5L9DH

Afamin antibody fragment, n14 fab, l1- glycosylated, crystal form i, parsimonious model
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
219
structure length
215
Chain Sequence
EVKLEESGPELVKPGASMKMSCKASGYTFTSYIIHWLKQKPGQGLEWIGYINPYNDGSKYNEKFKGKATLTSDKSSSTAYMELSSLASEDSAVYYCTRNYGSDSLDYWGQGTTLTVSSAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MOUSE ANTIBODY FAB FRAGMENT, IGG1-KAPPA HEAVY CHAIN
publication title The N14 anti-afamin antibody Fab: a rare VL1 CDR glycosylation, crystallographic re-sequencing, molecular plasticity and conservative versus enthusiastic modelling.
pubmed doi rcsb
total genus 42
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2016-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5l9dH02
3AM8A 5J12B 2R8SL 1KEGH 2DLFL 4FFWC 3Q6FA 5C09B 1NUFA 4MX7A 4OCSH 5FV2A 3VWKA 1HYSD 5L9DL 4L8CA 3GSUB 1UWXH 3IJSA 2Y9RT 1IC5L 3UMTA 4AENB 1WFUA 1XF1A 4PRPA 1U8QB 3RKPA 4W4OC 5L2KA 4HLJA 3MGOA 3N85L 1N59A 5GGTL 4LKXA 2IANA 4JQXA 1NGPL 1GZQA 2MCG1 4WHYH 1SEQH 4NKOB 3PWLA 4LCWD 5DC4B 5TDNB 3QPXL 5DSCB 2DF3A 4DZBB 2AV7B 3VFVB 1D9KD 3UTTE 3X14A 2QHRH 4BQ9A 2M8XA 2R0WH 3PXJA 3QI9A 5F93C 4YHYB 3MV7B 4YBQC 3V6FB 5CJQH 4C56D 2R1XB 1QNZH 2UVEA 1BM3H 1R5WA 3TN0B 1Z3GL 4QRRD 6CGTA 1FNLA 3G04B 1OP3K 2XA3A 1A1OB 5I9QC 1OW0C 5F6IC 4HG4J 1RAMA 3V4PH 4WTWA 2PN5A 1YEHL 1HOCB 3QO0A 2KKQA 2FATH 5T1KA 1NH6A 2ICES 4GW1B 1KIUA 3TT3L 1EBPA 4LSRL 4X6DB 5CZXD 5CCKL 2O5XH 2X4UB 4L8BA 5K9KB 4OBRA 3PIQB 5ERWA 1CGWA 4L4TB 3G6JF 4PLKD 5JLZA 1H8OA 3GHEL 2B5IC 4U6YB 3RZCA 2DDQL 4P3CH 1SJEB 5JORA 3MRGA 1QRND 2ZUYA 3ZDZF 4AM0B 3U83A 1U8IA 5BXFA 4H25B 3BPCA 1Q9OA 1AGCA 2ICWA 3DV6A 4R7DA 3RVXC 4NUGL 32C2B 2R2CA 4QWWD 5BRZD 4M7JL 1KB5B 5TH2A 3VXRD 4UIMA 2EE6A 3EO9H 2CK0H 3BEVA 4P9MH 1I1FB 4ZODA 3FRPG 3RWJB 4E42A 3LS4L 1NCWL 2BSRA 5D2LE 4LCCC 3RL1B 3IS1X 4N8CL 5DFWH 4PRAB 3LIZL 3HI1B 2X1PA 4GRLC 4OT1L 4MHHG 5HGDB 3VGBA 4Z9KB 5JPMA 4G80A 2OK0H 3HPLB 1V3KA 3GGWA 1R5IA 1E4KA 1NBZA 3GIZH 1X3DA 5AYUH 2VZVA 1TTUA 4U6HB 5BZDB 1MLCA 1CR9H 1RFDH 1I8MB 4XC1H 2W0FA 4APQC 4LCWE 4OV5B 2WBJB 1KIPB 1K6QL 5B38B 3D0VA 2RQ8A 1R3IL 1X5JA 5IESH 4D9RD 1I85C 4DOHB 3DETD 5FKPA 4TQEL 4N0UE 4HH8A 2YD4A 3TP4A 2IJ0C 2B39A 4H5SA 4XNMA 1IRAY 1G7IB 3MC0A 1JWMB 5H94A 5BJTA 1KFAH 4QHUB 1U95A 3L3KA 3MRCB 4HIEA 4JFFD 2NXYC 1JF1B 1I3GH 1LGVA 2R0LH 2XRAL 3RWGB 4C56E 5D1ZA 2JCCE 4HIJA 4ZS6C 5HI5C 1CK0L 2BY0A 4JY5H 2EKSB 2NY1B 2NW3A 5EN2A 1ITCA 2VZSA 2QKIA 3O4LB 4QRRE 3BISA 3QIWC 5E2TL 5H8DA 3K80A 5I0ZA 1AY1L 2YRLA 4WI9A 5ID1A 1WICA 3WSQL 3MLYL 4HUXA 5DLMH 1KGCD 5GGQL 4IOIA 3HE6D 2WP3T 3HUJF 1HQ4A 3W2DL 3DV4A 3JSSA 2HJLB 5KSBE 4KZEL 2F9BT 1I4FB 2ZSWB 5CAYB 3BRDA 3VI3E 1AGEB 3B8YA 5D1QC 2W59A 3EW3B 2BVPA 4HJJL 2W9EL 5HGBA 4BFIB 3VXTA 4OZFA 1T1WB 4XNXH 3FT3B 5D9SB 1A6UL 4PJHB 3IF1A 3OQ3B 4QCIB 4YO0A 3CVIH 3OZ9L 5CGYD 3NFPB 1QRNE 5JXEC 1J1OL 2J88L 5F7DB 4PJBE 4HGWB 4LIQE 1L6ZA 1D5BA 1S7UB 2HT2D 4E0RB 5D7JD 2VR5A 5I2IA 1PZ5B 1XH3B 3VXUA 4PJ7E 4M5YH 4EI5B 4IM8A 2Q8AL 3RY6A 3GMRA 5TQ0L 5A3ID 1XGYL 3T0EA 5BRZE 5HDBE 3E2HC 3BZEB 3T08A 3VXRE 1KJ2H 1CF8L 2BOCB 4Z7VF 1MFCH 5DK0A 1OY3B 3RKDD 3WJLC 1RHFA 3PL6B 1RMFH 1P5VA 5C0FA 5D2LB 2OP4H 1IGIH 1FO0B 5IGXL 1RUMH 4Z77B 2GSIA 5EFIB 1JGDB 1TVHB 1KB5L 2Q3ZA 1E6OL 3CLEH 1LEIB 3JWDL 1FGNL 4LCWB 4JB9L 4F57L 3T04D 4N0FA 3CDYA 1EFXA 4D9RE 3RVUC 4JFZH 4N0UB 3EYQC 4AY0A 2FCBA 4LAJH 3UTSA 2QHLA 3HMXL 3VD3A 3VDAA 5FCUL 3GMMB 4QY8B 1LNUB 1CLCA 4JFFE 1WT5C 5BQ7A 4CMMA 2JCCB 1KBGH 3LMJH 2Z31C 1AQKL 2B0SL 2BJMH 1U6AH 5HDOA 4MVBC 3NCJL 5IVXE 3B4NA 4U1GC 4XCNA 3LVEA 3IXTB 1KGCE 2PCPA 1JHKL 1OB1B 1QKZL 4XVSL 3GHBL 4ZQKB 4IRSA 3TJHD 3JTTA 1GSMA 1INEL 3FHAA 2XZZA 2VO5A 4QHMB 3SDDA 4LSDA 5ITFB 1ZEAL 2I07A 4J4PD 3UCRA 5D70H 3TC9A 3STZB 3DHJA 3RGVD 5E95B 3D85B 3L95B 1I1AA 1WF5A 4I0PC 4ALAL 1BF8A 1YJDC 2AERT 4XZUA 2LE9A 4WNQA 4XH2A 3QIUC 2M1KA 4YDLB 4PJBB 5F1NB 1ZMYA 4D0DB 3U30B 3RIFF 1A6AB 4Y2DA 3EO1B 5HDLA 2HT4C 3X13A 1DBJH 1BFOB 4PJ7B 1CN4A 5KAQG 3GMNA 2P42B 4HUVA 1KLUA 3QJHB 4NQCA 5IFHL 3VA6A 1IGMH 1CE1L 3B9EA 4CRPA 5HGGS 1ZTXH 1YUHA 1OAUL 2ITCB 4POYA 5I18H 2D03L 3JWDC 3U7WL 3R8BB 1BWWA 3DVGA 3EDDA 1VFAA 4I2XB 4PJ9A 3B9KA 3IJYA 4JZJA 5HYQA 3HN3A 4FHBD 5I15H 4NZTH 1FFNB 2VDPL 3CLFH 2YA0A 1DANT 3OJ2C 3WXVH 5KS9E 2ADGA 4LQFL 4LPYA 3OKEB 2R2HB 1FO0L 4KKNA 3WS6C 4X7TA 4CN4A 4N5UA 5IHUH 2RB8A 2X4PB 4JFFB 5DJ6A 4G43B 5JTWA 3L1OL 1XFPA 2JF1A 1B6UA 3IDIA 3G08B 2VAJA 4NJAL 4YHOH 2ESVD 4NYLB 5IVXB 4ODWA 3F12A 5JO5B 5FUOL 3LSOA 5B38G 2CUMA 3HE6B 1DQQB 3MJ9L 5TE6L 2DQCL 3DBXA 1TJIL 5J6HB 2APBA 5EO1A 1QVOA 2E9WA 4TUJB 4WCYL 4X8JB 2EE9A 4DVBA 2BSTA 2AK4B 2GTWB 4EIGB 2FR4A 2QSCL 2ERJB 1BFSA 1ED3A 4EVNB 4F3FA 3VW3L 5FGBA 3ULUD 3IKCB 5EU6B 3GMPA 1FL6B 3BW9B 5AG8A 3ARYA 4HGKC 3HE7A 4UB0H 2Y4SA 1YYMH 4HZLB 5B8CA 4NP4H 1YN6A 2QADD 2HLFD 4OLVL 2DTMH 4G8GD 4ODUA 4YEFA 2R1WA 3D3VA 43C9B 1S3KH 1HK6A 2Q6WA 2RR3A 2D9CA 5C7XL 3MR9B 2XA8L 1RZGA 4XWGL 1DVFD 4KDTC 1OLZA 4Q9CA 4FQIL 2FEEI 1HYSC 2W07A 2VDRH 1T7YA 2IMNA 1MCCA 3JV0A 1KIQB 1G7MA 1FV1B 2H3NB 1KSRA 4JHAH 3ULSA 1CTNA 2JLLA 3LKOB 1PDKA 3VRJB 5ILTH 1UACH 4TNVF 4M1GL 1WC7A 5J57B 1HHGB 3BZDA 5KS9B 1CDHA 3H7LA 4URTB 3HC0A 4XPTL 1J11A 4NSKA 5C3TA 1C16A 4J1UB 1IZJA 3T3MF 3VFTB 1D9KC 1UJ3A 1FBIL 3MCG1 4XBPB 3A6CL 1JUFA 3F62A 4JR9H 1YQVH 3DXAD 2YD5A 4M1CD 2ESVE 1P9MA 3AREB 3ARUA 5SWQB 3G5ZA 4LCIH 4A2LA 3UBXI 3GSNB 5E8NB 2VITB 1ZHLA 3X11B 4CKVX 1TZIB 4U1LB 5DT1H 1MFEH 1LK2B 2F8VA 4LCUB 2Z93A 4MSWB 4MCZA 4KQ4L 4LRIA 4NO0D 4RMUA 4LBEA 1QLFA 1RIHH 1O0VA 5E4EB 4PY8I 4LLMB 4DGIL 5D8JL 4DZ8A 2OZ4H 4YXLL 3RGVB 4NKIH 4NIKB 1SMAA 5K59E 5CZXC 1CICC 5ALBH 3LV3A 3ULUE 5MENB 7FABH 4PLKC 2YPVL 1E4XL 4G9FD 5JOFB 1UENA 4KMTH 5E00B 5ANMA 5C0AA 3S4SA 4QOKD 3SO3B 3G5VA 1NCDH 3BD5A 4UT9H 4LKCA 3V5KA 3MBED 4AQOA 1KPUB 4J3TA 5CJ8A 2JK5A 4Z95H 1IAOA 4GAFB 4G8GE 3SY0B 1IGYB 1MRCL 1AXTL 3ARWA 1VEPA 3QFJA 1ZA3A 4LPWA 4M62H 4XPAL 4K7PY 4EI6B 4PLOB 1JN6A 3QRGH 1FCGA 3I6GA 4QWWC 2E9JA 1LP9F 2JJWA 3V4VL 4B7LA 5EUOB 2K1MA 2CKBH 1CFSB 2CIIA 4PJAF 4U1MB 3V79C 3P0YH 4QRUB 4FQLL 3SGEI 1NUNB 4W70A 3KPPB 4R9HA 2EYRA 5LJYH 3AU1B 3HC3L 3QZWB 4AIOA 1TPXC 2X4TA 4OQ1A 1JZ2A 4Z76A 3HZYA 2W1NA 1KPVB 1B9ZA 1BX2A 2Z9TA 5F9WC 3STLB 5E6ZA 1AKJA 3B6SB 4OLZH 4OKVA 1A1MA 4UV7L 5LBSL 2BSSB 1I7UA 4M48H 12E8L 1FRGL 4ODHH 4GRMB 3EAKA 5CEZD 3NCCB 1SYSA 3T4YB 3PJSB 4K55A 1NDMB 5J8OA 4N90D 3DETC 5F3HA 1OAYL 2J8UB 2E27H 2YBRA 1BQLH 4HFUL 4HXAL 4MA1C 1TETL 1K8IB 1OF2A 1YEIH 1H5BA 3DXAE 1YC7A 5CLWA 4G6JL 1EO8L 3GBML 4FXKA 3VFWB 1J0ZA 3PWPB 2ESVB 4GKNB 3ABZA 5DR5H 3ZDYF 1RZ7L 4QXGL 4XXCC 3W39B 3RWEA 2V9RA 3BO8B 2X10A 1NGQH 1ZLWH 2VDMH 1FIGH 4LEOA 5DD0H 3W9EA 1G9NH 3OX8B 4GKSB 5IJVA 2GJ6A 3MLUL 1A4KA 5DMIL 1C12B 5C6TL 3O6LH 1KN2L 1S9YB 3L5IA 3LN4B 4I9WD 1AD0B 3SKNA 5ICYB 4UZGA 5ISZB 4ETQA 4KU1A 1ZXQA 3GSNL 3CX2A 4G9FE 4UQ3A 5E1AB 3KPNB 4X0KB 4DQOH 2CJUH 3BXNB 5H2BA 3ROOB 5EZIL 4QOKE 1GPOH 5CGYC 1IAKB 2WQRA 2LU7A 2HT2C 4JFDD 5HVHB 3MV8D 2DQFA 4N8VB 5K33A 5D7JC 1I9EA 3SE9H 2RCSH 4JGMA 4ZUWB 3E6FA 43CAA 5JW5A 3CZFA 1OD7A 3GRWH 3LH2L 3P4LA 4PJIB 5A3IC 2JJTC 2JJSC 1CXEA 3GKWL 4EDWH 3T65A 1PAMA 1A9BA 4M03A 1P7KA 3V5DA 3RKDC 1ACYH 4YDIL 5CIPH 3GSRB 2AEQL 3CD4A 1P4IH 2GUOB 5I1LA 2VLMD 1LVEA 4KVNL 3FRUB 4HV8B 1LHZA 1TQBB 2Y5TB 3NMEA 2VR9A 5CLTA 5JW3L 2F74A 1CDCA 3LEXA 1UT9A 3MRPA 4BJLA 3R06A 5CEZE 4DUXA 3WMSA 1NQBA 4TSCL 2RHEA 3O8XB 5J13B 4N90E 2KZWA 1LE9A 3IRZA 1JGUL 4RMWA 4QRQB 5GHWH 1B0RB 2AJ3B 3HLAA 4IIQA 4ZAKD 3PV6B 3GUTB 3UJIH 1F3JA 4Q9RH 3DXAB 2DLHA 3FN9A 2P1YA 4LGSB 4YK4C 3S34H 4Y4FB 1AIFA 2PO6D 4IEFB 1PGRB 2DIJA 1YMMB 1N0XH 4S1SH 1TQCC 4C4KT 4WFHD 1G7QA 4GAYA 3SE8H 3GMLA 5GGRB 5HYIA 3VMNA 2A77L 4FTVD 4XP5L 3V0WL 3RUGF 2V2TA 2CR3A 1FNGB 2BVUA 4OCXH 3U7YH 4JFPB 1F45A 4NO0B 3TJHC 4ISVA 4I9WE 4PREA 5F7LB 1T0NA 1S7QA 1SJXA 3BGFB 3MXVL 2Y72A 1FYTB 1QBLL 4J4PC 2BVEA 1KUMA 1XCTA 5F96H 5EIQA 4WHCA 2GITB 2VSDA 2PXYD 3OAUL 3RGVC 2IPKB 1BVKB 3BKMH 5JMOC 1QFUL 4RFOL 3G9AB 1HHIB 1YEJL 5EZJB 3FB6A 4QOKB 5IIEB 3DARA 2DM7A 1A1NA 5HD8D 3DRQB 3N9GH 4A6YB 3GSQA 4GG6A 1D5IH 5E8DH 4JFDE 4LCYB 5EZLB 3MV8E 1JZ6A 1FYHB 3U0WL 1WTGT 1H3VA 3ULUL 1YEEL 3PWNA 3I6KA 2X2YA 1IGFH 1AJ7H 4EXPX 1YEDB 5KSVB 2P5WA 1PX4A 1DSFL 5CBEB 1N5YL 4PYGA 4TSBH 2AXGB 4F8QA 1RK0B 2XNAB 4R4ND 3GO1L 3U6RA 4MMXC 2VLME 1U8JA 3MYJA 1ZGLA 1I9IH 4G6MH 5EU3B 1NC4A 1QSEA 4PBWD 4KK9D 4LSUL 5F72S 1HSBA 2MJWA 2XN9B 2W9LA 5DJZA 3S3JA 4PRNB 1LO4H 4MXQD 3PWUA 1ES0B 4TUOB 5IMOB 4CVUA 4PGEB 4UV4H 1NCUA 4HFWB 4UT7H 4QT5B 3HS0B 2P24A 5IB3B 4X4YA 4S1RH 3NFNB 5T1LB 3QZWG 2QQNH 4KI1A 3J7HA 3ZTJH 1A7PH 4M1DL 4O2CA 3K8MA 3OB0H 5ETUA 4WFHE 2GK0A 4FTVE 4K3DH 3V6OA 2XQBL 2N7AA 4KY1H 3ARTA 5HHVH 1I8LA 4ZYKB 3S35X 1S8DB 1AO7A 2C1PA 3KLDA 4ZO8A 3DWTA 1HH6B 2FRGP 5JDSB 3FQWB 1H3UA 1NDGA 4EN3A 2OJEB 1A6VH 5GS1B 1Z9LA 1BOYA 1UEYA 1DLFH 5L6YH 5J06A 4L1HA 3SKMA 3SDXA 3V4UL 4FQCL 3ULUC 1A3LH 1L7IH 2LTQC 1A7OH 5EU4A 1FVDB 5JUEL 1G6RA 4JN1L 3MV8B 4GXUN 5EOQH 1Y18A 5DTFA 3QJFB 1V5JA 1Q0XH 1VADB 2BXZA 4MJIB 2QADC 3OKKA 2OL3H 1XGQB 5LGJB 2Q8BH 2XPGA 1QBBA 5MERA 3FOMB 3FFCA 4TULL 3S37L 2E9IA 4A6YL 4MA8L 4ODXA 1PJ9A 4DFHA 5TPWL 2B1HH 3QUXD 4B53A 4L3ED 4WJ5A 4YEEA 3V5HA 4U3XA 1DVFC 4Z7OE 4D0BA 1KJMB 4PP2B 1MJ8H 4N8VG 2Q7YB 4G42A 3FO1B 4G8FB 3WJJA 2O61B 3WEXB 3D0LA 3HAEB 3I50L 4TOYH 2KUTA 1R3JA 3HRPA 5GSVB 4U1JA 1YN7B 3ARGA 5EBLA 1F8TL 2IH3A 4NZDA 4Z7WA 4YHNA 5FB8A 4S1QL 2ATPB 4AEHL 1XR8A 1RVFH 4ZAKB 4YDVA 2XI9A 1NAMB 2D7TH 3PDOB 5ICXA 3FT4A 1MHPL 4MXVF 2VXQH 5ID0A 3BVNA 4H0IA 4BUGA 2PO6B 1IEAA 5CEZL 3REWB 4MCYA 3BJLA 4YHMH 4ZS7L 4UINH 1H8NA 3L7EB 3HFMH 4M1CC 2VDLL 4FTVB 4GKZA 1FE8H 5AAMA 5HGHB 1HCVA 1CLZL 2GKIA 3BESR 1TJGH 1OQXA 4F7TB 3BWUC 1N5AB 2YUVA 3OHXA 3S5LA 1AXSB 1RK1A 4JN2A 4BK5A 5I17B 3SCMA 4PJDA 3TT1H 1KLGA 1Q1JL 3MRHB 4X6CE 4LSTH 5IW3A 3IT8D 2R56H 1KNOA 1DBAL 2YPLD 4NFDA 4Y1AA 5KSAD 2X40A 2UYLA 3V0VB 3WCYA 2VLRD 3MJ7B 1WITA 3KS0J 1T0MB 1I7RB 1WBZA 1JF5A 1G9MC 2BFVL 2W38A 5J6GA 5E94B 2MHAB 1UA6L 3K8KA 3MBEC 3NPZB 3GZKA 3VG9B 4ZD3H 2X1OA 1E0OB 3IB4A 3F7PC 5GGRY 3BMVA 1CS6A 2DQTH 1AD9A 4GG8A 2AQ2A 4PJEA 1WWWX 2AEPH 1JCKA 1QBAA 4KQ3L 1AQDA 4L3EE 4HDIA 3NN8B 1YEGL 4YHKH 1ZHKB 2YS4A 3BKCL 3QEUB 1T83A 1FORH 3BPCB 1EDQA 1AGCB 4KZDH 3O3EA 4LRNH 3HZKB 4QRPA 5DMJB 4MJ2A 1JPGA 2W9DH 5IKCA 1BBDL 1A5FH 5CILH 4H1LB 2A6IA 5JR1L 1NBQA 3MRIB 2K7PA 2H2SD 1ZA6A 3E8UH 4NWUL 1AXIB 2GTZB 2FHFA 1MIMH 4CMHB 1SEBB 2PYED 5DXWA 3M07A 4RWHA 1UKTA 4LPXA 1UH4A 1FZKB 3S96A 3PABA 1TLKA 2HTLD 1NBZB 2H32A 2ICEA 3DX6A 5ITBH 5BVPL 3HPJA 2IPTL 2W0FB 1IQWH 3HNTH 2FX9L 4JAMB 5D7SH 3TH3T 2DI9A 2PKDA 3TO4A 2FJFA 4FFZL 3WFCH 5LQBH 4MZ2A 2GY7B 4RFNB 4YNYA 3QG6B 5FYKU 5F88B 5T3XH 5C0BD 1NAML 1FFRA 3RNKA 5C0JB 4GJTB 5GS2D 4G6KH 1FG2A 4P4RA 3OAZK 5EH1A 1HKLH 1A6TA 1MY5A 4PGZA 1KJ3H 4LEXL 1RZIA 3MRLB 4RMSA 5D1XD 3TBYB 1TFHA 4X6CB 4GAGL 4NZUH 4KK8D 2AJSL 3IFNL 2YPLE 4MDJA 4PS4H 3DSFH 5GS1C 2QBWA 4QTHA 1UH3A 2IADB 2VLRE 5D71L 3KPSD 1QR1A 2B4CH 5IBTL 1QO3B 3STBA 3TVMD 1LO5A 3MGTA 1IGTB 2MSPA 3EJZD 1FZOB 3CFDB 2VL5B 1VACA 4DKFH 1XF2A 1IC7H 3S35H 2HN7A 3BDBA 5I1JL 4HC1A 2R23B 1BFTA 5CFHA 1JPTH 4MQ7A 1BMGA 4L29B 1CL7L 4FQ2L 1ADQL 3QXTA 5HYJA 1P4LB 4XVTH 4BSVB 1F6AA 2XACC 2VKXA 4OJFH 4L3EB 2EIBA 3CH8A 2J8HA 4YUEH 2EH7L 5HYSB 2NX5A 2P4AB 3KPLA 3SDYH 4XI5D 2D4DA 2JELL 5CINH 1FHGA 2VLJD 5JOPD 4P2OC 3VXPA 1YC8A 1AE6H 4K2UH 3SDCA 2P8MB 2VDKL 5GISL 4NN7B 3O41A 4MD0A 5EO0B 4NO5B 1BZQK 5E6IA 3UC0H 5CSZB 4PJ8A 1J05A 2C4XA 3VI4F 4M93B 2ARJQ 4X99A 1H3PH 1HQRB 3WFHA 4QRTB 5HPOA 2R4RL 4L1DA 1R24A 3ISWA 1U8HB 5E5MA 5GS0H 4R0LC 3TBSA 3QT2A 1WIOA 1A7BA 1WZKA 4ZAKC 3F8UB 2WP3O 2EIZA 2FBJL 5L2JB 1N4XL 3SQOL 2FWOB 1KXTB 2EDNA 4H8WL 1M71B 3HAEG 1RPQA 5GRYA 2PO6C 1AP2B 4S0SD 4IJ3C 5C0BE 4F37F 3FQXB 4EQ2A 2E7LC 3H9SA 2UY7A 3RTQC 3EYSH 2M2DA 3FO9B 2G2RB 4BSWB 3PGCA 1X5HA 4HH9A 4PD4K 1T20B 1LEKA 3FQRB 3RPIB 1F42A 2XZAL 4XCNB 5C9KA 2JB6A 4R8WL 4HKBA 3QAZC 5KJRL 2VLRB 3KPSE 3PDGA 2PXYC 4OCYH 4X5LA 4R2GB 1AGBB 4CU6A 2XG5A 3GM8A 4W81A 5EC1A 3DX7B 1GOFA 4OZFH 3TZVD 3BN3B 4IRZH 5FCSH 2E8ZA 5I1CH 5HD8C 4UIKH 4HKZA 1OWRM 1ZANL 4WU7B 3H9ZA 2WUCL 3DUHA 3IYLW 1U8PB 4WW2A 4QEGA 1FNSH 3GB7A 2QSTA 3TNMB 1M4KA 2BX5A 5LCVL 4XNUL 4PRHA 5DRNA 5HPMA 2FL5B 4XPGH 5BW7A 3MRFA 2P48B 4PJXB 3OL2A 3CU7A 2VLJE 4R4NC 5JOPE 2AGJL 1HH9A 4KPHH 4DCQA 2NLJA 3PHOA 4CJ0A 3U9UA 1NCBL 1J1PH 2FO4A 2CO7B 3IFPA 5IK3A 2R4SL 4N9OB 2CK0L 1RUAH 3MCKB 4KK9C 4E41D 3S36X 4RX4A 1QSFA 4YHPB 5E7FA 3QIBA 4MXQC 1JWUB 4P3DA 5FO8A 1T7WA 4LFHD 4LF3B 4H8WC 2E9BA 5CGTA 1V7ML 4ZUVB 1T5XB 3AXLB 1JPFB 1ND0A 3EOAB 3IDJA 3WL9A 4YBLB 5DUML 5HJ3B 3U36A 2BVQB 4B50A 1MWAB 1MFNA 25C8H 3NFSL 5DYOB 3L5XL 5C0BB 3G5XB 4UU9B 5C0ND 2ED9A 1EXUA 5D5MA 1GVIA 4RFNC 3UDWA 4Y5VB 3BN9D 2HT3D 4OAWB 4P5TB 4LVNB 1WISA 1EH9A 1ZT4B 5D1XB 1IAIL 5T5NG 2NY4D 4HF5H 1YECH 2WM0A 1U8KB 2XY1A 2C1OA 4UUJB 1XGRA 2X9YA 1H15A 1FZJA 5FUZH 4GSDH 4J3XA 1EGJL 1KCVH 5DLML 3R0NA 3KPSB 4K7FB 5FA4A 1A47A 1NCAL 1XGPB 4TUKH 2FZ3A 1T1YA 1NUGA 5I75C 4K3EH 1CDBA 1T22B 1DDHB 1T1XA 1JI1A 2BSTB 5ESQB 4PJCA 3BIAX 1S7RB 1RURL 5IW1B 4I18C 1HHJB 3FCTA 1ED3B 4Z0XA 5JNYB 3IXAA 4AEIH 3BPLB 1RZ8A 3U48A 1OSZB 1A64A 4P49A 1ZLVH 3CK0L 4WI4A 9CGTA 5JOEA 1QHOA 2VRAA 4ZMAT 1N6UA 3HR5B 1JYVA 1QSVA 3TPUB 1RU9L 1L0QA 3MMEA 5C0DB 2VZ1A 2IAMA 1CIDA 3QUXC 3MV11 4PB9L 3VFNB 4G5ZL 4XX1G 1BAFL 5DJ2A 3KYAA 3UBXA 1C5BH 2VDNH 5TDOB 1CD9B 1KJ2L 2IBBA 2PUQT 4U7MA 4QXUL 4UDTB 15C8H 4E41E 3WUWA 4KH2A 4JFXA 3CMOH 1ZS8A 1U91A 4GXUM 1EV2E 5IB5B 1QLRA 1TZHA 1REIA 2XWBB 3INUH 2YD6A 3K4DA 5HYSG 1ZAGA 3HZVA 4JE4B 3CSYA 3IETB 2AJXL 4M93C 3IU3B 3VD4A 3ZKQD 4JFED 2D7NA 1F13A 2R0ZH 4QKXB 4D94A 2DD8L 3RHWK 1DN0A 5KVDH 3SO5A 4Z7NF 4S0TD 4PJFB 3KNBB 1FQ9C 2ADJA 2K7QA 5KVGL 5E2WL 1JNLH 3MRKB 4ZNEE 5J11C 5K9QG 2YC1B 4XAWH 4JPVL 3ILQD 2K9UA 4X98A 1I3UA 2YRPA 4XPBH 1MWAL 3WKML 4CW1A 1U6AL 4JVUA 4ODSH 3K74B 4JKMA 3M45A 1WBYA 2OTWA 4R4BA 2OR9L 1GH7A 2QR0A 1ONQA 2QQLL 3VXMD 5IFAL 3U0TA 1N2RA 3RGHA 1YY8A 2BHUA 5KSAC 3BUYA 3OGCB 2N56A 2XOTA 4YDJA 2KH2B 2CDEB 1CBVH 3T2QA 1IC4L 5HHQB 2P44B 1DQDL 3ALWA 3PV7A 4WV1C 1EHLH 3WFBH 2ATKB 2C3VA 5C1MB 1NUDA 3QHZH 5GPRA 4X4XB 4QO1A 2VLKA 3SE4C 3SHSA 4LKCB 4OQTL 3MLTB 1RHHA 2ZOKB 5HGAA 1E4XI 3WE6B 4Q58C 4DVRH 3ARFC 1J1XH 2AJYH 3TESA 1OL0A 4M8QB 3VFRB 5IR1A 4Z78A 4EUPA 3B2UC 3JV6A 1NMAL 5MEOA 2ZCHH 3I6GB 2BXYA 3KAAA 4GG6F 1A6WH 5E03A 4MAUH 4ELKB 2MCPL 3BGAA 4ZXBD 3AVEA 4E41B 1QLEH 1J8HD 4GW5A 5F9JA 3LKRB 4M4RA 4GUPA 4NDMA 2YPKB 1BZ9B 1OSPH 4NM4H 5DURB 4F9LA 4OCMC 2G75A 1HDMA 3ARVA 4ONHB 2BNUB 4OCRL 2A6KB 3ESUF 4ZSOE 4JFEE 3UTQA 1IKNC 2HTLC 3VXSA 2WK2A 4KKAD 4LPTA 4FFYH 2BK8A 1EVUA 5C2BL 2QQKL 2OJZH 2P8PA 3WXVL 3MRBB 1YNTB 3P11H 4WFGD 1XIWA 4NWTH 1HXYA 2YSSB 4H0HB 3NIGF 4LAQH 3W5NA 1S5IH 1UADC 2WSKA 5MP6H 1OVZA 2X89D 3QDMD 1UZ6E 4NRZB 3GSOA 4M5ZH 1RZFL 1YEKH 3DSNA 4Q74A 2AAVA 4U6VL 1MIEH 4ESKA 4P23A 4P2RD 5D1XC 3N0PB 3VXME 3IFLL 4KAQH 3MA9L 3QISA 3KWWB 3VXQB 1PKQA 1T6WA 4KK8C 4X9IA 5C92A 2FH8A 2V5SA 3Q5OA 5GGUA 4TNWF 4PLJD 1UKSA 3C6LB 3VWJD 2CRZA 1TMCB 3TVMC 1CD1A 3FTGB 1JHLH 3QCTL 1X9QA 3GJEA 3EJZC 5TF0A 3VFUB 2DQGH 4XCCL 4J8RA 3O11A 1P2CA 2VKWA 4FP8L 2X44D 3K81A 2CD0A 5GXBB 1GCFA 4M7LH 3KYKL 3TA3A 4WHTB 2WUBH 4F2MB 4ELMA 1W0WB 2YWYA 4UB0L 3LRSB 3PGDA 1YYML 3JVGC 3DUUA 4LU5L 1VESA 4LPUA 1IZKA 2CUHA 2HVKB 2NY0B 3JWOH 4H88L 1DQLH 4HK3N 1F90H 2J6EA 3SDXF 4IS6B 5TE4H 1QG3A 3WUZA 3TIEB 5KN5A 1QPXA 3BH9A 4JPWL 5C0EA 3AY4A 5L88H 1MCBA 4ZDHA 2HFGH 4NQDD 1K4CA 3VCLB 1J8HE 2V7HB 5FF6A 2G9HA 1J0YA 5JHLL 1GC1L 4HPOL 5CEYB 4HPYH 4XP6H 1IKFH 5GGVH 1F3DH 3R4DA 1OM3H 3OXRA 1JPSH 2DJUA 3MODH 2A1WH 3F5WA 2FYYA 3QUZD 4JHAL 3CFJA 5EZOH 3NAAL 1OHQA 2ZG3A 3OR7B 4GH7B 3MRPB 1CFQA 2Q76B 4QHKJ 1DBMH 3KYOA 3QFDB 1FIEA 4PUBH 4WFGE 1D6EB 2X4OB 4PJ5D 1UXSB 2WLZA 4NPYA 1LEGA 2H8PA 3T3PE 1HIML 1BQUA 1CFNB 3GSXA 3QDME 5D4QA 4KGLA 4JO3H 5E6YA 1NJ9A 5CGMA 1FC1A 1QD0A 4MZ3A 1CGSH 1Q0YL 2VL4A 3CCHB 3VGAC 4QHNA 4CNIA 3FL7A 4S11A 4Z7WF 2A9ML 1LWRA 2Y36L 4WTZA 2BRRH 5I16B 1B2WH 2J12B 4JY4B 4PY7A 2BMKA 2VDQL 1M7DB 1KCLA 3BKJL 3BPNC 2GY5A 4ERSL 3QCVH 2CDFA 4WUUA 5E5RB 2MPAH 5TDPB 4Y16A 1UM4H 2VISA 3TWCL 3P9LB 2I24N 4JM2B 1KENH 3HRZA 4XCYB 4KROB 3TZVC 1RULH 2IFFL 4NCC2 4XPHH 3X12A 1M6OB 3ARZA 2EDOA 4AG4L 3TYGH 4MNHA 4P2QA 2VH5L 4PJDF 3SGDH 3VGGA 3VD7A 4JM4L 4QF1A 3NACH 4PRDA 4UNUA 1KELL 4NRXA 1JPST 1DUYA 1OPGH 3W0WD 3FT2B 2A83A 1IL1B 1CE6B 3VE0B 3MLXH 4TVPD 4PR5B 1GC1C 4OD1L 3MZTA 4R90H 4HQQH 4NQDE 1CYGA 5IMKA 1J8HB 3DECA 4U1IB 3F6IA 1X5YA 3S9DB 2HG5A 1T3FB 5EWIL 3IDMB 4NM8H 2LVEA 3L3IA 4ZFZA 5A2IH 1LO0H 3BQUA 2Y06L 3UXFA 2VLLB 4NO3B 5MEPB 2ZCLH 4PJEF 5IJKC 3A67L 3HI5L 3GDBA 2DQJL 3RWIB 2EC9U 4PJ5E 5HDQH 3GBNH 4NUJA 4YXKL 5SV3A 4OUUB 3FMGH 3RWFB 1IM3A 1XEDA 3MREA 1XGUA 3TV3H 1KCUL 2ARJA 4M6NH 5J3HD 1MJ7H 3BDYH 3PP4H 5C0NC 3QDMB 3T0XA 5E8EA 3KPTA 3HZMA 4LFHG 2X4RB 1QFHA 4Y0GA 1OW0A 1ITBB 1NLDL 3BP6B 1SBBA 2DB8A 3BN9C 3QWRA 1XGTB 5DR5L 1PG7X 2NY4C 2BDNH 4HHAB 1GGCH 1T03H 5FDYA 4HS3A 4LLQB 5AWNH 3MTRA 1MRDH 5C0CD 1BWMA 1E6JL 5JQ6L 4K3JH 4XMLH 5ADPH 1WIPA 1LP9E 3MLRH 2BCKA 4X9GA 3U4EA 4PJAE 1I7ZA 4AH2A 3MJGX 3RWCA 3FRPA 3ZTNH 4XGZA 3OKLA 2AJUL 1T2QH 3Q6GL 4AYFA 3QDGA 4FQ1L 4MMZC 3M8OL 3MRDA 4JHZA 4G7YL 4KDWA 4FQHA 2APTA 4LHQB 3RFZC 3W0WE 3ZO0A 4I3SL 35C8H 2FDBP 1WBXB 3OKDB 3WD5L 1WWBX 3DHMA 4TVPE 3OG4B 4PG2A 4LCCA 4I77H 1VKXA 4KTEL 1HXMA 2XPGB 4P3WA 4EJ1C 4GRLA 4NQDB 1Y0LA 1Q72L 1MRFL 4LLYA 4WDIB 3VWKD 4RISL 3DTXA 5L0QC 1NGXB 1S7SB 3BHBB 5A16A 1BVLA 1DL7L 1HSAB 5DHVB 3DNKA 5IROA 1DQJA 3EGSA 2VC2L 3DMMA 5D2NB 5F3BA 1I85A 1NCCH 3QUZB 3CFCH 4UOJA 1JV5A 1NANI 2J5LC 4HKXB 4JZOB 2ED8A 2IMMA 3UEZA 4D8PA 4KHTH 5FYKD 1YPZA 4BQBA 4YGAB 1CVRA 1UWEL 4RNRA 2GQHA 4RSVA 5FK9A 4RZCA 2AXFB 3QNXB 4ZTOL 2X4QB 4P99A 2MQ0A 1WFOA 4RAVB 1KYOJ 3QIWA 3F7YA 4PTTB 1X6NA 5T3XD 4NZRL 3HB3D 4OIAA 2G60L 2VWEE 5DHYA 3S34L 1IVLA 2R2BB 4NQSB 4W6YB 1G9NC 4G9DA 4YPGA 4HEPG 4RGOL 3TBTB 1D7FA 1NL0L 4UAOC 1XT5A 1WZMA 4LVEA 5C0CE 4JFYB 1OGAB 5KBNC 1JZ8A 4JDTH 2DKSA 3IDGA 1U9KA 1N7MH 5T1KD 1INQA 2HTKD 3LB6D 4MAYA 4YZFE 1NSNL 4RQQA 5JXEA 1NEUA 4XT1C 4FABL 3B3IA 1PFCA 4AT6B 3IAPA 2WANA 3PG2A 5TFSH 2J3SA 5EBGA 3RZCD 1OAKH 1G6RH 3ECBA 2F8OA 2DTSA 1FNEB 5HVGB 2DYPD 1D5IL 3CH1B 4G3YL 1G7HB 5TE7L 2APVA 2VZTA 3AFLA 5C09A 2HFTA 3LKQB 2O5YL 1FVEB 3FN0H 1UXWB 4PJGE 4WU5B 2DL9A 2Z8SA 5LWYH 3GSUA 2GYSA 1INDH 3LKNB 4AENA 4ZFGL 4Z7UB 3NZ8B 5EORH 1B3JA 1QFPA 1U8QA 5C8JB 3U1SL 4ZXBC 5BO1H 1Q9LB 5I8CB 4P2YA 4WW2F 1U8NB 4JPKL 2EDQA 3LY6A 1ZLUK 3B83A 4XNYL 3EJJX 3RUGE 3B5HA 4HUNB 4K71B 2BRQA 4NKOA 2DLGA 5JHDD 5FYKE 5TDNA 4JO4L 5DSCA 2HKFH 4DZBA 2I9TB 2AV7A 1WT5A 3UTZB 3VFVA 5IVZB 3MLZL 4KKAC 1EEZB 1UCBH 2CLRB 4JHWH 3VD5A 3BEWB 3OJDB 5HVWA 4GXVL 3VFMB 1OAQH 1EZVX 5F1KC 3MV7A 4FQPA 3V6FA 2R1XA 5T3XE 1HWGB 1ZLSL 5ALCH 2XZQL 3QEGH 4MNQD 3QNYB 4FMFA 4J6RL 5D1ZD 5EIVA 3HI6L 2GJZB 5KOMC 3G04A 5EBWB 1A7PL 1A1OA 1RUKH 2R29H 4GRWF 2J4WL 1MCJA 2IQ9L 4YX2L 2HKHL 2F19L 1HOCA 5JXAL 5LGHH 1JYNA 5DD5H 2AJVH 2NY3D 4GW1A 2FX7H 1CCZA 1YNLL 3C8DA 4X6DA 2X4UA 1JGVH 5K9KA 3PIQA 4PLJC 4L4TA 4XP9H 3VWJC 4DN4L 2DM4A 3I2CL 4GAJH 1EAPB 4U6YA 1UB6B 3KR3L 5D5MF 1NMBH 1SJEA 2P49B 3A6BL 4AM0A 2W65B 2P46B 4L5FL 1VACB 5I66B 1OAZL 4H25A 4JRXD 1KCRL 1EHNA 3FQNB 2BOBB 32C2A 5C0IB 1Q0XL 1MCHA 4JCLA 1KB5A 2CXGA 4OCLC 5FO7A 2YK1L 3T0ED 3RIAK 4PJGB 2P8LB 2PNDA 1I1FA 5IF0A 3RWJA 4PJCF 2Y6SD 3L3DB 3RL1A 1DBKH 4G6FB 1AGDB 4PRAA 3HI1A 5HGDA 4LHUD 1U2CA 3UJTL 1CL7I 3HMXA 3HPLA 1U0QA 1MJUH 1MHCB 4TVPL 5KANG 4DW2H 1V7NH 2Q3AA 3BIKA 5JW4R 3RUGB 4U6HA 5BZDA 1I8MA 5JHDE 4OV5A 4UOW1 3WS6A 4R4FL 4HSQA 4M7ZC 2WBJA 1GGYA 1KIPA 1OP9A 5B38A 1I3VA 4PP1C 3VMPA 3QUZC 3MV01 4TPRH 3V7MA 1EFXD 4X7FC 3DO7B 1F11B 1G7IA 1JWMA 4QHUA 4UILL 2H32H 4F15C 3MRCA 4L3CB 4RGND 1JF1A 3RWGA 3F58H 3MBXH 2EKSA 4MNQE 4QHLB 2H45A 4Z6AT 4EOWH 4KKCC 2A6JB 2D0HA 1NFKA 3O6MH 3MCLL 3GBLA 3T1FB 4RBPK 2SEBB 1P4BL 4XVJH 4HBQA 1HI6B 3QXWA 3WLWD 3MJ8B 1MHHB 1W0VB 4G7VH 2HJLA 2B1AH 2PW2B 1I4FA 2ZSWA 4ZPTB 2PR4H 4WWKB 1BZ7B 4IRSD 3HG1D 1AGEA 4HJGB 5FM5M 3RWDB 1BFVH 3B9DA 4BFIA 1G6VK 3C09B 1A6ZB 4I5BB 4O2FB 4FXLA 1T1WA 3FT3A 5D9SA 4LSTL 1I8IB 3MNZB 4PJHA 2JB6B 1I1AD 2R56L 4QCIA 1AHWB 3NFPA 5F7DA 4K8RH 4HGWA 3ZE0F 1S7UA 4Y5YB 4E0RA 4XVUD 2DYPB 3GJFB 4XMKL 5SWSD 5LXGL 1DE4B 3Q1SH 1PZ5A 4HC1H 4JRXE 1XH3A 3ZE1E 4LLWB 3O6KH 4EI5A 1PEZA 2CSPA 5L7XH 3GI9H 2IC2A 1BREA 1PYWB 3BKYL 3MLWH 3BZEA 3N06B 3T0EE 1A9EB 2BOCA 5EULV 1OP3H 2NCMA 3PL6A 2D7QA 1FN4B 2EIDA 5KVEL 3MFGB 4U6XB 5D2LA 3MXWH 4YDKH 2I60L 1MSPA 4OGYL 2AEPL 3CC5B 4L8SC 5CHNB 1EIBA 1FO0A 1K8DB 3GIVB 4LGPB 1BECA 4Z77A 1JGDA 5I1KH 1TVHA 4ZUUB 4K94H 5DWUH 1LEIA 2BNQB 5IM7B 4LCWA 5JHDB 1K5NB 3WFEH 3E3QE 3S8WA 4PB0H 4OM1H 2LABA 3RL2B 4RGMC 4N0UA 4LPCA 3MNVB 4BELD 4EBQH 4JG1H 4OCWL 3GMMA 4QY8A 1LNUA 3L3GB 4GQ9L 4QHKI 4RGNE 1CGUA 1QR4A 3MJ9A 4GQPH 2CMRH 2FHCA 1MEXL 2NY6B 2X4SB 4RMQA 5FGCE 2JCCA 1YEFL 5FYKL 4MNQB 3AMLA 4HLZH 3WIFB 3QBTB 4QRSB 5IQ7H 5J3HC 5SWZD 4OIBA 5CZVL 3WN5B 1IM9D 3IXTA 5D7SL 1MCSA 4DKEL 2X1WL 2XTJD 5FA3B 1NAKL 1AGFB 1OB1A 4YC2B 2VXVH 4NNXB 3WFCL 4ZQKA 1T7ZA 2YWZA 1WSST 5E08L 3HG1E 2NY3B 1XZ0B 5ITFA 3FZUD 4Y4KD 2YZ1A 3RU8H 3U46B 5K9QI 5CSGA 3MFFB 2HJKB 3STZA 5L8JB 1ZHNB 4DWHA 2UWEE 3D85A 3L95A 1BJMA 3FAWA 4R3SB 1UYWH 2HFFB 4NZUL 5C9JB 4C83B 1IAII 4NHUB 4PJBA 5F1NA 4D0DA 1U3HD 5GRJL 2DWEB 1A6AA 3EO1A 4U1KB 4OFYD 1PSKH 5E8PB 5SWSE 1JMXA 4JRXB 5J9PB 1BFOA 3MRMB 1A3RL 1FGVH 1OCWL 4PJ7A 1B0GB 1NMCC 4LHJB 4XBEL 3EYVA 5F8QC 3FCTB 4HD9A 5F6HJ 1WVZA 3QJHA 2VABB 1FL3A 3D3VD 1JPTL 3O9WB 2J2ZA 3BZ4B 2F54B 1A8JH 2ITCA 1HKFA 3QUYB 3QQ4B 2UZIH 1NFDB 1V05A 4LHUB 4QGYA 3TH4T 3VWKC 4I2XA 1F4XL 3WNLA 1FFNA 4DTGH 1DP0A 4DGVL 2VMFA 4ELMF 4OD3H 2J1KA 2FIKB 2VR4A 2Q1EA 3OKEA 2WBKA 3QDJD 2R2HA 3RJDA 2NY5L 4GRWH 3NTCL 5BOZG 2ITDB 2X4PA 4JFFA 4ZUTB 4G43A 1VDGA 1H3PL 5FGCB 2Y07H 3IU4L 1YYLL 2NY7H 5SX5K 5GRUL 4FZ8L 5SWZE 3G08A 4WEMB 4D3CH 1JFQL 3QI9C 4NJ9H 4NYLA 1BGXL 5IVXA 2X42A 2DKMA 5L8KB 1B4JL 5JO5A 2XTJE 1UCTA 1U3JA 4P59L 3HE6A 1DQQA 4BK4A 3NABL 5J6HA 3CNKA 1PLGL 3HG1B 4MDIB 4GBXB 4TUJA 4X8JA 1MCQA 2AK4A 2GTWA 3GSWB 3EYSL 1RY7B 2R2EB 3ILPB 5DF0A 2UWEB 1W0YT 1HHKB 2HTKC 4EVNA 2DJ4A 1UM5L 3V8OA 2B4CC 3IKCA 3LB6C 1T66D 5EU6A 2UZYB 3VGEA 1GXEA 1EAJA 2P47B 3C09C 1CQYA 4X80H 1FL6A 5CEXB 3BW9A 3AAZA 4JO2L 1ODAA 3SJVD 4Y5XB 1KPRB 2VYRE 2X6MA 1AHWC 3HR6A 3CXDL 3Q5TA 1RZJL 4HZLA 1IFHL 5SWSB 3R1GH 2XY2A 3RZCC 2W0PA 3BE1H 4FA8A 1JGEB 4Y5YC 1MELA 4YHLL 1VB9A 2YKLH 3QO1B 4YQXL 43C9A 5DK2B 3O2VH 3VI4E 5KW9H 3VRIB 2F53D 3D3VE 1MVUB 5T3ZH 3MR9A 2Q86A 3VFGH 2IALB 3QFJD 5FM4A 5DMGC 3NCYP 3VG0L 5IMLB 2ZUWA 3QCUL 4K3HA 1J5OL 1P53A 5EBMB 1X6LA 1KIQA 3LEVL 4OGXH 4E5XB 2FJHB 1FV1A 2H3NA 2LAAA 4UT6H 2YD8A 3LKPB 3QDHA 4ZOBA 3SDAB 3WO4B 1R0AL 5I19H 4NOFA 4P9HL 3LKOA 1QFOA 1QA9B 3VRJA 4F58H 1BBJB 4L9DA 2NY5C 2ADIB 1HHGA 3HMWL 5KS9A 1IEBB 4JZNB 3QDJE 3T1WA 4J1UA 1GHFH 3VFTA 5DQJB 5BOPA 2IQAB 5D6CB 3U0PB 3REVB 4X6EB 5C07D 5SWZB 5I1IH 1X5XA 1IM9B 3AREA 5SWQA 1VGEL 4WI3A 5D1ZC 1MQ8A 1OARH 4M9OA 2JB5L 1F4YH 3GSNA 5E8NA 2VITA 3BT2H 3X11A 1TZIA 2ZKHH 3QUMB 4NGHH 2IGFL 4U1LA 5I73B 2OR8A 5I1EH 1LK2A 4LCUA 1QQDB 4YC2C 4J4PA 4MSWA 4Y4KB 5FO9B 4LGRB 3VXNB 3GK8L 4NN6B 3RP1A 3THMH 4LLMA 3RGVA 4Z7QF 4P46D 4FQQB 4L4VD 3SGEH 3V0AC 5MENA 2FGZA 4FNLH 1IT9L 5JOFA 2EDJA 2NYYD 4OFDA 5E00A 2WINB 3SJVE 5EOCH 4OLWL 4TRPL 2QL1A 2PTTB 5HHXL 3P0VL 1KPUA 2QV2A 3NCEB 3SY0A 2D7MA 1IGYA 1MLBB 2F53E 3NIFF 5BV7H 1PBYA 4NQTA 4K23H 4EI6A 4OZGF 3SPVB 4QNPE 3QFJE 1NLBH 4XP1H 3QEQD 4N9GB 1UB5B 2DM3A 3T0EC 5EUOA 5DJXB 4U1MA 1CFSA 4HT1H 5DD1H 4WEBL 4P9HC 4ZO7A 5DJAB 4QRUA 3RVXD 4JDVB 3D69B 3KPPA 2Y6SC 4P4KD 3AU1A 1RJLB 3QZWA 4EUPH 4HWZB 3H7BB 3ZYOA 1KPVA 2AABH 3STLA 1CFTB 3B6SA 2V9QA 5F7YC 3EHBD 1B4RA 2BSSA 4U1HB 1KC5L 5T33L 4GRMA 3QDJB 1GOGA 1QP1A 1V8HA 1K9TA 4MJ6B 5IBLD 3DVNB 4PGBB 3T4YA 3E3QC 2YMXL 3PJSA 3QDAA 1NDMA 3ETBF 1CU4L 3O3DB 2J8UA 1G1YA 3O2DL 4LHUG 3P9MB 1K8IA 1JL8A 2XFXB 4KJWD 5DQDH 3RX5A 2XWTB 3OPZL 5C07E 4M61B 3VFWA 4RGNC 3PWPA 4M6OL 2ESVA 4GKNA 5SX4I 4WRLA 3W39A 2F58H 3BO8A 1FFPB 1WZ1L 3MV9B 1JRHL 3LEYH 4JLRB 5KVDL 2EDLA 4ORZC 1MAML 2DBLH 1MQKL 1A7RH 3OX8A 6FABH 4GKSA 5H35B 1JJUA 2FNBA 4AMKH 1QOKA 2YZ8A 5T1MB 1QHPA 4IOFD 1WEJH 1C12A 1P6FA 3WLWC 1S9YA 4JY6B 2YN5A 1YPZF 3LN4A 2XWJB 4HUUB 4IRSC 2ILLA 1AD0A 5I8KH 5ICYA 3LD8B 4L4VE 4XPBL 3OKNB 3QUML 2MQCA 5E1AA 3KPNA 4X0KA 4D9LL 1UWGL 1MNUH 3BXNA 3ROOA 3WNPA 3I9GL 3SJVB 1I1AC 3K2UH 4ODTH 5C0RL 1MF2L 4KUCF 4PRBB 5DVOA 1UFUA 2O93L 2NR6D 4XCFL 2XT1B 2VISB 4N8VA 5DK3A 4HEME 2V2XB 4XVUC 4ZUWA 1BD2B 1TZGH 2VAAB 4OF7A 2F53B 4LDLB 4OLEA 2HRPL 4PJIA 1FSKB 1BJ1H 4LSQH 3RX7A 3QEQE 4NNYB 4NC1E 4NQVB 2P5WD 4U4BA 1A14L 3TO2B 2FD6L 4ONFH 4UTBH 5DD3L 5I1HL 4POZD 3CXHJ 2LU4A 3DYOA 5E99L 4CBPA 2BY2A 3DX9B 3GSRA 1MPAL 4NO2B 3ME0A 2J6EH 2GUOA 1NFIA 5DJCA 3ZKSD 4Z7NE 3FRUA 4K3GA 4HV8A 4EXKA 1CGXA 2Y5TA 4R7NB 4NBZB 4KMLB 4U3HA 1S9WB 1VFOA 4OLUH 2JTDA 3WO4C 2HWZH 3WIHL 4JZJC 4TVSa 2HAZA 2DWDB 3O8XA 4Y88A 2V17L 2VJXA 4QRQA 1B0RA 2D0GA 1SBSH 4X6BB 2AJ3A 4H20H 2F5AH 3GUTA 3PV6A 3PUCA 3DXAA 5FYLD 2ICWJ 3UYRH 5F1SA 3OAYK 4Y4FA 3AB0C 4ZTPL 4M43L 1YMMA 4O4YL 1A7NH 1ROWA 5HHPB 4N68A 1VFUA 3SKOB 1NPUA 1ZWIB 3C8KB 4JGJA 1K4DB 5GGRA 3D39D 4HCRL 3P11L 1D3CA 2XTJC 2Z31D 1XGUB 1FNGA 2X1QA 2MQ3A 4JFPA 4NO0A 3S98A 3EFDH 1JWSB 3HZMB 2ZCKH 4X4ME 3S36L 4HIHB 1LD9B 1FYTA 2EH8H 3PNWB 3FZUC 4P46B 4WI7A 2AI0H 4L4VB 2EXWD 4Y4KC 4EN3D 1A0QL 3H9HB 3V7AE 2EYTB 2GITA 2IPKA 4OB5H 2CGRL 4M6MH 1HHIA 4AIZB 5EZJA 4QOKA 5IIEA 3DRQA 3PHQB 3MBEA 3RQ3A 4A6YA 1S9XB 3SGJA 1FDLH 4LCYA 5EZLA 3ES6B 2B5IB 4GG6E 1U3HC 5F9OH 3VFPB 2AS5M 2EECA 3WFDH 3HE7C 3QIUD 4YJZL 4WO4D 4JVWA 2R69L 5CKAA 1YEDA 5B8CC 3KDMB 5KSVA 1O7VA 4E9LA 3ZT5A 5CBEA 2H1PH 3QEQB 2P5WE 5KAQF 3WHE1 4X6DF 2AXGA 4M7LL 1RK0A 2XNAA 1AC0A 1MCIA 2RGSA 4OLXH 5DMKB 4GMTH 4P4KB 5ESVB 3K4AA 4KJPD 5T5FH 3CX5J 1CQKA 1FZMB 3HC4L 4BA8A 5EU3A 2VDOL 5M7QA 1UVQB 2CO6B 3OMZA 2XN9A 1UJTA 5KSUB 4DN3H 5I8OH 2VXTH 4PRNA 4TUOA 3BP7B 1ES0A 2HFGL 4LLVB 5IMOA 3BH8B 3M1BB 4PGEA 5A16B 4HFWA 4QT5A 3B9VA 3HS0A 4APQB 2R1YA 3O6FD 5IB3A 5FYLE 1VA9A 1IKFL 3NFNA 5T1LA 3UZQA 4EIZC 1Y6KR 3P4NB 1P84K 2BVOB 3NBNA 5EOTB 4N0YL 1UGNA 1HINL 3D39E 1EMTL 2NXYB 3NIDF 4CU8A 3BAEH 4LMQI 3AROA 3RPKA 4ZYKA 2V5TA 1S8DA 3D6GA 3RI5F 2ZUSA 3LS5L 1HH6A 1Q94B 3O3AB 3OBAA 4LSSH 5JDSA 3FQWA 5F7KC 2OJEA 3JZ7A 5GS1A 2EEAA 1C8PA 3BD3A 4YXHL 3SCMD 5IUSA 3AUVA 4LRIC 1KACB 5D1QB 5I1GH 1FAIL 5TF1L 1T66C 4Y1AD 3MO1B 1A02N 5FM5O 4KVCH 1FVDA 3MV8A 1EUTA 1YNKL 1VADA 4GLRI 4MJIA 3JV4B 2R8SH 5I76B 2DLFH 4U1NB 1WFTA 1VEOA 1XGQA 4R97B 5LGJA 5L9DH 1N26A 3FOMA 4IHOB 4X9BA 2D3VA 3AS0A 2AJZB 2P5ED 3JWOC 4ZPVB 3E2HB 2EDXA 3N85H 2WZPD 4PJHF 3NACL 1KJMA 4PP2A 4S2SB 2EDBA 5BMFL 1LDPL 3RWHA 2Q7YA 3FO1A 3QEHB 2CK2A 4G8FA 1WV7T 3G9VA 2O61A 1T1ZB 2MTPA 3WEXA 3HAEA 5TQ2L 4AQ1B 1AR1C 3KYNB 3MACL 5GSVA 1S9VB 1YN7A 1BJ8A 1N64L 2ATPA 2NXZD 4ZAKA 2DQDL 3IJHB 1NAMA 3PDOA 2PW1B 4NM8L 5GRXG 4NHCL 1N6QL 1AI1L 1ZHBB 5E2VL 3P4MB 5KANI 2PO6A 3REWA 1Z3GH 1C5CL 5D2LF 3KHOA 3L7EA 3MLPA 2E7LA 4KKBD 1H5BC 4FTVA 1SVZA 3TO4D 3KXFD 5HGHA 2Z31B 5C3LD 1YEHH 1DFBL 5HDQL 4F7TA 1N5AA 2FBOJ 2OQJB 2OS7A 3WNMA 1EHAA 4J2XA 1AXSA 5GSRB 4U1GB 3TT3H 4M6NL 4LSRH 1GZPB 1YA5A 4XPFL 5AZ2L 5CCKH 1MJ7L 3PP4L 5I17A 3MRHA 4NFCA 4PJDE 3MRNB 1MFAL 3GHEH 4HBCL 3ESVF 4NN5C 1H0DB 1A2YB 4O02L 4P46C 4P2CG 3H8NA 2DDQH 2JCCF 3V0VA 1GGCL 4JKPL 3W9DB 4Y1AE 3MJ7A 5FGSA 1ADQA 4LASL 2NYYC 1T0MA 3IVKB 1H3TA 5AD0B 1I7RA 5K9JL 4I0PB 4K3JL 3V52L 4K07A 1CICD 2CKNA 2BNRD 5E94A 2MHAA 4V1DD 4NUGH 3QIUB 4WO4B 3ZL4L 3FB8A 4X7SL 2O5ZL 4M7JH 2UUDK 3BPOB 3UPRB 3AMKA 1R3LB 1E27B 4JQIH 5B22A 2I9LB 3LS4H 4CVZB 1NCWH 1T7VA 3EYUL 3SKJL 1VFBB 2P5EE 4PJEE 4N8CH 1F02I 3NN8A 3LIZH 4NC1C 4OT1H 1ZHKA 2X7LB 1NBVL 4F33B 3QEUA 2COQA 1FL5B 3HZKA 2QSQA 4RMVA 35C8L 2NX5D 4MWFB 1T2XA 4P4KC 4H1LA 4PJBF 5I71C 4K9EH 5FO7B 1K6QH 2GW5A 5IF0B 3MRIA 4HWUA 3EHBC 4TQEH 1P7QB 2GTZA 4OGAD 4Y8AA 4PJ7F 1SEBA 1OWWA 3T77B 5H37G 1U3YA 5E6ID 5FHAL 1FZKA 4HWBL 1NEZB 4MLSA 4XB8A 5IBLC 2XRAH 2AK1L 4K7PX 2RFXB 1CK0H 1MJJB 1L7TL 3BIKB 5LKNA 5D7LD 2E8YA 5E2TH 2EZ0D 4JAMA 4KJWC 1AY1H 4IIQC 3QHFL 3MLSL 3WSQH 3MLYH 5DRZB 3U9PL 3UTTB 5GGQH 3GJFK 3KXFE 3QG6A 1MAKA 5F88A 5C0JA 2D7PA 5FYLL 1L9MA 3W2DH 3EOTL 5CJ5A 5DMYA 4KZEH 3H9SD 3JUYA 4LL9A 3DYMA 1KIRB 1U93B 4HIIB 4HJJH 2W9EH 4FQJL 3MRLA 5LAXB 3TBYA 4IOFC 4QTIL 3QG7L 4X6CA 3K8LA 1P1ZB 4HS6B 4LDOB 1F6LL 5FOJA 1A6UH 1Q9WB 3OZ9H 2IADA 1J1OH 4PTUB 1QO3A 2DQUL 1MAJA 1ZT1B 1IGTA 5HBBA 1FZOA 3CFDA 4HWEL 5IVXF 2VL5A 5F7FA 4PBXA 2I5YL 4PRID 2BNRE 1IAMA 2Q8AH 4B41A 4V1DE 1S5HB 2AP2A 5TQ0H 1XGYH 2R23A 1HCFX 1M7IB 1TTGA 2FH6A 2NR6C 1OAXL 2VOTA 1CF8H 1NGWB 2X09A 4L29A 3V7AG 3MOBL 1P4LA 4BSVA 4RWYL 3QUKB 1F58L 4R97C 3K0WA 1MUJB 1YJDL 5GZOD 5TJWK 4L3EA 1NC2B 3RBGA 3GM0A 1XCQB 5IVNA 5IGXH 3B2VL 5HYSA 1CDYA 4POZC 2GI7A 3TBWB 1KB5H 5KVFL 1E6OH 2O26U 3JWDH 3DIFB 4XP4L 4F57H 2APXA 5JPNB 4A2MA 2P8MA 3PWJB 2JIXD 3K4ZA 5HI4D 5EO0A 3EKCA 4NO5A 4KRPC 5E0QA 1DEEB 5LWYL 4I3RL 5ACMA 3HMXH 1INDL 5CSZA 5FCUH 1X5GA 3O3UN 1HWHB 2NXZB 2AXJA 1HQRA 5MI0B 4O5LL 4BYHA 4QRTA 4RX4D 1QSFD 1H3XA 1U8HA 2W91A 4OFIA 2C7UB 2J8OA 2B0SH 5E70A 5D7LE 2ID5A 3NCJH 5IOPB 4X5WB 1MCOL 5L2JA 3LQZB 2FWOA 2KQNA 1D9KB 3Q5YA 1M71A 3UP1A 1AP2A 1U58B 4OLYL 1QKZH 3KXFB 4XVSH 3KLHD 3GHBH 5JZ7D 2QEJA 1GIGL 3FQXA 1K85A 3L5WB 2Z92B 4BZ1L 5E2UL 1INEH 1EGJA 2MKWA 3ARPA 4ENED 1OAQL 3H9SE 4C56B 4IMKA 1ZEAH 3FO9A 2ORBL 2G2RA 3V6OC 4BSWA 5KS9F 3KJ6L 3PGFL 2XXMB 4QRRB 1T20A 1U8MB 4OD2B 1F3DJ 3FQRA 3RPIA 2YN3A 2H9GB 4ALAH 2VSCA 2GIYA 1SY6L 2EXWC 4EN3C 1IGJB 2OXGA 2R29L 2VLRA 1EJOL 1F4WL 3BGMB 5KSBB 1AGBA 3ARDD 2ARWA 3UZVB 3DX7A 4JEGB 2GEEA 2WIIB 1CICB 2H41A 4PRIE 3VGHA 4KXZI 2BNRB 2I26N 4V1DB 1D5ZB 1DANU 1QYGH 3SBWA 4WU7A 5DUPL 5AAWA 1MCLA 4WFED 4XP9L 1W72L 1Q9KA 4O9HL 1T89A 1U8PA 2EYSB 4RAUB 1YDPB 4KRMB 1CGVA 3SE4A 3NA9L 1CE1H 1EBAA 1RQ5A 4WO4C 5B3JE 1A7QL 4M3JA 3FHQA 1QRNB 4TYUA 1OAUH 3BPOC 4ONGL 3TNMA 1KN4L 1PG7L 2D03H 4UOW0 3U7WH 4AZ8A 1MOEA 3ZSSA 1F00I 2FL5A 3IAGC 3OAZH 3P30L 3EYVB 2BC4B 4PJXA 4QYOB 5BRZB 3EJYD 3NZHL 1QBML 3AS2A 4BZYA 4KJPC 3VXRB 1KTKE 1EPFA 2VDPH 1FL3B 3RHWF 2WMPA 4M00A 1WAAE 2DQHL 5F89B 3MCKA 1FO0H 1TPXB 3WJJC 3TH2T 4YHPA 3GNML 2M26A 4MXWH 5F9WB 3QULA 3LOWA 1JWUA 3B43A 3L1OH 4N0CC 4LF3A 3C08L 4ZUVA 1T5XA 1CXKA 3O6FC 3AXLA 5D7LB 4DW2L 1JPFA 4NJAH 3T2PA 1A3QA 5EUOF 3EOAA 4F80A 5HJ3A 2BVQA 5FUOH 1MWAA 3N50A 3CPLB 3DLQR 5DYOA 4MA1B 2Q87A 3TBVB 3L7FB 3MJ9H 5C0BA 3G5XA 3RDTD 4UU9A 5TE6H 2DQCH 1RIUL 1TJIH 1KB9J 4WCYH 1M1SA 1HN1A 4Y5VA 4XCEB 1I9JL 5DRWB 4OAWA 1AFVL 4P5TA 5D1XA 1ZT4A 1DN2A 2QSCH 2W92A 3BP4B 1O5DT 4K7PH 1U8KA 1M05B 4UUJA 4W4NA 3VW3H 3O6ML 5F97E 1HZHL 4PGDB 2J8UF 5EA0L 1T04B 1OT1A 4JRYD 4LSVL 3SCMC 4MJ5B 3KPSA 1MCPL 4K7FA 4P57B 3TVMA 1XGPA 5J4MA 1T22A 1DDHA 5ESQA 5IG7B 4PRIB 3S88L 4MLIA 3VMOA 1S7RA 5IW1A 4OLVH 4OQTA 1HHJA 4HUKB 1N8ZB 4WFEE 1MI5D 4XC3L 4HG4K 4LSPL 5JNYA 5C7XH 1X5KA 4EKXA 5ABDE 2XA8H 1OSZA 1WLHA 3A6OA 3LRGA 3H9YA 5FM8A 5GRVL 4UQ2B 4XWGH 3AAZB 3JVGA 1Y6MR 1W8NA 2HP4A 2WWKO 5D7JB 2R15A 4MB4A 4LVOB 4YHIB 3HR5A 4FQIH 3TPUA 1BVZA 5C0DA 5K59F 3VDCA 5GJSH 2FGWH 5INDB 3B9AA 1CLYL 2VLKD 4Z8FL 4KFZC 1QUNA 2IBGA 2F5BL 3RVTC 3VFNA 4M1GH 4RDQG 3BFOA 4HUMB 2Q86B 4LIQL 1NGZB 2JIXB 5TDOA 1F2XK 5CD3B 3IS0X 4UDTA 2FX8L 4XPTH 1P6AB 3FAXA 1L9NA 1IQDB 1KULA 1D5MB 1F4AA 2NZ9D 4UI2A 1FH5L 4FRWA 5IB5A 4S1DD 1FBIH 2XWBA 4OSUL 3LCYA 5CWSB 4PJIF 3A6CH 5I1KL 3IETA 2NXZC 3FQTB 1ZVHA 3IU3A 5MI0C 1C7TA 3I02B 4JANB 3VXSD 2B8OT 5CBAB 3H2WA 1JTPA 4PJFA 3KNBA 4M7KL 1X5LA 4KKBC 4OIIL 4JKWA 4HUWB 1XIWD 3MRKA 4YK4B 4XXDB 2YC1A 4L8DB 4Y89A 3TO4C 1IGCL 3ZE2F 2E3VA 4AEEA 4KQ4H 1CDGA 4TSAL 1TQCB 2ZPKL 2DIAA 5D8JH 3RVWD 4DGIH 3OV6A 3H0TB 4YXLH 3NH7L 3ZE0E 7CGTA 2VXSL 1GAFL 5FUCC 4V2BA 1R3HB 1E4XH 1CT8A 4KUZH 5D6DC 4JRYE 4OZHE 5EB9A 2RIKA 1LO3L 1RUQL 2VXVL 4KMQA 3D2UD 3S3PA 5C2UB 3ARDB 3TZVA 3OGCA 4C59B 2CDEA 3BX7C 4OTXL 1MI5E 1MRCH 1AXTH 2D2OA 5HHQA 2XICA 3O2WL 4XPAH 1T4KB 1CDJA 1LDSA 4BKLB 2AKRB 4IDJL 5ACLA 2ATKA 3V4VH 3CFIC 4X4XA 3TA3D 4HMEA 4FQLH 3MLTA 2ZOKA 5DDHB 1FC2D 2VLKE 4JGUA 3WE6A 1PSKL 3HC3H 4M8QA 1FGVL 1MCNA 3VFRA 4CN1A 4HIXH 4UV7H 5DZNA 2C4FT 5I74B 3QQNA 5LBSH 4NQED 4CAGA 5CD5D 2VNCA 1FRGH 3MLVL 4ELKA 3WIIL 4E41A 1I9RL 1CFBA 5HY9B 3LKRA 4K94C 2YPKA 2NQCA 1BZ9A 1OAYH 2E5EA 4OGAC 3RY4A 4HFUH 4HXAH 5IJKA 1TETH 5D72L 3DGGB 4ONHA 2BNUA 2ZOLB 2A6KA 4LOUD 4G6JH 5E6IC 1EO8H 4X7CC 1GGTA 4PJ8C 4JO1L 1EA9C 3VXSE 1RZ7H 4HXBL 4QXGH 3E1F1 5IMMB 3HNSL 2EIEA 4GT7A 2EZ0C 3MRBA 1YNTA 3RDTB 4IDLA 2YSSA 3ULVD 3MLUH 5IT2L 1PKOA 4YIQB 5DMIH 2MWCA 5C6TH 1JGLL 4YH6A 4NRZA 1BLNB 3AS1A 4YFDB 3GSNH 3S37X 1I7TB 3CDGB 4PGCB 4YAQB 4JRYB 4OZHB 3KWWA 3VXQA 4NCC1 4ZFOB 2XG4A 5EZIH 5LGKA 1PKQE 4RCAA 3QXDB 2IF7A 3BJ91 3FONB 1DZBA 3C6LA 4NNPL 3UO1H 1YMHB 2OTUB 1JRHI 2VZ3A 4XBGB 3FTGA 5I8EA 3VFUA 1MI5B 1KEML 4Y16D 4FXGB 1JHTB 4MA7L 2E6JA 2LTQB 3LH2H 3OKMB 1RUPL 4JG0L 4KTDL 5I6XB 3JBG7 2EKJA 4XMPL 4WHTA 5IB2B 3GKWH 4F2MA 3DROB 5JIKA 1CDIA 5FHBL 1W0WA 3L3HB 4P2QD 1EUUA 3LRSA 4YDIH 2QADB 2XXCB 2AEQH 3EDJA 3L6FB 4G8GB 5GZOC 4LVOC 2HVKA 1KCSL 4KVNH 4GKOA 4NKQB 4IS6A 1EZVY 3TIEA 4NQEE 5JW3H 3VFOA 3PP3K 2ZG1A 3MROB 2ENYA 1DVFB 1UZ8B 4TSCH 3VCLA 2V7HA 1JGUH 4YWGL 3QQ3B 5HI4C 4Q6IB 5CEYA 4JFHD 4OGXL 1NFIB 1CXHA 4P2OD 1BHGA 5DJCB 4KKLD 5CUSL 2V7NB 3BQUD 4KJYB 3ZKND 3OR7A 3U2SB 2Q76A 4WFFD 3QFDA 3I75B 3BP5B 1D6EA 2X4OA 1UXSA 4XP5H 3V0WH 5J1AB 1AH1A 1Z9MA 5AZEL 1FVCA 3ULVE 2NW2B 3D18B 4ODVL 1LO2L 3KLHC 1CFNA 5JZ7C 4ENEC 4LLUB 3MXVH 1J12A 2AVGA 3EOBB 3IGAA 3CCHA 3K1KC 1QBLH 1VFMA 4F7MA 3OAUH 5I16A 3QWRD 4OF5A 1LK3L 3RTQD 3WXWL 3P73B 4RFOH 3X3GL 4JY4A 4WW1B 1YEJH 3D2UB 4WUKL 1TJHL 3WLBB 1M7DA 4Y2OA 3VRLE 5DJ8B 4ZOCA 1C08B 1OTTD 2DMKA 4JRWA 5TDPA 2XKNB 3P9LA 3U0WH 4JM2A 2ZUUA 1YEEH 3ULUH 4NKMB 3THML 3ARDC 4XCYA 4Z0BL 3TFKD 4FZEL 3U7AA 3DX8B 4J12A 4ZFOL 4G9FB 3EIFA 1BIIB 1M6OA 5FGRA 1DSFH 2FEDD 3SN6N 1N5YH 1ORQB 3U4BL 3LZFL 3MBEB 4P2QE 4WY7L 3WFZA 3GO1H 4JQVA 3T4AB 3RA7L 3G6DH 3FT2A 3BSZL 1IL1A 4HULB 1CE6A 4JFQB 4XHQA 3VE0A 3HNVL 4FOMA 3VH8B 4NQEB 4YFLI 3S7GA 2YEZB 4LSUH 4PR5A 3WS3B 5BV7L 3EJYC 2IAMC 4K23L 3P77B 1J8HA 2QQQA 5I74C 5E7BA 4U1IA 2R0KL 2FB4L 3L3OB 1T3FA 3IDMA 4JFHE 4NQUA 4CVWA 2LU3A 1PY4A 2VLLA 3EFFB 4NO3A 5MEPA 2Z4QB 1JMZA 3DMMD 4M1DH 3KPRD 1UKQA 4WFFE 2H2PD 3RWIA 3RAJL 1DBBL 2EDKA 3T0VA 1G0YR 2XQBH 1XF5B 4OUUA 3RWFA 2R1YB 3RDTC 3UJJL 3QDMA 2X89A 5CJXA 2Z91B 2HH0L 4OM0L 2X4RA 2HMID 5D7IE 4CVXB 5I1AB 4N1CA 5EUKB 3BP6A 2IH1B 3C5ZD 3BWAB 3TJEL 1XGTA 4KUCD 1QFWL 5IB1B 4HHAA 2A9NL 1VPOL 5AUMB 3V4UH 3QHTC 5T5NF 4FQCH 4LLQA 2GT9B 1F2QA 1NKOA 2J7LA 2IPUK 5E4IA 4OZGE 2CLZB 5JUEH 3F7RA 4XHJD 4JN1H 5GIRB 1ERNA 4XB7A 2HJFB 4UTAL 4ZUSA 1KTLB 2XZCH 1MFBL 1RZKL 1KG0B 1D6VL 4X7DC 1XR9B 4NRYB 2VQUA 4TULH 3S37H 4A6YH 4MA8H 1SJHB 5TGBB 1NANH 5TPWH 5DEFB 4Q9QL 5I6XC 4X6CF 4JFDB 4O51B 5BV7C 1FJ1B 3QYCA 1WBXA 3OKDA 3MX0A 1UEMA 4P0DA 1U36A 3DI2B 2ZJSL 1G9ML 2B2XL 3V6ZB 3I50H 1J0KA 4NQDA 4FFVD 4OGZA 4WDIA 3TF7C 2PYFB 1F8TH 1PVHA 3CIQA 1NGXA 1S7SA 3BHBA 4S1QH 4AEHH 3Q2CA 1HSAA 5DHVA 1JZ4A 4P2OB 4YE4L 1Q38A 2AW2A 1CZ8L 2NZ9C 2VE6B 5ACZB 4QXWA 3RWHB 5D2NA 4DGYL 4Q6IC 3QUZA 4S1DC 4HKXA 1SM3L 4JZOA 5CEZH 4U31A 3KPRE 4ZS7H 5KTEL 1HEZB 2DQIH 3V9FA 3IDYC 5ADOL 4PJ5A 2VDLH 4NT6B 2E7BA 5BCAA 2AXFA 1CLZH 3AS3A 3QNXA 4R0LB 2X4QA 2XQYG 4OZ4B 4RAVA 3D9AL 5DJDB 3UYOD 1T21B 4PTTA 4H20L 3NCBB 4O58L 3CVHB 5D7IB 1XIWC 5F7EL 5CS7A 4IJ3B 1Q1JH 3KLAB 3TN0D 2R2BA 4BZ2L 4NQSA 3RVWC 3ULVL 3TBTA 1DBAH 3RTQB 5DJYB 2ZUQC 5DO2D 4OZIE 4JFYA 5CP3A 1OGAA 1FPTL 2HVJB 1RZKC 5F7NC 1EEQA 4PIRF 2BFVH 3WHE0 1UA6H 3QAZB 3I84A 4HKJB 4L4TD 2PXYB 4LARL 4OFVA 4IRJD 4AT6A 3X3FL 2NNAB 3O0RH 2BY3A 1FLRL 4GS7C 4KQ3H 2JJVA 1LQSR 3LKSB 1FNEA 1YEGH 5DZOA 2DM2A 3BKCH 3C6SB 3DURB 3N1QC 5DVMA 3W0WA 4U0RC 2BVYA 3TA3C 3CH1A 1LE5B 1G7HA 3WNKA 1BBDH 3OXSB 3FB8B 5IV2B 3LKQA 1FVEA 4Y4HD 1CGTA 1UXWA 5JR1H 4WU5A 4DAGL 4DEPC 4NWUH 1RJYB 3LKNA 4HS8L 4Z7UA 3NZ8A 5CD5C 3ARFD 1CXFA 5C8JA 3SOBL 2ZUTA 1T6VN 1Q9LA 5I8CA 1P5UA 3B2UD 1U8NA 2FHBA 4EDXB 3TM6A 5BVPH 3NCMA 2EEDA 3HAEH 4XNQB 2IPTH 3CFEB 3KPRB 2PTUA 3VH8G 4LOUC 1D5XB 2I9TA 2VXUL 3UTZA 2WBJD 5IVZA 4FFZH 1DQML 1EEZA 2CLRA 1U2HA 3BEWA 1CD0A 2X70B 3BYYA 3OJDA 1NAMH 4RRPG 4NCDA 4PJXF 5CMAB 3VFMA 4OF0A 4LK4A 1MH5B 4X6FB 2FECL 3ULVC 5EPMB 3QNYA 4LEXH 1PX3A 3C5ZB 3JXAA 3U4AA 2NY1D 2GJZA 4GAGH 5EBWA 1ZVYA 3O4LD 4QGTA 3C2AL 2AJSH 3IFNH 5J0BA 3IFOB 5K9OB 4OFPA 4OZIB 5IBTH 4U1SB 3CVHL 3MRQB 2EE3A 1IBGL 1GGBL 5KG9B 5I1JH 2D9QB 3GKZA 4KI5F 1CGYA 4L4TE 1EAPA 5I75B 1UB6A 1CL7H 1T80A 4FQ2H 1ADQH 4Y16C 3WDHA 1G7LB 5DZLA 4I18B 3BZFB 1M7XA 5DA0B 5IFJB 2W65A 4OF8A 1GGIL 3T8XB 1OOAA 2EH7H 5I66A 3DRTB 3SQBA 2DL2A 3FQNA 2JELH 1OP5K 2BOBA 5C0IA 4EI5D 2Y7QB 3R8QA 3F7VB 2VDKH 3KPQA 5GISH 4PJGA 2P8LA 1MFDL 3LN9A 1GYAA 3L3DA 1C1EH 5EG6C 3GI8L 3QUXB 4WGVB 3PL6D 1AGDA 4OFKA 5DVLA 5I30L 5EOCJ 2ADFL 5F71A 2R4RH 1MHCA 3H42L 3UAJD 5LVEA 3NIDE 4H1LH 2D4FA 3RUGA 1KEGL 5C08D 1SYVB 4KKLC 2FBJH 4ZOEA 1N4XH 5HI3C 3SQOH 4LVHC 5GRVK 4OCSL 4H8WH 3OF6A 3BQUC 2UZXB 3LPWA 3DO7A 2PYEE 4DOHE 3T0WA 3D25B 3ZKNC 1F11A 1CG9B 3MUGB 5IWLA 4L3CA 5L8LB 4R96B 4BFBD 4QHLA 2FLRT 2A6JA 3Q3GB 1SEQL 3O4LE 3T1FA 2SEBA 2XZAH 4U3CA 1JNHB 5EO9B 4R8WH 2H6PB 3KPOA 5J11B 1HI6A 5KJRH 1ZT7B 1A4JB 3MJ8A 1MHHA 1W0VA 2QHRL 1I3RB 2PW2A 2R0WL 1ULVA 4ZPTA 4WWKA 1BZ7A 1MCEA 4CADB 1MVFA 1OGTB 4R6UA 4HJGA 5CJQL 3RWDA 1QNZL 1OTTC 1BM3L 4O2FA 1A6ZA 4I5BA 1ZLUH 1ZANH 1QFWM 4PJFF 3FQUB 3TNNB 2WUCH 1ETZB 1I8IA 2YPLB 3D85D 3MNZA 4IRJB 1TCMA 2Q7NA 1AHWA 3TFKC 5KSAB 4HK0B 4PJHE 1R5VB 4PPTA 4G8EB 3V4PL 3EYFB 4Y5YA 2FEDC 2LFGA 4GW4B 2FATL 3P4OB 3VJ6B 1TVDA 2DYPA 5LCVH 3GJFA 4XNUH 1DE4A 2RAMA 1FNFA 1L0YA 4LLWA 4RFEB 2O5XL 4WV1B 1PYWA 3FO2B 2XYCA 1Q9KB 2AGJH 4Y4HB 1A9EA 1EK3A 1NCBH 2R4SH 1FN4A 3L3JB 2C5DC 3ARFB 4JQIL 4P3CL 4U6XA 1KJ2B 2MMXA 5E8OB 3T0DA 4PG2C 3CC5A 5CHNA 1K8DA 3GIVA 5IHZB 4F7PB 1JVKA 2Z8WC 3ZKXB 1Z5LB 3EO0B 4ZUUA 1V7MH 5IEHB 4MNGE 2BNQA 5IM7A 4PV8B 5JHDA 1K5NA 5C08E 2P7TB 4ZG1A 3BUTA 3QH3B 5DUMH 4K9EL 5IROC 3EO9L 3RL2A 4P9ML 3DMMC 3MNVA 3NFSH 2PYEB 3L5XH 1BJ1J 4G8IB 3L3GA 2H2PC 3QULB 1KXQE 4TTDD 3DGCR 5HHOD 2X4SA 1RD6A 2OK0L 4MNQA 4JDZB 2VB5A 3GIZL 5AYUL 3WIFA 1IAIH 4QRSA 4W6XB 1CR9L 1RFDL 4XC1L 4JFOB 3WN5A 4H1LG 2HMIC 3GFUA 2DN7A 2EDRA 5FA3A 3VXOB 3C5ZC 5IESL 1AGFA 1EGJH 4NNXA 4WHYG 3G6JE 1NCAH 1CXIA 3O45B 1KFAL 1XZ0A 5JIIA 1I3GL 2R0LL 3U46A 2PETA 4F7EB 3MFFA 1T2JA 1RURH 2HJKA 2MKLC 1UC6A 4JY5L 2AK4D 1ZHNA 3L9RA 3ZDZE 5F70A 1S7TA 3LDBC 1JZ5A 1I1YB 4XHJC 4R3SA 4J3SA 2ZZUT 2HFFA 1UG9A 3CK0H 5C9JA 4MAYC 4C83A 5EU6D 4NHUA 3T0AA 3TVMB 3CDFA 5IBUB 2DWEA 5C70A 4KTYA 4U1KA 1RU9H 5E8PA 2G5BB 4JRXA 5J9PA 3MRMA 4C55A 1B0GA 4DJMA 4X8XA 1G1CA 4KRLB 4PB9H 5DUBB 4G5ZH 3ARQA 1BAFH 1NKRA 2VABA 4N5ED 3U79A 2C3XA 2FLBT 4XNXL 3O9WA 5FOBB 1MCKA 3BZ4A 4RBPH 2F54A 5J12C 3CVIL 4QXUH 4RA0C 2V2WB 3QUYA 3QQ4A 1NFDA 3MNWB 4LHUA 4FFVC 5BS0D 1WK0A 4K9EC 3FFDB 4I2XE 4M5YL 1CXLA 2AJXH 2VLJB 4MNGB 5C08B 8CGTA 4P5KB 3N1GC 5ENWB 2DD8H 2FIKA 1MFCL 5MEQB 2CPCA 1RMFL 2OP4L 2YD3A 2ITDA 4ZUTA 2W60B 5HHOE 5KVGH 1IGIL 1VGKB 5E2WH 3GMOB 1RUML 2A38A 2EDDA 4JPVH 3QPQD 4EEEA 5F1IB 2EDTA 3HUJE 3CUPB 8FABB 3CLEL 1MWAH 3WKMH 4YHYC 4LQ1A 2OR9H 5J89A 5GS2H 1HNFA 3ARED 2QQLH 5IFAH 4JFZL 5DVKA 3TN0C 3G6JB 5D93B 3HG1A 4MDIA 1KV3A 4GBXA 5DO2C 3MOQA 3GSWA 3VGAB 2R2EA 3ILPA 1U8OA 1KBGL 2AK4E 3LMJL 4KC3B 2BJML 2UWEA 1IC4H 1HHKA 3RY5A 1DQDH 5F9AC 1K2DB 3BPNB 1CT8B 1RI8A 4I4WB 5MEND 2ZUVA 1WZLA 5EU6E 5CEXA 5IQ9B 3PQYD 1UZ6F 4U33A 4I48B 4IRJC 4Y5XA 1KPRA 1CI5A 2D31B 1NBYB 4OQTH 5SWSA 3TZVB 4Z7VE 1JGEA 5D70L 3V6BR 3QO1A 1QYGL 3FB5B 4UDUB 5DK2A 3VRIA 1MVUA 2BP3A 1NMAH 2IALA 4PG9B 3TYFB 5DRXB 2OI9B 5IMLA 4MD4B 2MCPH 4Y4HC 2VIRB 1VERA 4JM2F 5BS0E 5EBMA 1N3NB 4E5XA 2FJHA 1T0PB 3IKKA 1KT2B 1BQHB 1S7XB 1DBJL 4LNRA 5F7MC 1PQZB 4WEUD 3LKPA 3SDAA 4OCRH 3O2DA 4KWUA 1QA9A 1MREH 1BBJA 1IEHA 1HILB 1V3JA 2ADIA 4L9LB 3ZKXC 5C2BH 3C5SB 4BQCA 1IEBA 4JZNA 1IGML 2QQKH 2WAHA 3QQ9D 2FIRT 1ZTXL 4HJ0D 1CFVH 4NKDA 5DQJA 2WBJC 3BRFA 5I18L 3GMQB 2IQAA 4MXWL 5HHOB 2B7DT 4BH7B 5D6CA 3U0PA 3REVA 4P5MB 3HUJB 3MQIA 4X6EA 4QXTB 5SWZA 1RZFH 5I15L 4NZTL 4XTRD 4U6VH 1FG9C 1IM9A 2OYPA 3PWPD 3LHPH 5M94B 3FO0H 5C6WH 3CLFL 3W82A 3D87B 4BQ6A 3IFLH 2DICA 2NY1C 3LN5B 3MA9H 3Q0HA 3PE9A 5DEGB 2MNUA 3QUMA 5IHUL 1QQDA 1CWVA 2KDGA 3GEWB 4Y4KA 5FO9A 1GJIA 3VXNA 4ORGB 1JZ7A 2NY4B 3QCTH 2OX5A 2HLAB 4FQQA 4AEFA 5E9DD 3E6HB 4XCCH 4YHOL 3T3PF 4Z5RB 1O7SA 4K7PL 2XQYK 5ISZD 1TTFA 4FP8H 3OWEA 2ZNXA 3ZYZA 5MENE 1TVBB 3QNZB 1FLTX 2WINA 3KYKH 3PQYE 4RIRB 1U3HA 5FYJH 2OSLB 3MRRB 4JJHA 4OKDA 4OFYA 5BZWB 1MY7A 2PTTA 3UZEA 4Z7VB 1X7QB 3WHXB 4LU5H 4NC2B 1GOHA 4H88H 5I8EB 1R3KA 4KJQC 2A73B 3ARXA 5SX5H 1MLBA 1DR9A 5CP7B 4PV9B 3EZJB 1TNMA 2KBGA 3CFBB 5FYJU 3SPVA 4JPWH 4JPIB 4EI5C 4XNZB 4N9GA 1UB5A 1KOAA 1ORSB 5DJXA 3WIHA 2CIKB 5DJAA 5BS0B 1LILA 2FJGB 4JDVA 5EUOE 5IBUG 5JHLH 3D69A 5SX4H 1GC1H 4HPOH 2VQTA 3MOAH 1RJLA 5GJSL 2FGWL 2CKBB 3PL6C 4HWZA 4NP4L 3H7BA 3ARBD 2DTML 3SGKA 1CFTA 1WIUA 4WI6A 3VA2C 4Y7MA 4B7IA 2DLEA 3NAAH 1S3KL 4XRCB 5HHNA 3UAJC 1B6DA 3VFOB 4U1HA 5L0QB 3QDJA 1DUZB