5L9DH

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form i, parsimonious model
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
215
Chain Sequence
b'EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2016-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dH02
5DURD 5FHAL 1FVEB 4ONHB 1VPOL 3MRMB 1DR9A 1XH3A 3ZDYE 4KUZL 2HA1A 3FL7A 4D9RD 4YDJA 4M02A 2AERT 3G08B 4RGND 1F6AA 4QHMB 3U83A 3QDJB 4KTYA 3IXTB 3IAPA 4R7NB 3IDUA 2BK8A 1HYRC 4BH7A 5CJXA 3M17A 1KOAA 5F7HA 1JYVA 4PLJC 2GUOB 4HFUL 2XZCL 2X6MA 3VXMD 1LD9A 2DLTA 4X4XB 5FM5O 3S98A 4I0CC 1P1ZB 3AB0B 5D6DA 4K2UL 3NZHH 1MH5A 1AGDA 2HVJB 1RUPH 3FB7A 4L3CB 1E27A 4LCWE 4HBQA 5AUMA 3RUGF 4RDQG 3LZFL 4OV6F 4X7DC 4XPTH 4G80B 3WXVH 1T0MB 2ARWA 1T20B 1OTTD 3ROLB 1U2CA 3PWNB 35C8H 4KK9C 2ZUYA 3ULSA 2A1WH 3VXRD 4DN4H 5DJYB 1NQBA 4MJ5B 2E9IA 2EDQA 3OXRB 4MX7A 5FGCE 4ZD3H 3RWCA 5KW9L 1NLDL 2UVEA 1BZ7B 1E4XH 2A77L 2BSSA 2Q76A 3ME0A 4E41A 4YE4L 4NO5B 5IKCB 2BXZA 5E4IA 5B21A 3IDMB 3QUXA 3U0WL 4M1CC 4NNXB 2VXSL 5C08A 2DQGH 4NQEE 4X4ME 1C5BH 2V5SA 4Y19D 1F2QA 1EJOL 1CL7H 3U4BL 2ERJC 4YDJB 3TT3H 2K7QA 3D5OF 4QHKJ 4N0FA 3MOBH 3QDME 1IKFH 3SO3C 4ZTPL 4DKFH 2QQQA 1NAMB 3IFNH 2BOBB 4BH7B 1TCRA 3FFDA 3MRBA 5IFHL 4LARH 2IPUK 2D4FA 3M17B 1D9KB 1U8PA 4LFHG 4GMSH 3BQUD 1LD9B 2X4TA 1UWGH 4KK6D 1RUAH 5LKNA 1Q0XH 2NY1D 5LBSH 3BIKA 5DT1L 2AJUL 1MH5B 1AGDB 1JNLH 3BGMA 3OKNA 1FNSL 4P23A 1RZ8A 2DLGA 5AUMB 2P5EA 4ZO6A 1CBVH 5K9KB 1VSCA 1YEDA 1DQQA 3L95A 5J6GA 3KPTA 3MV9A 3CLEL 4XNXL 1KLGA 2WINA 3PQYE 2FO4B 4G9FA 1KN2H 1AQDA 5DI8A 5GGUA 3OJMB 4MX7B 3WLBB 1AGEA 4YH6A 3RWCB 2EDOA 3GUTA 2BSSB 1WQVT 1OP3H 3W11C 4Y16A 4E41B 4PBVC 4LDLB 4BA8A 4TTDD 3CCHB 1YEJH 3QUXB 2EC8A 3CFDA 3HC3H 1BLNA 4Z7WE 4X80L 4L4VD 4HGMA 4Q9RH 3GO1L 5IBUG 5C08B 1C5CH 3OAZK 1OTTC 3SGJC 1MFCL 4HAGA 4HGKC 3VWKA 1TENA 4K71B 6FABH 3QWOB 5BMFL 1L0QA 1MCPH 5D1XD 1K4DB 1CGTA 5EDXA 3HFMH 4MLSA 5MEOA 3RIAK 4KKCC 4P57A 4HQQH 3CC5A 4QTHA 4O00A 3MRBB 5F6HJ 1KIUA 3OF6A 3UTQB 1ZA6A 4JM2C 2FB4H 2DM3A 3HMXH 3QCUL 4NQDD 3HLAB 1C1EL 1U91A 4KMLB 1Q9OA 4P2OD 4NN6B 4PJ5A 2X89A 1PGRB 3BGMB 5DZOA 3OKNB 3IDNA 4LCIH 1JGLL 3NZHL 4DK6A 1TTGA 2P5EB 1RUPL 3U9PH 5DLMH 5KSUA 5I73B 1YEDB 5E9DA 5J6GB 3Q5YA 4D0DA 4XPTL 3WXVL 1AQDB 5DI8B 35C8L 5GGUB 3BQUC 3FQNA 3CU1A 5I75C 4V2BA 4RIRA 1CDUA 5GSRB 4ZD3L 1BF8A 1E4XL 4PRID 1IAIM 2Q3AA 3NFPA 2IQ9H 5DF0A 2ARJA 3L3JB 2AP2A 4BFIB 2UWEF 3UTZA 4NO0A 5DS8A 5BRZE 5JOPD 2FX8L 3VWKB 3I3BA 4HW6A 3ES6B 1CGXA 4YHKH 1C5BL 2AABL 1NCWH 4ZS6C 2F5AL 4IDJL 4M3KB 1CL7L 1R5WA 1YEHH 3F65A 3TT3L 3ZE0F 2JTDA 2W9DH 5MEOB 5IB4B 3MOBL 3IDXH 2I9LA 3CC5B 1IKFL 4HWZA 4DKFL 4KKLC 3P4OB 3IFOA 2OL3B 5F9AC 5D9SA 2KDGA 5E94A 2XA8H 3GSQB 1C12A 4GMSL 3OAYK 5C8JA 5EZLB 4DZBA 1UWGL 1U91B 5H35B 2YPLA 4AEHH 5IB5A 1RUAL 1I1AA 1OHQA 1Q0XL 4PJCE 3TVMC 3DXAA 3ULVC 4M62H 3OX8A 2QQKH 5HDBE 5LBSL 3OJ2C 4F57L 3DGGB 4K94C 1KPRA 3RPIA 1JNLL 1I7RA 3WEXA 2WLZA 1IC7H 4OKDA 1K3ZA 4IMLA 5KSUB 4ZOCA 5E9DB 1CBVL 1OSPL 3NIFF 4D0DB 3TIEB 3D85A 4QOKA 1MF2H 3ZL4H 3WFBH 2IADA 2ZKHH 3QIWD 3KLHD 1KN2L 4RIRB 2LAGB 4HPOH 4FG6D 5JQ6H 3NFPB 1V3JA 1K5NB 4ODTH 2GJ6B 2ARJB 4U0QB 1YEJL 4PJAE 1YQ2A 5DJ2A 1RAMA 3UTZB 4Q7DA 5DS8B 5K93A 4Q9RL 2DQIH 3A6BH 4PD4J 4KGJA 4NQVB 5MHSD 4EJ1C 1VERA 2DLFH 5T3XD 5EZOH 6FABL 1A9EA 3TWCH 4PJDE 4WI5A 5TF1L 4L3EB 5HYSG 1MCPL 5GGTL 2QQNH 3SY0A 2OZ4A 4CKVX 3HFML 4P5TB 4FZ8H 3ARZA 3QUMA 5K59E 32C2A 3V6OE 2QBWA 1EUUA 3IJSA 3VGAC 1CI5A 4HQQL 1HHGB 5GXBB 4NFCA 3V6ZA 5D9SB 4MNHA 4W81A 2W92A 2YUVA 3FCTA 3R1GH 4R2GB 3UTTB 4ZSOE 1J0JA 4GBXA 2CLZA 1EHLH 2J12B 5C8JB 3HMXL 2NY3D 5IB5B 1I1AB 3RKPA 4DGIH 3CXDH 3OX8B 2H26B 4PJGE 4I1NB 3RKDD 1KPRB 5E5MA 1JPTH 4YFDB 1I7RB 1HYSD 2PCPB 3BPCA 3WEXB 4LCIL 1MCWW 4IMLB 3V95A 2HLAB 3U9PL 5DLML 1T7XA 3QDJE 4GRWB 3MJGX 4XAKD 3T2PA 3MUZ1 2HT3D 3D85B 4X4YA 4QOKB 2ICWI 3BO8B 2VN4A 2ZG2A 2IADB 1QBMH 3QDGA 1CWVA 3DTXA 3QNXA 4D0CB 5FYKH 4P2QD 1J18A 3NPZB 1I8IB 1T0NA 4MJIA 4LRNH 2MNUA 4MNQE 4FFVC 2IQ9L 2R1YA 3H9YA 3EOAA 1KT2A 5DJ2B 4JB9H 2VDQH 4NBXB 5DHVA 3KYMA 4CJ0A 5DTFA 1OWWA 1T2XA 1UJ3C 2VLKE 5CAYB 2R1XA 1GC1H 2YD7A 4HAFA 4KKBD 4DOHE 2VZUA 3ULVL 3O6MH 1A9EB 5GJSH 4YHKL 3L7EB 3LD8B 4J3WA 4X83A 1BJ8A 5F93C 5CD3A 5T1KD 1QLRB 2W9DL 3X14A 32C2B 5BS0A 5C6WH 1Q72H 3IJSB 3L5HA 3V6ZB 1CS6A 4X7EC 4MNHB 3C6SA 3KLAA 3FCTB 1NLBH 2F58L 4GBXB 2CLZB 3BJLA 1INQA 1RHFA 1YNTA 4OBRA 3S6CA 5L2KD 4GQPH 1U93A 3EYFA 5DFVC 3S5LG 4NHUA 5DUML 5E5MB 5KBNC 1TJHL 5EA0H 3BPCB 3HC4L 2DTMH 1IC7L 5D70H 3N06B 4X4YB 4JCLA 1OGAD 5KS9F 4LVNB 2Z35A 4BQ6A 3VDAA 1MF2L 1TPXB 3ZL4L 3WFBL 3QNXB 2ZKHL 2YWZA 3D39E 3LN5A 3DJ9A 1FVCB 4G7YH 4FN0A 2YWYA 1DEEA 1BBJB 3O4LA 5E8NB 3VFUA 4HPOL 3QQ9D 5JQ6L 3OMZA 3T65A 2NR6C 5SX5K 3TYGL 4HWNA 4ODTL 3EOAB 4MJ6A 5HI4D 1S7TB 5DHVB 5C1MB 2K9UA 4IOFD 5DTFB 5DMIH 1PX4A 4JLRB 2R1XB 3J8F7 4HXAL 3C5SA 1Q38A 1I3RB 4KROC 3FT4A 2DLFL 1IGIH 3MACH 4LK4A 5EZOL 3TWCL 1FGVH 2YXFA 1TZGH 1M6OA 3WHXB 3WIIH 3CSBA 1I3UA 2QQNL 2EIZA 2IBZY 1TZIB 4E41E 4Y5VA 3X3FH 1R3IH 1KXTB 3JV5A 2N7AA 3ZKND 2D9QB 4K7PY 3O6FC 3OB0H 4QWWC 1YEEH 3C6SB 1S7QA 3KLAB 5F3BA 4X6BB 5JOEA 2AEPH 2YN3A 5C08E 1P7QA 4NZJA 1BAFH 1INQB 3RAJL 1EHLL 3EYFB 4PV8A 4B5EA 5C9JA 1X3DA 4DGIL 3CXDL 5F9WC 2AEWA 1JPTL 1LE5B 4P5MA 4PG2C 4OTXH 2O61A 2WBJA 1A6VH 4X6DF 2R1WA 1GPOH 3I6KA 1Y6KR 4P2RA 3I50H 5FV1L 1XCQA 1XIWA 1NBYA 3LN5B 1QBML 5EO0A 1FYTB 4YDVB 3UTOA 1DEEB 4Q9CA 3VFUB 3CDFA 2VIRB 3T65B 5F8QC 3E6FA 5L8JB 3L3OB 5IB2A 4MJ6B 5KVFL 4UINH 1ZLVH 2AEQH 3U79A 2P44B 1W72L 3A0OA 4LGPB 5F89A 2P5EE 1S7XA 2ARJQ 2VDQL 4G8IB 3FQXA 3QI9A 4K3DH 4R8WH 1BWMA 3MLPA 1ZSDA 3MV9E 1SEBA 1WBXA 1KG0A 3FT4B 3O6ML 4G9FE 3V2AR 5T3ZE 4A6YA 2VQTA 4N0UB 4MWFB 1FJ1A 4PLNC 1YYLH 4J23A 1X6NA 2J5LB 3DBXA 2EIZB 3V5KA 4B0MM 2QADD 3B9VA 5HI4C 1A7PL 3GSUB 1HQ4B 1RURH 1KGCE 5CINH 4OM0H 1BFOB 1AP2B 1Q72L 5HHXL 3VXQA 4R97B 4GW5B 4LHUG 1S7QB 2J7LA 1P7QB 5JHDA 5KG9A 3KPPA 3NGBC 5BO1H 1EFXD 3ILQD 4EZMA 4HLZG 5TDPA 4I0KA 2OSLA 3W2DL 5IB1B 4Z95H 3TH2T 4NC1C 2GEEA 4LSUH 5INDA 2NY7H 1IL1B 3U7WH 3DARA 1P9MA 2X10A 5EA0L 5A40E 4P5MB 3ZKNC 4NKMA 2WBJB 4Z7UA 4J3OC 4C4KT 2O61B 1U8MB 2DTML 2Q8BH 2R1WB 5D70L 3I6KB 4OI8A 4P2RB 1YEIH 2ZSVA 3L3HB 5I74C 1LO5A 3MLWH 5LGJA 4MVBC 4FXKA 5EO0B 1X6LA 5C0CD 2E3VA 3KPLA 5IJVA 1VACA 3H0TA 5HHOA 3DWTA 3G6JB 3GRWH 4G7YL 1A6ZA 3E6FB 3I85A 4LLYA 4PJ5E 3GSVA 3TNNA 4WHDA 5EOCJ 3S9DB 1NFDF 3C87A 4R26H 3JV4A 5F89B 1S7XB 3GKWH 3JWOC 3FQXB 5F3HA 5E9DE 2R2EB 5JPNA 1ZSDB 1S3KL 2W0PA 1WBXB 1KG0B 1MJ8L 4NT6A 3JWDC 4Q6IA 2DICA 3NPSB 2BFVH 4A6YB 1IGIL 3CVHL 3E3QC 2E8ZA 3B8YA 4LIQH 2X40A 4GRMB 3WIIL 3V5KB 3CMGA 1EEQA 3F7YA 1BVLA 2D31A 5E0QA 2LTQB 2DQCL 5F1IA 1LP9F 1R3IL 3IDGA 4UQ3A 1JHKL 4Z9KB 3VXQB 3GHEH 4HUVA 5F1KC 1YEEL 1KB9K 3KJ4C 5HTSA 3D18A 1J05A 2QV2A 5I19H 5JHDB 5KG9B 5D2NC 1B3JA 5TDPB 4IHOB 1BAFL 2EDRA 2OSLB 1MRCH 5IT2H 4NM8H 3TPKA 3SKOA 4OGAD 5INDB 1YY9D 4LPUA 5F72S 5HHQA 5JPMA 1ZTXH 3BAEL 5LGHH 3F6LA 4Z7UB 3MRNA 4FFYH 4OTXL 1A6VL 1XF5A 1BZ9A 2ZSVB 1IC1A 1LO5B 1QP1A 2V5RA 3B3IA 2VSCA 5ESQB 4FXKB 3F8UB 1ZLUH 3KPLB 1HQRA 2IANA 1VACB 5HHOB 2GTZB 4P3WA 2AJ3A 2QTEA 2YPLE 3DXAE 1A6ZB 4LLYB 4XWGH 3AREA 3GSVB 4N0YL 5FGSA 3PF2A 1GZPA 3X11A 3JV4B 2AEQL 4HPYL 3X3GL 2L4OA 4TUKH 2FLRT 3PJSB 5F3HB 1QBAA 1MFDH 3MJ9A 4WFGE 1IKNC 3AUVA 3QXDA 5IM7B 4K3DL 2FD6H 5JPNB 4QYOA 1DBMH 3TBTA 4G6FD 4QOKE 1WK0A 1FO0B 4OLZL 5GS2H 3RGVD 4Q6IB 3FTGA 4PGEA 3VH8G 4X6CF 3N1MC 4DGYH 5IBLC 3SQBA 1YYLL 3RDTD 5DZLA 3F7YB 2D31B 3TBVA 5F1IB 2XIDA 1E6OH 4M7LT 3L3GA 2X1WL 5TQ2H 3IDGB 4UQ3B 2HWZH 3P2TA 4HUVB 4GKSA 5TQ0H 1RURL 4OM0L 5E70A 5IMLA 2JJTC 3PG2A 3D18B 1J05B 1CCZA 4LASH 5BO1L 3AM8C 5I2IA 3DMMA 4Z95L 3UZQA 1XGUA 4LSUL 2NY7L 5HHQB 5JPMB 5T5FH 3U7WL 3QFJD 4FFWC 4YZFE 4EUPA 4AL8H 3QUZA 1JI2A 1NBVH 2HT4C 3KYAA 4JHAH 1IM9B 2Q8BL 3C60B 1XF5B 1PKQA 3ZTJH 5BV7C 3T0XA 4NIKB 3MLWL 5F9OL 5GGRA 1HQRB 2BCKA 2IANB 1KNOB 4QRQA 2AJ3B 2BHZA 4OGAC 3GRWL 4KQ3H 1GJIA 3OGCB 4HH9A 4R96A 5J6HA 4NCC1 1JP5A 4XT1C 3IDYB 2FYYB 1GZPB 3X11B 3BX7C 5I66B 4EI6B 3VFOA 1MVUA 2H1PH 4OD1H 5ID1B 3GKWL 3QXDB 4ONOA 4QYOB 3TBTB 4XPFH 1WTGT 3TO4C 3TIDA 3FTGB 3IYLW 3QDGE 4PJ8C 1ZMYA 1NBQA 2CQVA 4DVRH 4WWKD 4XNYL 5FV2A 4CN1A 1CQYA 4LIQL 4MJIE 4BFEA 2CRIA 1AXSA 3TBVB 2R2CA 2ZUQC 3L3GB 3O0RH 4ZOAA 5DQDH 5I15H 4GKSB 1QSEA 3B83A 3GHEL 2X4PA 1J0ZA 1MVFA 1G9NC 2V9QA 3RGVC 5I19L 5E6IA 3DMMB 1GGIH 2OK0H 1MRCL 5IT2L 2OR8A 4XPBH 3UYRH 4NM8L 1JZ2A 2A9NH 1XGUB 3RY6C 5GISH 4N1CA 4PJHB 2IC2A 3M45A 4UTAL 5D7SH 1PDKA 4EUPB 1ZTXL 1U3HC 3QUZB 2AK1H 5LGHL 3WN5A 5BS0E 4BKLA 1L7TL 4FFYL 1P53A 1PKQB 3G5XA 2L0DA 3CUPA 5CIPH 4X8XA 1CLCA 5GGRB 1S9YA 4IIQB 3V8CA 4MCZA 4DJMA 5JXAH 5D71H 1S8DA 4WO4D 2FJFB 4XNQB 5FAAA 3KPNA 5J89A 3NAAH 1G7QA 2I5YL 4U6HB 4XWGL 3VFOB 1MVUB 2EYRA 5GRUH 5ISZB 1TQCB 4TUKL 3TBYB 1KJ2A 3EZJB 1MFDL 1G7HA 4NYLB 5AYUL 1J8KA 2FD6L 1FL6B 3D87B 5F7UA 1DBML 4IM8A 3TIDB 5CBAB 2KQMA 1I1YB 2PXYC 2YC1B 3V79C 1MIMH 3LDBC 3AXLA 5CJQH 3O4LE 4OJFH 3DGCR 3HNTL 3KAAA 1AXSB 5EUOA 1NPUA 3SCMA 3KYOB 1T80A 1E6OL 2FZ3A 5BV7L 4XP1L 5TQ2L 2HWZL 2BZDA 5TQ0L 3HHRB 5FCUL 1LK3L 4K23L 4U1GC 1KJMA 2GITA 4UQ2A 2NX5A 3FB8A 4TYUA 1U58A 4IMKC 4H20H 3LKSA 1F4XH 4HIHA 3FQTA 3ARFA 3MUHL 1TVHB 1FN4A 4JRYA 4X99A 3N1QC 2A6IA 5T5FL 1HHIA 4PJBF 1CGYA 5D7IA 4KV5E 1MCIA 4AL8L 4BKLB 4Z77A 4AK1A 3G5XB 4DFIA 1PG7X 3QXAA 4MNGA 4I48B 4N1HB 4O2FB 4MCZB 3EO0A 1BOYA 3KPNB 3QULA 5MEQA 1G7QB 3DROA 4HCRA 1KXQE 1NGYA 2AXGA 3QHZL 4KQ3L 4KRMB 5E8OB 4Z7VB 1OAKH 1MCFA 4I2XA 5DR5H 1FZMA 4QRSA 1TETH 1WC7B 1DE4A 2NXZB 1KJ2B 5TH2B 1G7HB 2H1PL 4OD1L 4F3FB 1LO2H 4MJ4A 5ENWA 4HIJA 3I6GA 5BQ7B 4P2RE 1AFVL 4XPFL 3OV6A 1TJGH 3DHMA 5ACMA 2J4WH 4WO4C 2AJVH 4PJXA 4ENED 3VI4E 3AXLB 1CG9B 1Z9OA 3FN0H 3ZDYF 4Q97A 4NKIH 3ARXA 5GZOD 1FNGA 5ILTH 5EUOB 5C09B 1KB5L 4CW1A 3VFWA 1AGCA 2APWA 3SCMB 5F6IB 4YXLH 3SGDI 1WBZA 2FZ3B 1RU9H 3O0RL 5DQDL 5I15L 4KUCF 4PYHA 1GRWA 1K6QH 2VB5A 5DRNA 4UQ2B 3FKUS 3FB8B 5EFIA 5K9QI 1U58B 4U6XB 4XBPA 2OM5A 5JLZA 4MXQD 5IROA 1XR8A 3LKSB 5F7KC 1JWMB 4LCCA 2OK0L 4RQQA 4HIHB 3FQTB 4XPBL 3ARFB 3UYRL 5HPOA 2A9NL 1FN4B 4OFYD 4FQJH 5GISL 2O5XH 5IVNA 2A6IB 1UM5H 5AZ2L 1HHIB 1IGMH 1CVRA 5D7IB 4LCYB 4LGSB 4WI4A 4Z77B 2AK1L 2E9WA 3QXAB 1QQDA 4MNGB 5EOQH 2HG5A 3LQAH 5EU7E 3HTLX 1HZHH 4MB3A 2WK2A 3GKZA 3EO0B 1IT9H 3ZT7A 5DJ6A 5JXAL 3OR6A 4X9FA 4HLZH 5MEQB 1ZVSB 1TCMA 3KPRA 3DROB 4EQ2A 3S4SA 1NGYB 2AXGB 1YJDH 2D9CA 5I8CB 2AJZA 1A6AB 4U7KA 4FRWA 2AQ2A 2YD2A 4IRSC 2ESVA 1P7KA 1FFNA 4Z7UE 5GRUL 5BCAA 1KELH 4HIJB 4D8PB 5F9DC 1SEQH 2N1KA 3RTQB 5C0ND 4PJXB 1XF4B 3A6OA 4RFEA 1YEFH 5HHOE 2CJUH 2FEEL 1IQWH 1MIML 3QHFH 1FNGB 3HG1D 4CW1B 1AGCB 5D6CA 4M6OH 4ONGH 4YEEA 1OL0A 5F7EH 3RVTD 5DRNB 2X7LB 4KK8C 1XFPA 2CIKA 1E4KA 4OUUA 4LPCA 1ROWA 5MEND 3PP3K 5CGTA 1XR8B 3VE0B 5A43C 4LCCB 4ENEC 5IJKC 4RQQB 4PV9A 1S7VA 4LHQB 2Q87A 2PO6D 1F4XL 2PTTA 2B39A 1RJCA 4GT7A 4JY6A 1LHZA 1YECH 1AJ7H 4FQPA 2E7LC 1ZHLB 1DDHB 3UXFA 5FYJE 4RAVA 1QQDB 3ZDZE 2HG5B 12E8H 2JJSC 4NN5B 1CFQB 3MCKB 4ZG1A 1M7XA 4HC1A 4C57C 5DJ6B 3C2AH 3DVGA 2FHCA 2XPGA 3OR6B 4KI5E 3KPRB 1RK1B 3S4SB 1ULVA 1DP0A 3TBWA 2N7BA 2AJZB 1JGDA 4JFDD 3TFKC 1OAKL 4LLMA 5DR5L 4G3YH 2ESVB 1P7KB 4UBDD 5DRWA 4Q9QH 4EIZC 1TETL 4HJ0D 4M00A 2IGFH 43CAA 3GBLA 4Z7WF 5C9KA 4OKVA 2HH0L 3B9AA 2DWDA 1WAAA 5L7XH 3JUYA 3BP4A 2BX5A 1TJGL 3FHQA 5I76A 2IANE 2J4WL 4RFEB 3K4ZA 2AJVL 2O26U 1H5BA 4YHYC 2VZSA 2VXTL 4JO3H 1I85C 4NKIL 2WBKA 3D3VA 1D6EA 1DZBA 5ILTL 4S1QH 2MCPL 3RWIA 4JAMA 1DBAL 1MY7A 4F8QA 4YXLL 1WEJH 1RU9L 4RGOH 2GKIA 5CEZD 4U1IA 1FFQA 1K6QL 3AY4A 3RQ3A 4WV1C 1C8PA 4LNRB 1EAJA 2CXKA 2F19H 3AS0A 4KHTH 4AMKH 2XY1A 4PV9B 3LRHA 4ZAKA 1F4YH 4UMGA 4LBEA 2O5XL 1UM5L 3EFFB 1IGML 1JK8B 1LO4H 2NNAB 4HUNB 1J5OH 1R0AH 5AAWA 1FE8L 1RVFH 2ZUWA 5C0FB 5HVHC 1QLFA 5J1AA 5EOQL 3RVWD 2XPGB 1BD2D 1IT9L 2VZVA 4PIRF 1V8HA 4LKCA 5CLWA 5EORH 1JGDB 2ICES 2FHBA 4X0KA 1YJDL 4LLMB 2H2PD 5DJAA 4M8QA 5DRWB 3B2UD 4AM0A 1A47A 2GT9A 2CUIA 43CAB 5EOCH 3CDCA 4APQA 2Y7QA 2YN5A 4CNIB 1YNKL 4OKVB 2AEIT 1PKQE 1KELL 3NABL 5IIEB 2DWDB 4JDTL 4WW2C 5BW7C 2LV4A 1EHXA 1SEQL 4PJ9A 2X4QA 5I76B 4UDTB 1H5BB 1G7JA 1U95A 5IHUH 1YEFL 2CJUL 3QHFL 3DIFA 4Z78B 3WKNA 3GNMH 4YGAB 1D6EB 1DN0B 1MEXH 1VGKA 4JAMB 4X8JA 2WANA 3BGFB 1HILA 1UGNA 2CGRH 2H2SC 4Z0BH 4M6OL 4ONGL 5ESVA 5F7EL 1R24A 1HXMA 1K9TA 4I3SH 1U8OA 2P8PA 3JZ7A 1SY6H 4NKOA 3S3PA 1IILE 3FO0H 1CICC 2Y9RT 5FOBB 4WEBH 5INCA 2LU3A 4PJCF 4ZAKB 4KPHH 4LBEB 5HDBF 4HGWB 1CT8A 4L4JA 2IH1A 1H15A 4N8VA 5ICXA 4G7VH 1YECL 5DD3L 3B9KD 1KCKA 3BZDA 1AJ7L 4F9LC 4I5BA 3ALWA 5T1LA 1QSEE 1QLFB 3FQUA 1A9BB 4HBCH 2IAMA 4Z5RA 2X9YA 3O6KL 1Y0LB 3PL6D 4CN4A 4O58H 2H8PB 3WS6C 1YN7B 3GMRA 3LPFA 5DK2A 3ET9F 3C2AL 4N9GA 4BZ2H 1BJ1J 5FKAA 5T1MA 4X0KB 3DX6A 4G6MH 4JFHE 5T5NF 3BXNA 5DJAB 3EYVA 4M8QB 1A4JB 5I1KH 4QRRD 4AM0B 3TYFA 4G3YL 6CGTA 4PJAF 1QFPA 4APQB 2Y7QB 5HD8D 2IGFL 4P3CH 5D7LB 1FNEA 4D9QD 4N90D 3OKEB 4PRAA 5L7XL 2X4QB 2YBRA 2OTWA 2Z9TA 4XH2A 1G7JB 3E0GA 4M4PA 4PJDF 2GK2A 1Y6MR 3DIFB 1NDMA 1B90A 2EH8H 3FMGH 3BPNC 5IP4A 4JO3L 3U4EA 4K3JH 2H2PC 4X8JB 4S1QL 3WL9A 1HILB 1P6AB 3U46A 3C9NB 5TE7H 5K59F 3DYPA 1D9KC 4RGOL 5ESVB 2DRUA 4OLVH 3W0WA 1HXMB 3E2HC 3EYOA 2W0FA 4LCUB 3TA3C 2P8PB 2ATKA 4HLJA 4LSVH 3U0PA 3RVVD 2WSKA 2F19L 1URLA 2C3VA 4FQLH 4AIOA 1OT1A 3MBEA 4KHTL 5INCB 4AMKL 4DFHA 5HI5C 2JKXA 1I8LA 3DX7A 4PJGF 2QL1A 5KVGH 1QYGH 1F4YL 1ZHKA 2IH1B 3QO0B 4N8VB 5TPWH 5EUOE 1DQDH 2BNRA 1NUDA 2VZ1A 4OF0A 1LO4L 3BDYH 3FQUB 1J5OL 1R0AL 1KTDA 1RVFL 3OKLA 1D5MB 2DI9A 4X5WA 1GGBH 3ZTNH 3JVGA 4HMEA 2NX5E 1SBSL 3RFZC 3GMRB 2CMRH 5DK2B 5FDWA 4N9GB 4U05A 1EXUB 5FKAB 1PYWA 5FYKD 4BZYA 4U7MA 5EORL 2VLRB 4JRYE 3EYVB 3TYFB 2D7TH 5D7IE 3ARGC 1HEZA 4P4KA 5EOCL 4HF5H 5EG6C 2CO7B 1FNEB 4MA1C 5JNYA 2EO1A 4MNGE 4NRZB 5IWLC 4DVBA 1FCGA 2YBRB 2OTWB 4XH2B 4Y4HD 4U3CA 4J7RA 3EYQD 5D2LA 5IHUL 3U4EB 5T3ZH 3GNML 1M71A 5HYJD 4I2XE 1MEXL 3WL9B 3CDGA 3U46B 2O5ZL 2UV3A 3BISA 3TN0B 5FIEA 3Q5TA 2CGRL 4Z0BL 4UIMA 4Y4FD 4WW1A 1IGTA 2VZ3A 3W0WB 3EYOB 3RP1A 3AAZA 3BIBX 2W0FB 3MRIA 4J8RA 4YHOH 3UYOD 4ZUSB 1QBLH 3SPVA 4L9LB 4I3SL 3N85H 3MBEB 4PJXE 1SJEB 3FO0L 5J11C 1N5AA 4WEBL 3DX7B 2A6KB 3O3BA 1E4WH 4K9EH 1ZHKB 2EDEA 4XBGA 5EC2A 3EOTH 1KPUA 4PS4H 5EO9A 5GGVH 2BNRB 2CK2A 2VLLA 3ARYA 5DUPL 3QQ3A 4G6AD 1KTDB 1A7BA 3OKLB 3Q6FA 3SBWC 4HBCL 4KRPD 3RWFB 2FIKB 2L7UA 4ETQB 3MNWB 1IJ9A 4O58L 4D3CH 3RVUD 5DYOB 2OL3H 5ADPL 1NAML 1WVZA 1X4ZA 4XB7A 3GSNA 4FQIH 2AK4D 4G8FA 2D03H 1NCDL 2HTKD 3IU3A 1NANI 4HFWA 5I1KL 2DM2A 2MHAA 3FO9A 5FUOL 4P4KB 1OY3B 1BOGA 3QXWA 3H9ZA 5JNYB 3WKMH 5AD0B 1N6QH 5DQJA 3BP7A 43C9A 4GKZA 5D2LB 2GAZB 2R0WH 3KPRE 5DEZA 3UDWC 1IARB 1M71B 2EH8L 3FMGL 4M7JH 8FABA 1B4JH 1CQKA 1I8KA 1R3HB 2ADJA 2ESVE 1GSMA 5TE7L 1P4BH 4O5LH 4WW1B 1IGTB 1RJLB 1A14L 5KVMC 4ZOEA 4OLVL 3SDCD 4XCFH 3VCLA 1NL0H 3O3AA 1I7UB 1MRFL 3OB8A 4LSVL 4QTIH 4FQLL 2ZSWA 3DV4A 1N5AB 4XNMA 2WZPD 2VDKH 3O3BB 1SVCP 1IEBA 5CZXC 3H9SA 1KPUB 5EO9B 3CSPA 5TPWL 4MA3A 5JDJA 3K3QA 3E1F1 3ZHKA 3FQRA 3BDYL 2HKHH 3Q6FB 4TNVK 3EZ8A 3ZTNL 1Q0YH 1PQZA 4NQCA 2UZIL 2CMRL 3GSNB 3MBXH 1T21B 1NBZA 4GRLB 4NZRL 4XC3H 1QVOA 3BGAA 4EI5A 4LFHD 3QPQC 4G8FB 3RL1A 2EDKA 3IU3B 1AI1H 4HFWB 3MLTB 1N8ZA 2BXYA 2QR0A 4RMQA 1MCOH 3FO9B 4KK5C 1F3JA 3SGJA 1BOGB 4B53A 3VXRA 4HF5L 5E00A 3UMTA 3BP5A 2C4XA 1ZGLA 2F54B 1Z9SA 5DQJB 5B39G 4L3AA 2C7UA 3IVKA 2MMXA 3P40A 3RVUC 4LAQL 2ERJB 5SWZB 4NBZB 4GRWH 4GKZB 3QIUB 4P5TC 4WU7A 3LPWA 4JY4A 1VKXB 5T3ZL 3SO3B 3VA6A 4MD0A 1HHHA 4P5KA 4E42A 2ADJB 2Z93B 3WYRA 3WNLA 3O9WD 4KQ4H 4LRIA 4GG6B 3OAZH 4JM2A 3MJ7A 5DURB 3UJTH 1AO7A 5SWSD 3VCLB 4YFLI 3O3AB 1MLCB 4H1LG 4YHOL 1WAAE 3UBXB 2BY1A 1V3MA 1MJJB 2ZSWB 3DV4B 4LSRL 5FYKU 4XNMB 4I9WE 4HDIA 4HS8H 4RGNB 5GGTA 3LKRA 1BQLL 4K9EL 1E4WL 3D3VE 4WY7H 4MA3B 3EOTL 4PS4L 5GGVL 1MFAH 1S9XA 3MLZH 3QXVA 5F8RC 1E4XI 2COQA 2OZ4H 4EUPG 2RHEA 3W5NA 2EEBA 4ZDHA 1JF1A 4KC3B 5CFHA 5CILH 4L8CA 3O6LH 3LH2L 4NQCB 4I3RL 4D3CL 1W0YT 1DBKH 1NBZB 2OL3L 2FLBT 4Z76A 3RL1B 4FQIL 2CUHA 2YZ8A 3DUUB 2D03L 1N8ZB 4Y88A 2W65B 3MRJA 3DX9A 1X5HA 4PRHD 1WCQA 1CL7I 1U36A 4PRNA 3VXRB 2LU7A 3MJ8A 4OFPA 3HB3C 4YXKH 4CU7A 2C7UB 3IVKB 1G7MA 3QEQA 4OD2A 3T0DA 2EXWC 3BUTA 3RZCD 4QLRA 3QWRA 3G5VA 3K8MA 1CZ8L 2R0WL 4NKDA 3L3DB 4LQFL 1INEH 4M7JL 4NSKB 2YUWA 4MD0B 4LKXB 3P4NB 4L4VA 4PJEA 3BKCH 5CJOH 5SWQA 4L8SC 3BHBA 4Q6YA 2DF3A 2WAHA 3MJ7B 3FT2A 1P4BL 2GJZB 1A1OA 4JM2B 3OKYA 4ZOBA 4Y19B 1N3NB 5F7LB 4XCFL 5DHVH 3EHBD 1NL0L 3TVMA 1TVDA 2DIJA 4GUPA 4I3GA 2FGWL 2VISA 4NN7B 4HDIB 4NRXA 3WBDA 3KGRA 5JUEH 4NNPH 3ULUC 4YHLH 3LKRB 1IGYA 2IBBA 2VDKL 3TLRA 5FA4A 3TJHD 3NA4A 3O2DA 1QPXA 1H3GA 3O9WC 1JFQH 3KR3H 1OP5K 5E8PB 2CXGA 1XZ0B 2HKHL 3BQUB 4ZDHB 5KSAC 5I75B 3JTSA 1T1YA 4L8CB 3EW3B 4LVOC 5HGDA 1Q0YL 3DRQA 3RX8A 5CD5C 4I0PD 2N56A 5BJTA 4RRPA 1FFOB 4TNWF 1G0XA 2D7MA 5DHXB 3SO5A 4Z76B 2PKDA 3MBXL 5GIRB 1LQSR 4EIGB 4ZXBC 4B50A 3MRJB 3DX9B 1AI1L 5IG7A 1AC0A 2Q7NA 4OZIB 1BX2A 5EIQA 3WE6A 4GJTB 3T4AA 3VGBA 1ZT4A 3PABA 4JEGB 1QACA 1Z2KA 4GRWF 5K9QG 3AS3A 1EO8H 3O81A 1FFPB 5F9JA 2VLJA 5GS2D 1EV2E 4L8DA 3UPAA 3G5VB 1BEYH 2OI9C 4NKDB 5IHBA 3UYPA 1FQ9C 4ELMB 3GMPA 4L4VB 4PJEB 4JKPH 4WDIA 5SWQB 5GGSA 1T22B 3K7UA 4Z6AT 3E8UH 1QKZH 4KQ4L 3SN6N 1H3UA 1A1OB 2F53A 4GSDH 4L29A 5IEHA 5MP6L 3UJTL 3C08L 2VDLH 2X4RA 3TVMB 2VWEE 2K1MA 4OB5L 2VISB 2ZOLA 4NRXB 3O8XD 1IGYB 4GW1A 4J6RH 4HS8L 5IQ9A 3VWJC 4JFPB 5FA4B 5FUCE 4WY7L 1J0IA 3QG6B 3FRPA 4V1DD 4YZFF 4HEPG 4FQXC 3MLZL 4PP1C 5C07E 3Q48A 4MMXC 2CKNA 4NQDB 5EULV 1JTPA 3W0WE 3MCLH 4EEEA 5ETUB 5HGDB 1LVEA 2DWEA 2DI8A 3NIGE 2DKMA 5CILL 1HH6A 3O6LL 4P2OB 3PWPD 2IPKA 3VMNA 2AQ1A 2X44D 1DBKL 4OD3H 2OTUA 1SBBA 4F9PC 3DRTA 4TUOA 5IG7B 1W8NA 1BX2B 1CFNA 2BNRE 1UJ3A 3QA3A 4OZ4A 5TE6H 3RNKB 3T4AB 3LKPA 4ELKA 3JBG7 3B2VH 3H9HB 2LABA 4UV7L 5DD5H 3EDKA 2ITDA 1NUGA 3ULUL 1OTSC 5F9JB 2YS4A 4I0PC 3R8QA 4PRIB 4L8DB 1MFNA 4ALAH 4JFOA 5BZWA 2G75A 3ARDC 4G8GA 4XVTH 3V5HA 3VGAB 1INEL 4G6JH 3QEUA 4ZUWB 4WDIB 5GGSB 1VFMA 3BKCL 5CJOL 1NGWB 3U7YH 1W72A 1BQHA 1XAUA 3RIFK 2PUQT 2BNUA 2ZUXA 4L29B 1K85A 4X7CC 4OLEA 4C83B 4UUJA 4Y89A 1JWUA 4HMCA 2B1HH 5K9OA 3P73A 4X9GA 1S5IH 4BQ9A 2HT2C 1JCKA 1TDQA 5JUEL 5D2LE 5EPMB 4NNPL 4YHLL 1QUNA 1MLBA 4A6YH 2P7TA 3RX7A 4NRYA 3FO2A 1UENA 1JFQL 5I1EH 3KR3L 4ZFGH 1P5VA 3VDBA 5C0AA 4DK3A 3R0MA 2DWEB 3K8LA 4LCWD 3EIFA 4QRPA 1CXIA 2PN5A 1BJ1H 4PUBH 2WWKO 5DSCA 3DRTB 3HR5B 4TUOB 3S4SG 2CUMA 4NC0B 1A3LL 5C0BA 1CFNB 1UJ3B 3QA3B 4OZ4B 4KMQA 1WIOA 4ELKB 4CVUA 2XI9A 3NCFB 1DLFL 3VRIA 3HS0B 2X1QA 1UQSB 3BEWB 4AQ1B 1EO8L 5BOPA 1TJIH 1MCBA 4EVNB 4DKDC 1BEYL 4NQED 4G8GB 4FXGA 1FPTH 3QEUB 1XF2A 3O6FA 2F15A 3INUL 1DQTA 2X4NA 3LPGA 3V4UH 4JG0H 1QKZL 3VFVA 3VI3E 2BNUB 2GSGA 5IVZB 2NW2A 3F7RA 1G9MC 4M9OA 4GSDL 1AR1D 1IC5H 4BM7A 2VDLL 1JWUB 3QDMD 4LL9A 3MOAH 5A3ID 3CVHA 2B4CH 1DLHB 2BDNH 4U1LA 2IFGA 1FO0H 3Q0HA 5IEKA 5D1ZD 1MY5A 1MLBB 1OQXA 3K2UH 4J6RL 4P46D 4PG2A 2P7TB 3DUSB 4R0LC 4NRYB 3DOSA 2VDOH 4KV5F 4U1NB 4NFBA 5B3NA 1CU4H 4M4RA 2SEBA 1MFEL 3CFEA 3VD3A 4FQ2H 5ACZB 2VXQH 1OM3H 3RWGA 4AT6A 5FYJH 1GGTA 4LSTH 3NVQA 3IETB 5E03A 5I1IH 2B7DT 3MRQA 1R3KA 3WFEH 3IGAA 4J3TA 5HPMB 5TDOA 2NW3A 4OD3L 5DSCB 4XMKH 4YXHH 3H9SE 4JZJC 2AXFB 1CDHA 1SYVA 1KTRL 4Z0XA 3OHXA 5TE6L 3TZVC 2M26A 3VRIB 3TH4T 4YFEA 3B2VL 1QZ1A 1ZHBA 1CFTB 2YA2A 3RNQA 3MSPA 4NQCE 3VI4F 4ALAL 4M5YL 3K4DA 1QR1A 1T3FA 1YN6B 2ZCHL 3CFKA 2NXYD 5JW5A 5GSVB 3QQ4B 2BVOA 1KC5H 4KJYB 4LLVB 1XF2B 3O6FB 1MCLA 1JYXA 4G6JL 2X4NB 2XZQH 4JO2L 3VFVB 2GSGB 2NW2B 1LE9A 4K3EH 5CJ5A 2CKBA 1FRGH 4P2CG 4FMKA 1G7PA 5DMGD 4HEME 3MJ9H 3MNZB 4IEFB 4Y8DC 5F9WB 1MELA 4P99A 2B1HL 5T1KB 3GIVA 3ARTA 3KPMA 1S5IL 4U1LB 5IEKB 4W68A 2CRYA 1UWEL 4A6YL 4DQOL 1DN2A 4JFZH 4TOYH 2Z8WC 3CFEB 4WUUA 5IW1A 5C6PB 4PY8J 1AO7E 5L2KB 5ESAB 4M43H 2J8HA 5TF0A 4LHUD 3MRQB 1R3KB 3WO4C 5TDOB 4HX1A 5DQ9B 2C1PB 2NW3B 4FQCH 4WI6A 5D1ZC 1DCLA 5JW3H 4PRDA 3GSOA 2HRLA 3KVQA 4PUBL 4MQXC 4XX1E 5I71B 3VG0H 1BM3H 1GHFL 3NBNA 4OLUH 1QHOA 1SYVB 1OGAB 2J8UA 4YHMH 3OHXB 4Z7UF 1M05B 3NCBB 5C0JA 2APFA 4EUPH 4AEIH 3RHWF 1ZHBB 2HMIC 2B5IC 1TJIL 5EBWA 1ZT1B 3N9GH 2CDFA 4DW2H 5FB8A 5A2IH 2KL6A 2QHRH 3CFKB 3BRFA 5F71A 5JW5B 3GRWA 4TVSa 2BVOB 4WFHE 4MXWL 2RCSH 3P0VH 1FPTL 5I17A 2H9GA 1P4LA 5DK0A 3KWWA 3MLUH 3GMMA 4JG0L 1LE9B 5D2NA 4MAYA 2CKBB 4U6YA 4FNLL 1PX3A 3QSKB 3THMH 1XCTB 1BFTA 5L8KB 5AZEH 1FZJA 1GIGL 5C0RH 1G7PB 1IC5L 4XCYA 1NEZB 3QEQE 1Z6JT 4LPYA 3MOAL 5HHPA 2V5YA 3GIVB 3KPMB 5ALCL 1OVZA 1WTLA 2B4CL 2BJMH 4KFZC 3BE1H 2NXYC 1FO0L 3HZKA 5EC1A 1A7QL 3K2UL 4AIZB 3SDAC 4L4VE 1CD0A 4PJEE 3KXFA 4PY7A 2VDOL 5I74B 1U92A 4RBPK 1R5IA 3QUYD 4XP4H 5IW1B 3ZDZF 2CRZA 1KTLB 1BVKB 3WJLC 4FQ2L 1G7IB 2VXQL 1OM3L 1V7MH 5DMGC 4HS3B 4LSTL 5FYJL 3ULVE 5I1IL 4KI5F 1QSVA 3T4YA 1UH2A 3WFEL 4HX1B 4NZTL 3GSOB 1AD0B 4XMKL 3UX9B 1NUFA 4YXHL 2PW2A 2J8OA 4PB0H 2PYFA 3GSRA 3MRRA 3NTCH 1MJ7H 3OKKB 4ESKA 4F8TA 2NY6D 3LSOA 1E6JH 1OSZA 2QJDA 2EDTA 5E6YA 1EEYA 3PXJA 1HH9A 1CXLA 1K2DA 3TPUA 2CDFB 2EDBA 5FB8B 3IDJB 3PDDA 1N2RB 2OQJA 2NQCA 2DDQH 4CVZA 1BBDH 2W1NA 5I17B 1KC5L 2H9GB 1P4LB 5B3JE 1V7NH 2XQYK 3QDAA 1IEHA 5DK0B 2JJTA 3KJ4B 3KWWB 1FL5B 2XZQL 3GMMB 4FHBD 1X9QA 2QSTA 1MUJA 2JCCA 4YPJA 3ARBD 4K3EL 1U6AH 1JGEA 3AM8A 3FZUC 4MA8L 1T7WA 2BNQA 2O5YH 5CUSH 4BSWA 2W0KA 1KJ2H 1DQJA 2VLJE 3MJ9L 4F7MA 3V7MA 1ZANL 3E6HA 2Z91A 1ZOXA 3HZKB 5EC1B 4J2XA 4JDVA 2EKSA 1B0GA 3RVXD 1TQBC 4D9LH 1T6VN 3KXFB 4PY7B 1U92B 1ED3A 4XI5D 4YLQT 3WSQL 4TN9A 4JFZL 3F5WB 4ODXA 1ZS8B 2F53E 2C3XA 1BQUA 1ETZA 4M43L 2EZ0D 4UDUA 3T4YB 3QDJD 1ZLWK 3ZKMD 2W0LA 5EBLA 4FQCL 5JW3L 5JMOC 2PW2B 3BIAX 2GIYA 3MRRB 1JPFA 1YMMA 4OLUL 4NQXA 1I9IL 4YHNA 4LQ1A 3QUYC 3R8BB 3LSOB 2BY0A 3TO4A 5JXED 3MRLA 5D5MA 1UH4A 4MNQD 4PJ8A 1QTYT 3VDCA 4QHKI 4XPAL 4AEIL 2Z31C 1K2DB 3TPUB 3CMOH 3BESR 3N9GL 2VLKD 3VXSA 1KLFA 2QHRL 4CRPA 4IRJD 4CVZB 1NCNA 1H8SA 2NY6C 2RCSL 3P0VL 3U9UA 2FNBA 5B38A 1CLYH 2I9TA 2XN9A 1T1XA 2JCCB 3RGVA 1UG9A 2X4SA 3THML 5AZEL 5C0GA 2YUZA 1UB5A 5C0RL 4UNVA 3RY6A 1XGQA 3QAZC 5FF6A 4F7MB 1MI5A 2YOCA 4O2EA 4POZD 2NY4C 1U3HA 4JDVB 3O3DA 2BJML 3C6LC 2YD6A 4G8GE 4U1MA 1KB5A 4M8VA 1ED3B 3CPLA 4NWTH 5BV7B 4HUKB 3IRPX 4ODXB 3HE6C 2XV6B 4PJIB 4XP4L 3OGOE 4RZCB 1ETZB 2NZIA 2FHFA 2NY5C 1V7ML 2VN7A 4UDUB 1X5GA 2AV1B 4JO4H 3IFLH 3VD5A 5EBLB 1MIEL 3HZVA 3C5JA 1YMMB 3D39D 3MXVH 4PB0L 1T04B 1MJ7L 1U8JB 4YHNB 1SMOA 2JB5L 1F42A 4XAWH 3WUWA 5D5MB 3UTSA 4PJ8B 5C0AE 4LLQA 3GHBH 2PXYA 2R29H 1E6JL 4HKXA 3NZ8A 5ICZA 3P9MB 4LEXH 4XTRD 4UB0H 4QRPE 3ZKMC 3K81A 4F7CB 1MJUH 2ZUQB 3VXSB 5HYQB 5F6HI 2X05A 5B38B 5C0BE 2I9TB 2XN9B 1T1XB 5EBMA 4G6FB 4X6EB 2XZAH 1EVTC 2WNGA 3RGVB 3KG5A 5JXEC 3HAEA 4IMKA 4E41D 2X4SB 5DRXA 5E08H 1U6AL 5C0GB 1UB5B 1XGYH 1XGQB 1SHMA 3QUXD 2O5YL 5IMKA 4LLDA 25C8H 2YD9A 4JFYB 4JHZA 5FF6B 4NO2A 1U3HB 3O3DB 5C08D 4OLYH 4IRJC 2DL9A 3EJYC 4EN3A 1FHGA 5EUOF 4U1MB 1RD6A 2Y72A 2X1XR 4D9LL 3CPLB 4B7LA 4HKBA 5HDQL 5I1HL 3WNOA 3EGSB 2IF7A 3IFPA 2ID5A 4HJGB 2X09A 3GJFK 2GK0A 3MRCA 1K3IA 5E5RB 4POZC 1M7DA 3HZVB 3C5JB 1MPAL 4U49A 2GCYA 4BH8B 2VZTA 1ZXQA 3H6JA 5D7IF 4KZDH 3ESUF 1EZVX 1CTOA 5JIIA 3CK0H 4OCMC 3WUWB 2PXYB 2PETA 4WO4A 8CGTA 3LDBB 4P23D 4QXGH 3BRGC 1FVDA 2XWBA 4UOW0 2P5ED 2VJXA 2A73A 5GS0H 5HHVL 1F58H 2OXHA 3EOBA 2Q86A 3MV9D 4HC1H 4JN1H 5CJXC 4G9FD 2G5BA 1JTOA 1M4KA 2GFBA 2XACC 4NOBA 5T3ZD 3IAGC 4YUEH 5IGXH 4U1GB 4RX4A 1CLYL 2H32A 4JKLA 4HWEH 1GCFA 3LKQB 4Y16D 1NGXB 2EH7L 5CGYD 1PAMA 1TNNA 3B8SA 5MI0B 2Z4QA 4KVNH 5JZ7D 4ORGB 1IEAB 4G8EA 4XTRC 3O2VH 2D0GA 5I1JH 4PJXF 4NO2B 1F4AA 4YK4C 5SV3A 2CDEB 3JV6B 1T1ZA 3VWKD 4ODHH 1HSBA 4XX1G 5I8KH 4Z8FH 3H7LA 4NWTL 2ZUSA 3MRFA 1QFUL 1FAIH 5J1TC 1QHPA 3LY6A 3OJVC 4WGWB 5T33H 2W07A 4QCIB 4GAGH 4NC1E 4XXCC 4HXBH 3NIDE 3MRCB 5JQHC 3IJHB 3PWLB 4JO4L 3IFLL 3STBA 2IPTH 4NPYB 4IRSA 3OF6D 4MQTB 2NZ9C 2GCYB 3KDMB 4WI2A 5SX4H 2FEEI 4R4BA 3B5TA 4J1UA 5FDYA 3RUGB 1WWCA 4WUUE 4PJ5D 4XAWL 4WO4B 3DVNB 3GHBL 1P84J 1FVDB 2R29L 3VXPB 2XWBB 3C8KA 4P3DB 2A73B 4JN2A 4MAUH 3EOBB 4LEXL 5E9DD 2K3TA 2Q86B 4UB0L 3BGFC 4GKOA 4EDWH 1MJUL 4KJWD 2G5BB 5B22A 2KBGA 4J12A 1W2KT 1QPPA 3QZWB 2GHWB 1OP3K 4UOJA 2H32B 2J8UE 3PUCA 2XZAL 3NACH 3QCVH 4NQTA 3FFCA 4BFGA 5GRZA 2Z4QB 2NYYD 5AYQA 1MAMH 3E3QE 4HV8A 4M7ZC 3VRJB 1XGYL 1A7NH 3D69B 3PXHA 1LO0L 25C8L 4F7EA 4NO0D 4GMTH 5EN2A 3OTTA 3QIBD 1T1ZB 2VO5A 3SGKC 2E7LA 2WUCH 4OLYL 5JO5A 1HSBB 3QDHA 4CMMA 3UROR 4LMQE 4Y4KC 4M03A 1RQ5A 1KENH 3GJFA 5CJ8A 2JJSA 1OQOA 3MRFB 5D2NE 3D25A 1Y18A 3S3SA 5CGYC 2NY0D 3PGFH 1F3DH 2HJFA 5EOTA 4TVPL 5DEGA 1JZ8A 3T04D 5F1SA 1HWHB 2YPVH 4NP4H 4IRSB 4RRPG 5IESH 5FK9A 1YYMH 4R2GD 1U8KA 4LIQE 4ZPTA 1VPOH 1U3ZA 3VD7A 4S2SA 2XOTA 4XNUH 3KXFE 2YPLD 2DS4A 2W60B 5J56B 1I1AD 1YC8A 1U0QA 4L9DA 3DXAD 5FO7B 4KZDL 3GMLA 3C8KB 4HMDA 2RIKA 4QXGL 4JN2B 2R9HD 1I85A 1QFWH 2ZZUT 3K4AA 4WFGD 5GS0L 4AYFA 5AWNH 1F58L 3BZ4A 5HVWA 3D85D 4QOKD 4MB4A 4HC1L 4JN1L 4HFUH 2XZCH 2P42B 1EMTL 4YUEL 4WV1A 5IGXL 1ZEAL 3FN9A 3U1SH 2ZUTA 3TH3T 1MQKH 4HWEL 3FFCB 4O4YL 2AGJH 5DJ0A 5I18H 5I9QC 2VDPH 3EO1A 4HV8B 3O11B 3SDDD 4FTVA 1F11A 4KVNL 1WAAF 3QJFA 4YR6B 1U8IA 2FIRT 3RL2A 2EKJA 4TULH 3O2VL 1DVFD 5I1JL 4KJWC 3BUYA 5JO5B 2C1OB 2J88H 4CU6A 4ODHL 1C5DA 1J8HA 4U4BA 5I8KL 2XA3A 3REVA 3GJFB 1NLDH 4LLWB 4Z8FL 3FRPG 5F44A 2A77H 3AMLA 5TFSH 3D25B 2JCCE 1LEGA 4C59B 1Y18B 4XCNA 1FAIL 4S1RH 3T1FA 4OQTL 5B4MD 5T33L 2HJFB 5EOTB 2BNQE 4FQHB 3FOLB 3P4MA 4HXBL 1G6RA 1LEKA 3RWDB 1IAMA 1WCBA 3FJTA 4FABH 1MREH 3KPOA 3QIBC 5FK9B 2IPTL 1A0QH 2ITCA 3AMKA 1J1XH 1R3LA 1CXEA 1MHPH 1IVLA 4ZPTB 4GBXD 1FVEA 5ECJE 4ONHA 3MRMA 1EJOH 3U4BH 5BW7A 4WW2A 3WXWH 4K8RH 3LIZH 4IOSD 2VR9A 2Z92A 5FUZH 3G08A 3GMLB 4RFNC 3TO2B 4YHYB 1VEPA 4ZTPH 4MAUL 3WDIA 1U8LA 4FOMA 3TN0C 4EDWL 3TJEL 1OPGH 3AC0A 3IS0X 4QEGA 3QDGD 2J6EH 1YMME 4XMPH 4WV1B 1MFBH 4X4XA 3GFUA 5DT1H 4OGXH 5KJRH 4MJID 1YY8A 4H88L 5DJ0B 1BQHG 1KIPA 3QCVL 5D5ME 1CICA 1F11B 4FTVB 1MAML 3QJFB 2HVJA 5DC4B 1KACB 2XY2A 4L3CA 1U8IB 5M7QA 3T0VA 1N64L 3GBNH 3BZEA 4MHHI 5JR1L 4GMTL 3OXSA 1T0MA 3VXSE 5JDSB 1SJHA 4F9LA 5T1DH 3PWNA 5KAQG 2WUCL 2UY6A 1C5DB 1FNFA 3PIQA 4KY1H 1J8HB 3H42H 4WHCA 5HVHB 5DJYA 4ACPA 3REVB 3NA9H 4ODVL 1T7ZA 2XN9E 1EX0A 1KENL 4QXUH 4XCNB 3WS6A 3T1FB 1VFAB 4F37F 4YEFA 4KKAD 2C4FT 5IKCA 3SDDC 5E95B 2PO6B 3PGFL 4MXVF 3RJDA 4PRBA 1UVQA 3IDMA 5BS0D 3P4MB 1G6RB 1GOHA 2QQLL 1DVFC 1WCBB 2NCMA 2YPVL 3CXHK 3KPOB 2P5WA 3CVIH 1MI5E 4NP4L 1MFCH 3BZFA 5IESL 1R3LB 4J4PC 1YYML 5BMFH 2VR5A 2JK5A 4H0HB 3T0EE 4XNUL 4WW2B 1LO3H 1EH9A 3S97C 1C7SA 3ZYIA 2Z92B 4Q74A 4HG4K 4ZFOA 5E1HB 2EIDA 4JFDB 1N0LA 3GI8H 5I1LB 1QFWL 3S35H 3KLDA 1U8LB 5AWNL 1MHCA 1S9WA 1NAMA 1D7FA 2BOBA 5HXMA 1A5FH 5D93B 1D9KA 3QCUH 5CMAA 1C1EH 4GXUN 3GSNH 3CIQA 4UT9L 3O4LD 4U6VH 3U1SL 3TA3A 4P2YA 1B2WH 1MQKL 1YY8B 1KIPB 3FQWA 3UTSE 1RZGB 1JGLH 5I18L 1FNAA 1CICB 2AGJL 3C8HA 4MQSB 2VDPL 4XZUB 1MCCA 1PKOA 3EJJX 1WZ1H 4L4TA 1W0WA 5K9KA 3BZEB 4TULL 4MGXA 3OXSB 1SJHB 2FO4A 1TIUA 3PIQB 2J88L 3UAJC 5E8DH 3WLBA 3D0VB 2FBOJ 1UH3A 5TFSL 4DUVA 3REWB 4GRLC 4S1RL 3NIGF 3CCHA 2V17H 4PRBB 1UVQB 5FHBH 1GAFH 3LS5H 1MCRA 1UZ8A 3PNWA 2P5WB 3D6GA 2FX8H 3BZFB 1MREL 1D5BB 4FABL 1A0QL 2E6JA 4ODSL 1J1XL 1MHPL 2AABH 3ARGA 4JVWA 4BK5A 2JK5B 2VXUL 1RIHH 2F5AH 2WBWB 1PJ9A 1TMCB 1K4CB 4IDJH 15C8L 3QWOA 1RJYA 5IWLA 3WXWL 1S7SB 1BD2B 4K8RL 3QIUC 3L3IB 1K4DA 3LIZL 2HFGH 5C3TA 4ZFOB 5HHMB 5FUZL 3BPNB 5E24E 1KIRA 1CFVH 4PLKC 4Q0XH 4XHJD 1O5DT 2WWKT 4TUJB 1MHCB 1S9WB 2VC2L 1PZUB 4W6WB 4P2RD 3BWUC 4RWYH 1OPGL 4QHLB 1CVSC 1XIWD 4RFOH 3UTQA 5CMAB 3TCLB 2J6EL 4XMPL 3HLAA 3L3KA 2WQRA 3E2HB 3SJVA 3EDJA 4PTUA 1MFBL 4M6AA 3TA3B 4OGXL 4F57H 3FQWB 5KJRL 3V6BR 4HIIA 2A74B 2R4SH 4RGNC 1A1NA 5KVDH 4L4TB 1MCHA 1OSPH 1W0WB 4RSVA 3MX0A 3QI9D 1ZA3B 3JSSA 4N68A 4DKEH 3GBNL 1OAQH 5CCKH 4FZEH 5D2LF 2FJHB 4HKZB 4R90L 4PPTA 1ZKAA 2NMSA 3B6SB 5T1DL 1GH7A 3LRSB 4KY1L 3H42L 4OLXH 3SBWA 1MWAA 3NA9L 2HTLD 3B43A 1X5YA 5GSRA 4QXUL 4N0RA 1FP5A 1SJVA 3WHE0 2VLME 3BPOB 3MNVA 3OR7A 3L3JA 4EDXB 4BFIA 1UZ8B 3PNWB 2YMXH 2OCFD 3CVIL 5GJTL 4P59H 4LSSL 3ES6A 1FNLA 3ARGB 4MA1B 3MLRH 5TF1H 1RJYB 1ORQA 5GGTH 4XBEL 5GHWH 1LO3L 2FR4A 3U36A 1QR4A 4QRUB 4Y5VC 5KS9B 3T2NL 3UDWA 1RJZB 5IB4A 4KXZH 1KIRB 4JPVL 1CDGA 4UT6H 5IOPB 5FYLE 3GI8L 3W82A 4QRRB 4RMUA 3S35L 3P4OA 2OL3A 4K07A 1A5FL 2ZPKH 3LEVH 3GSQA 1PW3A 3MYJB 1FBIH 3L3KB 5CGMA 3GSNL 5HHOD 3SJVB 5EZLA 4PTUB 1HSAA 5H35A 3VI3F 4U6VL 4YFLF 1B2WL 1O7SA 4HIIB 1ZLVK 3DGGA 4NN7C 1HHKB 4JKWA 1A1NB 4FXLA 5J11B 5C3LD 2WWMD 4ZFFB 4GQ9H 1WZ1L 4XHJC 5J1SC 2XTJE 1YQVL 4M6ML 3TIEA 2DKSA 1XIWC 2Q3ZA 5DD6A 2CRMA 1I9JH 4KK6C 1MWAB 3CFCL 1CDYA 2NY1C 5E8DL 4NUGH 1NCUA 2HLFD 2OBGA 3D9AH 3DLQR 3FFCE 5HVFB 3IU4L 1K5NA 4E0RA 2GJ6A 3OR7B 3MNVB 4XNZC 5IW6A 2V17L 5FYJD 5FHBL 1GAFL 5JHLH 3LS5L 1WICA 5IHZB 4WHTA 3FB5A 5JIKA 4OCYH 3ULVH 4NQVA 1TFHA 3IF1A 3Q6GH 2HN7B 1X5FA 1ZHNA 4BSJA 4KI5D 4K94H 1ORQB 2Z0BA 1RIHL 2HTLC 4L3EA 3O2DH 2FR4B 3U36B 4JPKH 4WFEE 4X6DB 3SE9L 4JGJA 4TTDC 1EJ6A 2HFGL 4P5TA 2DKUA 3LN4A 1TITA 1CFVL 4Q0XL 2C3GA 1HHGA 4I4WB 2F58H 3KYNA 3GSXA 4RWYL 2UUDH 4RFOL 3UTTA 2GYSA 2IAND 2QSCH 1HSAB 4JZNA 5DUMH 4HWBA 2H26A 5D1XC 1TJHH 3ARED 2BRQA 3V9FA 3HC4H 3BI9X 1FLRH 2PCPA 2R4SL 2WMPA 3AVEA 5IUSA 1S5HA 5KVDL 3DI2B 5JOFA 3V6FB 1J9CT 2HLAA 4X4ZA 1UB6A 3PP4L 1A2YB 2V9RA 4DKEL 1OAQL 5CCKL 3FN3A 4FZEL 3EYSH 3BO8A 2FH8A 3G5YB 2DQHH 5DD6B 4Y4FB 4D0CA 1ERNA 3F7QA 1GVIA 4OLXL 1VCAA 4KDTC 3WUZA 1H0DB 3ESVF 1I8IA 4P2OC 3U4AA 4RNRA 4JM2F 3TYGH 1HNGA 4E0RB 1T6WA 4AG4H 5IW6B 4FTVE 1YZZA 5LXGL 1KBGH 2XKSA 5I8EA 2XXCB 3GDBA 4HXAH 3FB5B 4WHTB 2YMXL 2MPAL 1OF2A 3BT2H 3A6CL 3MUGB 3IF1B 2G60L 3UPCA 1ZHNB 4P59L 1Z0MA 4DCQB 4OZGA 3DMMD 3VFSA 1J8HE 3MLRL 3L7EA 3WCYA 5C0IB 2KKQA 4Y1AA 3MZTA 5GHWL 2DIAA 1GZQA 5CP3A 5FGRA 4F15C 1QLRA 3LN4B 1G0DA 2BVQA 3QUZD 3WFHB 3ZTJG 3SQOH 4OGYL 4UT6L 1ZLUK 4HZLA 3KYNB 5I30H 4GFTB 3GSXB 4KJPD 4BZ1H 2FDBP 3RAJH 2ZPKL 3LEVL 4ERSH 1FBIL 4JZNB 2EEAA 2DN7A 1NFDB 2AJXH 2P46B 2ZCLL 3SKUD 5FEBA 4NJ9H 1S5HB 4WFFE 5JOFB 1XEDA 3ARPA 4GQ9L 1UB6B 2C9AA 5J12B 4G9DB 5KZCB 4PJEF 1I9JL 1FVCA 5KSAA 1BBJA 4RNRB 5E8NA 1AXIB 3OKDB 3AREC 4NUGL 3D9AL 3CH8A 1XT5A 5DC9B 5KVFH 1J88A 1W72H 2BVTA 1S7TA 2ZG3A 5DXWA 1QSED 5I8EB 3DVIA 3WD5H 3ULVF 4ZXBA 3VFTB 5JHLL 4H26B 4JLRA 5GRWA 3I9GL 1OF2B 1MCNA 2M1KA 2DM7A 3MR9A 4OBSA 4OCYL 1I3RA 3QIWC 3KLHC 5E6ID 4JGUA 3Q6GL 4OZGB 1OP5H 3VFSB 2FX9H 4K94L 5HY9B 4Y1AB 4FG6C 1XGTA 2CD0A 3WHXA 1JF5A 4N8CL 4JFHD 1GZQB 3O2DL 2DQEH 2WV3A 4JPKL 2IALA 1NGPH 1TZIA 2OXGA 5DVNA 1A7PH 2BVQB 4ZO8A 1JPGB 4OCXH 2BMKB 4WU5A 5HHXH 4JFFA 3IXAA 1Q8MA 2P5WE 1FG2B 4HZLB 4PRHA 4L8SB 4X6BA 3HE7D 3I6LE 4OFVA 3W2DH 1FGNH 3ZE2E 5B3JF 4EOWH 2QSCL 1E0OB 4ZO9A 2BHUA 5FGBC 5IF0A 3UO1H 1S7RA 2DLIA 3HAEG 5E5UB 4YBHA 1LK2A 5HHME 3TT1H 1FLRL 1LE5A 5FYJU 3S36H 3VWJA 4ORZC 5TGBA 3SOBH 3O9WB 4X6FB 3EYSL 4FQXA 3UTPE 2L7JA 1AR2A 2DQHL 5FO9A 1Q9LA 4BELD 1FYTA 2NY3C 5SWSB 2YR3A 4YDVA 5KSAB 4YGVB 4LVOB 4NGHH 2VIRA 4NHCH 5JIHA 3RKDC 4H0GA 2ATPA 5IBUB 1DSFL 1HYSC 3L3OA 4AG4L 5F96L 2RAMA 4C55A 4L4TE 3RWJA 4F9PA 3P77B 4ZXBB 1CGSH 5L88H 1KBGL 2F74A 4G8IA 4NCC2 2HT3C 1S3KH 2BC4A 2PYEA 3L7FA 3MR9B 1MJ8H 2NX5D 3BT2L 3W39B 3T0AA 3LKOA 3CVHH 2G2RB 1RHHA 1B0RA 4N0UA 4MWFA 1S7WB 1XGTB 4LSQH 3ARFD 3BJ91 4JRYD 1CGVA 4JFEA 2IALB 5MERA 3O45B 2DQCH 1JHKH 2OI9B 3ETBF 4YDKH 3GSUA 4WI7A 4WU5B 1HQ4A 4EXPX 1UACL 2NY2D 1BFOA 1AP2A 2G9HA 3ARDA 4JFFB 3IXAB 5HJ3B 4GW5A 3SQOL 4IJ3C 4WJ5A 4PRHB 3SKNB 4KKBC 3OZ9H 3BN3B 3QNZA 5I30L 5E6IC 5L8LB 4KDVA 4BZ1L 3NMEA 2FECL 5IB1A 3BKYH 4ERSL 1LNUB 5GQBA 5DK3A 5IF0B 3MO1A 4H8WC 1S7RB 2Y4SA 2AJXL 1IL1A 5HGGS 3RZCB 3LOWA 3BAEH 3LQMA 4TSAL 1LK2B 4NJ9L 5E2JA 3UZVB 3VWJB 1U8MA 3MRKA 5TGBB 4PD4K 3MRPB 3HA0A 3L3HA 4FQXB 3HE7C 3C5ZD 5FO9B 1Q9LB 3VU2A 1VA9A 3NFSH 4ISVB 3WFCH 3SJVE 3G6JA 1AGBB 1Z5LB 2ATPB 3CX2A 4N0YH 3W9DB 4OV5A 3QNYA 1UM4H 3H3BC 4HPYH 3RWJB 3X3GH 5I71C 2CKBH 2F74B 5T3XL 5LWYH 3WD5L 2BC4B 2PYEB 3L7FB 3NCMA 1JZ4A 2R2EA 3S96A 2GTWA 1NSNH 1RMFH 4OLZH 5KAQF 5JMRA 3HI6H 4JPWL 3C09C 2OP4L 2YRLA 5H94A 3LKOB 3QUKA 4YBQD 1WGOA 3AS1A 1RHHB 2AV7A 1PY9A 1B0RB 1J12A 2FX9L 1T66D 2VDRL 3QQ9C 2FWOB 4MDJA 4GRMA 4JFEB 5MERB 4I0PB 2DQEL 3VJ6B 1NGPL 4PBXA 4N0CD 4XPHH 2DJ4A 3V52H 4IOFC 2G9HB 2JJVA 3ARDB 4OCXL 2AQ3A 4WJ5B 2HFEB 3QNZB 3GK8L 3V8OA 4XP5H 3SE3C 4IHOA 1LEIA 1FGNL 1A22B 1WFOA 4EOWL 5AG8A 1IGJB 2A2QT 3KPRD 2I24N 3MO1B 4P4RA 1VFOA 3JWOH 4HT1H 3UO1L 1AIFA 2VABA 2WUBL 5I0DA 4HZAA 2ESVD 1ZT7A 5DMJB 4XRCA 3DX8A 3TT1L 3V5DA 3JWDH 2NY2C 3MRKB 3ZSSA 3S36L 1REIA 1UYWH 4R0LA 3SOBL 2MJWA 5F9OH 3BH8A 1GGCH 5ESQA 2HJKA 5GZND 2WM0A 2A6JA 5D72H 4OCWL 2GTZA 4LLUB 3T3ME 4JREC 3OPZH 4NGHL 4NHCL 3BDXA 3GBMH 4OV5B 2EC9U 3QNYB 4PP2A 1GGUA 5I0ZA 4PLOB 4ZODA 3QP3A 1P69B 1CGSL 3PJSA 5L88L 2F5BH 4JZJA 4CU8A 3S96B 1L9MA 5IM7A 2GTWB 4V1DB 1FO0A 3C5ZC 3QUKB 5H94B 2YUXA 4C56A 2AV7B 3TZVA 4BK4A 4XNYH 4PJBB 2LVCA 2ZUUA 3LMJH 4LSQL 3MLVL 4MDJB 3MGAA 5H2BA 1L0XA 2F8XC 2GJ6E 2EC9T 3V0VB 2GY5A 4YDKL 4MHHG 5GS0D 2JJWA 1IGFH 3BP6B 2Y36L 5FOJA 3OZ9L 1LEIB 5J3HD 1N5YH 1MAJA 3BKYL 1T66C 4P4RB 4L3EE 4UTAH 1AIFB 1G1YA 2VABB 2QADC 2OR7A 5AEAA 5T5NG 4XPGH 1T89C 4PJ7A 1B9ZA 1ZT7B 4N0CC 4XRCB 1ADQA 3DX8B 3MRGB 3V5DB 1L7TH 5KTEH 1V3LA 3VW3H 4I18B 2CR3A 3TM6A 1IM9A 3FAXA 5ITBH 3C60A 3PWUA 4R0LB 1DUYB 3QB7C 3BH8B 1WLHA 2HJKB 3ILQC 5EIIB 2E9BA 3UTTE 5KSVB 2A6JB 1KNOA 3NFSL 4DN3L 1NCCL 5ID0A 4I9WD 1JIBA 1T7YA 3MMEA 3WFCL 2I5YH 2VE6A 3U30B 4WEUD 3WS3B 3OGCA 5F7MC 3D3VD 4OIBA 4QHNA 1KEMH 4PP2B 2FL5A 2FYYA 5HYFA 5I66A 4EI6A 5D1ZA 1UM4L 3NIDF 2CKBL 1TXKA 5AYUH 4JZJB 5ID1A 5LWYL 3TF7C 1T4KA 2DB8A 1PVHA 4GRWE 4QF1B 4DAGL 1NSNL 1RMFL 1X44A 3HI6L 4C56B 4P0DA 3TZVB 3HZYB 3SGEH 4O2CA 1JRHH 1WWBX 4DTGL 1OOAA 3VFMA 3HNTH 2YPKA 4ZAKD 4LCWB 5H2BB 1SM3H 4N8PA 5EU6A 5BV7H 3DETD 4XP1H 5DC0A 4IRZH 2YKLL 2BERA 4XPHL 1ZWIB 5DD1L 4XB8A 3V52L 1N0XL 5D7KE 3IT8D 5FCUH 1LK3H 4K23H 5A16A 3WIFB 2P8LA 5FGCB 3JTTB 2M2DA 4CAGA 3D0LB 3U6RA 3KPSA 4LNVA 3I84A 4XP5L 3O41A 1LMKA 1NKOA 4OZGE 5DJCA 1ZAGA 2E7HA 2J8UF 2R2HA 4Y1AE 2EE9A 3ARVA 3JWOL 4HT1L 4PJHA 1VHPA 4PJ7B 1NGZA 2Z8SA 3Q3GA 4R6UA 4LPVA 3G9AB 4APQD 3JWDL 3PWUB 5F1OB 4OIIL 3SDAA 4MDIA 1KCSH 1UYWL 1IBGH 5DFWH 3ARUA 4IIQA 1GGCL 4PJ9D 5EBGA 4CVXA 5J3HC 4OM1L 1AGFA 2FJFA 5ID0B 3MMEB 4XNQA 5D72L 2VE6B 3WJLA 1YY9C 1T83A 3QHZH 3PWVA 2XKUA 4U33A 2ZWLT 4QHNB 3P0GB 3OPZL 2VH5H 4U6HA 3WO4B 2FL5B 3CNKA 3GBML 3H3PL 1G9NH 2VITA 4G42B 5D1ZB 3ULUE 2OR9H 2E6QA 5ISZA 1T4KB 4LDEB 3TBYA 4D2NA 2F5BL 3RU8H 4NYLA 2DTSA 5DWUH 1AFVH 1FL6A 5J57B 1TTUA 2PR4L 5CBAA 5ICYA 4FFZL 3GJEB 3M1BA 4PRPA 4O2CB 1I1YA 2YC1A 3ZE1E 3VFMB 2YPKB 3MRDA 3RZWA 1I4FB 3LMJL 2B5IB 5DHYA 1KB5H 2Y23A 2DQJH 4ZPVB 1FZKA 5EU6B 5E7FA 3CXHJ 3KYOA 3QRGH 5T1LD 4ZUUA 1A1MB 4R4ND 1UEYA 2FX7H 3CX5J 3ZMRA 2IAMD 5D7JD 4B41A 4Y8AA 5A16B 2P8LB 3RI5K 1D5IH 3UP1A 1IGFL 2HAZA 3U6RB 1MHHA 2JIXA 3KPSB 3O41B 2Y25A 4AH2B 5DJCB 1N5YL 1EO7A 1ZGLP 2R2HB 1SJXA 3RDTC 1Q9WA 1TVHA 5AZ2H 1RIUL 1PZ5A 1DQMH 1NGZB 2GW5A 4ZUTA 3DETC 4XPGL 3HMWL 3Q3GB 2NXYB 1PBYA 5KTEL 2JELH 3VW3L 3SDAB 4MDIB 5ITBL 4JFFE 4I48A 4O2FA 4CVXB 2DYPA 1DQLL 2XICA 1AGFB 4GW4A 3PWVB 2YA1A 3CAFA 4M7KH 5E8OA 2JCCF 4Z7VA 4QGYA 1KEML 2VITB 2XWTA 2Y5EA 4K7PH 3WO3B 5C07D 3LHPH 1WC7A 2Y5TA 3GMOA 3HAEH 3H3KA 2YK1H 3HPJB 2EDWA 4YO0A 5DVOA 5TH2A 3W0WD 4F3FA 2BVEA 3S37H 5BQ7A 4QNPE 5ICYB 2CSPA 4AENB 3M1BB 4PRPB 5DFTA 1UKTA 1FYTE 2P8MB 1JRHL 1CG9A 1GL4B 3MRDB 5DHYB 4LHUB 2Z31A 5C09A 1FZKB 2D4DA 3PWJB 1MHEA 4DWHA 1SM3L 1KJVA 1R5VA 1ZLWH 4IRZL 4ZUUB 1FFRA 3LV3A 2R0KH 1WV7T 2PYEE 4HH8A 1MHHB 2JIXB 3CFJA 3ZLQC 4U6XA 4ETYA 3VRLE 3VG9C 5MI0C 4WWKC 1JWMA 4N0UE 2FJGA 4Q2ZB 1Q9WB 1VENA 2VYRE 5IHLB 1PZ5B 4JFEE 3LEYH 1V5JA 5D5MF 4ZUTB 2VXVL 5I8OL 1RULH 1ORSA 4LCYA 3GMQA 2DLEA 1F02I 2GSIA 1UWXH 1RZFL 3K1KC 3C6LA 4P4KD 5L6YH 4P9HH 4BQCA 2IAMC 1TQBB 4R7DA 5D7JC 5LAXA 3SKMA 3H8NA 4WRLA 1KCSL 1IBGL 4JQXC 2DYPB 4BUGA 3BEVA 3HE6A 4BUHA 4GW4B 2DJUA 2XWJA 4FQ1L 1X5ZA 4O9HH 1U8HA 1ZVSA 3ABZA 4WUKH 1QEWA 1K8DB 5I8CA 1A6AA 1JHLL 2XWTB 2VH5L 2E7BA 3DO7B 2H32H 1G9NL 4WVRA 1JBJA 2Y5TB 1P4IL 3GMOB 2ZOKB 4MCYB 4OF6A 2OR9L 4YO0B 4ZSOA 3VH8A 1QSFA 4OCSH 3IJYA 2HH0H 1FSKB 3RU8L 4D8PA 4U7SA 5DWUL 4PJCB 3S3JA 2VWEC 1QSZA 1A21A 3QUYB 3RTQA 4P9HC 4GG8B 3PHQA 5DA4A 1XF4A 2PW1A 2VXTH 3G6JE 5D8JH 2Z31B 2MCPH 1MHEB 3QFDB 1DBAH 4M1DH 2DQJL 1KJVB 2P24B 1R5VB 3QT2A 4MLIA 5AG9A 1CK0L 3QRGL 3LV3B 5F1NA 4KK9D 4S10A 2FX7L 4AIXA 4O51B 3VGEA 4X9HA 2NY6B 2YRPA 2X7LA 1D5IL 3CFJB 5FYLH 2X5PA 5JXEA 5IB3B 3VE0A 2BSRB 2FJGB 1XR9B 3K0WA 4Y2DD 3VXNB 1ND0A 5L0QB 4HKJB 5MEPB 3HCVB 3D1MC 1JN6A 3QAZB 4EBQH 4F7TA 1ORSB 4M1CD 1DQML 3GMQB 1RUKH 3F6IA 4PTTB 2GSIB 2NY4B 1FE8H 1DDHA 1ZHLA 3C6LB 4R7DB 5LAXB 1NC4D 3T2OA 3SKMB 2JELL 1FAKT 2OTPA 5EH1A 3STLA 1CFQA 5HGAA 3QH3A 5JHDE 3MCKA 4DGVH 3BEVB 5FKPA 3ARBB 3HE6B 2XWJB 1U8HB 1RK1A 1QRNA 1QEWB 4M7KL 4UAOC 3F62A 4JRWA 4E9LA 5FECB 3QHTC 4K3GA 4K7PL 4KI1A 4ZFZA 5B8CC 1DUZA 3LHPL 3T1WA 1CGWA 4ZSOB 3VH8B 1YNKH 5F7DB 1QSFB 2YK1L 3IJYB 3CZFB 3NABH 4JDTH 3S37L 2XFXA 4PJGB 3EDFA 3BKJH 3PHQB 2PW1B 2V2XA 3EYUL 4LVHC 2H3NB 4M6NH 3MUJA 3H9SD 1F00I 4GS7C 5IVXA 3PGCB 3GJFH 2IPUG 5F1NB 3D39A 5GS3A 2R0KL 1V3KA 4LNRA 1X4YA 5JIPA 2X4OA 5KVEL 4Z7OE 4NQCD 3W11D 1OW0C 4C56E 2YD8A 4MNQB 4CADB 5GZOC 4EI5D 1ND0B 5C86A 2I07A 4Y5YC 1JN6B 5DD3H 4F7TB 3ZZ1A 3LEYL 3EFFA 2VLKB 3TBSA 4R4FH 1JK8A 1RULL 4DOHB 1KCRH 2NNAA 4IRJB 1N59A 4CL7A 5C0FA 3SKJL 5L6YL 4P9HL 1FIGH 3O6KH 4YWGH 1CLZH 3ORJA 3STLB 2NLJB 4CDGC 5HGAB 3QH3B 2YD3A 5FKPB 3RGHA 4P48A 1A6UH 4MXQC 1UM6H 2W59A 1QRNB 4Y2DC 4OCRH 1TTFA 4O9HL 4WUKL 4XXCA 5JW4M 5H8DA 4KKCD 2QKIA 3W9EB 4EXKA 4PJ7E 4ZFZB 1DUZB 2MKWA 1RSFA 4ZYKA 5E8EA 4JM2D 4Q58C 4CNIA 1AO7D 1U42A 4OCSL 4OT1H 2XFXB 5IIEA 3RBSA 1XH3B 2XRAL 3W81A 4Y7MA 5IMOA 1S9KC 2V2XB 3BD3A 3BPLB 4UDTA 3EDEA 4YDLC 5GRVK 4Z78A 2V5TA 1G1CA 1F6AB 5D8JL 4A2MA 5IR1A 3ALXA 4A2LA 1DN0A 1BMGA 4OZHA 1EA9C 5IVXB 3QRFM 1G0YR 4M1DL 4RCAA 3LAFA 4OQTA 2ILLA 3D39B 3PDOA 1ZVHA 4HIXH 5C0EA 1L0YA 1F8TH 2X4OB 4KTDH 1G6RH 4D94A 5FYLL 5C0NC 4Z7NF 5FOBA 5ACLA 4TNWK 3FB7B 2I07B 1E27B 4WFHD 3R06A 4HGWA 5CSBA 4WENB 5EU6E 4EBQL 3TBSB 3B5HA 4YK4B 5DJ8A 4S1SH 1RUKL 1N59B 5D1QD 4UV4H 3SGKA 4YQXL 3ULSB 3RVTC 1A9BA 1PLGH 1SBSH 1Y0LA 3N1GC 4Y4KA 4ZS6D 4C54A 3QEQD 2H8PA 1YN7A 2BY3A 2Q76B 3KPSE 4DGVL 3MRHA 1WFNA 3QWRD 4EI5C 2PO6C 3CFBA 2IJ0C 3RWEA 2QKIB 1A4JA 4PJHE 2D7OA 2XNAA 4KKLD 3S35X 4ZYKB 5E8EB 2CO6B 1N7ML 5D7LA 1D5XA 2R23A 1YEGH 3VXUA 3BDBA 5IMOB 3ULVD 3OKEA 4HK0A 3TVMD 3BKJL 5IBTH 1A3RH 4N0FB 5CEZH 2MQ3A 5IR1B 4M6NL 1H3PH 4ZO7A 4OZHB 3WJJC 2O5ZH 4UBDC 4OI9A 4Z18A 3C9NA 4LRIC 1TCRB 3FFDB 4HJ0C 5D93C 1HK6A 1U8PB 3PDOB 3QPXH 5ISZE 5C0EB 2X4TB 1BIHA 3HI5H 4LCUA 1HDMA 3BIKB 2ED7A 4PRPE 2J3SA 4P23B 3ZYJA 1RZ8B 2Q20A 4M7ZB 3R06B 4LSDA 3QO0A 1DQQB 3L95B 5DJ8B 5DUPH 3G04A 3MV9B 4R4FL 1KLGB 2WINB 5FO8A 3PDGA 1KCRL 1EK3A 3TCXA 4G9FB 2A1WL 1D5MA 4UNUA 4DN4L 1FIGL 3GM8A 1W0VA 4YWGL 4Y4KB 1AGEB 1CLZL 3UPRA 1KXVC 4BQBA 3GUTB 5DVKA 2VLJD 3MRHB 4Y16B 5LVEA 1A6UL 5ADPH 1NAMH 1EXUA 1UM6L 2VRAA 2W91A 4U0RC 2APBA 1NCDH 3FT3A 3DECA 4OCRL 3MV8A 3CFDB 3CFBB 1BLNB 2VLRA 5SX4I 4XHQA 3RWEB 2XNAB 2C3HA 5FUOH 3QIBA 5D1QC 2VAAA 5J0BA 2F53D 1M1SA 2DQGL 1D5XB 2R23B 3PV7A 4JRXA 3VXUB 1NDGA 4OT1L 4NRZA 2AVGA 3V0WH 4HK0B 3RVWC 4K7FA 4J3UA 5A2JH 5KSBA 4Z7QE 1AKJA 1EEZA 4M93C 2V7HA 1RK0A 2NPLX 5DZNA 2XT1B 4P57B 4OI7A 2ICWA 3F7PC 1LDPH 4Z7VE 4QTHB 2P1YA 3B2UC 2A9MH 4LPWA 1QRKA 3TN0A 3I2CH 3IFNL 4RMSA 2EE3A 4GXUM 1ZA6B 4HWUA 4LARL 1A14H 4HIXL 1F8TL 4JANA 1MRFH 3K80A 1HDMB 2EDHA 4ZUSA 1Q9OB 4KTDL 4L9LA 1G6RL 5KOVC 3T0WA 4PJ5B 5TJWK 5I9QB 1SJEA 3IDNB 4TTGA 4FFVD 1FZOA 4WW2F 2A6KA 4N9OB 5C09E 2FH6A 3G04B 1HOCA 5FO8B 1A7RH 4S1SL 3MV7A 4UV4L 3QO1A 5FXCH 2A0LD 3FQNB 3FO1A 1W0VB 3BYTA 3RWFA 3UPRB 2UY7A 1PLGL 2FIKA 2OS7A 4ETQA 3MNWA 2UZIH 3VGFA 4TSCH 5DYOA 1OTUD 4NZRH 2J6EA 1F3RB 3WIHA 4S0SD 1NGQH 3BPOC 3FT3B 3F7VA 3SDDA 3MV8B 4WWID 3MA9H 4G8GD 1JMXA 3HC3L 3B9KC 4QHUA 4NO0B 1DVFA 3QIBB 3BD5A 1H3VA 1EIBA 2VAAB 1C5CL 1YEKH 4LAJH 3HNVH 4J4PA 4YIQA 4JRXB 1NDGB 2PTUA 2HJLA 3PL6C 1JMZA 3LS4H 1YEGL 5AD0A 4LAQH 1N4XH 4PBWD 4K7FB 1QFWI 1R5WB 5DFVD 3HUJA 5KSBB 1AKJB 2MQ0A 1EEZB 2V7HB 2NY0B 1RK0B 2ADIA 4RFNB 5IBTL 1GOGA 2GAZA 1A3RL 3BFOA 4KWUA 4HK3J 5CEZL 2I9LB 2ICWB 1H3PL 1MWAH 4HWZB 1CIDA 3IFOB 2E7MA 1R3HA 5E94B 5HD8C 3QPXL 4TQEH 1AXTH 1C12B 1QSFE 1RJLA 5C0AD 2FB4L 4JANB 4DZBB 2YPLB 3G9VA 1WT5C 3DXAB 3HI5L 1I7UA 3WNMA 2FGZA 2WW8A 3ZE2F 3OAUH 4QRPD 5F88A 4LSRH 1XMWA 3RPIB 2NR6D 1FZOB 1BQLH 3CSGA 3A67H 3VGGA 4I13B 4TRPH 5C0BD 2B1AH 1HOCB 4KJQD 1DTUA 4ZTOH 3MV7B 3QO1B 4KROD 4KRLB 3FO1B 4ZFOL 3P4LA 2I25N 4PY8I 3LH2H 1CLOH 2NTFA 4I3RH 3RVVC 1NC2D 1EHNA 1LWRA 1T21A 4GRLA 3SDDB 3F7VB 1TVBA 1GYAA 5IQ7H 2QHLA 1X5IA 4QHUB 1DVFB 3O6FD 3MLTA 1U8QA 4QWWD 2DQUH 1EBPA 4YIQB 2A0LC 3CDYA 2HJLB 5IVOA 2F54A 3AU1A 1NCWL 1VDGA 1EGJH 3V0WL 3HUJB 3SY0B 2HP4A 3JUZA 5SWZA 1OTUC