5L9FA

S. enterica hisa mutant - d10g, g11d, dup13-15, g44e, g102a
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
247
structure length
222
Chain Sequence
MIIPALDLIGDTVVRVVRQRDYGNDPLPRLQDYAAQGAEVLHLVDLTGAKDPAKRQIPLIKTLVAGVNVPVQVGGGVRTEEDVAALLKAGVARVVIASTAVKSPDVVKGWFERFGAQALVLALDVRIDEHGTKQVAVVSLEQLVETYLPVGLKHVLCTDISNVSLYEEVCARYPQIAFQSSGGIGDIDDIAALRGTGVRGVIVGRALLEGKFTVKEAIQWQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneam
publication title Structural and functional innovations in the real-time evolution of new ( beta alpha )8 barrel enzymes.
pubmed doi rcsb
source organism Salmonella choleraesuis
molecule tags Isomerase
total genus 70
structure length 222
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5l9fA00
3KRZA 4WUIA 2G95A 1W1ZA 2EHHA 3W2UA 5K9DA 1LRNA 1BTMA 1SUXA 4WD0A 3LTSA 4GUJA 1VHCA 3W7CA 2BWGA 2Y70A 3NQDA 3UZ5A 1YXDA 4KWVA 1GTHA 4MZ1A 1OYAA 2PE4A 4MPQA 3W1XA 1JCJA 3O06A 4H3DA 3W7OA 4MY9A 3G1VA 4FX7A 5F1UA 1TV5A 2WSYA 3JS3A 4LVFA 4ZZ9A 3T4CA 4MY1A 1J5TA 2EGZA 1ZAHA 5D2YA 2DJLA 2A85A 3IIVA 4JX4A 3USBA 4XTDA 1W5PA 3RLUA 4UTWA 2GVLA 4RXGA 4BF9A 2E6YA 1EIXA 1R2SA 4UTJA 1U83A 3G0XA 3VKJA 4Z1CA 2TMDA 4WY0A 3W3OA 1CI1A 2ZRZA 4JYEA 3EWYA 2X16A 3TUUA 4JTJA 3M41A 1KBJA 1K8YA 1W3IA 3B0VC 4HNUA 2CZDA 4MOZA 1TTPA 4UTTA 2V9DA 1FXQA 1EWDA 5I3GA 4ADUA 3UWWA 1JCXA 2JKAA 3PSWA 3S1VA 3FYPA 4LC8A 4QNWA 1L6YA 3A9IA 2DZPA 4HHPA 4JY8A 1SO6A 3NL3A 1MXSA 5CSRA 1L6WA 5EMUA 6ALDA 1IIHA 4DO4A 4Y8FA 1IXOA 3TQKA 1LBFA 5CKSA 2ALDA 3B03A 2ZZ2A 2YXGA 5AYYA 4O54A 1JJKA 3GYEA 4OT7A 3N14A 3P8IA 4PODA 3T44A 1MZHA 4GUGA 4K8EA 1S5VA 4GUFA 4NU7A 1AMKA 3HG5A 2VFIA 3N2XA 1RZMA 2DZSA 3F4NA 4UNKA 1GVFA 4X22A 2C1HA 2JGQA 3G3MA 3DFTA 3BGJA 4GBUA 3KHJA 1OFQA 4HKPA 1OX6A 2Q8ZA 5D37A 4YCPA 3Q37A 1KFEA 1IXQA 3AO0A 4BWLC 4O1DA 1OG0A 1PCWA 4JY9A 3U8GA 1KM4A 4Q4KA 3L0KA 2PCQA 1F6KA 3IVUA 1LDCA 1QNVA 1AW1A 3W2NA 4LUIA 3IV3A 2YR1A 4H4IA 1LOLA 2DU2A 3WK3A 3LHUA 3C0JA 2DZTA 5L6UA 3NVTA 3W76A 4M6QA 2Y7EA 2Q8LA 1GYNA 5IBXC 2CLHA 3E12A 1SR9A 3RMJA 4N4QA 4RR4A 3GDMA 3QC3A 4UTHA 4GUHA 3RFAA 1W5NA 1EWEA 1H50A 3F03K 1B4EA 1TRIA 4UTMA 2X1SA 1HFBA 5G1YA 1X6UA 2QUTA 3LBCA 3P81A 2YDAA 4S2CA 1VR6A 4JS3A 5KZMA 3W75A 1FCBA 4MFDA 3TR2A 4AVFA 3EEGA 1J4EA 5H91A 5F4WA 1TPDA 5FF4A 2Z6IA 1T96A 1TV8A 3EWWA 2ABAA 1V5XA 4HNVA 1KM0A 3MYOA 1JUBA 1KLZA 3Q2DA 1VLWA 1JULA 3TMQA 2B0MA 3RK8A 3DI0A 3MHFA 3MI2A 1KTCA 4KWWA 1KM5A 4RX0A 2GVJA 2ATSA 3SR7A 2OZ0A 4TMCA 1BWKA 1KM3A 1JQXA 3O6YX 4FNRA 3R5EA 3THAA 4CNOA 1GG0A 4S1FA 3NDOA 4JIPA 1C8VA 3GDLA 1Z44A 4RZ6A 5I3HA 3DFOA 3OEXA 4MUZA 3I65A 2CLOA 1LOSA 4P2VA 1KM1A 1H1ZA 5CZ0A 4N9BA 3TH6A 4NJIA 1DQWA 3HGOA 1L6SA 4NUWA 1FWRA 1TQXA 4QITA 3QQ0A 3FYOA 1T0OA 2AGKA 4E38A 2EPHA 1H1YA 1UJPA 2ZZ3A 4GE8A 5LNSA 2PC4A 2YFNA 4JTKA 2X30A 4Y90A 4EVZA 1Q45A 3LI1A 3FFSA 2Y62A 2Y7GA 1EX5A 3L5AA 1QPOA 2FLIA 3W7KA 2XN2A 3W7GA 2B7OA 4Z0JA 2QDHA 3W7PA 1QWGA 4M7TA 5G1TA 1OFRA 2VEMA 3C52A 1SW3A 3N2MA 1RD5A 4OBTA 1TRDA 2UV8G 2A4AA 3M5VA 4OU1A 4PFMA 5D05A 5FEZA 1JCNA 1AK5A 4NZFA 3UPWA 5HWNA 5KINA 3EX1A 3TC6A 2QUVA 3EWBX 4A3UA 5HWMA 3P5ZA 4MJZA 3HMJG 2X2GA 4AMAA 3U2OA 2NXIA 1W5QA 2GJNA 5SWUA 3BK0A 2WNQA 1LCOA 4MZYA 3PBVA 1OK4A 3NNTA 1XFBA 4UFMA 3WJSA 2NLIA 4JTFA 3GNNA 1H60A 1PHWA 2RDTA 4AXKA 4TR9A 5D09A 4Y96A 1MEHA 1QCWA 4PEKA 1IF2A 4CCEA 3W2MA 5F2GA 3MW7A 5K3VA 1F7BA 3DI1A 2F7FA 3M9YA 2E5BA 1TREA 3EX6A 5KMYA 2VFEA 3W85A 3GX9A 3STFA 5I3IA 4M6VA 5CPOA 1ME7A 2DZWA 3A22A 4PTNA 2FPVA 1JQVA 4K6AA 3IGXA 2TSYA 1LBMA 4LNYA 1K7EA 4UR8A 3IIZA 5HQEA 5LNVA 3GDRA 3LGEA 3QF0A 3QMRA 3QQ1A 2A7NA 4MJMA 3UNDA 1YADA 4HSOA 2CWNA 1QO2A 3S5ZA 1UUMA 1ICQA 3EX4A 1TPH1 4IX2A 3RLVA 4CQ9A 2EAWA 3BG3A 5EKYA 4PL2A 3NGJA 1FWNA 3N34A 3PF3A 1MSSA 3NO5A 5DLCA 1D9EA 2DJXA 1NF0A 2J9XA 3LERA 3B8DA 6TIMA 1JRBA 2GPTA 2J6XA 1UUOA 5D2TA 2OX1A 4EIVA 5HUOA 4LW7A 5HR7A 3TQVA 2YPIA 1FX6A 3HO8A 3C2FA 1MEIA 3FKRA 7TIMA 1UBSA 2WQPA 1BEUA 3MHUA 2YW4A 2YX0A 3P82A 3PUEA 3EKZA 4CCCA 2EF9A 4UTUA 3A5FA 3LI0A 3YPIA 5AC7A 3NOEA 1P0NA 1KA9F 4OV4A 1FQ0A 4ADSA 4LS0A 2ZZ4A 4FNUA 3QJAA 1ME8A 1LRQA 1K8XA 1DORA 3JR2A 1EP2A 3L5MA 2YSWA 3VNDA 3PBYA 3STGA 1THFD 4UTWC 4I7VA 2ZA3A 1XBYA 1O5KA 1YDVA 4UXDA 4TO8A 1IXNA 2FPYA 1VC4A 3PB2A 4WX2A 3L67A 1LLWA 3L68A 4DF2A 3TW6A 1YLVA 3QM3A 3INPA 3N3MA 3ATYA 5TIMA 1TPVA 4ZVJA 3B05A 4UTTC 3F4WA 2ISWA 4UTKA 2FDSA 3SECA 4BI6A 3TSBA 4D2JA 3BLFA 3W9ZA 1W3TA 3G1AA 3NL2A 1JCLA 3M5XA 2QJGA 3DAQA 3CB8A 2JGYA 2CZFA 4RV8A 5J5RA 3O6DA 5K7JA 3GR8A 2F84A 1PE1A 1F5ZA 3W1LA 3SSJA 1YPIA 4N02A 1WAUA 3OIXA 1ZHAA 3P5YA 3W2JA 3PUOA 4UMBA 4IMEA 1A5AA 2E5CA 2WSRA 4O17A 2GJLA 1H51A 3CEUA 3DXIA 3TKFA 3IGSA 2NXGA 3TFXA 4PH6A 4OE7A 4Z1BA 2E1DA 3W7HA 4ADTA 1NVMA 2J9YA 4MY8A 5CZSA 1Q3NA 3HPXA 4M19A 3C61A 2WV8A 2V2CA 3H54A 4NJKA 4WJEA 5FEXA 3ABQA 3IVTA 4DBEA 2NX1A 3B06A 4PCFA 3DBPA 2A21A 4NQ1A 5A5WA 2DZVA 5L9FA 3KVLA 3SFKA 3TAOA 3ZFHA 1ZNNA 3GK0A 4HSNA 3LBMA 4TX9A 4WY0B 5HULA 1EP3A 3G1DA 3N73A 2Z1BA 4P61A 1DV7A 4O11A 1F05A 1W5OA 2ZRUA 4DO6A 3P74A 2ZTKA 2A2IA 3FKKA 4OHQA 2TPSA 5FF0A 3P80A 5G4EA 2VKZG 3O6CA 3W7JA 2I9EA 3TSDA 3PUDA 1DQXA 2V8ZA 2XFWA 4PL1A 4GFSA 3N9RA 2QDGA 1HO1A 1O95A 1VGAA 3M43A 3EXSA 1WBHA 4O16A 2ZDRA 2FB3A 2ZTJA 4N9DA 3QMSA 2NX3A 3O16A 2A7PA 1GJPA 1QOQA 4W9TA 3BW2A 1I2NA 4JNMA 4K39A 2V2HA 4RCXA 2C16A 5D04C 1OFAA 4IX0A 4MYAA 5T26A 5CZTA 3NQVA 4YMZA 3LCGA 3KVKA 4NNAA 3K30A 5E93A 4FO4A 5G2WA 3GXNA 2DZXA 1G7VA 2H3BA 1WBJA 4CQ8A 1DJQA 3O8AA 3P61A 1Q6OA 1PIIA 5HMSA 3AJXA 5D33A 1O94A 5LNRA 2C18A 5U7SA 3B0UX 3S42A 1VS1A 2IQTA 4AEOA 2V82A 1H62A 4JGDA 5LGXA 1GG1A 3W7IA 2YZRA 1G4SA 3TMLA 3W7LA 3R13A 4CQAA 4RZ5A 1R2RA 4LVBA 4JTGA 5GVJA 3HOJA 3MP4A 4N9CA 1Z41A 1PL9A 1SZFA 5E0KA 3WK2A 2J9ZA 4N4PA 1M7OA 2YW3A 1SFLA 3C2OA 3NYZA 2R94A 1KV5A 3MJYA 1D3GA 1TSIA 3FOKA 3C6CA 1EA0A 4LY8A 2D73A 3A24A 3LCXA 2NV2A 3TX9A 2B7PA 1LBLA 2Y85A 3ZWSA 2I1OA 3G22A 3W71A 1PV8A 4Z08A 4YL2A 3W7MA 3HF3A 4DPPA 1FY6A 1ZFJA 4UCGA 4JXCA 3HQ1A 1K7FA 2P10A 1F74A 4ALDA 3W72A 4TIMA 4YCOA 1M6JA 3DFNA 2ZRYA 2RHGA 3C2EA 5AN7A 4K7VA 3GIYA 3NQ2A 3R2GA 2G96A 1TJRA 4GXMA 5EPDA 4X3ZA 1R30A 5HUPA 1YXYA 4IXXA 3G1FA 2PRHA 1LZOA 2VFFA 2WKJA 2DZUA 3PG8A 3NAVA 1T99A 1SZEA 2JKEA 1QO5A 2RH9A 1HO4A 1WV2A 4JYFA 5F2LA 4UFHA 5CPLA 2Y7DA 4JN6A 1RQBA 1EUAA 4Q33A 3QW3A 3W1AA 1P1XA 4K8HA 3W1MA 1Q6QA 1AL7A 1NFBA 4MVAA 3HGSA 3IRDA 2J88A 3FEMA 2VXNA 4KKXA 4XTIA 3L21A 4E2DA 2FIQA 3LHWA 3NQ6A 3G0SA 3UWQA 4A29A 4E2BA 3M16A 3NPXA 4IMFA 2P1FA 3MYPA 4A22A 1O5XA 1NEYA 1L9WA 4DO5A 2NWSA 4U4MA 4E0CA 3B4UA 1SO3A 1KFBA 5AFDA 4BFAA 1HG3A 1SQ7A 3E96A 1F73A 1R47A 1OK6A 2Z6JA 4RK8A 4O8RA 5AC6A 2Y6ZA 3C8FA 3MUXA 4XBKA 4GUIA 3GDTA 1VLIA 3NQ8A 5FEWA 5BNKA 1KLYA 3GZ3A 4IQLA 5D2WA 2CW6A 4WZHA 4NX0A 3BVJA 4AHPA 2BX7A 4JYDA 3KAOA 4WY0F 3TROA 1IGSA 5CSSA 2ZQ0A 4UIOA 3LLDA 3LHYA 1KW1A 3LRKA 3M0ZA 2CLKA 3M7WA 4S2BA 1XBZA 5EL1A 3HB9A 2WNZA 2ZRVA 5EYWA 3V75A 5DN1A 4N6EA 4O15A 3S6DA 2WNNA 3CEPA 4LOCA 5HINA 3GXPA 4JTLA 4AB4A 4UMCA 3OVPA 1SW7A 1GZGA 3EXTA 1L2UA 5AB3A 2DORA 1KV8A 2TRSA 2PURA 1VCFA 2RDUA 4QM1A 3MI6A 4JEQA 1FCVA 4UC5A 1WQ5A 2QAPA 3TC7A 1GOXA 4ZMGA 1WOBA 3TQ0A 4JD4A 3UWUA 4LS2A 3M1ZA 3P84A 5FI8A 1GWJA 4PC8A 4CLMA 2CZEA 2C19A 2W79A 1IXPA 1VJIA 4UR7A 4MZ8A 4QIUA 5D38A 3W1RA 3CTLA 1CX9A 2LLEA 4O0KA 1K03A 3FJLA 3TIMA 4ZQRA 1QMLA 3LTYA 3KVMA 4QQ3A 3EWUA 1QPRA 4Q32A 5KZDA 1I2QA 3PBWA 2E6DA 5D2XA 3W7EA 2DP3A 1S5TA 3QPZA 1ZCOA 3W7RA 1SSDA 2E68A 2G5WA 5LHFA 3SJ3A 3TU9A 3IIXA 1KFKA 1EPXA 4IXHA 1OFOA 1SO4A 2VC6A 5LNUA 2W0UA 3HGJA 4DPQA 4JTSA 4ZL1A 4LVDA 4CCDA 4LUJA 2HSAA 1QPNA 3P8JA 1H7WA 3T78A 5I3FA 4MIMA 1H7PA 1WDWA 4NXKA 2VEKA 2CLEA 1X7FA 2A6NA 4O19A 1TTJA 4ML9A 2YCEA 5HWJA 1K7XA 4JDYA 4WXYA 2E6FA 5DBTA 4RXFA 4IOTA 4DF0A 3NL6A 2CLMA 4O50A 5DXXA 5AHLA 2GOUA 8TIMA 4HPXA 2ZRXA 5J5DA 1ZAIA 4O57A 2HS8A 3TNOA 5AYXA 3DZ1A 2QCFA 4LRTA 1WOAA 2G97A 1BWLA 1OF8A 1Q6RA 5TBOA 3LHZA 3NZ1A 1SSGA 3KFTA 1H7NA 2CU0A 5E1QA 1D3HA 4I9AA 3LRMA 3BARA 3UZJA 2OCZA 3W23A 1ALDA 2CLFA 3W2LA 1EB3A 3W1UA 1TV7A 3EX2A 3GKAA 3A5VA 3QFEA 2C3ZA 3LXBA 3QSRA 4IPIA 1QFEA 4OGZA 1N55A 4UFIA 2NUYA 1TO3A 4A21A 1K02A 5I3KA 4NJGA 3HJZA 4EF8A 1R46A 5K2ZA 4Y9AA 3CM4A 1DVJA 1ME9A 4CNNA 1W37A 2TYSA 1KTNA 4ORMA 3NM1A 5C6MA 3CWOX 3OG3A 1NF7A 1GTEA 2RKXA 3LTPA 3NQCA 3BG9A 3LCIA 3O07A 5FF3A 1R2TA 3THQA 3W87A 3QYQA 1XKYA 4AWSA 1QPQA 4HPJA 5FEPA 3SGUA 4R33A 1TPEA 3TSMA 1DHPA 4IMCA 1VRDA 1M7PA 3F1QA 1A5BA 3FA5A 2C0AA 1GVQA 4N2YA 3G24A 1YYAA 3UY8A 3R89A 1A53A 2Q3RA 4XWUA 2ZCGA 3CU2A 4WOQA 3QSTA 3DENA 4FNSA 1F2JA 5CPNA 3W1PA 1GVRA 5TQLA 3S9YA 1B9BA 1FUYA 5BOOA 3W84A 1TB3A 2NUWA 1M5WA 3ABRA 3NQEA 1GT8A 1WX0A 2A1YA 4UFLA 5BRBA 3LM7A 4HNTA 5EA9A 4O1AA 3M5YA 1RVGA 1K3UA 3KX6A 4O0ZA 3TA6A 4AWTA 2Q3OA 2VFDA 4XUGA 5AOUA 3MI3A 1OF6A 3GXTA 1ZALA 3JRKA 1H7XA 1DBTA 2ZBTA 2ZZ5A 4MYXA 1P5BA 2HTMA 5K9CA 3E49A 2NUXA 4LS1A 5KITA 3SI9A 5DY3A 3S5NA 1CW2A 1DKWA 4JTTA 5DCBA 3LXAA 4PA8A 3HPZA 1XL9A 2RDWA 5DELA 3RF9A 3LHTA 5D02A 1KBIA 4ZQMA 3EX3A 4TU1A 3VE7A 4NNBA 1C29A 5U4NA 5AYZA 4FHAA 4X2RA 4ZQCA 3V1PA 3DH7A 3W86A 3M47A 1XXXA 2V5BA 2Y88A 1YTEA 2GVGA 1A50A 3BPWA 3BO9A 3W7QA 3I7RA 2X1TA 1SO5A 1O60A 1PVNA 1VCVA 2QCHA 1PHQA 3E0IA 3GKFA 1W8SA 5LNWA 4MKNA 2QAFA 1VHNA 2E5DA 3BG5A 2Y89A 3IIPA 1Q6LA 4R7JA 3QRHA 1TYGA 5EY5A 1XM3A 1FBAA 2Y63A 3C2RA 1ADOA 1EUNA 2P0OA 2R91A 1W56A 1W0MA 4GRSA 1NAL1 3C56A 4C1LA 3CLMA 4XQ6A 1P0KA 2XN1A 1XDLA 1ONRA 4AF0A 1JR1A 4LVAA 3DFSA 2VOMA 3SZ8A 3DFQA 1LM1A 3W70A 1TCDA 2ISSA 2AAMA 4GNJA 5C2XA 2C6QA 1QAPA 1JCYA 2V81A 4XKYA 1OFBA 1GEQA 1YPFA 4JDBA 3DHFA 3M5ZA 5BMXA 3G0UA 1ZY9A 3GAKA 1HL2A 4IPJA 3PAJA 3UY7A 2ZA2A 3P62A 2KZHA 5AHIA 1OFEA 1YDNA 1UASA 4QJ1A 1WXJA 1OX4A 3NQMA 4NVTA 1FDZA 2V0TA 1QDSA 2QCDA 5AHEA 2QR6A 1H7OA 2H90A 3LHVA 2C14A 3MP5A 4QSHA 5LGZA 4L4MA 5G2IA 2WJZA 1B57A 3W73A 3LCFA 3STEA 2H8XA 1ICPA 2QUUA 1F76A 2VFGA 3L65A 4R34A 3UXAA 3H55A 5MHBA 3RNDA 3QPYA 4I7UA 2W6RA 3P67A 4UTIA 3L9CA 3S1WA 2H8ZA 3HG2A 3LLFA 2GUUA 5DBUA 1G4PA 4ORIA 1VCGA 1H61A 5HR6A 4WQ6A 1LTDA 4K36A 3TE9A 4EF9A 3UWYA 3WJXA 3TK7A 3UWVA 4NZJA 1EEPA 3M44A 3S1XA 1TIMA 2NZLA 4DQWA 1QR7A 3G3DA 4IUOA 1T8XA 3NM3A 1TPB1 2CZ5A 3EXRA 1LOQA 1GPWA 5K4ZA 3NXFA 3W88A 2VEIA 3FJ6A 1LP6A 3N19B 3EB2A 1J2WA 1FWTA 4FXSA 2H6RA 4NXSA 2OT1A 2YYUA 3D0CA 2QCNA 3PR2A 4RLIA 2YYTA 3TFCA 2ATMA 1O4UA 4X9SA 2NWRA 1A5SA 1U5JA 4M6PA 3WJZA 3C4UA 3QW4B 1WYIA 1JUKA 4NT0A 4O53A 4IWWA 3GDKA 3ATZA 3TJXA 2J24A 1OFPA 1YTDA 1I45A 1IIGA 4ZQOA 3HBLA 3PG9A 1S5WA 3S0CA 1RQEA 5HJLA 3LXCA 3SGZA 2WOQA 4UNLA 4Z1DA 1AG1O 3O1NA 5G5IA 4IMGA 3ABOA 3PM6A 1BKSA 3NQAA 3W22A 1QOPA 5C54A 5FESA 3PWAA 3A23A 3G8RA 1KM6A 1I2OA 5D03A 3G1XA 4O10A 1AW5A 3W6YA 1KFJA 4NJHA 1ZJIA 3T40A 4YXGA 3O05A 3SIZA 2J27A 3BGGA 5AHNA 2V2DA 1MO0A 4LU0A 4JTHA 2B7NA 2I14A 3GVGA 1XCFA 1XUZA 1VYRA 2QJHA 3TDFA 4TMBA 4KFPA 3ZR4A 2QCGA 3HPSA 5D2VA 3LCWA 1HTIA 2ISVA 3OBKA 4O14A 1I2PA 3Q58A 1VQTA 2FB2A 3SW6A 2JKPA 3DU0A 1TMHA 1KTBA 3KOFA 3ELFA 4DBDA 1KM2A 2QCMA 2ZRWA 3HG4A 3DFPA 3WK0A 1JCMP 3CIWA 4J9JA 3PY2A 3T7VA 2GQAA 3ZS4A 3NL5A 4LWWA 1XUUA 1LORA 1JVNA 1NSJA 2QCLA 2Y61A 1B3OA 4B5NA 4QNEA 1TPFA 1G4TA 4POCA 2B4GA 4K37A 3ABSA 4G1KA 1OYBA 3S5OA 4O28A 3E02A 4O1BA 2VEPA 3A21A 3LX9A 3IEBA 3QH2A 1YXCA 4DF1A 3Q94A 2X1RA 3MBFA 1VYSX 3NG3A 3BV4A 1DJNA 1GVOA 4MLRA 1TTQA 1I2RA 1GVSA 4WXZA 3L0NA 3VFLA 4NX5A 4YWIA 2C15A 4ZQNA 3PBUA 1XC4A 2NX9A 2E09A 1YTKA 2QF7A 2NXHA 2XN0A 3W1QA 2A5HA 1TQJA 2A0NA 3CT7A 5K4XA 2R8WA 3TAKA 2VENA 4YLWA 4MLJA 4BR1A 1F6PA 1FDJA 3GR7A 1G4EA 3W07A 3I6RA 4M7SA 1GYLA 3OHIA 2ZFAA 1WA3A 3VCRA 4N6FA 2HS6A 2PRMA 1MEWA 3UXDA 3RU6A 3DHDA 3L66A 3KVJA 3VI2A 3QZEA 1SU5A 4ICNA 1TTIA 1I4NA 3BW3A 3CC1A 4UMAA 4JIQA 4IJBA 5KTLA 3U6WA 1H7RA 1X8FA 4RKAA 1JUEA 4IMDA 5F2IA 4HT3A 5BW6A 3HIJA 1FWWA 1OHLA 3WK1A 2QCCA 1TPUA 3TXZA 5AC8A 3G1HA 5H2ZA 2QEZA 2B7QA 2QKFA 1LRTA 3QMTA 4FNPA 3M6YA 3QEZA 5F2MA 3NQGA 1PS9A 2CLLA 2YGYA 1OJXA 2H3DA 2FQIA 1GQNA 2PRLA 3P7YA 2CFFA 3MP3A 4RJEA 5D32A 4BI7A 3CQ0A 4JX6A 5DY2A 1UCWA 3FS2A 4HN4A 3WJWA 3ZWTA 4BI5A 2O7SA 4FEZA 3TV8A 3G18A 1FCQA 2EKCA 4JX5A 1FXPA 3PS7A 4OWGA 4LV4A 5DCDA 1SPQA 4IGHA 4DEFA 3W2KA 3GLCA 3S5YA 3MO7A 5AHMA 4AAJA 5KZEA 3BLEA 3PB0A 3HG3A 2FJKA 5G2HA 1E51A 4QISA 3EWXA 1X1OA 4HNNA 5K9XA 4O12A 1RPXA 2WPBA 1AL8A 1RV8A 4FNTA 2JK2A 2FPTA 2ZA1A 4MFEA 4DELA 1V7YA 1UB3A 3C3NA 1HUVA 3DGRA 3W1TA 1TPC1 4A2RA 5LHEA 3MMTA 4O4VA 1Z42A 3BW4A 3KRSA 4UUIA 1EP1A 5DCEA 1W54A 1PCKA 3EKLA 3GNDA 1W3NA 4BWLA 1SFJA 5CZJA 3KRUA 2ZYFA 1OYCA 1W31A 3LCLA 4LC6A 1N8FA 3NEVA 5F1VA 3UPBA 3KXQA 2RFGA 3R8RA 3L0GA 2O7QA 3W1NA 5C55A 4UFJA 4O52A 5IBXA 4LTSA 1LYXA 4XZ9A 3TCEA 3PSVA 4FIRA 2Z2UA 5DXYA 1K8ZA 4KFNA 1X1ZA 4JTUA 1VPXA 3G1SA 1H63A 4XBSA 1H5YA 3L5LA 2E6AA 5AHFA 3NQFA 2GQ8A 3NPVA 3I68A 1OABA 2FTPA 2AQWA 1LLZA 3IIOA 3UQNA 3NR0A 2GQ9A 1OVDA 3PC0A 3MBDA 3HGRA 2ZZ6A 1XI3A 3OA3A 4CNPA 1G69A 4GC4A 2X1UA 3UWZA 4Y6GA 3CPRA 1P4CA 3NZRA 4BK9A 1ML1A 2Z0IA 4I7WA 3FIGA 4EWND 5LKYA 4DXVA 4AWUA 3B0PA 5FF2A 4RZ4A 4UFKA 3LV5A 4N9EA 3MWAA 4OV9A 2QJIA 3LCHA 5ABTA 4H6KA 5FF7A 5F4XA 2Y7FA 1YDOA 3W7DA 1XDMA 4O18A 1W5MA 2C13A 1DL3A 3DKLA 4AF0B 3OVQA 5C5YA 3IVSA 2BTMA 2VFHA 3TJLA 5HNRA 1N7KA 3E9AA 4HIBA 1FCUA 2WO5A 5BMWA 4XKYB 3NA8A 4GWEA 5LZLA 3BLIA 4FIQA 1LROA 1G67A 2BXVA 4K38A 2WSQA 1FDYA 1G7UA 3WFAA 3L2IA 2YFOA 2E77A 5CPMA 4QAIA 4LV9A 1ZAJA 1OX4B 3EWZA 3G1YA 1ICSA 4LVGA 4NNCA 4O4WA 2R14A 1Y0EA 1ZENA 2QCDB 4NJJA 1TPWA 4WOZA 2A7RA 3S8HA 2ABBA 1G6CA 2HMCA 2ZZ1A 3R12A 3T55A 3WJYA 4M5PA 4ONVA 3LOTA 5G4WA 4FNQA 2V5LA 1RQHA 2A6LA 4FB7A 2JBMA 3ANYA 3PULA 1VYPX 4JICA 5D30A 3LB0A 4EOUA 2V30A 3S1UA 3H53A 4ZQPA 5I3JA 1VZWA 4Z0SA 2FFCA 2ZZ7A 1AW2A 4UTLA 1Z48A 5KSWA 2VELA 3O63A 1A5CA 3STCA 4JR5A 3NPWA 3UYCA 4LT9A 1TJPA 4A2SA 5CGQA 3CWNA 4AHOA 1KFLA 4FXRA 3FLUA 3MHGA 3CHVA 4LRSA 1B4KA 1KFCA 5LSMA 4K7YA 2OJPA 3G8EA 4KFOA 3LRLA 1JRCA 3NPUA 5IM51 1VH7A 2NV1A 3LDVA 3UD6A 3I7QA 4L4LA 4JTIA 2CLIA 4FX8A 4AH7A 3OVRA 2BSLA 3NQ7A 2QCEA 4FF7A 1DOSA 4OQVA 5EBUA 4GJ1A 1RR2A 3P60A 3GB6A 3CIXA 1I8JA 2BLEA 3N9SA 4C1KA 3W83A 1C9DA 4Z1AA 2OT0A 4O1CA 3PVFA 1FWSA 3DKJA 3LV6A 1XBXA 2BZNA 1S3HA 3IGUA 4FX6M 1SZGA 3C2VA 1XBVA 5CG7A 5A8GA 3O15A 3TW7A 3W74A 3I7SA 1OX5A 1SW0A 3TXVA 1OFDA 3B04A 3SY5A 3W7NA 4AHQA 5F4SA 4JTEA 3VE9A 4O13A 1SZNA 3GAYA 4R53A 4U28A 2OMAA
chains in the Genus database with same CATH superfamily
4ENLA 2JEQA 3BMVA 2EHHA 3W2UA 1SUXA 4WD0A 1Q8AA 5CZKA 5C71A 2XDFA 2DQXA 4X0VA 4KWVA 3ZXWA 4HYRA 4MZ1A 2CZVA 1BXBA 3W1XA 5C2CA 4K68A 3O06A 3I4KA 1A4MA 2FHBA 4QEHA 1XICA 3GZAA 5IDZA 3JS3A 4LVFA 3ITGA 5DX7A 1ZAHA 3E38A 1R3TA 3MCNA 3OLDA 2A85A 1OQFA 4H41A 4CEUC 4JX4A 1XC6A 1KKOA 2TODA 1OD8A 3RLUA 4AY8A 1IT7A 3E1F1 2GVLA 5HK4A 2BGSA 3VKJA 2QDDA 3G0XA 2TMDA 5LIKX 1BGGA 4DYEA 4WY0A 1CI1A 2ZRZA 3DHPA 1KXTA 3M41A 4O0QA 7ODCA 4LFYA 3GVRA 3WH5A 4HA1A 4U10A 3AMDA 3SQLA 4DWSC 4AD0A 1NFGA 4HZ8A 1L8PA 5I3GA 2C7FA 1RBOB 1JCXA 3PSWA 2VURA 1L6YA 5A6SA 5CPQA 4Z2LA 3QGKC 6ALDA 4DO4A 4BQ2A 3AUOA 5IDIA 1IXOA 5FAGA 2ALDA 3WUBA 1IV8A 2ZZ2A 5DT7A 2YXGA 3VIJA 1JJKA 4OT7A 3P8IA 4DBUA 4GUGA 4K8EA 1XYZA 1MW1A 5J8LA 1M7JA 3HG5A 2VFIA 1H5VA 3N2XA 2DZSA 3SQSA 2DIKA 3N29A 2X05A 1GVFA 1UR2A 1V3MA 4X22A 3D47A 1MUMA 4GBUA 1OFQA 5D37A 1MVYA 3V0UA 1S1RA 3AYVA 4KCVA 2QLYA 1OG0A 1KM4A 3U48A 5CGMA 1ZBVA 1QNVA 4GCXA 3F4CA 3N4AA 3R8GA 1NDWA 2HK1A 5FL0A 4H1ZA 3FCPA 4YVVA 3E12A 3UXKA 1KKRA 2BFGA 2HV5A 3GDMA 3WQPA 4GUHA 3RFAA 4XZMX 4WDXA 3M46A 1S2CA 3F03K 1B4EA 5JIPA 3L4TA 1VR6A 5ABEA 4CUCA 4TTGA 1U22A 3GIPA 3TR2A 2P50A 1TPDA 3N6QA 1EJRC 1NDVA 5A8QA 4EX4A 1T96A 2EG7A 1P43A 4XAZA 1UKTA 2ABAA 2F2HA 5A2AA 1KLZA 1PDZA 3U7BA 7XIMA 4GVHA 2CYGA 3DI0A 3MHFA 1RA0A 4KEMA 2BP1A 2ZC1A 3MI2A 3Q4DA 2ATSA 4DJDC 2OZ0A 1KXVA 5M17A 3VKKA 1KM3A 1JQXA 2IKGA 3WNPA 5I2UA 3AJ7A 5FSEC 2IKIA 1PAMA 2A3BA 2PBGA 3QGVA 1Z44A 5I3HA 3HPAA 2L5HA 3OEXA 4PCNA 4FZIA 3EOUA 3S9ZA 3CHFA 3MMWA 3HGOA 1PXGA 1FWRA 1R86A 4Q4MA 5LNSA 4G7EA 3DG7A 3FFSA 3PZMA 2Y62A 3ITXA 2Y7GA 4R27A 2FLIA 3W7GA 3VINA 4Z0JA 4O1FA 2RJHA 3EOEA 3N2MA 4UTFA 2POZA 3M5VA 4OU1A 5C8BB 4NZFA 3UPWA 3A4JA 5KINA 3QR3A 3RIKA 4HNOA 3OBAA 1XISA 3LMZA 3TOPA 4MJZA 2X0HA 3CL6A 3HTWA 4TTUA 2PDWA 1M9HA 5SWUA 4H00A 1AZ1A 2WNQA 5LA2A 4RNIA 4JQAA 3EEZA 3QHMA 1UWQA 3SUVA 4YHGA 4TXEA 5JQ9A 1PHWA 4AXKA 2P8CA 1QCWA 2WBKA 4V2XA 5HPOA 4GY7A 1CBGA 3JZEA 3QR0A 3QTPA 1PIGA 3DI1A 3GXIA 3WLPA 1A5MC 2PP0A 3SUWA 3N2BA 4MJ4A 4J3XA 4DBSA 5JXQA 9CGTA 4RNHA 1ME7A 4F2BA 4K6AA 2TSYA 3IGXA 1K7EA 3IIZA 2ZX7A 3E0WA 3GDRA 3LGEA 4QBXA 1KBLA 3VNJA 4MJMA 5HNUA 1QO2A 2E8ZA 4IX2A 3RLVA 1GW9A 3BG3A 3BOFA 5BU9A 4IIHA 2W27A 3PF3A 1RXOB 3ZLHA 1FWAC 4IG2B 2EG8A 2GJXA 3LERA 4QDMA 4C65A 1JRBA 3AUJA 2J6XA 2VEGA 2OX1A 4NKCA 5HUOA 4LW7A 4P5UA 2IW0A 2YPIA 3FKRA 4ZEPA 1UBSA 1JYVA 1XW8A 2X0YA 3S9IA 5JBDA 2FVMA 4D6DA 2EF9A 4M24A 4QG8A 3GFZA 3NOEA 4DNHA 4DYJA 1P0NA 1FQ0A 5G1MA 3KEHA 1UMYA 1P0EA 1A4LA 4MG4A 1XD1A 3CAQA 1HW6A 1HX0A 3WNMA 4GLEA 2BBFA 3L5MA 1XGZA 1DPMA 4Q7NA 2ZA3A 1O5KA 1AH0A 1XBYA 4I7VA 3CZJA 2WSKA 5CJ5A 3QY6A 3UZYA 5D8WA 4DJFA 3PB2A 1LLWA 3L68A 3A12A 3WQDA 4J1OA 2PLCA 3QM3A 3INPA 3SB0A 3WNKA 1O66A 3WCZA 5AKQA 1TPVA 4ZVJA 4QTGA 1OD0A 3NO1A 2YXOA 1HKKA 1KR1A 3BV7A 4L6DA 3W9ZA 3KBJA 2D0FA 3M5XA 4F2TA 4EPBC 4PMNA 5XINA 4OFCA 3P14A 3LPPA 4MB4A 5EFDA 5EGRA 5K7JA 1QRQA 3A47A 1PE1A 3E0LA 3QQWA 4AD5A 3OIXA 3P5YA 3W2JA 1L2QA 4O17A 3O0FA 1WZAA 2JEPA 2YCLB 4OE7A 4C60A 5E9XA 3W6LA 2Z1XA 1NVMA 4CQBA 4MY8A 2X7WA 1Q3NA 1GOWA 2D22A 4C6KA 1M7XA 2VC5A 3GTNA 4NQ1A 4H2HA 5ECVA 3KVLA 3SFKA 3TAOA 3KWSA 1US2A 3GK0A 4EAYA 4TX9A 3PNUA 1EP3A 2BDQA 1MW3A 1DV7A 1JF6A 1DXEA 1F05A 1JG9A 2QIWA 4DO6A 3P74A 1AMYA 4HTBA 1ENUA 2TPSA 5FF0A 3O6CA 3DGBA 2I9EA 3TN5A 3W7JA 5HANA 3UR5A 3N9RA 2QDGA 3TONA 4PGLA 3EXSA 2GGEA 3QMSA 1KC7A 2DH2A 2QT3A 4YYFA 1GJPA 1QOQA 1S2AA 2BGQA 2E40A 4K39A 4L9XA 1QHOA 1JGMA 1WNOA 4DZAA 5CZTA 2CEQA 1XLJA 3LCGA 4ZTYA 3VUSA 3FXYA 3K30A 4H7ZA 4EXQA 4FO4A 3SCVA 4XO7A 4LCRA 4RE2A 1BTCA 1IZKA 1DJQA 3O8AA 2Q71A 1ECQA 2WBGA 3IRSA 4P8XA 1GVYA 1I60A 1JPDX 4L61A 3B0UX 4ATLA 3DN5A 3S42A 2DVTA 2VP8A 2PWVA 2V82A 2XM1A 3W7IA 2ZUSA 4EAMA 3QV6A 1R0MA 3R13A 3T0BA 4RZ5A 2HRWA 3QFWA 1H2JA 4EK7A 4UOZA 1E4NA 3F2CA 3TYEA 1SZFA 4IFKB 2J9ZA 4N4PA 1M7OA 3G5EA 3WDJA 4GABA 1TX0A 1D3GA 3GNPA 3FSTA 3LD5A 4LY8A 2YBTA 2D73A 1B3WA 3RO6A 3KCOA 3LS9A 1KGXA 5A6KA 2B7PA 1EOMA 2R82A 3W71A 1PV8A 5CQ1A 5A6MA 3I3EA 3HF3A 1EDTA 1ZFJA 4H19A 3NZPA 3VIMA 3E6EA 4M0XA 4XKMA 4ALDA 3W72A 4TIMA 4Q4QA 1M6JA 1XPGA 2GJRA 4FS9A 3C2EA 2PDGA 3HQPA 4K7VA 3GIYA 4KQNA 4J28A 1R3SA 4JTQA 4GXMA 3K5XA 5EPDA 1Q6FA 1YXYA 4ZFMA 4IT1A 4P8UA 2R1NA 2VFFA 2WKJA 1M41A 2G3JA 2KAUC 1UWAA 4L7ZA 3PG8A 2G50A 3ZR6A 4A8NA 4MNJA 5CCZA 1HO4A 3SCWA 5F2LA 4A8IA 5CPLA 2Y7DA 4JN6A 2RAGA 4CU7A 1MUWA 1TWIA 4NSBA 1G94A 4Q33A 4XZHA 1Q7ZA 3VYLA 1CEOA 2VVSA 1WUFA 3H4WA 1PX8A 2VVNA 4WSKA 1JYXA 1Q6QA 5ENLA 5BU6A 4YVXA 4CQCA 3WQVA 4MVAA 3RPTA 4P7LA 2VXNA 3B8SA 3RRXA 1KQYA 1R7OA 2FIQA 7CGTA 1JDAA 5G4HC 4DNMA 3UR7A 3NQ6A 3G0SA 3UWQA 3ARYA 3RM9A 4A05A 1Z3NA 3AIVA 5C0QA 3AXHA 4Y9NA 1L9WA 4U4MA 4E0CA 3B4UA 3W37A 4BFAA 3DYOA 4ZTXA 1E56A 3EDDA 1JDCA 1YMYA 1EYWA 1F73A 1R47A 4RK8A 5AC6A 4O8RA 1F6YA 3MUXA 3K8MA 4QLJA 2NSOA 1K4HA 1E6XM 1J9YA 3NIYA 5FEWA 3WX7A 4NYUA 1UUQA 6A3HA 3BVJA 4H8VA 2BX7A 4JYDA 3TTSA 1W3JA 4WY0F 3TROA 1XIBA 3CAVA 4XSLA 3V0SA 2W91A 1KW1A 2BXZA 4HP5A 5A6BD 4KS0A 2ZRVA 5GJPA 5DN1A 1NQ6A 1HGYA 2WNNA 3UJRA 5HINA 4GQGA 3GNRA 3U2CA 2ESCA 3FAWA 4DRSA 2WC4A 1MQRA 1U1UA 4H9UA 3UWEA 4QM1A 4IFOA 1FCVA 3TC7A 2QAPA 4H6RA 1WOBA 1JAKA 1TCMA 3AYTA 3W25A 4JD4A 4E3VA 4GX9A 4JTRA 2CZEA 2C19A 3ZVHB 3HV9A 1VJIA 5D38A 3W1RA 4Q7BA 2QPXA 2V38A 1K03A 3TIMA 3AMLA 3K8LA 1QMLA 1KCXA 1Y5XA 4Q32A 5KZDA 3VOCA 3SN4A 4WDTA 5D2XA 3W7EA 2DP3A 3DYPA 4GI6A 1SSDA 2GL5A 2G5WA 5LHFA 3R7MA 4YNGA 3IIXA 4FXFA 1KFKA 1KBBA 2HE5A 1SO4A 3R0KA 1TVPA 1NIUA 5CEWA 4LVDA 4MIMA 1WDWA 3H7UA 4PYSA 4NXKA 3WMBA 1LG2A 3T07A 3IJQA 2A6NA 2GK1B 5HQLA 4ML9A 2O9RA 1XG3A 1K7XA 3RAOA 4YTSA 1HKMA 1E4IA 1PPIA 4S3GA 1NOWA 1KCLA 3OW1A 1UZ1A 2ZRXA 3TNOA 1NP0A 4XSMA 2QCFA 1WOAA 4X2PA 5HMFA 1BWLA 3VZXA 2I17A 1CXFA 1X96A 4EP8C 1MZRA 3AZRA 4ZOBA 1G5AA 5E1QA 1D3HA 3LRMA 1QK2A 1ZJAA 3UR8A 1JGIA 3BARA 3UZJA 2OCZA 1RALA 4OKDA 5FOOA 2CBUA 4AC7C 2D1ZA 4B16A 4JFSA 1EB3A 2ZIDA 3TTOA 2PDFA 3GKAA 3EPOA 4FA3A 3IK4A 4PUDA 1QK0A 1EJTC 2PC8A 3LXBA 4RL3A 2W61A 4W5UA 1Q7QA 2DVXA 4UFIA 1AQFA 1OGBA 3H2NA 4A21A 4LALA 4BHYA 1EC9A 2WLYA 3IWPA 3CZKA 4Y9AA 2V3FA 1BKHA 3AHXA 2DY3A 3WENA 4CNNA 3BDKA 4I3GA 5EB8A 4NASA 2ONEA 4ORMA 3NM1A 2FZDA 3OG3A 2RKXA 2J78A 1ITXA 1ISXA 2DT2A 2FGLA 5HDRA 1R2TA 2F38A 3W87A 4XZLX 4QE1A 1XKYA 1QPQA 4HPJA 3URNA 4R33A 1VENA 3FA5A 2C0AA 4N2YA 3MCMA 4M8UA 1U2YA 2J7BA 1A5NC 3T8QA 4L56A 4FLRA 1YBQB 3M7SA 3R89A 2Q3RA 2ZCGA 4PMYA 3CU2A 1XYBA 1UOZA 3GHRA 5CPNA 3HN3A 3CV2A 1JIBA 3T0AA 3W84A 1WXZA 3NQEA 2INFA 1TV3A 3SRHA 4MB5A 1UWSA 3GQYA 4PMOA 2PWEA 4ACZB 3LN3A 4O1EA 3RO8A 1XLLA 4AWTA 2VFDA 4XUGA 2ZE3A 3SY8A 3MI3A 1OF6A 1H7XA 3H7VA 1DBTA 3ARTA 2W62A 1PWLA 3VZZA 4MYXA 2HTMA 4UR9A 1UR1A 1KO0A 5DY3A 1DKWA 1HZYA 4OBRA 3HPZA 4GKTA 5D02A 3H2OA 1H41A 1QPKA 3VE7A 3PZQA 4CQDA 3L2MA 4X61A 3V1PA 1GYMA 4JQ2A 1XXXA 2DT1A 2GVGA 3Q45A 3PWGA 1B31A 3VD5A 4OTKA 3T9PA 4IQJA 3BPWA 3BO9A 3W7QA 1IEIA 4XVDA 3I7RA 3VX0A 4D1IA 4XB3A 4HZ7A 1VCVA 4ZSTA 2X42A 3T0CA 2Y89A 3IIPA 4R7JA 4IGNA 1TYGA 1FBAA 2VHLA 3USZA 2P0OA 3W24A 2R91A 2G4FA 3TP4A 3MB9A 3KL0A 4C1LA 3CLMA 2Y2WA 3DG3A 3AISA 4NIRA 1FWEC 4E8GA 2DDXA 4AF0A 1ONWA 1JR1A 1MI3A 2OPJA 1LM1A 1V6VA 3PZOA 3VDHA 1J0IA 4DJEA 1E3XA 3PPHA 2UY2A 1NOFA 4XKYA 3R58A 3DHFA 3M5ZA 5BMXA 4DX3A 1X39A 3KBMA 1LUCA 3LK6A 3EWDA 3M0MA 1OX4A 4WKAA 4NVTA 1J0ZA 1QDSA 2QCDA 2QR6A 2PDUA 5DMNA 1OADA 2H90A 2E9LA 2C14A 4FP1A 5LGZA 1B3YA 1HJSA 4MSSA 2H8XA 1XV8A 1IEVA 2VZTA 4GC3A 3VDBA 3P67A 4B5WA 3HG2A 1FWDC 5HR6A 1HJWA 1LTDA 1UBPC 3TZFA 3UWYA 4NZJA 1EEPA 1H0GA 3M44A 3S1XA 3G3DA 3B40A 5E6YA 3NM3A 2CZ5A 1LOQA 3ES7A 1QJWA 3MUCA 3W88A 3N19B 3EB2A 1FWTA 1XLHA 1U1JA 3LY0A 2OT1A 5HOSA 3D0CA 2QCNA 1PB0A 3WF4A 3CQJA 1RH9A 2YYTA 1EGVA 3I3DA 3BCJA 1Q85A 1B3XA 2NWRA 3UJEA 1C92A 3BAYA 1TUFA 3PTKA 4I5UA 3KBVA 1WYIA 1UKSA 2XVNA 1OFPA 1YTDA 1P1MA 3N6JA 4LF2A 3S0CA 3AAMA 3MWCA 2V67A 2WOQA 3RLGA 5G5IA 4S38A 3TTQA 5BXPA 2WZTA 1W9XA 4OOUA 3G8RA 1SR0A 5LYRA 3TA9A 3W6YA 4YTRA 5DANA 1AJZA 3C5QA 3CPGA 4JKKA 2J27A 5A8MA 2VJXA 4LU0A 2B7NA 1TMQA 3WY1A 1XUZA 1WO2A 2Z26A 4TMBA 2JQXA 2QCGA 5D2VA 1HTIA 4HMEA 4O14A 4HMNA 3Q58A 3LSCA 3GNOA 2JKPA 3KOFA 1RJQA 4NZCA 1F07A 2OFJA 3CIWA 3ZJKA 4J9JA 1UP2A 2GQAA 3NL5A 4MWAB 4B5SA 4BS0A 1YE4A 1W1PA 5BOEA 3WQCA 1G4TA 4POCA 2B4GA 3AS0A 2YJQA 2XISA 3QH2A 3GBDA 1IR1A 1M65A 1UOKA 1VYSX 3BV4A 3NVDA 3SSZA 3L0NA 1VAHA 2AMXA 3VCCA 3AHZA 1VFOA 3MUAA 3PBUA 1XC4A 4C6PA 3S2NA 2OODA 2ZXBA 3VA8A 2QF7A 1TQJA 3L4WA 5K4XA 1NDZA 3WBAA 3F2BA 5CLWA 5I23A 1W2VA 1F6PA 4FOJA 2E28A 5J04A 2VNCA 1JDFA 1MXDA 3GC5A 5FJUA 2C79A 1J2BA 5HNTA 9XIMA 3VCNA 4F40A 1W1IE 4MADA 3VCRA 2HS6A 4D71A 1R8LA 1FWCC 5FACA 4AMCA 3D6NA 5KEZA 2OB3A 3L66A 4W93A 1CZ1A 1TA3A 5JU6A 4ICNA 1TTIA 1XLDA 5LIYX 3ARXA 4UMAA 4JIQA 4WGHA 1E0UA 1JUEA 3SAZA 3QV8A 1TZZA 5BW6A 1V0LA 4MJ2A 1YNYA 3OTRA 4REQA 3GD6A 4U33A 1OHLA 4BKNA 4CN1A 1TPUA 3G1HA 1XF0A 4B5UA 3HZ3A 1OC5A 4GBDA 5H8UA 2YGYA 2G3IA 2FKPA 2PRLA 4BI7A 3CQ0A 4AD4A 3FXGA 3UVIA 5DY2A 4AVNA 4DWSA 1WKYA 3CL7A 4OUIA 3VGGA 1VJSA 1FWIC 4OWGA 1DJGA 4LEQA 1XCWA 2VCCA 2VL4A 3E5BA 3W2KA 5GNZA 4DUOA 1MRAA 3QLDA 3WH9A 2WNWA 5EMYA 1XIDA 2JALA 2FJKA 4I6KA 1R5YA 2CERA 2PWGA 3FYYA 3N2OA 1F61A 3OBEA 2YXXA 3BMWA 3V35A 5CJNA 3W28A 3T4WA 1A0EA 3DGRA 3W1TA 2VI0A 1HJQA 3LZ3A 4GH3A 3D5HA 2FVLA 1KQZA 2BVYA 4C1NA 1MFUA 3QXBA 2GUYA 3WQ5A 1E70M 2CHNA 4LB3A 3EKLA 3GNDA 4JFTA 1V7AA 3ZO9A 3BAJA 1LF1A 1N2VA 1MW2A 3LCLA 1K6WA 4YWSA 3NEVA 4XK2A 1XJBA 3KXQA 2ISDA 3GYCA 4TVDA 1DIEA 3V36A 5C55A 3NWRA 4UFJA 4JOMA 4LTSA 1LYXA 5DXYA 4HOXA 1T6MA 2PZ0A 3SRDA 1P6WA 4ZCWA 3LPOA 4PBEA 4MWAD 5A6LA 1H63A 2Y5SA 1Q2RA 3L5LA 1HJXA 4D6EA 4LAOA 1GOKA 2FTPA 2AQWA 4HJWA 2GQ9A 1W9DM 3MBDA 2MNRA 2ZZ6A 3MVTA 4R3UA 1WKEA 2X1UA 3AOFA 3UWZA 1FFRA 3MA8A 2VTFA 3VD7A 4EPDC 1ML1A 4I7WA 4DB7A 4DJDA 5LKYA 3RX2A 4MTVA 3CMGA 4GXPA 3GG0A 3MWAA 4QX4A 2XFFA 1V3JA 4GZ7A 1EOKA 3CH9A 2E0PA 4GQRA 4H6KA 4NHVA 4LAUA 2Y7FA 1Q6DA 3GC2A 3IAPA 4LY4A 3E74A 3BJTA 4D6IA 1CGYA 4QDPA 1RBLA 1JNEA 1X8CA 4HZMA 1XYCA 4H6QA 3IVSA 3AROA 1E9LA 5HNRA 3CYVA 4HIBA 1FCUA 1HXJA 2WSPA 2QW5A 2VD9A 1VPYA 3NA8A 4FIQA 3TYUA 2PU1A 4LYRA 1EDQA 4I6VA 4G2DA 2J66A 3GH4A 2VX4A 2YFOA 2E77A 2PDLA 4LV9A 1ICSA 4LVGA 2GGIA 4NNCA 4O4WA 4R7OA 1Y0EA 4M80A 5A8NA 4WOZA 1CECA 2A7RA 3GO2A 1BSLA 2HMCA 2ZZ1A 1OCNA 4M5PA 3LOTA 5G4WA 1SJCA 4FNQA 1ZBKA 4NAEB 2D2OA 4INFA 3ANYA 3RM8A 1VYPX 2V30A 2W4XA 3S1UA 4H04A 3H4GA 3NTYA 4KCWA 4UTLA 1Z48A 3ZT6A 5LA0A 1X1NA 2VELA 1A5CA 1NH6A 3STCA 4W87A 4LT9A 4ZO8A 3SCNA 1KFLA 4GYPC 4FXRA 1BYAA 1E72M 4LRSA 1OB0A 3LRLA 5ABGA 4P7OA 1VH7A 3LDVA 3I7QA 4JTIA 1TJ1A 2CLIA 4FF7A 2QCEA 1W3HA 2QGYA 1XYMA 2JF6A 4H2CA 5FJPA 4ATDA 2PDHA 2AL2A 2YL9A 4NRSA 1CGVA 2BLEA 3QYSA 5BRQA 4BEUA 3WO8A 4Z1AA 1QTWA 2OT0A 1FWSA 4QRNA 3GBEA 1XBXA 3VMNA 2X7VA 2XJ7A 1JPMA 1OX5A 4W85A 3VE9A 1SZNA 2HEJA 1V3KA 4U28A 5FCZA 2OMAA 4FI4A 1J0KA 3KRZA 4WUIA 1CXIA 2NQLA 4GUJA 1Y8BA 2W63A 2Y70A 3NCOA 3NQDA 4DIAA 3GHSA 3I10A 2GLKA 1UR0A 2PE4A 3RJYA 3WLLA 2XU2A 4BQ5A 1JCJA 3CNYA 4JCLA 1KNWA 2PF0A 1OT1A 3G1VA 5F1UA 1ZL1A 2WSYA 1XLAA 3ANUA 3ZLGA 1V02E 2OXNA 3T4CA 4K1GA 3KS6A 3N12A 5D2YA 3VIHA 2DJLA 3UR2A 3IIVA 4C91A 3PFRA 1DJYA 2REQA 2OG9A 3B8IA 4G7FA 2R1MA 4B5VA 2WMHA 4BF9A 1H11A 1UPMB 2XM2A 3O0KA 2Q8XA 3P93A 3WF3A 3V18A 3AZSA 3TUUA 4F9DA 2IMRA 2AGTA 2BY1A 3I6TA 3B0VC 4PB4A 3NYDA 1A5KC 4HNUA 1S2WA 6REQB 4MWAC 3W00A 1FXQA 1K77A 1G9HA 4A6GA 4ADUA 1R3YA 1DWGM 2JKAA 2VZUA 5I3DA 5IFTA 4U2ZA 3A9IA 1QT1A 2DZPA 4HHPA 3QV7A 4JY8A 1SO6A 2AOSA 3CHCA 1PBGA 4AY1A 3QKZA 2FJUB 3F5KA 1IIHA 1V6YA 3JW7A 1LBFA 4GIRA 3RXZA 1W1B1 4J3VA 3VOJA 3B03A 3BQ6A 4IL2A 3IGHX 5AYYA 4D6CA 3GYEA 3N14A 4PODA 1MZHA 2I9UA 2YLAA 2ADAA 5ABHA 2JGQA 3DFTA 3BGJA 5FJOA 5IRPA 3C3UA 1OX6A 1QI3A 3ZQ9A 2IPGA 2Q8ZA 4L4PA 4Q8VA 1RLDA 4H9VA 2FH6A 1CDGA 3AO0A 4O1DA 2OYMA 2ZX9A 4GY0A 3ARRA 4IF2A 4CGTA 2YR1A 4H4IA 1V0NA 4MHBA 3LHUA 1XLMA 3WZ0E 1JZ2A 3NVTA 3GW3A 3SJNA 3WIJA 4U5IA 4M6QA 3GRIA 4KEUA 5IBXC 2CLHA 3RMJA 4N4QA 3ID7A 1W5NA 1H50A 1VIZA 4CD5A 4UTMA 1F3WA 3LBCA 3P81A 4S2CA 4JS3A 3WMCA 4AVFA 1J4EA 3FDGA 5H91A 1NWSA 2E3ZA 3ARVA 3T08A 2Z6IA 4X9YA 3KOZA 3LPFA 3EWWA 2Z1WA 1DJWA 1KM0A 3MYOA 1QNQA 3ZM8A 3TMQA 2ACQA 4ZO7A 2VCBA 4KWWA 3BWWA 4NY2A 3UG4A 3OGSA 4GQ0A 3THAA 3F4VA 1GG0A 4YTQA 4S1FA 4JIPA 1C8VA 1XSIA 3UERA 2QUNA 3G1RA 4RZ6A 3TYAA 1HF6A 3I65A 4MUZA 1E4LA 2CHOA 3ME3A 1KM1A 5CZ0A 3AU6A 3WNLA 1TQXA 3QQ0A 4QE4A 1TWZA 2VYOA 3FYOA 3VMOA 4AW7A 1GORA 1S2UA 3NSXA 4P7QA 1GJUA 4GE8A 4D9PA 2YFNA 2X30A 4Y90A 1Q45A 5GJMA 3JUGA 1U5VA 1JZ3A 3TLLA 2X41A 3MKKA 3L5AA 1QPOA 2Y5EA 3OIHA 2B7OA 3APYA 2PWUA 5I0DA 4GH1A 4M7TA 3SY1A 1V6XA 3VAVA 2VEMA 4ERAA 1OM0A 3VIFA 1A5UA 4OBTA 4PMXA 2UV8G 2A4AA 1W2PA 1AK5A 4HCLA 3WMLA 1LQAA 5FAJA 3R4IA 5I00A 4A3UA 5HWMA 4C5ZA 2X2GA 3T42A 3U2OA 1JEZA 1W5QA 2HBVA 2FZ8A 3BK0A 1LCOA 6CGTA 1OK4A 4LBRA 1S2TA 2AL1A 5JUVA 1R9ZA 3WJSA 2OZTA 4JTFA 4PTXA 4AIOA 1NU5A 1FFQA 4AISA 1CCWB 3OB8A 2RDTA 4TR9A 1Y5WA 1MEHA 4CCEA 5XIMA 5F2GA 2E67A 4C6QA 4KCUA 2F7FA 1ZP3A 4RNFA 1W32A 3RUBL 4DYKA 1TREA 3EX6A 5KMYA 3W85A 3VZYA 5I3IA 1RBAA 5CPOA 1K9EA 1R9YA 1VB9A 4D72A 2DZWA 3A22A 3VOHA 2XH0A 3EYPA 3QF0A 3QMRA 3QQ1A 1LWIA 2ZKMX 2UBPC 3UZXA 1UUMA 5C9UA 3EX4A 1TPH1 2EAWA 5CAHA 2IUZA 4PL2A 3NGJA 3CZLA 1MSSA 3NO5A 5CPTA 1QHZA 1GKQA 1NF0A 1J01A 2Z25A 2J9XA 4HHMA 2XIOA 4DXKA 1UUOA 4HJFA 4B90A 2BB0A 4PRWA 3TQVA 7TIMA 1IEWA 2WQPA 1BEUA 3B9EA 4UZSA 2YX0A 1XKJA 3YPIA 3A9BA 4MNMA 1KA9F 1E9IA 1AZ2A 3OYZA 4LS0A 6TAAA 1R85A 3QJAA 2PDCA 4A3RA 3P2VA 4AFYA 1XRSA 3M0VA 3DG6A 1MMFA 2ZICA 1E73M 3K8KA 1NM9A 3STGA 1THFD 1WP6A 4UTWC 2JIEA 5LXXA 3SCOA 4WX2A 4NAFA 4HA3A 1XR2A 5T9CE 3M07A 3QZ6A 1V77A 3N3MA 3ATYA 4HCDA 4M82A 5IHSA 2HVNA 4UTKA 3SECA 2HE8A 4D2JA 2WHMA 3NL2A 4LUTB 3VNLA 2QJGA 3DAQA 4NI3A 3CB8A 4C6EA 5J5RA 2I5GA 2QYGA 3VK5A 3O6DA 3GR8A 5C9XA 2ACSA 2F84A 3N25A 2UY4A 4NZ1A 1YPIA 2GGJA 1ZHAA 3PUOA 4CD4A 2D24A 1VFTA 3DXIA 3E2QA 3TKFA 3IGSA 4HU3A 4PH6A 4Z1BA 2E1DA 3GNXA 3MDWA 3W7HA 4ADTA 3WQFA 4JNYA 2WV8A 1QASA 1E0WA 3H54A 4D8LA 1KD0A 1F3TA 2NX1A 2A21A 2YB4A 5A5WA 4JIEA 1FKWA 3DFHA 1PTAA 3WDIA 3R0UA 4WY0B 3WQEA 3G1DA 2QPUA 3S6TA 5T9BG 4O11A 1S5NA 2ZTKA 3GWQA 1E4MM 2XFWA 1UC4A 1O95A 1ZGDA 1VGAA 3M43A 3REQA 1WBHA 4O16A 2FB3A 4R7WA 4NZ3A 3R8HA 4N9DA 2ACRA 1FWHC 1NJJA 3BW2A 1XP3A 3CMJA 5D04C 1OFAA 4AXNA 2FZ9A 3KVKA 2WWCA 3MVIA 3L4UA 3CUZA 3H70A 5G2WA 5CLTA 2IPJA 1WBJA 2G0WA 2VQUA 4D1JA 1Q6OA 1R6WA 3UU0A 2YL5A 2C1GA 5LNRA 2Z2BA 2OYKA 4JGDA 2FMOA 4PRRA 4Y8EA 1HJVA 2YZRA 5FJRA 2WANA 3SIMA 4CQAA 1QW9A 3GTXA 1REQA 2YDSA 2YCLA 2EPKX 8XIAA 2PDPA 4WKFA 1P7TA 1Z41A 3ARSA 4HHLA 2EO7A 1UWUA 1QNPA 2R94A 2WWDA 3FOKA 3F5JA 1UD3A 4KCTA 4U31A 3ITLA 4NILA 4RPPA 2QULA 1LBLA 2Y85A 4QLKA 3W02A 1QI5A 3IANA 1PUDA 4UCGA 2BG5A 3CQIA 1K6AA 1K7FA 2P10A 3UYIA 4YCOA 3MCOA 1YE6A 3LG3A 2WMIA 3DFNA 3TTEA 5HQMA 4L64A 3N4FA 4GX8A 5AN7A 2XWDA 1XH2A 3RU8X 4S3FA 3R2GA 2XSAA 2G96A 4RDZA 4F2UA 3G1FA 3T2QA 4G1NA 3N6HA 2Z00A 5CSUA 3QBUA 5CJMA 1LZOA 2YLLA 4TX6A 2CPUA 2VR4A 3NEHA 3NAVA 1TVNA 3H2CA 1QO5A 5C2GA 4AIEA 1F8MA 4E5TA 4UFHA 4B4HA 3A4AA 1QHPA 5JH2A 4Q8PA 5AECA 1EUAA 4HU0A 4KGLA 3QW3A 3GM8A 1GCYA 4K8HA 1P1XA 1T5AA 3W1MA 6XIMA 4G7EB 3WUFA 5A2BA 3FNDA 3HGSA 1R38A 2J88A 1QBBA 1FOBA 3OGRA 1ADSA 1OC6A 3L21A 4GI4A 4S23A 4E2DA 3TN4A 4A29A 3H21A 2X8RA 1MW0A 3MYPA 4PUMA 1LT8A 1V03A 4B5XA 1DYSA 3AMGA 1UH3A 4Q8QA 4XG1A 3H6OA 1OK6A 2Z6JA 2Y6ZA 3C8FA 1KCKA 1XSKA 4S3KA 1ISVA 1XRTA 1EEXA 4GUIA 5CH9A 3AYSA 3BMXA 1KLYA 3GZ3A 4IQLA 3ZVIA 2NQ5A 1CENA 1X6NA 2CW6A 4BJHA 3KAOA 4PBFA 1V6UA 5CSSA 1AUSL 2ZQ0A 3LHYA 3DCPA 3M0ZA 2CLKA 3M7WA 1XBZA 2VGIA 3HB9A 2WNZA 5EYWA 1CB2A 2P53A 5HBFA 4JTLA 4UMCA 3OVPA 4S3DA 2G3MA 1GZGA 3RX3A 4KEZA 4GYKA 4MWAE 2WVTA 3D3AA 5ABFA 4M6UA 2VGBA 3A6OA 2JIWA 3S46A 3SN0A 1WQ5A 1GOXA 4YYCA 1QXLA 1DEDA 4LS2A 5M2FX 3M1ZA 3P84A 3S4TA 3G6LA 1GWJA 2ZX8A 4PC8A 3FVDA 1B2YA 2XVGA 3CTLA 3I3BA 2IPWA 3T0DA 1V08A 5EMLA 2F8QA 2HPMA 2C8NA 4J4KA 2G37A 3EWUA 3W27A 4UOQA 2WVSA 4HGXA 1D3CA 3QPZA 2DV0A 1EBHA 1UKPA 2GDUA 3W7RA 2E68A 1TZ7A 1J10A 3SJ3A 3UGVA 1EPXA 4IXHA 1OFOA 3BICA 5LNUA 2W0UA 1FWGC 4JTSA 1J0YA 6PTDA 4CCDA 1NQKA 4LUJA 3P8JA 3DEQA 3BSGA 4IIGA 3OODA 2VX7A 1X7FA 3EZ4A 2YCEA 1XH0A 4WXYA 2E6FA 4IOTA 4JKMA 4Y7EA 5DXXA 8TIMA 2GOUA 3AHYA 4DI8A 1IWAA 4V33A 4HK6A 1S1PA 2C0HA 4M1RA 4D6JA 5FIPA 2V5JA 1PKNA 3K1DA 1Q6RA 4WR3A 3LHZA 2ON3A 2ZWZA 1SSGA 1GQJA 4MDPA 1DP0A 5A6AA 3WLJA 4UQCA 2VDIA 1E1FA 2PLJA 2GQ3A 4FMVA 4ILSA 4I9AA 4WCJA 3VGHA 2OU4A 1JL8A 1ZLPA 4Q6XA 4NYYA 1XGDA 2CLFA 1DTUA 3ZVHA 4ML4A 1JFXA 3FN9A 2J7GA 2RGMA 1I0DA 2I56A 4M81A 3RRAA 3BLKA 4IPIA 1A5OC 4OGZA 4F9JA 5E9AA 2NUYA 3BSHA 2P5NA 3RN6A 4N7QA 1IGWA 4GJIA 4CCZA 1K02A 1XG4A 3PPFA 2DZBA 3TYZA 4LCQA 1W37A 2PDMA 2TYSA 3OVGA 3U3HA 3CIVA 3PANA 1Z6KA 2X0SA 3MUIA 1GTEA 1NWRA 1XGEA 5FF3A 2Z28A 4HB7A 3QYQA 2F9RA 1KGUA 4QXIA 5B7ZA 3TSMA 1VRDA 1A5BA 3C2YA 2XVPA 4GVIA 3ZMRA 4F0SA 3W29A 4AYSA 1S3TC 5DMMA 4ZGYA 1RD6A 3HM7A 2HK0A 4WOQA 3UG8A 1Q4NX 3DENA 3LENA 2Z24A 1F2JA 3CYJA 1EJUC 1MRQA 1KBKA 1E71M 1US0A 4GGHA 5TQLA 4HMCA 1LLOA 1FUYA 4B3LA 1GK8A 3AWOA 3BQ5A 1BSIA 3ZZ1A 1M5WA 3ABRA 3TC3A 3PZ9A 1GT8A 5AYBA 4HOZA 1WX0A 2A1YA 1V3LA 3OJGA 5E0FA 3M5YA 3H8AA 4W86A 1K3UA 4GVGA 4PUKA 1POKA 4LAZA 3TA6A 3VNZA 1VBRA 1HGWA 3PZGA 1ZALA 3UA4A 1VFMA 4GYJA 2ZZ5A 1HKJA 3VMPA 1P5BA 1RK5A 1JI1A 1LG1A 4LS1A 5C70A 4LX4A 4JTTA 5DCBA 3LXAA 4PA8A 2WMGA 4W89A 3JZUA 4HOWA 1KBIA 4ZQMA 3UEQA 4NNBA 1C29A 2D2JA 4FHAA 4GI9A 1OCJA 3W86A 3M47A 2BMBA 1EL3A 1DWAM 2V5BA 2DSWA 4KW2A 4ERGA 3WLOA 4JTAA 4I5RA 1RY0A 1PKMA 2GDQA 1O60A 1PHQA 3BH4A 3M6DA 3CUGA 4MKNA 4GHRA 1LWJA 4MAZA 3QRHA 1XM3A 3SUTA 4IM4A 1BXNA 1U33A 2Y63A 4GQBA 3ECQA 3ZOAA 3CZGA 3B9DA 4PULA 1W0MA 3UCCA 5E0CA 3L7RA 5DRIA 2D23A 3BAIA 1CB7B 1E1CA 1O5QA 1ONRA 2DIJA 4Q8NA 1FKXA 2VOMA 3W70A 1T40A 5DMYA 2QMJA 2HPIA 1TIWA 5C2XA 3OLIA 2C6QA 3V3WA 1OFBA 1GEQA 1YPFA 4MDOA 4TOQA 2QZRA 3WNNA 3G0UA 4LGXA 3PAJA 1FP9A 3P62A 4DN1A 2P8BA 4TUFA 2WPGA 2WCAA 3MSDA 1HVXA 5AHEA 5AZ1A 3IV8A 4AEEA 1E1EA 3MP5A 4EXAA 5G2IA 3MQTA 2WJZA 4I9MA 4R34A 2VFGA 1F76A 2HXUA 3B8UA 4PMVA 5MHBA 1L8NA 1VEMA 1ADDA 3L9CA 1UR4A 1WXYA 3AFBA 3LLFA 2GUUA 3PTMA 3MT1A 1FH8A 4ORIA 1VCGA 2JE8A 4K36A 1DWJM 2PTWA 4AD2A 1QR7A 1S2VA 4QGCA 3FHAA 1T8XA 1KCZA 4IUOA 1GVIA 1XWYA 1M03A 2D2GA 5DO8A 2VEIA 1J2WA 3PR2A 3T2PA 4RLIA 3MKCA 2OLHA 1OY0A 4FR6A 3TFCA 1J12A 5LXEA 1CPUA 2WVVA 1O4UA 4X9SA 2CETA 1U5JA 4CD8A 3SBFA 3LMYA 4M6PA 4AWEA 3QW4B 4NT0A 2HDJA 1E9ZB 3GDKA 4AU0A 2YA0A 1I45A 3HBLA 3PG9A 1VP5A 1RQEA 3ARWA 3OG2A 4GACA 3LXCA 3UZWA 4UNLA 1LL7A 2J13A 3FVMA 3NQAA 3WNOA 3VILA 3PWAA 2VZOA 3A23A 3NSMA 1GOMA 4O10A 1VJZA 3S47A 1KFJA 3K4AA 3IS4A 4YVPA 3C0SA 3O05A 2ZXQA 3GTIA 1ZS2A 1VYRA 2QJHA 4GYPA 3L2LA 4Q3MA 3RDKA 3TDFA 4J3WA 4KFPA 3ZR4A 4PUEA 3LCWA 4AZ6A 4GCAA 3CS2A 1GUVA 1I2PA 4A8LA 2OELA 1VQTA 2D69A 3KOYA 3BLDA 4PUWA 2OR2A 1WDDA 1TMHA 3ITCA 1KTBA 2YA1A 1RJPA 3N3TA 1V0MA 1KM2A 1F9CA 1R3QA 5DF0A 5E5CA 2QCMA 2ZRWA 1HL8A 4AX7A 1JCMP 3WUEA 4LWWA 1XUUA 3FY1A 1LORA 2FTYA 4QNEA 1RLCL 4K37A 4FPSA 3CASA 2GVEA 3ABSA 4G1KA 3EAUA 2VEPA 2R1KA 3BC9A 3AIRA 3VFCA 1H1NA 3MBFA 4B92A 3IJ8A 3NG3A 1GVOA 1TTQA 4DXXA 4YWIA 3J7HA 1AH4A 3GHUA 4D8ZA 3QN3A 1Y5VA 4GD0A 2NX9A 3VNIA 3WL1A 2AKMA 4H9MA 2XN0A 2BVTA 4FXJA 2R8WA 3RR4A 2HJPA 2GGGA 3ITVA 4YLWA 4MLJA 1FDJA 5HMDA 3MSYA 1A47A 1WPCA 4LEFA 3ZR5A 3OHIA 2ZFAA 1YX1A 3BL3A 2A3HA 1KR0A 1TVLA 1CIUA 5IFPA 1J6OA 4N6FA 2PRMA 3UXDA 4ZFCA 3SCSA 3WLNA 4XZBA 2IQ0A 5M03A 3VI2A 1A0CA 3QZEA 2OX4A 2WHKA 1VKFA 1ZU8A 4JCMA 3BW3A 3CT2A 2BHYA 1OGGA 3U6WA 1GW1A 3K2GA 4RKAA 4IMDA 3LPGA 5F2IA 4HT3A 1UH4A 1YW1A 3O7UA 4ZOAA 3V5FA 1JZ8A 3KOWA 5AC8A 2YBUA 3CXOA 2O9PA 2QEZA 3C0QA 3BJSA 3GFYA 3QMTA 3QEZA 1PS9A 2H3DA 2RDXA 1XFCA 1CGTA 5D32A 2PDQA 3UG5A 1V79A 1UCWA 2E9MA 1X97A 3TYBA 3RCNA 3WJWA 4MWAA 2XGBA 4BI5A 2O7SA 1M53A 4L1GA 4P8WA 3G18A 1FCQA 3TV8A 2J47A 3PS7A 3MPGA 1I1XA 4TV6A 5DCDA 3UETA 3AXXA 4ASTA 5E09A 3VU2A 3GLCA 3S5YA 4LPCA 2B31A 5AHMA 4AAJA 1XRFA 5KZEA 4CN6A 3PB0A 3HQOA 2XGIA 4QISA 1X1OA 4HNNA 3WEZA 5K9XA 1VFSA 1RPXA 3T2OA 1XQLA 1RV8A 5BROA 2FPTA 2ZA1A 4MFEA 1TJ0A 4GOAA 1V7YA 1UB3A 2J25A 3WBYA 3GUWA 2NQJA 4A2RA 2OQYA 4H7VA 3ZLFA 1I1WA 1QU4A 4AVOA 1DJZA 1XHGA 4UUIA 1EP1A 5DCEA 5HA7A 1W3NA 2NV9A 1DXFA 3B97A 3A3XA 5H8PA 2KX9A 5CZJA 3VKBA 2GVYA 3G2GA 1RP9A 3RILA 3ABZA 2HBXA 4KEVA 1N8FA 3UPBA 5XIAA 3SFWA 3W1NA 4FAMA 4GQQA 3ES8A 5IBXA 2YB1A 4F0KA 4FIRA 1VD6A 5LIUX 4PMQA 2YL8A 4KFNA 3EOSA 3G1SA 5AHFA 1EZWA 4PMRA 3SADA 2GQ8A 4JL1A 4GY1A 1OABA 4L80A 3FSUA 4IFRA 3PC0A 3VDGA 4E2VA 2W5FA 4XZIA 5I5RA 4ZXOA 3KRBA 4BK9A 2INEA 4JFWA 2WXDM 4QFUA 3WG6A 3FIGA 4EWND 4DXVA 4S3BA 1C7TA 1H49A 1QI0A 2QJMA 2WM1A 4RZ4A 3H24A 3VD3A 3PP7A 1CT5A 4ECLA 3FDKA 1V4YA 4PSPA 2FFIA 5FJJA 1YDOA 4G6CA 1EHAA 4O18A 1ISWA 5C9RA 4IP4A 3DKLA 4AF0B 2VGGA 4ZB5A 3CH0A 2JFEX 5C5YA 1E5NA 2VFHA 3AZTA 3TJLA 1N7KA 4R9OA 3DYMA 1EGZA 5BMWA 4XKYB 5LZLA 2VUYA 3RCMA 3KTXA 2D2HA 4ZOEA 4K38A 4DO7A 2WSQA 3TOYA 1LUCB 3L2IA 1ZB5A 3B9NA 4QAIA 1OX4B 2R24A 3OLGA 3EWZA 4AZCB 5CG0A 4PMUA 2R14A 2H9AA 1ZENA 2QCDB 4NJJA 2PSNA 1JNDA 3F5LA 2CKSA 4ZE5A 2ABBA 1G6CA 1DWHM 3T55A 2XIBA 4W8BA 4ONVA 1OWQA 1B30A 4HN8A 2JBMA 5D30A 5HJYA 1BRLB 4RV3A 1QWKA 5CBIA 4KERA 3CAKA 2INZA 3TYCA 4Z0SA 2FFCA 2P3ZA 1AW2A 3H4XA 2V3GA 2PTZA 1ZPTA 2O55A 4GGBA 3UXIA 3PJXA 2QNEA 5CGQA 3CWNA 4AHOA 4IQDA 1GKPA 1V3HA 1IEXA 3FLUA 3MHGA 1PIFA 1XQKA 1OBAA 1FH7A 3WH6A 5LSMA 4K7YA 1BG9A 1GVEA 3G8EA 4OECA 2OEJA 3E3HA 1P48A 1JRCA 3NPUA 3PUGA 1N82A 4L4LA 5A3HA 4FX8A 4AH7A 4HVXA 3OVRA 2BSLA 2VMFA 3NQ7A 5EBUA 5HATA 1RR2A 1E0VA 3HMCA 3OZYA 2ZUNA 4UQBA 4PEEA 3CIXA 4Q4SA 3WD1A 2Y4SA 3IPWA 4I90A 4O8AA 4O1CA 2GWGA 4FX6M 3C2VA 4B9ZA 3NZGA 3CTTA 4WSJA 4YHEA 1OFDA 5F4SA 4JTEA 3GAYA 4IGSA 5DEZA 2G95A 1W1ZA 1E0TA 3CUFA 4RW3A 5K9DA 2DW7A 3M0HA 1AQ0A 3MV01 4ERIA 1VHCA 3UXLA 3W7CA 2ALRA 3UZ5A 1BPLB 1OYAA 4LQ1A 1EO7A 1KXQA 2ZVRA 3GC4A 1LT7A 4H3DA 2ZXAA 4MY9A 1TV5A 2PODA 2Z29A 4JTCA 4ZZ9A 1E55A 1BVWA 1MNSA 1XRVA 3O6AA 4MY1A 1J5TA 2EGZA 1NTHA 1WZLA 4X60A 3USBA 1W5PA 1VBJA 1VFHA 2VC9A 4UTWA 4H9YA 4RXGA 3UW6A 2E6YA 1EIXA 1U83A 2GFTA 4IZGA 4BQ3A 1RK6A 4UWMA 1DIKA 3KCLA 3UVAA 4JYEA 3EWYA 2X16A 4JTJA 1D8WA 1KBJA 1BG4A 3MU7A 2W92A 1Y65A 1RJRA 2QMKA 1K8YA 1W3IA 2DSVA 1GQIA 1GOOA 2VR2A 3I6EA 2CZDA 3SRFA 3KDNA 4CNUA 2ZE0A 7ENLA 3UESA 4J2PA 4BA0A 4LC8A 2X09A 1UQZA 4JEJA 2Y0FA 1FP8A 2PDNA 2PDBA 3NL3A 2Y24A 3VKAA 1MXSA 2V3DA 4WDUA 1IT0A 3R10A 3KP0A 2WB5A 1CXHA 2BV9A 5CKSA 3EWCA 2A79A 3DC8A 2F6XA 4AX6A 1UQYA 1S5VA 4FLQA 3WLMA 1AMKA 4R9XA 3BXWA 1RZMA 3GU1A 4C7FA 4F79A 2RJGA 2C1HA 3G3MA 4IIFA 4REQB 2WJDA 1PKYA 2XSXA 1AH3A 3Q37A 1KFEA 4W5ZA 1IXQA 2NVCA 2PF8A 4JNZA 1PCWA 5DQPA 3DUGA 4JY9A 3U8GA 4Q4KA 3POHA 1MQPA 1EO5A 1F6KA 1LDCA 4JKLA 3W2NA 3IV3A 4DWSB 1LOLA 1JYNA 4C7GA 3URBA 3CB3A 3AS1A 1QVBA 2Y7EA 2BY3A 3DHUA 4JBRA 3IAQA 1EWEA 5A8PA 1HFBA 3LGGA 1X6UA 4LSBA 4S3AA 2QUTA 5G1YA 2YDAA 5KZMA 1PEZA 1BQGA 2QV5A 2DUXA 2X2YA 3BURA 4A8RA 3EEGA 1XCXA 5F4WA 4LAMA 1F3EA 4PTDA 2FYMA 3RGTA 4RNJA 3LYEA 3VC5A 1U5HA 1IZJA 2XVKA 4QG6A 4HNVA 1JUBA 6REQA 1Q66A 3Q2DA 1VLWA 1JULA 4RDYA 3GDBA 3NO3A 2YDRA 1KXHA 3WBWA 2B0MA 5T8GA 1KTCA 3OOQA 1KM5A 4RX0A 2GVJA 4C1NB 3SGGA 3SR7A 4OUEA 1BWKA 3O6YX 4FNRA 1AD1A 3R5EA 3TW9A 5EBAA 3VC6A 5KZ6A 3NDOA 3FJ4A 3DFOA 2OSWA 2CLOA 1LOSA 3VD4A 1FHLA 4N9BA 3TH6A 4UQDA 1D7KA 1MXGA 3FHQA 2ZXDA 4NUWA 4QITA 1T0OA 3RR1A 1H1YA 3E2RA 2HWGA 4QLLA 2ZZ3A 1W1VA 1SFTA 2PC4A 4JTKA 8XIMA 4EVZA 3LI1A 4J3UA 3EB3A 1EX5A 4WJ8A 1V6TA 3PFMA 2XN2A 3T6CA 4Q4PA 3M4HA 4FALA 5G1TA 1OFRA 3WFLA 1OEPA 3MJMA 1SW3A 4ICCX 4URIA 1TRDA 5D05A 1JCNA 4NL1A 5HWNA 3UJSA 4IPPA 1E6ZA 3A4WA 3P5ZA 1O68A 1FA2A 5JVLA 2NXIA 5CC7A 4U2YA 2GJNA 1XLCA 1PX3A 4MZYA 3PBVA 4QDWA 1ZBWA 2PUZA 2BVWA 3NNTA 1XFBA 4UFMA 4YJ5A 3GNNA 3WN6A 1BXCA 2HROA 1CXLA 5D09A 1IF2A 2AMGA 2EJ1A 3MW7A 5K3VA 2J8GA 1TWDA 1CYGA 3M9YA 2E5BA 1K70A 2BXYA 2W3ZA 4C6CA 2VFEA 3GX9A 3EPMA 3STFA 2O4MA 1AJ2A 2DW6A 1SFSA 2FPVA 3CUJA 1JQVA 4GINA 1LBMA 4LNYA 5LNVA 2PI6A 1XIMA 4FLOA 2A7NA 1OIFA 3AIBA 3UNDA 1YADA 4M29A 4HSOA 2PWDA 3ARUA 3TWAA 2CWNA 3S5ZA 1ICQA 4CQ9A 1DXIA 1E0XA 1FWNA 2QVNA 4QSFA 1DE5A 5DLCA 1FHDA 2YCIX 4JFVA 3DC0A 3PK7A 4UQ9A 6TIMA 2GPTA 2WZEA 5D2TA 5JBFA 2VC7A 1NWTA 5HR7A 1EFZA 1FX6A 3HO8A 3VPLA 4CU8A 2J8TA 2CXEA 3MHUA 1RA5A 4RE4A 3P82A 3PUEA 3EKZA 3BSMA 2UY3A 3VDAA 4CCCA 4CVUA 4UTUA 2OLSA 2W66A 3XINA 4I8DA 5AC7A 4WK9A 4OV4A 1IWBA 2EXOA 2NQ9A 1UKQA 4ADSA 1G0CA 2ZZ4A 4FNUA 1ME8A 3QKEA 1K8XA 2AL2B 3JR2A 3PJWA 3WQ6A 4W7VA 1EP2A 5JH1A 3VUPA 3VNDA 5BWFA 5HPCA 5AY7A 4UXDA 4TO8A 2WC3A 1C3FA 1VC4A 3WH8A 2J7CA 3U7VA 3TW6A 4G56A 3S3GA 4HK5A 4XAPA 4IMAA 2OSYA 1RVKA 5TIMA 1RY8A 3B05A 3EDJA 2DT3A 4UTTC 2ISWA 3EKGA 1D2KA 2J7EA 3KBSA 4BI6A 2PGFA 4A4AA 4D6FA 1Q5MA 1DJIA 3G1AA 2R9RA 1JZ5A 2Z1KA 5BZAA 3WQOA 1JCLA 1J93A 2PTDA 2JGYA 2CZFA 2PA6A 4L1XA 2V6AA 3VKDA 4Y9OA 3W1LA 1O1HA 2ZOXA 4N02A 1WAUA 4IMEA 2E5CA 1H51A 1NWUA 2ANUA 2NXGA 4FOUA 4QP0A 2O9OA 3TFXA 1Q6GA 1R7AA 2J9YA 4CU6A 5CZSA 3HPXA 4M19A 1TR9A 2YKKA 2V2CA 4IGMA 3SCQA 4KPLA 2P76A 3B06A 3DBPA 5L9FA 3EGJA 3ZFHA 3RLHA 1ZNNA 3IJDA 1UMLA 5M3WA 5HULA 4KT2A 3L4ZA 4H83A 4B2DA 1B90A 3CMFA 2Z1BA 4P61A 3K13A 3RITA 2ZRUA 1X6LA 3A3WA 2VWTA 2SFPA 3RHGA 2A2IA 4JHOA 3FKKA 3KZSA 3P80A 5G4EA 4GKLA 3PUDA 4PL1A 2OQHA 1HO1A 1VF8A 1MDLA 2C71A 2ZDRA 3QVQA 3WF2A 2NX3A 4W8LA 3E0FA 2A7PA 4YPJA 3WD3A 3VIOA 4DUXA 1I2NA 2A3AA 2V2HA 4PSRA 2XTKA 4MKSA 3AICA 4IX0A 4MYAA 3BAWA 5T26A 3VM7A 2XVLA 4NNAA 3WMSA 3KL3A 4LANA 4PB3A 5CC3A 3ZT5A 2DZXA 1Z69A 1ONXA 4Q4OA 3O2LA 1G7VA 2HNEA 4L9YA 3UFYA 1F4AA 3ZIZA 3WFZA 5HMSA 1C8YA 2AAAA 3AJXA 4B9YA 4LUTA 3MSRA 1O94A 5U7SA 4J27A 1VS1A 4ROPA 4AEOA 3HU7A 1H62A 1I75A 1CWYA 3W7LA 5BXRA 2BVDA 2DZAA 3W6MA 1Z7AA 4ZBCA 4DZIA 3FW6A 1CNVA 5GVJA 2WMJA 3HOJA 4WIWA 3MP4A 4N9CA 1EJSC 4YIWA 3N1AA 1R3RA 1PL9A 2O9TA 1V3IA 1R87A 3WK2A 3TWBA 2YW3A 1MWOA 1ZBCA 1SFLA 2OVLA 3M0JA 5I06A 1PYMA 5D9PA 3MJYA 1TSIA 3C6CA 1PZ3A 4YTUA 4JHZA 3FJNA 3KL5A 4U5KA 3BANA 2ISFA 1RHCA 4E4UA 4CKQA 4ES4A 2I1OA 2EEXA 3W7MA 4DPPA 1FY6A 3E2VA 1CGXA 3CO4A 1J0HA 4JXCA 1F8IA 4OBSA 3M0LA 1YHTA 1BQCA 3HQ1A 3TZNA 1ITCA 1F74A 3URQA 4E4FA 2POTA 2VEFA 3KE0A 1ONEA 2RHGA 4QJ5B 3GSMA 4JL2A 4JIRA 4GK8A 4E6MA 2VDHA 5A8OA 4BY3A 4KESA 1FWFC 1TJRA 3WQGA 5FKYA 4DZHA 3VXGA 4UB9A 1R30A 1VPQA 4IXXA 2V5KA 4GZIA 5AVNA 2PRHA 1T7LA 2OYLA 3ITTA 4IPLA 4N42A 2RH9A 1WV2A 4JYFA 4C6OA 4UOJA 1RQBA 3B3DA 3BLLA 4GISA 3BOLA 3M64A 3II1A 3VKCA 3W82A 3HJEA 2F61A 3M0IA 1QI2A 1O6IA 1XLIA 1AL7A 1NFBA 1L6GA 3PBGA 1A49A 2HVMA 3FEMA 4KKXA 3SRKA 3LHWA 4LUSA 1ISYA 3NGFA 4E2BA 1EPVA 5I79A 3M16A 1BYDA 2P1FA 1O5XA 1NEYA 4ZA0A 2WVUA 1BF6A 2PDYA 5AFDA 1KFBA 2FVKA 1HG3A 3E96A 2HZGA 1TR1A 1QNRA 3THUA 2QVHA 1C93A 4DM2A 1OCBA 2DGAA 3EOLA 3T1GA 3VNKA 3BUVA 2CBIA 4BF7A 4DM1A 1H09A 1TKKA 3K46A 1IGSA 3MANA 4AC1X 3LLDA 3DERA 1HN1A 2DPEA 2P3EA 4AUBA 1XYFA 5EL1A 2EPOA 1M3UA 3MSGA 3FK4A 4P8VA 1NFPA