 3OJ0A 5KJ6A 3QHAA 5K6AC 1SOVA 5JDCA 1SBYA 3QVXA 2YDXA 3UVEA 1I24A 2ZKLA 4II2A 4LISA 1HT0A 1I3NA 4GLOA 3DBHA 4IPTA 3B1KA 4CM8A 3PJEA 2VTDA 3W4IA 3PHIA 2NVBA 3LT1A 3JQDA 4QO8A 2OORA 3L0DA 4O63O 3NKLA 3ICCA 3OM9A 4NZ9A 1HE2A 3WBFA 1RJWA 1PZEA 1ADGA 2Q2WA 2NM0A 1XU7A 4YRAA 4BO6A 3GZNB 4EDFA 1ZK3A 4YPOA 3GN1A 2YV3A 2PKQP 2ZB3A 4GMFA 4LRSB 3RBVA 4CM6A 5L53A 1CRWG 3HG7A 4JJGA 3AI3A 3WNVA 3G1UA 3FTNA 3A06A 5KJ1A 5I8ZA 2VZ0A 4ND4A 2P4HX 4ZRMA 3ZNOA 4R1SA 1M75A 2ZYAA 5BT9A 2OXIA 2E82A 3IUSA 2WE8A 2D0IA 2I5PO 1Y8QB 4BO3A 5IDXA 3ST7A 1ZCJA 3GVXA 4F3YA 3H3JA 1E3SA 1OI7A 3TL3A 2ZCUA 4D41A 5JAMA 1KS9A 2IRWA 3DTTA 2WMDA 2DTXA 1F8FA 5IN5A 4XX0A 4E32A 2GYYA 2Q3EA 1HTBA 1A5ZA 4P38A 1PZHA 5ER6A 3HDQA 3OEYA 3H3FA 5THQA 1VKNA 3DOOA 3RROA 4J9VA 3WR5A 5ADHA 5LCXA 3CKYA 4D0RA 3ZGYA 3P5SA 4JQCA 3H9JA 5JYDA 4F6LA 3PFWO 3HJAA 1R15A 1LSJA 4FJ0A 1IUKA 3GK3A 5C7OO 5EINA 5I9LA 5I9NA 4BGUA 1XGKA 3LYLA 1WP4A 3ZV6A 2BFAA 2RAFA 3M2PA 1OZAA 4CM4B 3JYQA 4D46A 1E7QA 4HFRA 1IOLA 1JA9A 2Q50A 5I7SA 3TWOA 1PTJA 4RVGA 3ZWNA 1NWHA 3VZQA 4D3DA 5H83A 3INGA 1KEVA 3JQFC 3IC5A 2ILTA 4LMPA 5ER9A 4YTEA 4CV0A 1N1GA 3PYXA 3AOEC 1K3TA 2EGGA 4TQGA 3W6ZA 4I9HA 1E7SA 1M76A 1K5HA 3I23A 1V35A 4MINA 2AHRA 1I2ZA 3NTRA 3Q6IA 1BGVA 4W9NA 3IS3A 1NX6A 2AEMA 3FD8A 4KTTE 1UP4A 3O26A 5CEFA 1TVEA 3D4PA 4DYDA 1RPNA 3ROPA 1DBVO 1HZJA 2DBZA 3U4IA 1I5RA 5DOVA 1UDCA 3FNEA 3ZN2A 4IS3A 2CD9A 4BO4A 1U8XX 2CDAA 1BG6A 1YQXA 1B2LA 2FR1A 4FFRA 2JD2A 3U0BA 3JQ9C 3MJVA 4A0SA 2JFHA 5DCUA 1AN9A 1R4MA 1BSVA 3E48A 4B8WA 2EW2A 4CMBA 1DPGA 2Z95A 3SJUA 3DZFA 4RPHA 4Z9YA 2VNAA 3V8BA 2GD1O 2FHSA 3DAGA 3NDRA 3L4SO 3ZWOA 1N8KA 2XOXA 1ISMA 3DBVO 3IQDB 4YJHB 1MC5A 4K6FA 1ML3A 4DTIA 4AJ2A 1Q0QA 2B0JA 3ZWMA 5JCJA 1Y8QA 1UP7A 2YDYA 2AA3A 4L0QA 4AJ4A 3OQ6A 4XEHA 2TMDA 1B15A 4A26A 4OH1A 3PTZA 3FR8A 2NLOA 1SZJG 3HB4X 3CSDA 4NQZA 1O6ZA 4Y98A 1DJQA 1EUCA 4XDZA 3LT4A 3SVTA 2X22A 4AJJA 1XYGA 2O3SA 4RCVA 1E6WA 3RUIA 3W8FA 4D43A 4CLXA 2VCYA 3QVSA 1DXYA 4BNYA 1R4NA 5TNXA 1ZKMA 2Y0EA 4GMGA 3KB6A 4CM3A 1QMGA 3L9XA 5A02A 4PG8A 4ZQGA 4E13A 4PG5A 1HDCA 2VHXA 5K6AA 3KZVA 2CDBA 4IXTA 4JBHA 1S6YA 4XD2A 5A3VA 4N5MA 4BMNA 1NFFA 2Y1FA 2D2IA 3IAHA 4BQRA 3EAGA 5KJEA 4CM4A 3C1OA 3JCZA 3MJTA 2C5EA 4MVJA 4B4VA 3HFGA 1GCUA 4ID9A 5CG2A 4HXYA 1HDXA 1TT5B 2IYOA 4L73A 3E6AA 2AW5A 2HK9A 5DBIA 2CY0A 1Y5RA 3UAGA 3RJ9A 3W8EA 5L7WA 2VRBA 4GWKA 4GGPA 2EF1A 3V1TC 1MGOA 1PIWA 4CODB 5JO9A 2D4AA 5KIAA 4OSPA 4JN6B 1Y6JA 1E0DA 3WYBA 4ALKA 3V5NA 3T4EA 2EP7A 1FDVA 2NSDA 2X0IA 3EW7A 1QRRA 1U3WA 1ISIA 3RKUA 4CUKA 4YXFA 8LDHA 1QV6A 4KWIA 3MJSA 2DLDA 1JQBA 3TRIA 1O5IA 3GAFA 5ILGA 2EV9A 2I66A 6ADHA 1F17A 2UV8A 2Q45A 3U49A 2BHLA 4KDFA 1DAOA 3HNPA 4RLSA 4TVBA 1R0SA 3BTVA 2W98A 3BMNB 3ULKA 1GZ4A 1P0CA 1DC3A 1C0LA 1N5DA 4NHEA 5TJHA 3EVNA 1YVEI 1DRWA 5KJFA 2G17A 2PZLA 4UULA 4YACA 1ENYA 3I9KA 3CZMA 4RLHA 3VPSA 1MP0A 1RM4A 2VN8A 2EHDA 5L40A 2J3HA 1NWCA 2AEFA 1PQWA 1GUYA 2EKQA 7MDHA 5JMPA 4ALLA 1XHLA 1V0JA 3GUYA 2GDZA 5JCXA 3Q9NA 1NFQA 4BNWA 1GD1O 2ZB4A 3TFOA 3TFQA 2GF2A 3HDHA 2X86A 5MGBA 3GEMA 2HLPA 3I9NA 5G4KB 1X7GA 4C4OA 4BNFA 5T6BA 2VT3A 1GU7A 3JQFA 3IKTA 4L8VA 3DFUA 3LT2A 4CV1A 3AOEA 4PZEA 4XJTA 3SLGA 4KWHA 5TJ9A 1CJCA 3G3EA 3PYMA 1EUZA 5ICMA 3VH1A 2W4QA 4LCJA 5JYEA 2HDHA 1X1EA 1SB8A 4F6CA 5KWEA 1B8PA 1Q2XA 4E31A 5L4SA 4ZHSA 1KVQA 3DFZA 3K8ZA 2HRBA 3H4VA 2VTEA 2O7QA 4HNHA 1ORRA 1YB5A 4KUHA 3TZQA 2ET6A 1HDYA 3ENKA 3KSUA 1LDBA 2IZ0A 3EZYA 4MIYA 3G1TA 2RHCA 5F5NA 3JQ9A 4G5HA 1LDGA 4BNZA 2YHIB 1SMKA 1JW9B 3BTUA 3DL2A 3WTBA 3ZW9A 5A9SB 4GWGA 5EL0A 1T2CA 4RF3A 3S2IA 9LDBA 1H6AA 2UUPA 4B3HA 3KYDB 2V65A 4TSKA 1ID1A 4XGIA 1N9GB 2FY8A 1E1MA 1ZK4A 1WDKA 2HMWA 5G0WA 2G82A 1A7KA 1T4BA 1U7HA 1WNTA 2O3QA 4FQ8A 4ND2A 4XDYA 3GC6A 2QRJA 3L6EA 3TNLA 5L45A 2BI7A 1HKUA 2BF7A 4UREA 3SX2A 2VUUA 4ZGWA 2Q4BA 1VLLA 4YAEA 4NFHA 4Z3KA 1U4OA 4N18A 3L77A 3FPCA 3BMNA 4WNIA 5H81A 3ZI0A 1HEUA 3PIDA 1YL7A 1O0SA 2IZZA 3OA0A 2O3UA 4WLVA 2YQ4A 3LF2A 4W82A 1D3AA 4TRRA 3VKUA 1E92A 2IDZA 1A71A 4BV9A 1X14A 2NU8A 1KEWA 1D1TA 4AJIA 4TRJA 2JCXA 2UVDA 2BRUA 1Q7BA 4Y67A 3QWIA 1IY8A 1N1EA 4W4TA 1QV7A 5TT0A 1LLDA 2NNLD 4I1IA 1YQDA 3ZNNA 4H3VA 4LMRA 1DIRA 1PJQA 2BFOA 3VDQA 1YS4A 3DBLA 1J5PA 2VT2A 3K6JA 4I5EA 1ZEMA 1QYVA 2AEJA 3HB5X 4JP2A 2NUAA 4J4BA 5T5QA 1GCOA 1TA4A 4QX6A 1TI7A 3VDRA 3GDFA 3ZV4A 3JQAB 3C1AA 1CWUA 2Q2VA 1V3UA 4WPGA 4IDDA 4IIUA 2NVUB 1X1TA 3R0IA 5JDIC 3HDJA 1QYCA 4OKIA 4E12A 3B6ZA 2GRAA 5JMWA 2QZZA 4PLFA 5LC1A 4W6ZA 5FI3A 2I67A 3FNGA 2DBRA 1U3UA 4DUPA 1MXFA 2B5VA 3ANLA 3WJ7A 3QP9A 4JP3A 1P44A 3TF5A 2PA3A 2VHZA 1V3VA 3M1LA 2OL4A 5H82A 4NH4A 4XRRA 4ALMA 3TSCA 4NG5A 2G0TA 3WDSA 1PR9A 8ADHA 3RVDA 4CQMB 5F1OA 3V1UA 4E30A 1OOEA 4S3MA 2YHIA 3CXRA 4FFLA 2IODA 1LXCA 2LDXA 3OF2A 1ZMTA 2VRCA 3JYNA 4H15A 1HZZA 5FF9A 1LQUA 3I4FA 3W4JA 4A73A 2C20A 4NBUA 1N9GA 1P3DA 1ONOA 3VH3A 1JU9A 1E7YA 4PG7A 1XDWA 4Z0TA 4MVJF 3K31A 1ZK2A 4DPLA 3ONFA 4E33A 3LC2O 2GR9A 4QTZA 5CDSA 1RYEA 2HQ1A 4HFJA 5IXYA 3ZHZA 4YWJA 5A5FA 4DXHA 4EUHA 1KERA 3GVIA 1QYDA 1UAGA 5CPFA 1NYTA 4JNKA 5C7LO 3COSA 1VC2A 1BTOA 2YZ7A 4OQZA 1ISHA 3GFBA 4E5NA 3KSZO 2VHVA 3PDUA 4GLLA 4DGSA 4YRBA 1XA0A 1EDZA 1D4FA 1X0VA 3C3XA 4CMHA 2FWMX 1UXGA 3QLJA 1GAEO 5TC4A 3Q11A 3GNSA 3WICA 4MOWA 2GN9A 5TIIA 1C1XB 2GERA 1YJ8A 3DZJA 5KJCA 1UAYA 2PZJA 4MP8A 1YL6A 3QVOA 3PQFA 2PH3A 1HLDA 2X9VA 3H5NA 1YRLA 1HYGA 1JKJA 1LC0A 4J6FA 3IOYA 3ORFA 5LDGA 4I08A 5CDTA 2Z1MA 4J4TA 3S8MA 3ADPA 1NPYA 2Q1TA 3D3WA 1ZSVA 3NGLA 4FJ1A 3JQAA 1YKFA 1FF9A 3WBBA 4U0KA 1EVIA 4C7KA 3NV9A 1DIGA 1UXHA 4FDAA 4IDGA 1A7AA 2I6TA 2C54A 4BOYA 3CEAA 4DMMA 2ZJ0A 1UH5A 1CERA 3H8VA 3QV1A 4K28A 4R1UA 1EEHA 5AXAA 2IE0A 4IJWA 1XKQA 3ETDA 4O59O 3AW9A 2W2KA 4YJDA 2A4KA 3TN7A 2Q4EA 4MVJP 4D42A 2WYWA 4WLFA 4DRYA 3KETA 3ZU2A 2PZMA 1WZIA 4OAQA 3QRWA 1OC4A 1IB6A 4L75A 4IJKA 4I8XA 5AOVA 1FXSA 1Y81A 1JN0A 3WIEA 1LNQA 4O6VA 3KO8A 2Y1OA 5EN4A 5JC8A 1GPJA 3AM5A 4HY3A 1WW8A 3F4LA 3GZ4A 1J0XO 1DLIA 1CQJA 1EE9A 1DEHA 1W0CA 1I8TA 1M6HA 5F3RA 1P1RA 1KVUA 4HBGA 1QP8A 3VH2A 4IQ8A 2QYTA 1NAIA 1RM3A 4MPDA 4UVHA 1B16A 3H2SA 4NJOA 4BO9A 1GEEA 3H2ZA 3K96A 4TWRA 4WEQA 3S2EA 4RPJA 4YAJA 4P22A 4M55A 2VHYA 2H5LA 3I6QA 4CM1A 2GUGA 4J0EA 2EWMA 3WGGA 2V6GA 2BD0A 4RF5A 1E1LA 1HYEA 3EGOA 4L9RA 4WASA 3ZZNA 1HE5A 1C0IA 2C59A 3R3SA 3IMFA 3GN2A 1PJ4A 4QSMA 2VWGA 2HAEA 3DBRB 1QG6A 5L3ZA 2WSBA 3NGXA 4MKRA 3FF4A 3X2FA 4M49A 2HMTA 3I9LA 1LC3A 4KUEA 4JROA 4K9DA 1ADCA 3KOUA 4FFPA 2PLAA 1DFHA 2D5CA 1LRLA 4IMPA 4XIJA 5CP8A 4BO8A 3F5SA 4E2YA 2GZ3A 5JDIA 3U5TA 5F21A 3WSVA 4H7PA 3KUXA 1A9YA 3UN1A 1E3JA 4BMVA 2NVWA 1F06A 1HDGO 1P74A 4QT0A 5B1YA 4ZU3A 5J23A 1C14A 2AQIA 4BGVA 3QJ5A 1R66A 3AY6A 4RPLA 2DTDA 4BNUA 4EZBA 1C1XA 2OOSA 1ZZEA 4IGEA 3TZHA 1DDOA 5KTKA 2JHGA 2Y0CA 4NBVA 1LDNA 5FYDA 2YUTA 2YJZA 4J7CA 3ZWAA 2RH8A 2RIRA 5GY7A 4BO0A 1LX6A 5IZ4A 4DQUA 2P5YA 1HRDA 2PD6A 1VE9A 2GN8A 2GO1A 4AJ1A 4ALIA 3EMKA 1B14A 1BHSA 4LW8A 2XXJA 1H9AA 4IDAA 2NTNA 3E1KA 4JCOA 5IN4A 3RFTA 3B1FA 1EZ4A 2UUOA 3KLMX 5HA5A 1GPDG 3UCEA 1YBMA 3GOHA 4BNTA 4OL9A 4ND3A 4A03A 2TMGA 4DLBA 2HUNA 1T25A 4DC1A 3U4CA 9LDTA 3V1YA 3VOSA 5B12A 2VYND 4IINA 4FGWA 4Q39A 4OOFA 4PLCA 1R4MB 3RUEA 5IG2A 3I9OA 4D7AA 4OM8A 3ZWPA 3FSRA 1BDMA 3JQ6A 3UUWA 2J5KA 2J3IA 4O0LA 2FP4A 5L7TA 1ARZA 3QVWA 3U62A 4AJPA 3UOGA 3D5QA 3HWRA 3AU9A 2QQ5A 2UAGA 1LDYA 4NR0A 3C7AA 4PLWA 2VQ3A 1MUUA 3JD0A 2JKVA 1SB9A 2I76A 3BYZA 1P45A 1T4DA 3OIDA 4CM5A 2EG9A 3BHJA 1I32A 3ZWYA 3S2FA 4BO5A 3VPXA 2Q2QA 2ZATA 4E4YA 5JW6A 4CMAA 1VJ1A 1Z73A 1MFZA 3DBRA 1I2CA 3HADA 1QKIA 1R4NB 1NAHA 5I7EA 1C0PA 4ALJA 1LDEA 2FZWA 3TJRA 1BWSA 1NFRA 3WGYA 1OAAA 1CIVA 2ZB8A 1PS8A 1U7TA 1WLYA 1SOWA 3Q0EA 3D64A 1O94A 2C29D 3FPLA 1ZW1A 1W6UA 1ZK1A 1G0NA 3BZUA 3O03A 1B3RA 4PLPA 2OUIA 1H94A 1U3VA 4BNVA 1MX3A 3VAZA 4CQMD 4KDEA 2YFQA 2Z5LA 4Z9FA 4PLYA 2O3JA 3DMTC 2P91A 3UCFA 1W4ZA 1DIAA 4RDIA 4BB5A 4DQXA 3PRJA 4YJFA 2O4UX 4AJEA 3ADOA 3IDSA 4DIOA 1JVBA 1U5CA 2D1YA 4BV8A 5EESA 4WE3A 1GZ6A 1P0FA 3MJEA 2X0JA 2R00C 1ZH8A 2B4TO 2OHXA 4ITUA 3M6IA 3KEQA 2NU6A 1VSVA 5CEJA 4UVDA 3V2UA 1H6BA 1ZNQO 3M2TA 1H93A 5B37A 5ES3A 1HLPA 5EERA 1PL7A 2C2XA 5BSGA 4IDEA 3QSGA 2P5UA 2P9GA 1Z75A 2FZEA 1RYDA 2Y68A 4KP7A 4LGVA 1EQUA 4A7PA 1U9JA 1HE3A 5CPBA 1KY4A 3Q2KA 3W1VA 3ANMA 4QO7A 3Q9UA 1U2GA 2X6TA 1HDRA 4OOEA 3JQ7A 1ONNA 2IZ1A 4UUOA 1Z74A 2IXBA 1MC4A 2Z1NA 4GH5A 4MP3A 2P2SA 3WTCA 4AJLA 3QWHA 5GZ6A 5A1TA 5CFZA 2IEBA 3RFVA 5TX7A 4ALNA 3PWKA 2CNBA 4P8RA 3A9WA 3AUAA 3PVZA 1H2HA 5KKAA 1K6JA 1FDTA 3W8DA 1XSEA 1JKFA 4YAKA 2FR8A 2WE7A 1PQUA 4B8ZA 4ZD6A 2W2LD 2HJRA 1KEUA 4RVUA 4B3IA 1SEPA 4YJGB 4BNXA 3D3EA 2O48X 5IDWA 2CFCA 1DLJA 5KOIA 4PIVA 3RQSA 1PJSA 1FMCA 1P9LA 5CAEA 4E5YA 3EHEA 3OJFA 4R3WA 3NUGA 5F1KA 3H7AA 3WQQA 4B3JA 4R3NA 2D59A 1P1KA 5TLSA 2PY6A 5ICSA 3FWNA 3DOCA 3HQ4O 4P4NA 4AJHA 4BKRA 1PS9A 1GQYA 1N92A 4AFNA 3RBXA 3AI2A 3OHSX 4UUNA 4Q3AA 3GFGA 1ZVMA 1RKXA 4DREA 5TF4A 5AXCA 4K6CA 3MOGA 1LUAA 4BMSA 4OJNA 2V6FA 1DHTA 2JFGA 1GY8A 2PKRA 4FSHA 4TKMA 5BR7A 3GMSA 1X7HA 1LLCA 1T1RA 2BI8A 4J90A 1K6IA 4KZPA 4A2CA 3LF1A 2G1UA 3ZWCA 4EJMA 3GY0A 5CDUA 3L6DA 3SC4A 1YJQA 4FW8A 3INTA 1V3TA 1JKIA 1MV8A 1VRWA 1X7DA 4U0JA 3E8XA 3NT4A 3GRKA 1T1SA 3IIEA 3PEFA 4N5NA 2YFHA 4UEOA 4EJ6A 5B4TA 1U1IA 4JLWA 5C5IA 3WIDA 1IULA 1NP3A 4QQRA 4UEKA 4HNGA 1TXGA 3EDMA 4RQTA 4XB1A 3IUPA 2DT5A 3ZW8A 1VSUA 4FOSA 4RJTA 3IP3A 1V9LA 2W90A 3PK0A 2CVOA 3B20A 2VZ8A 3QW2A 4PRLA 4BNJA 4F45A 4FGSA 1U28A 4AJKA 2E48A 5JS6A 2C0CA 1ONPA 4IS2A 5FI5A 5BNIA 2WJPA 4GKBA 2HCTA 2PFGA 3ONEA 4DYVA 1U4SA 1NHGA 4RVDA 3RIHA 3FR7A 4YB8A 5TT1A 1XU9A 4Y6PA 4NU6A 2QYSA 1DOHA 4J1SA 4GVLA 2OBNA 1MG0A 4RF4A 3VHRA 4CM7A 4XQGA 4BNLA 4UVEA 4CMEC 2BGMA 1BXKA 1K89A 4NDNE 4RO0A 4Y6SA 3STHA 4FS3A 1LJ8A 3ZH2A 1Q0LA 4UAGA 4UVGA 2YYYA 5A3JA 4EEZA 1KETA 4TRNA 1HDOA 3S2GA 4N5LA 1ZIDA 5DN9A 1XLTA 2EGHA 5A05A 3NEPX 1KVTA 1KVSA 3ONDA 2CVZA 4YJGA 1AXGA 1VJ0A 1E7RA 1RM0A 2B35A 4CR7A 3UHAA 3LSYA 3DBLB 4P4LA 3VH4A 3RAJA 3DMTA 3RKRA 1SCUA 3RU7A 2O50A 4WK6A 3KYCB 3VVBA 3DAPA 2PGJA 1E7WA 2AQ8A 1L7DA 1U5AA 1LLQA 4FBGA 3ZNQA 4PG6A 1OFGA 2JCVA 2H63A 1I30A 2IYPA 1H2BA 3NTOA 4NK4A 3RUFA 4WKGA 2GASA 2FMUA 2R00A 2UYYA 5BSFA 4Y8VA 1C3VA 3KTDA 2X58A 3DHYA 3PIIA 4NIMA 5FWNA 3LC1O 2PZKA 4YA6A 1ZK0A 1T2AA 4TZTA 1K6XA 4J16A 1LA2A 3CZRA 3BTSA 4JXKA 1R12A 3WSWA 4HV4A 1YDWA 1NQOA 2VUSA 4MO2A 1ZJZA 3WWZA 2IXAA 1A72A 1J6UA 1LEHA 3WJAA 4Z6KA 4Z3DA 4BKUA 4HX5A 1I2BA 1Z7EA 4XQCA 3WYCA 3F9IA 1GR0A 4A10A 1NXQA 1JDJA 2EIHA 1G1AA 5JCJD 3UXYA 3IKVA 2J8ZA 4FN4A 3RU9A 4PLGA 2ZQZA 2ZYDA 3AJRA 5JSFA 3HE3A 2P9EA 2Y93A 2AG8A 2B4QA 3FBGA 4B7CA 2OP0A 1I0ZA 4WEOA 4LK3A 4R9SA 1IZ9A 1AXEA 1BXZA 2GPTA 1WMBA 1XCBA 1LRJA 1M6WA 3WFJA 3GGGA 5HS4A 3PP8A 2AQHA 3IJPA 2VWHA 5B4UA 2R6JA 4E6PA 2JD1A 3LU1A 2DM6A 3OA2A 2D3TA 3PZBA 1EDOA 1I10A 5JPIA 3ZHYA 5G2OA 1F8GA 4CM9A 1PL6A 5B4VA 1JVSA 4MVJD 4CLOA 1CEQA 2QRKA 3FI9A 2EXXA 4N7RA 1K2WA 4QFDA 3GNTA 3D4OA 4JX8A 2VWQA 2PKQO 2D8AA 3A4VA 3ZV3A 1M67A 1AHHA 3BIOA 3GQVA 2J3JA 4U5QA 3KXDA 1A9ZA 3N58A 2JD0A 1IHYA 1PJLA 5A4DA 4ONEA 3CIFA 2AMFA 3IP1A 4Q3CA 3WLEA 2PV7A 4CMKA 1MLDA 1NR1A 5C3MA 1P1FA 1QYXA 3QE3A 1NPDA 1R0KA 3KYCA 1I3KA 3D3WB 3OICA 3OBBA 3LZ6A 2OBYA 3D7LA 1QSGA 3HDYA 3SJ7A 3OP4A 5G0SA 4CMGA 2D5AA 2Y1CA 5A9RA 4RZIA 3DR3A 3TL2A 4PLTA 2O2SA 2EKLA 2C5AA 2GN6A 3OJOA 2Q1SA 3UFXA 4TVOA 1G6KA 4GX2A 2HRZA 1P33A 2Q99A 3ASUA 1HSZA 1EE2A 2YV1A 3LK7A 4LSMA 5JNLA 3PJGA 3TOXA 1F14A 1UXIA 2W2KB 1FJHA 3DAFA 4CLRB 1Q7GA 5U4QA 4PN3A 5IZCC 3X2EA 4E0BA 1T2FA 3EK2A 2JL1A 4IQGA 4U6SA 4FFNA 3GEDA 4D3FA 5EJ2A 1VM6A 3E9NA 3GUCA 1Q1NA 1SAYA 5CDYA 1H5QA 3OECA 2CMDA 3O4RA 4ND5A 1PEDA 4FPXA 5KVQA 4M1QA 2NQTA 4R69A 2Q1UA 3DC2A 2CVQA 3G79A 3ROMA 3TPCA 4AL4A 4XR4A 2HSDA 4AJNA 1X13A 4TZKA 3ROKA 2DKNA 3ZU5A 5KKCA 1B3BA 4CMEA 2CSUA 4B7UA 2HKIA 4ESOA 1YGYA 3DQPA 4R54A 1JAXA 2VYVA 1YL5A 2YY7A 4D3SA 2GZ1A 3GNQA 2C7VA
chains in the Genus database with same CATH superfamily
1PQPA 2H7CA 2LIVA 2D5BA 2PGIA 3B3JA 4BBJA 5J47A 1EX1A 1GPMA 3PGMA 4N5IX 2H00A 4PYMA 1QAQA 3A9UA 3PRHA 4X8LA 4Q7QA 3RAFC 1Z6XA 1VCHA 3O47A 4AAYA 3DBOB 3H4MA 4M76B 5DCWA 1J1IA 4U9HS 2HF7A 2L69A 3E2PA 1AS3A 3HFSA 2O19A 4G5QA 3MRSA 1JSCA 5K0FA 1DC4A 5C7IO 2A9VA 2G0NA 3SLRA 2JLQA 3I62A 3THSA 3O90A 1K8QA 1E69A 5TB5A 2ZWOA 4LS3A 1I1QB 1GAXA 1FQWA 1QAMA 3HCBA 1L5FA 1VKZA 3P9SA 4Z9BA 4JH0A 4MDHA 3C5VA 3DEYX 4YQZA 3C16C 4WHMA 5ENVA 5DXFA 4KMRA 3BDAA 2G5CA 4II3A 2WSMA 3DLPX 2H9IA 3P2JA 1V11B 1QFXA 3IXQA 4HX9A 5BP7A 2BDTA 2QMZA 3BB3A 5FTWA 2NO9A 4GSYA 3T0IA 1U0SY 2PUTA 3TZKA 5J2TF 4BNIA 3CWZA 1UOOA 1J9GA 1SA0A 4C30A 4ZZ0A 1PJ3A 2Q4TA 3L7LA 1EBUA 1WEHA 1US8A 1YMVA 1SY7A 2BE7A 3DTYA 2P40A 3FBTA 3K32A 3R3YA 4G81A 4EFDA 4HR7A 1B0AA 3TTUA 1Z17A 2B4RO 3SBEA 3ZJ4A 4GLBA 1SQFA 1Z8FA 2V0CA 5EZSA 4FSXA 1L7VC 2QWXA 4UBOA 2AJBA 4NYIR 3WS7A 4YV1A 4G0PA 3V7NA 1XAJA 1KYQA 4KDCA 1ENPA 3WXBA 3TGLA 1ZVKA 2PGOA 3BHIA 2CF6A 4R41A 3WO0A 5BV1A 2AMLA 3WNQA 4HUJA 1NVTA 1E1NA 1OIWA 4KGVA 3HXMA 5CFPA 5LP6C 2WMYA 1GKYA 1W5BA 4C2TA 3VVCA 4OQXA 3BM5A 4MKXA 4N5DA 3VUFA 4IYJA 1A2KC 5EY5B 2ST1A 4DA9A 3CR3C 1GYPA 4FN5A 4MQEA 2WAMA 2P79A 4Y6RA 5CYGA 3HBLA 1DAEA 1GPH1 4Z9XA 1JKXA 3E8SA 1MVOA 2AHOA 2C7GA 1RRFA 5DBHX 3FKJA 1YHNA 4GGOA 2X0NA 4L85A 4MUYA 5G1NA 3K2BA 5AP9A 5C80A 5MFPA 3K0FA 2O8EB 2X8LA 3AKEA 3MT0A 2QHXA 3HUDA 4RTPA 4MUNA 1FUYB 1SKBA 1UMKA 2IEZA 2QKYA 4YT4A 3EEBA 3I32A 3TBHA 5DPMA 1NW5A 1F1BA 4HFNA 1PX2A 4AD8A 5E95A 2VF4X 4RHYA 1HWYA 3LA6A 1AUPA 2WTBA 4UHBA 3LA8A 4LVNA 4URWR 5BYJA 5FWXB 1R6XA 2H4WA 3PLRA 4P34A 1BJKA 4ZQFA 2QTVB 3ETEA 3NTXA 2PMKA 2BCJQ 4X54A 1RLUA 4Q3KA 1R2QA 4RTOA 3HCCA 3IALA 1LBEA 4M9UA 5GJCA 3T3PB 1OXUA 5FNZA 1RC8A 5ITVA 1EAYA 3FXAA 3IP5A 3DLTA 3WB1A 4U2GA 5CVTA 4D44A 4JOBA 1TT7A 3QMVA 4DLPA 5AVSA 4D4MA 1DBIA 4YRRA 2DVMA 3HXKA 3LP6A 3IEMA 4MZXA 2P9HA 1EM8A 1HEIA 2YW9A 1PTKA 1V4BA 3T7EA 4A6DA 4ZICA 4MHTA 3FTEA 3QBDA 3VYVA 3A04A 1CVIA 1XJQA 3HUEA 4G26A 4WCFC 3FN4A 1ISGA 2IUEA 3T5MA 4FIZA 1G3QA 3B12A 1HTTA 4LDAA 4BZPA 4ZOEA 1TM7E 1Y7TA 1G20E 2DFLA 1ZD8A 4Q3NA 4F9FA 5CA0B 5FHQA 1FPQA 1LI4A 1JLLA 4WOBA 4N6GA 9ATCA 1MQ9A 4EB6A 3WP0A 1ZCBA 1OXXK 2XX3A 3UA3A 3RVNA 5LP6B 1W5TA 2GFQA 3KFLA 3EG5A 2H7XA 2HXYA 3AVQA 4LJAA 3HM9A 2FWPA 1NVVR 3R9IA 2ZB2A 4LSWA 1EA5A 1FSFA 4R9RA 4QWMA 1F2TA 3WWPA 1XZBA 3UJ8A 3PXBA 2Z83A 1B23P 3LY8A 1GQRA 4U02A 5F78A 1CSEE 4OM7A 1I7SB 3AU8A 2R97A 4WGGA 4HB4A 2I8AA 3VVLA 1U1EA 1MO5A 5JO0A 4Z53A 2B1JA 1GILA 3K2EA 2HXGA 1G8GA 1Q19A 3K5IA 1JNYA 2LCFA 5EPOA 1EUQA 4B4UA 5I9IA 1MB4A 3CUUA 3I8SA 3LBFA 3QQ5A 3GLTA 5GADl 1NBWB 2XCTB 2I2FA 2FSIA 3HO6A 2IYSA 2A3NA 3C5HA 4MB0A 4RKFA 4PYOA 4RL4A 4N0PA 3GJ6A 3Q12A 4LWZA 2P7IA 5BNWA 1E1RA 4M54A 5B7GA 2NTJA 3KXLA 1BE6A 4CKEB 3E05A 3EPJA 4OGWA 1Y4ZA 5JNRA 1YFLA 1WMAA 3TJZA 1LTQA 5F64A 2WIAA 2CBZA 4MMYB 3O84A 3OY2A 4CDRA 3IOEA 4OI2A 4ZCLA 4MTCA 5EMLA 4E5DA 4F5EA 3KQHA 3LQQA 3RKSA 5IAAA 2PBZA 3AV3A 2C2KA 4O25A 4CQLB 2O8VA 4FKZA 2VRWA 4HADA 2OGZA 4LTNA 4A6EA 4OQYA 1G2IA 1YSCA 2BC9A 2J9ZB 3L7YA 2XVXA 2ABWA 3R3JA 4A2QA 2R8BA 5J4VA 3K2IA 5TQ0B 2FV8A 2MYPA 1Z4IA 1ZD9A 4TSFD 3GT3A 3FCOA 4HZUB 2XUAA 1GXSA 2Y2UA 1SXJD 3PSHA 4P4TA 1VP9A 1H2WA 2EKBA 2FN7A 2RHWA 3TW8A 5KEIA 2BI4A 1KY5A 2WM3A 1L5HB 2EP5A 3U2QA 3NX4A 1JR2A 2X23A 3EZXA 3U4HA 3WDLA 1KTIA 1PGNA 4WCFB 3SR0A 2BM9A 1HY3A 4NFSA 5I4BA 3KZCA 2YIMA 3ZGLA 5HILA 1NVKA 3C8UA 3KJNA 5EJGA 1GRRA 1N3BA 3ANNA 5EJ9A 2O8EA 1T0IA 4AB1A 2HWUA 1CETA 3TZ6A 4P58A 2VBGA 2ZDQA 3PHLA 3W6OA 1YT5A 2ZIZA 1VG1A 4UCXA 2DUUA 1G2OA 2J5RA 3GJ0A 1FZTA 1QMPA 1WZUA 2VOEA 4HNAB 5BMOA 3EVAA 2Q9UA 3U3MA 4DBLC 3T52A 1XVLA 3AOGA 4EIWA 2A57A 4J7XA 3TG2A 4C89A 5CAEB 3QXSA 3R7BA 1RQNA 1G6Q1 2BFCB 2HA5A 3NBQA 3NU1A 3OIGA 3QTTA 4PWZA 2NSJA 3BE5A 3OQHA 1CRZA 1LTHR 2BLLA 4W5WA 4Q9IA 4ZYYA 3JASA 3GL9A 3IBTA 1PUIA 1KU6A 3VC7A 2OYSA 4UD2A 3IEVA 2BSQA 2B4KA 1XL0A 1XK6A 1K97A 2HEIA 3AI7A 1BX1A 3BSFA 3KR9A 3H1TA 3MGAA 3T3EA 3DTVA 3LVQE 4RKEA 4XFKA 5BORA 1LRKA 4GYWA 4LE0A 3V8MA 1C9KA 1QG4A 2FE1A 2OGUA 1QP4A 3EH2A 2QRUA 3RGGA 1MA0A 2X0FA 2J0EA 1TAHA 2ZBGA 1E1KA 2I2AA 2CJWB 4IDOA 3PNKA 5EWLA 4QECA 2Q9CA 1CF9A 1PJRA 2EKPA 3HDTA 1BXRB 2CLFB 4MJXA 2C0PA 5HGXA 3IEPA 4RVSA 3A6JA 1S3FA 2WJHA 3QGMA 1KYXA 4LPSA 4FC7A 3NP9A 5TVKA 3I09A 3M1AA 3SYKA 1S3SA 4GQAA 5CHEA 5C5EA 3A32A 2DBVO 3FWZA 5A06A 5EZYA 4IJ5A 2RMKA 4IZ6A 2ZAOA 1R8XA 3QVKA 1KDYA 3ZJYA 1G3MA 3ADCA 2IHNA 2PZ8A 1SUBA 3BIWA 5EIWA 4WACA 1YS2X 4PNHA 4QUHA 2LCQA 2RIPA 1QGOA 2ADFA 3W3ZB 4B4OA 2VYCA 3BD6A 1LBSA 3DW3X 4W7SA 2VQ6A 1LZLA 1H0HA 3SLKA 3Q7EA 4Q3DA 3VR2D 3VR6A 1PL0A 5FPYA 2FZVA 4GOND 2Z9DA 1DDIA 1WCXA 2GBIA 2PM8A 3DWIA 4LXYA 4O4IF 3UCXA 1D2EA 4QULA 4J0FA 1Y4AE 3IQWA 1LPNA 1N7GA 5DNCA 2OEPA 1NVDA 4RVNA 2HV8A 3ETLA 4OHRA 1KFEB 3HKBB 3C98A 2POQX 4NI5A 1J21A 5CHYA 1Z0SA 3MTGA 1WM1A 3CNBA 2FKNA 5MN5A 3HKDA 3LDFA 3RT9A 3KB8A 1WVGA 4KBFA 1H69A 2X5JO 5SV2A 4KSCA 1Z35A 1QGAA 2RJ3A 2OAQ1 4NBKA 1OH5A 5FCDA 3BMCB 5TVGA 4D02A 5L9AA 1T5IA 2OZKA 4N6OA 4NNPA 3ZU3A 4HRXA 3OCUA 2W2NA 1NBMA 1VSTA 2QP4A 3H75A 8MHTA 4TYQA 4V0KA 1UJMA 3GLUA 4G36A 1N4DA 1UDAA 2RG1A 3EQ7A 4JITA 1U0EA 3IEIA 1EX9A 5A7GA 3KQUA 3K9WA 1D03A 1OTHA 2EBHX 3JAWA 2G76A 1IN5A 2WUVA 4G3XA 4KXWA 1E2HA 4OHVA 5EP3A 3KSAC 1PUJA 5A7FA 1ZCFA 2GF0A 2BBSA 4TQ9A 3UYLA 1AHIA 5FBRB 3ACCA 5AVOA 2JLUA 1GAJA 3EIXA 1XQVA 1QR6A 2Q21A 3MELA 3WOHA 1ZISA 3E0XA 3FI0A 4IIJA 5JZSA 1T2VA 3S29A 3IV6A 3DDSA 4LZJA 4YAIA 2OCPA 3AL3A 4C4SA 3OOJA 1C9JA 4GPBA 3LPAA 4WK2B 3P9XA 1Q83A 2E6UX 4PC1A 1RVDA 2FN4A 1IHPA 3L8HA 4PGMA 3H6KA 5SYAA 1N6HA 4JU9A 1KDVA 4A27A 4KOAA 1Z12A 5DZSA 3ZV5A 1SU4A 4Q1VA 1J00A 1WDWB 1J0EA 4Y9UA 4QPNA 4KR9A 4DJFC 2QT0A 3A9SA 3S1AA 4TUYB 1V4VA 2DR3A 2PK3A 3BMOA 4PSCA 4AXXA 2WYOA 5KU1A 5LD2B 4LDQA 4FP9A 1X0XA 2DAPA 3OX3A 4F3NA 1LX7A 3U4DA 1DIHA 1O1YA 5E9AA 3NOVA 2J09A 3AG6A 2R1TB 4WY8A 1K6EA 2WHXA 4PSVA 3HY3A 1Q15A 3RC9A 1SVLA 3WHLA 2BKUA 1XQ6A 3PXEA 5DMXA 3CA8A 1H0KA 3ELUA 1H85A 1PJ2A 1P2UA 1Y89A 2I2WA 1II9A 3EWIA 1DAPA 1NVXQ 1ZOSA 4MV4A 4N5HX 5IDQA 4PYKA 4JB0A 1FS5A 1Q21A 5TMEA 1ZGBA 2ODNA 4WJLA 4MDEA 3DXFA 1KVRA 2WDZA 3PGXA 3K8YA 4WCDA 4XLTA 3SBDA 5AQ1A 4K88A 5AOBA 2Z8ZA 3ZX4A 3FCSB 1PV4A 2BSXA 4N3AA 3HA3A 4YVFA 3JQGA 3BL8A 4YDSA 1I2AA 3A8TA 1KMQA 4IQFA 4PIMA 4QGFA 5EVJA 1UXJA 3AUTA 1SUIA 4KH0A 1ZXXA 4KQXA 4CNBA 5H9WA 2I4MA 2GRUA 3PC2A 2YS7A 1MIHA 3AJAA 4OA5A 4Q82A 5MF6A 4S2UA 3ZC3A 4DBLE 3TMAA 3NT2A 2A92A 5F9MA 1XFDA 2Z4SA 4WVFA 5BNTA 1Z6GA 1ZXBA 1QTNA 5D85A 4N0QA 3Q3EA 2BPOA 2WB2A 2RGBA 4RPKA 4AKHA 2N0SA 2R4TA 2DWCA 3PJDA 5TE9A 4HQ0A 3BG5A 3EGXB 4CR8A 1YCFA 5F3DA 4K9RA 2J5QA 2QE7A 4DJTA 2BSAA 3CX4A 4HRYA 2REQB 2IP2A 3GA0A 1W85A 4XYBA 1P1IA 2EERA 4G8CA 5KAPA 4OBBA 3DMHA 4G86A 2JVIA 1Y8RA 4J1TC 5DNAA 5KVCA 4AROA 1RKVA 1TF5A 2PL5A 3GCGA 3NVAA 4LRQA 3OETA 4IV8A 1R3DA 5LWHA 4HUQB 2VEDA 3HHPA 1TJYA 4I9UA 1EUDA 2AJ8A 2QTLA 1XKLA 3KT6A 1W93A 4LBVA 2H31A 1JAIA 4PX5A 3X1JA 1O58A 3NTVA 4B82A 4EHJA 2D7DA 2V6IA 1FU7A 4B33A 1RLTA 1IPFA 1Q1BA 2IXFA 3D6FA 3M82A 4GOMD 4H60A 4UMVA 3IUEA 1MC8A 4NBTA 5HF5A 1EK5A 3WHKA 1R0ZA 2NAFA 2P68A 4RK4A 3WLQA 4YRZA 3FAKA 3N8DA 4FNGA 4WLUA 3GVCA 2G9NA 4ID3A 1LNSA 2HHCA 2EJBA 1XZAA 1CF2O 2XA1A 4LGYA 1W35A 4UBJA 4CV3A 4JA2A 5CLFA 5HKKA 4YI5A 1C9DB 2OZLA 2QAGC 4G1FA 1D6NA 1B6TA 4TLMB 3RWOA 3STXA 2YCLA 3QITA 3QEBZ 5B6PA 3CWQA 2BKVA 3M89A 4UTOA 1SUPA 4YJHA 3TRDA 3MTQA 4B80A 3CRQA 3MCTA 3ML1A 3V80A 4E5VA 2PXCA 3UICA 3LVBA 2PUJA 2XYVA 7REQA 1RWOA 3UKOA 1USUA 3G9ZA 3S8EA 2CXXA 2H5EA 3JZAA 1W73A 2PUWA 4KYUA 2AK3A 4X1YA 1BDBA 2WI8A 5IFLA 4M98A 3DHVA 2FUCA 2WEKA 3NDJA 1M73E 2Q1XA 4O0MA 4K3UA 3TINA 3VTFA 4CL3A 3UJ3X 4ND8A 3K9FC 2O5VA 3DWFA 2FVXA 1GUBA 1E2IA 2HMSA 3BAZA 1WA5A 1T2NA 4X45A 4KB5A 3R7LA 3GZTB 5C8DA 1N2ZA 5EJ6A 3PLAE 5CNMA 3L7DA 5IBPA 5H0IA 3PNMA 1ZDMA 2FRVA 3B6IA 3EDRA 1YAHA 3JYHA 3L4BA 3M6MD 2JJ8A 2E4VA 2WJWA 2WAYA 1GQQA 3B1ZA 1GYRA 3CH7A 4O4HF 2P9TA 5L3QB 1L7MA 1RAIA 4D9JA 3M3PA 2OFOA 5E6RB 1VBFA 1R8YA 2QRLA 4OJMX 3D6UA 2W6CX 1GPUA 1QHSA 3A9CA 2KLHA 3KJHA 1ZI9A 4HNSA 4K9NA 5HKLA 5LOVA 3ETGA 1VIAA 3WGMA 4I4LA 1PU2A 3UOWA 3TD2A 1DVRA 2ZSBA 4MGHA 4B3BA 5T67A 2BGGA 1MEJA 2D0PB 2Q1WA 4O2RA 4D6XA 1A4UA 4JR0A 1W2GA 3U3JA 1EVKA 3H8WA 4LTDA 5FT9A 4XB2A 2FG7C 3F71A 4ZU1X 3SI7A 1TCCA 3B1JA 4Z6KA 1S8FA 4PS0A 4IGFA 1XTBA 4JK3A 4F4JA 5LLTA 3R3UA 3CQ9A 1OB2A 2BN4A 1ETUA 2C9DA 3F2VA 3OLZA 4JOQA 5IDYA 3GLGB 5KUTA 4FOOA 1Y3BE 3OZ7A 4RELA 4Q4CA 5MN6A 3K16A 2A9OA 1J4AA 4NE9A 5FOSA 1W5EA 4L8WB 4HDOB 5BSUA 3GLQA 3AHCA 1FFAA 3DZGA 4WJZA 3OVMA 4HDMA 4EFLA 5KWJA 5T7BA 4CJXA 5CRIA 2PPLA 2JGIA 1DG3A 1JTEA 2QVCA 3U3XA 2GSWA 3DAHA 3OJWA 5DBGA 3B3GA 4RC9A 4GAEA 3DZCA 1DV1A 4JQSA 3VPCA 3BE4A 1OR8A 2RFLA 3N7TA 4BLTA 2AWOA 1VHDA 4WLNA 1QIKA 4ENUA 1BDHA 3SF0A 1I6WA 4YGYA 1IK4A 1NOJA 4XGNA 2CB9A 4XCQA 2YY6A 3P0FA 3RFXA 4UDYX 3X1ZA 4YCSA 3UGJA 3EXEB 1N7HA 3KV3O 4JU8A 1YB1A 3ODPA 3WQHA 4C3ZA 1O2DA 4J43A 1UK6A 3DVAB 1L9KA 1NASA 1NW6A 1U7XA 3QY9A 4KGZA 3BSSA 4NLLA 1JYEA 5GVRA 2GHRA 5HFNA 3SDSA 2P1DA 3D31A 4RF3A 1QFZA 5IRCD 2ERYA 4TROA 4B6PA 2GA9A 1MB9A 5G41A 1PO7A 1AXRA 3DSRA 1VKOA 3DEFA 3MLEA 2A9RA 3OPYA 5MDHA 2YXPX 3V48A 4RJLA 1CDDA 4FHZA 4KTVE 3CCBA 4DB2A 4WNAA 3HKCA 3BTOA 3F6YA 3X1KA 4X90A 3KAJA 2PT6A 2P5SA 3AM4A 5C8VA 1ZRSA 3Q3CA 3BWEA 2V1XA 3KWMA 3ZWVA 1CNFA 1LK5A 4U7PB 5KNDD 4FGUA 2PH1A 1NYLA 1QCZA 1PGPA 2Q0QA 3KIPA 4FD3A 1P7CA 4RV9A 4ZOCA 3NRJA 3SM9A 3WGTA 1EWTA 4FGKA 3PKIA 4HAVA 5CVVA 1SVMA 1C41A 4G5XA 2XB2A 5G4KA 3EY9A 4KLAA 4M0KA 2ODTX 2PLRA 3AFIA 4NL4H 1BXGA 3O75A 2OKGA 1Q7CA 3LLMA 4OTZA 2FWBA 4HQRA 5CEEA 1XDBA 2HCJB 3OM1A 1Q22A 4X64B 3NUQA 3PF8A 2EKDA 1W44A 4MQUA 1NQUA 4CXMA 2GXAA 2B1RA 3G2KA 1G3RA 3ZWQA 3O3NB 2A35A 4KGDA 2OO7A 2PKEA 3F4BA 1YMUA 1IEVA 4YJ3A 1CE8A 5ALTA 5HHTA 1FU8A 3P2OA 4DL9A 3SQDA 4OO3A 3FHCB 2VCHA 3QWFA 4FINA 5EJIA 2X9QA 3W3AH 4EHNA 4WZAE 1NXTA 1PDVA 4N54A 1WBJB 3H3XA 1YWGO 2WD8A 5DBFA 1Y4SA 4V39A 1T3GA 3OUZA 4ER5A 2GYUA 2BKLA 1KJ9A 2ECPA 1F48A 2X9LA 3CUTA 3FCAA 4R1LA 2F8LA 1JHUA 5ALDA 1TYCA 3OE5A 2O8BB 1KWGA 1Y5MA 3G49A 1IHXA 4MRSA 4EH1A 1DB3A 5L51A 5DH9A 3DF9A 3TLZA 1TE2A 2E55A 1DHRA 2QDKA 1EFHA 2CHUA 3MAGA 2RDMA 2Z8YM 1OYWA 3QFFA 4AF6A 4PVCA 3INRA 3H5AA 4HYEA 3QTLA 1BKYA 4D0GA 3K0AA 3ENNA 4DIBA 3NMUF 3IVAA 4LY0A 4KKXB 4M53A 3WMRA 3OE4A 2B7LA 1N4AA 3P94A 2F90A 4LN1A 5A9SA 3M34A 1OX5A 4XA8A 1BHQ1 3JQ8B 3CF0A 5ERXA 4NCXA 4QELA 3OOSA 5DW0A 3ZE1B 5KQPA 2AEEA 1OZGA 4P36A 3WNZA 4GEGA 3MHPA 4JDPA 4WUTA 2ZK7A 1NURA 1H23A 2Z3ZA 3BT7A 1EBFA 1FOEB 1N2SA 4OK3A 3O8QA 4WZBE 4I9GA 4DSOA 1B0UA 3TD6A 3AVPA 4RCYA 3LLSA 2A0XA 2PGLA 3F9CA 3VNRA 3D0RA 3TR6A 3U7GA 1OXMA 2DPHA 2UYCA 3DHEA 1W4CA 2OCBA 2KMLA 4V0QA 5IXSA 1R0CA 1YE8A 2YH2A 3BWDD 4Y1FA 5AI5A 5FUXA 3I4CA 1LQ2A 3AGQA 1PS0A 4KODA 1SUWA 3K35A 1V16B 4DDUA 3ON5A 5JQGF 5AJTA 5EUMA 1ATIA 1EXDA 1QTIA 2FW6A 4JJFA 4TYPA 1Y7HA 1DBRA 2BH9A 4XI9A 3U1BA 2QMEA 3EULA 4MDFA 4D6YA 3P20A 5GM1A 3WSTA 4LYHA 2IC5A 1QDEA 4I6JA 2VXCA 4ZOLF 5LLDA 4Q6BA 3HA7A 4PRKA 2FLWA 5KNBH 3U61B 2YVAA 2WUDA 1SEVA 4FCCA 2HRRA 2AZTA 4RA9A 1BD3A 2XHZA 5E1OA 5FOTA 1WCWA 1WVIA 1I01A 3GVPA 1UZNA 4LYDA 3WMWA 1NF8A 4OFXA 1OYOA 1TNDA 3W2FA 1YIDA 3EW9A 3WYEA 4V1CA 1EB8A 1H65A 1IYZA 3IUYA 1DG1G 2YZMA 3TTTA 3SGLA 1GTZA 2HIGA 1BS2A 2DXIA 4OB7A 2R8RA 6YASA 1BA3A 1SBZA 2ZTLA 3UGKA 5G1PA 5KYUB 5CB0A 3UBTA 2X0RA 4LE1A 3EAQA 3TQRA 3IPCA 4JC4A 5EHZA 2HYDA 4NK5A 3C85A 1QVVA 2BAGA 2PYZA 4QEZA 5IMBA 2CL6X 3GCZA 4HN9A 4XCVA 4C0AC 1GSAA 2QZPA 3RABA 2H06A 2A0UA 1IZ0A 3BZBA 4MW1A 4A8JA 3ESDA 1GP2A 1R9MA 2XE7A 5IFKA 2PH7A 4LOAA 3MTEA 2E49A 2NVUA 4TS3A 3F7MA 3LYAA 3ESAA 4PYIA 5IVDA 5A9TA 3Q3GE 4CKWB 4U3JA 1JHMA 1PGQA 5JC1A 1KOFA 1Q91A 3LLVA 4D92A 3QEJA 4C5CA 3CZPA 3WY9A 4BTEA 1E5VA 4MGZR 5K0LA 5IXJA 3ZD7A 3RASA 2C7OA 4IXWA 3QBJA 3E5MA 3FNFA 1C4KA 1J7JA 4I4TB 4GHWA 4I6EA 4X1KB 3EIWA 3QUSA 2X7XA 4JT8A 4BAUA 4E94A 1KEKA 3IEXA 3U9LA 4EL5A 4JUBA 2VTBA 4R68A 4I81A 4G0QA 3GFOA 1X7YA 2ZDHA 3DH0A 3C3BA 2EZUA 1AGYA 2GJ8A 3INNA 1T9GS 3BCRA 3MWLA 3V8NA 3KEOA 2FPIA 1GUFA 3BH7A 4W9NC 2N1BA 4GKJB 4BS9A 4NJEA 1VI2A 3AX6A 3ZWKA 2IP1A 3JWIA 7ADHA 4BWYA 2A9FA 3AFMA 3LM8A 4CEHA 2IZ7A 1SUFA 3QENA 5BYKA 3FCYA 4FFSA 1JXOA 3SEZA 3QNMA 4DC9A 3WGIA 1WG8A 2ZIAA 3KVVA 5AJHA 4HVLA 2VTBB 2XZLA 4QLAA 1UZLA 3A11A 2JGAA 3EPLA 1H0RA 2C5GA 3NJRA 4NONA 3H1AA 1RXIA 5KYXB 2ZETA 4C4ZA 1Y7IA 2C83A 3QLVA 1BDIA 5D86A 1LJLA 1PT6A 3AK4A 2CNWA 4XX0B 4WLOA 1M1NA 1QE3A 3AGPA 4EZIA 1Y7LA 4C4RA 2AFIB 2EFGA 4BQFA 1PD1A 5EUCA 1Y1PA 1A77A 5EP4A 2R6R1 3J7TA 3NJ4A 2ZUVA 3DCYA 5HQJA 1LPBB 2NU9A 3FHTA 3FJOA 5IC5A 2D54A 1A8PA 3R23A 5C8YB 2P35A 1U11A 1WV0A 1AX9A 2ZYVX 4XLZA 3VA7A 4QAQA 4AICA 1N57A 1YC5A 2X41A 3WKEA 1Q74A 1RYBA 5FA6A 5IJ0A 5SZJA 1VB5A 2PAFA 4G23A 5DP2A 4V2UA 1NRWA 5IT4A 1JHPA 2P9CA 4HS9A 2ZUUA 3OCWA 1DXQA 1II0A 1MXHA 3TZCA 3RWBA 4I5IA 3KAKA 2XY4A 1L3BA 2AFHA 2H5JA 4HQFA 4DNXA 5ETJA 4B3RB 1ZO8A 4FFMA 4GIBA 3HYRA 3UF0A 4I3FA 4EL0A 3EMBA 2AN3A 2NQ8A 1QHHB 3OPQA 3HDVA 3NJ8A 2R66A 3MA0A 4FZVA 3P2YA 1SG9A 1JXMA 1T8WA 3QLTA 2ZR0A 1KKMA 3MFQA 3C24A 2F62A 3QQPA 1ZH4A 4JLKA 5DF1A 3CV3A 1JEOA 4YUWA 3GA7A 2FPGB 3E15A 4GPZA 3SYMA 3ABSB 3DFFA 4Q4JA 4EG8A 2X42A 5KJ6A 1E2GA 3K70C 3DGFC 2Z30A 3ZOZA 1SOVA 5E2IA 2V7EA 5CNIA 4BB0A 3QVXA 4NXMB 3RQIA 3NAMA 2ZKLA 4II2A 1HT0A 1DP4A 2IUTA 1OXBB 1B43A 3DBHA 4QBIA 4N03A 4EJFA 3AV0B 3M4JA 2IPXA 4C6RA 1T6NA 1OX4B 5LYYA 4CM8A 3PJEA 3W4IA 5JZ9A 3PHIA 4QICA 2P4EA 2IVFA 3WNDA 1ZLXA 1D2CA 5BWMA 4YUXA 2OORA 3HO8A 2P9QA 2D0OB 3HJHA 3NKLA 4XJXA 1SQ5A 2X40A 3OM9A 2QN9A 5JLJA 4C05A 1TKRA 5ABPA 4TTQA 1MV5A 4MDYA 3GZNB 1ZK3A 3MCUA 2MSEB 3UKDA 3GN1A 2JGEA 4C0WA 2LNDA 3O5AA 4HTAA 4KYVA 3VKFA 4CM6A 3TLCA 1Z6TA 3HB0A 3AI3A 3WNVA 2VO1A 5K3OA 3FTNA 3JRNA 2FEWB 2QP9X 1C8VB 4FK8A 4MV1A 4WERA 3W6PA 5IJ9A 3EISA 4NMLA 1UAAA 2J7KA 2P2ZA 1ILWA 2ZRPA 2QVZX 3L8FA 5TMBA 3OM0A 3WVNA 3ZNOA 4R1SA 4KRGA 3MC1A 2YMMA 2DHCA 3CZ9A 1GDDA 4Q01A 4DNPA 2DWUA 4AX8A 5CB6A 4YJ3F 1G55A 1XVUA 1B1CA 2BFWA 4N7MA 1IMJA 4Q12A 4B2YA 3I5YA 3ELWA 4XUCA 4HDRB 3ST7A 1ZCJA 4M7RA 5DXAA 1QCDA 3GZJA 5E6UA 4A82A 5JYCA 3ZWDA 1N36B 3ZJVA 3VYWA 1YI1A 4MW5A 2GZRA 2ID8A 3DTTA 2F59A 2J3LA 1T9ZA 3PRKE 1SUAA 2P8SA 4I8IA 3W1EA 4ZV4A 2GYYA 4GZ3A 4P38A 3EXFA 1PZHA 4MEBA 5ER6A 1KK3A 3G2IA 1KYTA 3BXZA 4C7XA 2AG1A 4AT1A 3CVYA 5JZMA 1MIOB 5LCXA 1P2BA 4X00A 4S1OA 4JQCA 5ALWA 1MRSA 4YRPA 4EW2A 1RQ7A 5A5DA 3T06B 3H9JA 2PS9A 1T9GR 4EGJA 3O82A 5JYDA 3L05A 2B8JA 5T4BA 4GDMA 1R15A 3K1YA 3K9HA 3MJFA 1W48A 2FN8A 2X2OA 5I9LA 1H8EA 4WKBA 2WIJA 1N5KA 5AJZA 5C4MA 4KHPB 1XO1A 5A0TA 1XMSA 3IAM6 3K1TA 3NC0C 3HM2A 4CM4B 3O1LA 1E7QA 1JA9A 2IPMA 2E4XA 3GPBA 4KO1S 3TVYA 4RD6A 2ZYUX 3VOAA 3B8HA 1CUHA 3GLHA 3MTBA 4Z9AA 3KU4A 3SQOA 2R62A 2B8WA 4KPEC 1EFVA 3DPIA 2BGIA 1U3DA 1KEVA 5CVCA 5EIFA 1M6YA 3FETA 5CGQB 2O1SA 1H5NA 2ILTA 5M04A 5IM4A 1W1WA 3SDBA 2OV6A 5BUZA 3LQ1A 2BMVA 4FMPA 1H66A 5IH3A 1K3TA 4TQGA 1AQNA 5C32A 3C3MA 2FPSA 1E7SA 3F97A 4KAAA 2FGJA 2AHRA 1IPHA 4FEGA 1N2IA 2BBTA 2VNIA 2BUAA 1J8DA 1B2RA 5IANA 1NX6A 1SIBE 1MQAA 4PFQA 4KTTE 4KXXA 4O4JF 4YUAA 3W2GA 1NIJA 1UP4A 2FPKA 3JARB 3O26A 3AMVA 3X43A 5SZIA 1Z08A 2ECFA 3D4PA 2HWYA 1RPNA 2IYXA 4HRAA 3ROPA 1ZESA 2C3OA 3A1FA 3U4IA 5DOVA 4R71A 1QAOA 4OMCA 4U2EA 3QKRB 3PXGA 1OUMA 3I01M 5CTJA 3ZN2A 1W4AA 4BO4A 3RYFA 1U8XX 2XYRA 3W2EA 2GZAA 4FFRA 3RAGA 4UOQA 2AN9A 4BRSA 2R6HA 1ECGA 5DCUA 1R4MA 1BSVA 4WMLA 4B8WA 2O0HA 3O73A 3IRVA 4U39A 2IH2A 4CMBA 2Z95A 1XXHB 1T8UA 3LDUA 1S8OA 3NDRA 1O96A 1Z38A 2H4XA 3IPXA 4C7OB 2HCBA 2YHBA 3G8AA 4X6XA 1ISMA 4ZI7A 5C51B 2DG2A 1E1RD 3EXAA 3EPHA 4YV7A 4F2DA 5TQJA 4EMSA 4FM9A 5LMZA 1E2LA 1LVUA 4FYIA 3SS9X 5B30A 3H99A 3UATA 4P35A 3IJEB 1IWOA 1WKCA 4MWZA 5FAKA 1Y8QA 4L0QA 3I05A 4P1ZA 1OV4A 2ZJBA 4M36A 2XTNA 1TA9A 3UV7A 3TNFA 1GT91 5BR4A 4OH1A 1PQYA 2MYNA 3K53A 3QBTA 2N46A 4QUAA 2NLOA 4L50A 3CSDA 1Z2EA 4Y98A 4GM4A 1NVBA 1VYTA 5KYYA 3VSAA 4BRUA 1EUCA 3W3AA 2CE7A 4WXMA 1L5QA 1ORVA 2SKDA 1IWPB 2O3SA 3T5TA 2R86A 2KE5A 3U4GA 2GN1A 2QSYA 4V3CA 2GILA 4CLXA 3QVSA 1JYFA 3IIJA 2PBLA 3DE1X 3OCJA 3MUEA 2ZAIA 5KQRA 1ZKMA 3KC2A 3WLLA 1ZU4A 1EINA 3BSYA 2OHIA 3KOZA 3LRTA 4G09A 3QKIA 5CLQA 1YCGA 4ZQGA 1HDCA 1T3HA 1FDIA 2VHXA 3TTVA 5HFJA 3EC2A 3OQNA 4RNCA 4MVWA 1U8AA 2AV6A 2WIGA 2BRUC 5H3CA 2SHKA 4FDMA 1TKCA 4MA4A 4BMNA 4LHXA 5ALQA 2A5FA 1QIJA 2FQ1A 2H4FA 1NIPA 1DUIA 2Q5QA 3RG2A 4FFBB 5CBKA 2J6CA 3BWCA 3JCZA 2C5EA 4QNRA 4BFXA 4TTTS 1JFRA 1GCUA 2UVQA 4ID9A 4X91A 3ADKA 1PVVA 4UNNA 4AF8A 4BJ5A 4C0KA 1DEKA 3MS7A 1FFXB 2RK6A 5G3YA 2AW5A 1FIUA 2H4ZA 2JLBA 2UXDB 1MABA 1HURA 3TLBA 1P6XA 1ZL0A 4JLJA 1W88B 3UAGA 2VRBA 4GWKA 3W8EA 4GGPA 2QT1A 3A6FA 4EM6A 1MGOA 1PIWA 2GK6A 2QQGA 1L5OA 2YVLA 2AJLI 1HM5A 4M1KA 3L1VA 1E0AA 2G5TA 2EJTA 3RFUA 1P9WA 4KLCA 3E7XA 1S4QA 3KTAB 4OUDA 1F2DA 1TUIA 4NKRA 2EP7A 4J6EA 3O2SB 3I34X 1R18A 2OV4A 2VJBA 2X0IA 3DTVD 3EW7A 1QM5A 3KALA 2E3JA 4U4AA 5I4CA 2HIAA 4MW4A 3QVLA 4Q1BA 2YN4A 2IYFA 1UBNA 3G2JA 3RKUA 4CUKA 5DLEA 4YXFA 1RWPA 2EGUA 1L1QA 1XWWA 4KWIA 2FFAA 4FWBA 2GBPA 4LZWA 2Q6OA 1BQ3A 5ILGA 3GAFA 3ECAA 3EOAI 4UEWA 4DLZA 1BFDA 5C5DA 6ADHA 1F17A 1BU5A 1SELA 2SKEA 2HA0A 2VHEA 5KNBA 2UV8A 3NIDB 3QSYA 1HFWA 5IVHA 4BP1A 3DEZA 3HNPA 1C7EA 1YQ9A 2APJA 1E3QA 4A6XA 2Q62A 1HTWA 1ZICA 5C8ZA 3QM1A 2OGTA 3NHPA 2ZS7A 3MJDA 3WIBA 3KHKA 4IHJB 1VLVA 3IQXA 1GZ4A 1WSWA 2VP3A 4AK9A 4C76A 4RTQA 1W6RA 3G8CA 5LZ8A 2RGGA 4ZCRA 3LW7A 5AM2A 4FCTA 1ESDA 3LY7A 2PZLA 3PKJA 3F78A 4TV9B 3VR6D 3PUYA 2C99A 2ZSUA 2CZGA 3CZMA 3ZUGA 4F4DA 1MP0A 1RM4A 2VN8A 2XMCA 3DLAA 1HH4A 2J3HA 4GS5A 4MLDA 5CK4A 5KQSA 2EKQA 2I87A 1N78A 1AS2A 3GUYA 3IDQA 5A62A 1OB5A 1WF3A 1J20A 1JMKC 5HIAA 1HGXA 2GCIA 2IPNA 2O6HA 1NFQA 4KQEA 4MI9A 4QDXA 4ZJPA 1IXZA 3KK0A 4BNWA 2ZB4A 3N7AA 2D8MA 2GF2A 2XZPA 4MPTA 3HDHA 5I48A 2X86A 1C4WA 1KRHA 2JFNA 4R7TA 2HLPA 4CN9A 1TM5E 2AVNA 3I9NA 4QOSA 3WV5A 1X9GA 3CT4A 3QX8A 4FFWA 3C3EA 1AF7A 3PCXA 4C4OA 4ZXFA 4BNFA 4EA8A 2YASA 3Q8LA 4P4SA 3EQZA 5DI3B 2CLMB 5T6BA 2KS6A 1ECBA 121PA 3JQFA 3FMOB 2MTBA 4K86A 5FEMA 2G9QA 3IKTA 3UGQA 3MG9A 4X84A 1XRJA 2DHDA 2E89A 2O2DA 4TS4A 3ZE9A 5D1HA 3LT2A 3AP1A 1NBMD 1EFPA 1BFKA 3AOEA 4QYWA 5DTJA 4I1SA 1K7CA 4NZYA 4I50F 3KKZA 3NCHA 1F0PA 2OESA 4ZZ3A 4LY6A 3LNTA 1XJ5A 1VFNA 4LCJA 3VKWA 3EPKA 1NJFA 2XUZA 1GPNA 3I0ZA 4J0IA 2IY7A 1FNNA 4BN4A 2O8NA 5CK5A 4FLFA 3RF6A 2E9SA 4AY5A 3L6RA 4MR9B 4ZO4A 1B0ZA 2C2WA 1RI5A 1ZGCA 3UMBA 3VC3A 3K8ZA 4MWCA 3O1HB 5JH7A 4DMGA 2CZQA 1X9HA 4FHDA 1ORRA 1KBQA 2QEQA 4NQRA 3STUA 1KDPA 1JEQA 1CUAA 1HDYA 1QYIA 1U0GA 3KSUA 5CM8B 3F4KA 2WQZA 3R5FA 3EQ8A 2P4UA 5AT1A 4DZRA 3PNYA 2GMWA 3BVPA 2EDCA 3R5XA 4G5YA 3ZEAA 4RHXA 4AP6A 1LDGA 4BNZA 2YHIB 1JW9B 4FILA 2I8LA 4RADA 4AKGA 3DL2A 3WTBA 2HF9A 4XWTA 2FDRA 1WXIA 1OXVA 4Y0NA 2Y1KA 1T2CA 3FLBA 4IIFA 4MCJA 4MS4A 3BCUA 1N75A 4HEA6 2MSDB 4JCCA 4O1HA 2WWGA 5DHQA 4B3HA 3AEKB 3HA5A 1U7ZA 3F3YA 4TSKA 3KL4A 2XIQA 2Z8YA 2PEYA 1TMYA 4XGIA 4KYTA 5KKNB 1V2HE 1NJ5A 2I9KA 4AWXA 4BVKA 4OKSA 3QTBA 3CLSC 1W47A 3IPAA 3ND8A 3PQ7A 5EJEA 2G82A 4UOZA 1U7HA 4FQ8A 4ND2A 4RYLA 3LUAA 4B0PA 5K8VA 3C45A 2CVFA 3RVLA 4ACBA 2PHZA 1EX7A 2RG7A 4F1WA 4ARSA 2BF7A 2EFCB 3OOWA 1SZDA 3M4YA 1UCFA 3KUKA 3L93A 2AI1A 4ZGWA 2VDOB 2FMFA 3GRAA 5IM4F 3IP6A 3UJAA 2I8CA 1VLJA 3NHKA 3L77A 4N18A 4D4KA 2HGSA 4HDNB 1YL7A 1O0SA 1UODA 1KDZA 5KTNA 4FDUA 4WFIA 4DRXB 4PR0A 5LYJA 4KJZA 1SRRA 3PPXA 2D06A 3C3KA 3HCFA 1SXJB 1TIKA 4GUDA 1QF7A 3SPXA 4DQDA 3WO1A 4BV9A 2NU8A 2IH4A 2RH9B 4JSYA 2DECA 3SXUA