5L9MA

Structure of agrobacterium tumefaciens b6 strain pbp soca complexed with deoxyfructosylglutamine (dfg)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
241
structure length
237
Chain Sequence
DNPLGLIDPTTISVGTMGDAKPYAFTTADGNFTGFDIELFLNVAGRLGFKKEQVVFTGQEFSALMPSVANGRFDVAAAAIGTTAKRKETVDFSDGYLAGFLSVLTSTDAAGLKGKRLGVVQGTLQEIYAEKNFAGTDLVKFPDNNSAVSALNNGTVDAHFLDFEAAKDYSARYPALKIAVNIPSFDAPAGFVIRKGNDALRNALDKGLKEAMQDGTWKKLHEKWFPGTPMPAAYLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for High Specificity of Amadori Compound and Mannopine Opine Binding in Bacterial Pathogens.
pubmed doi rcsb
source organism Agrobacterium fabrum (strain c58 / atcc 33970)
molecule tags Transport protein
molecule keywords Deoxyfructosyl-amino Acid Transporter Periplasmic Binding Pr
total genus 75
structure length 237
sequence length 241
ec nomenclature
pdb deposition date 2016-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9mA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5l9mA02
4NF5A 5A5XB 4RA1A 3T22A 2XXXA 2UVIA 3CSGA 3LSWA 3QXMA 5KDTA 4KD5A 2R6GE 4LONB 1ZKBA 3RTWB 4H5GA 1OVBA 4OVJA 3C32A 3KJTA 3V8XB 2CMOA 4F3GA 1LAGE 1NL5A 4ELRA 4OERA 4YMBA 1QVSA 3MP8A 4YMAA 3PUWE 1JW1A 4ONYA 1D4NA 1AMFA 1M5FA 1NNTA 1UQWA 2RF1A 3ZKKA 4EF2A 3FJMA 4U23A 4DXUA 1M5EA 1JQFA 3R6UA 5CMBA 4R6HA 3EHUA 1Y20A 4NF8A 1EH3A 1B51A 1FTOA 2V3TA 1DPEA 1TXFA 1F9BA 3MQ9A 4R75A 2V3QA 4JWXA 2HEUA 5H8QA 2PVUA 5K2XA 2UVGA 4RXLA 5H8NA 2A5TB 4NTLA 1B46A 2GHBA 4THIA 3SETA 1TFDA 2PX1A 5ICQA 2OCUA 4UACA 3H4ZA 5CC2A 3VXCA 4X48A 3SEUA 3LR1A 1MPCA 3M3LA 3H6VA 4RYAA 1MXVA 3VXBA 1B3HA 1JEUA 1OLAA 4WKMA 1MRPA 1Q1KA 4N6PA 5K2YA 1P1UA 2RC8A 2V84A 3MPKA 3TTRA 4LZ8A 2DWHA 3TODA 3RN8A 1LLSA 4ELQA 3LBSA 4WEDA 4ECFA 1YPNA 3K6VA 1URSA 2F7AA 4ZEBA 3O2AA 5FHNA 5I58A 5EHMA 5I56B 2OWSA 3L6HA 4IY6A 4EUOA 4F18A 2HFBA 4ESXA 3K0VA 1QUKA 2F78A 3FUZA 1I69A 3BFTA 1DMBA 3GBAA 4YZZA 2Y84A 1S50A 3MUQA 4G2ZA 4LQ2A 2GRVA 3UP9A 1SD3A 4NF5B 2AIXA 4QSCA 3TTMA 3VLUA 4EQ7A 1FTKA 1BLFA 2HAVA 3FJ7A 4YKKA 2H4IA 3RTFB 2XXYA 4U4XA 4GVOA 3K4UA 4EDPA 1QKBA 1DTZA 3QSLA 5DYHA 4GF8A 2F7CA 1BIYA 1P1QA 2AL4A 4KCCA 1EZ9A 2DP8A 4YB6A 4HS7A 1BKAA 1QKAA 2O84X 3FASA 1N7XA 1FQDA 1M5DA 1ZJLA 4PP0A 5I84A 1D9VA 4N07A 2I3VA 1B1HA 2VP1A 1MQHA 3KN3A 3MBPA 4N13A 3T96B 4E0XA 4G68A 5I57B 4NF8B 2E1SA 3MVZA 4MF3A 4Q5TA 5F7VA 2F35A 3FJGA 2D3IA 3QYTA 2DS9A 1UIUA 3LSLA 4LP2B 3TDJA 3P7IA 5IKBA 5M2VA 5H8SA 2O51A 4PFTA 3V83A 1FW0A 1KWHA 4MLVA 3PGFA 3CSBA 2QS4A 1FQAA 3HCQA 1SBPA 3D4GA 1XS5A 2ESNA 1YCJA 4LVQA 4QFNA 4LATA 4U2RA 1A8EA 1R9QA 4YU0A 3FVOA 2DQVA 2OK2A 4IO3A 3IX1A 4DDDA 1FTJA 3IB2A 1Y1ZA 4GWOA 4YB5A 1LCTA 5AA2D 3MAMA 3K00A 2DE4A 4MBPA 4XIGQ 5DVIA 4ELPA 4F31B 2AYSA 2R71A 2BJJX 1SYIA 2QS3A 1JETA 5AA4B 1MDP1 1VR5A 4M4GA 3DP8A 1N04A 2DVZA 3G3IA 3TFLA 1I6AA 1SI0A 4FECA 4C0RA 2ABHA 1NNKA 4R6YA 2FYIA 3TCGA 1ZTYA 4OFLA 4XKQA 2XXHA 1MY4A 5ISUA 5CRYA 3O28A 1IITA 3EHSA 4GXAA 5EHSA 1FQBA 3H6WA 3S4UA 5KCJB 4DXBA 4BDRA 5H8QB 1JW4A 4H65A 1XT8A 1B58A 4FE8A 3C31A 4IGTA 4MH5A 3O6GA 2H9BA 3EPEA 1D3KA 1MG1A 4GL0A 4DCXA 1D9YA 2D21A 2X26A 4KFQA 4QFOA 4U1ZA 4KYEA 3ZS6A 4FATA 2REGA 2M8CA 4QFPA 4POWA 3RNNA 3B6TA 3CG1A 4JWYA 3TTKA 3RY3A 4G68B 1MQDA 1R9LA 1R6ZA 2FA7A 3G3FA 3TQLA 2YJPA 4O3AA 3O9PA 4ZZAA 3V89B 2V3UA 1AIVA 4C1TA 1DTGA 1EZOA 1ZLQA 2RC9A 1UTHA 1IXGA 1OQHA 2F34A 3ONMA 2Q89A 3MVWA 3VLVA 2XX8A 3HHGA 1N3XA 2YPNA 2RCBA 4NE4A 4ZZEA 4F3PA 2PT1A 1A40A 5L8DA 4BDLA 4KPTA 2XXIA 4U1OA 5JK4A 1A55A 2F36A 3G7WA 3OEKA 1H43A 2QL3A 3EF7A 2I0CA 1IXHA 3C36A 3KBRA 4GL8A 5TP9B 5CBSA 2UXAA 1ATGA 3CI8A 4LUBA 2ALUA 3MP1A 2I48A 2Q9TA 3LSFB 4XKPA 4YB7A 2XD2A 3V5AA 5J1DA 5L9SA 3UA8A 3IOUA 4NF4A 4E0WA 4R9FA 4FEBA 1MDQA 3KEIA 3UORA 4LZ5A 4RNSA 2Z8DA 1H45A 4H5FA 1VE4A 3VV5A 3N26A 3A3CA 1IQ7A 1MXUA 3KJ7A 3FVKA 2G93A 3ODBA 1B3GA 4R72A 1GV8A 2NWJA 3THIA 2V93A 3O66A 1Y3QA 4BDQA 4F1UA 2XD3A 4NF6A 2UVJA 3VE1B 4Z7EA 3IK6B 2ONKE 3C34A 3IO4A 4AQ4A 1DOTA 4KI0E 3L6GA 4R73A 4ZEDA 3T9UA 3DLNA 4G8MA 1LBCA 1B5IA 1N84A 2YLNA 2F8DA 3U93A 1WODA 2B3FA 2VHAA 1A99A 3G3GA 3MZ1A 4WEPA 3JV9A 1EU8A 3OO8A 1M5CA 4F29A 2H99A 1LSTA 2QSXA 3PUXE 2Y7PA 1MXZA 2ZYKA 3FXUA 3QIMA 1USYE 3R26A 4JB7A 5CM6A 1AOVA 2IEEA 1MQJA 4OFJA 4OENA 3MZBA 4H6DA 3FVNA 3KGCA 4P11A 4XTCQ 2NXOA 5DVFA 5ITOA 4GD5A 3W9VA 4FAJA 3F11A 1NKXA 3TKDA 2HXWA 1II5A 2PT2A 1M5BA 3E3KA 5I58B 3FV1A 4G8HA 1NH7A 3IO6A 4U21A 1B2HA 1LAFE 2X7PA 3CRBA 2P1SA 3PPNA 5AA1A 3S9MC 4YKJA 1P1WA 1B5JA 1UTBB 3B7DA 2H98A 3H03A 4HCWA 4IO7A 4RJZA 3ZSFA 1H3DA 2Y7WA 3O6IA 3KSXA 4G4PA 4R6KA 3SEVA 4MLQA 5H8HA 1SYHA 3TTNA 3S9LC 4F22A 2I58A 3K1NA 4FIMA 3A3UA 3MC2A 1B4HA 2I0BA 3MVXA 3PUZE 3M3FA 2H25A 4I1DA 4O3CA 3BKIB 1QW0A 5AA3A 5H8NB 1SW5A 2ONRA 4BDOA 2GFEA 3TEPA 1LAHE 1S9TA 1TWYA 4PFYA 3RT8A 1VFEA 1CB6A 3K6XA 1Y4CA 2QPQA 2P0SA 2XHDA 3KN8A 3MZ9A 4IGRA 2REJA 3QAXA 5HPQA 1H76A 3OO7A 3PMXA 4YKPA 4HW8A 4GOTA 1AL3A 4G77A 2XXVA 4XXUA 2Q8JA 3Q29A 1OLCA 2O7IA 4ND9A 3SKPA 4F1VA 3TUSA 1B7UA 5I2KB 1MH4A 2Q2CA 2ZNSA 3Q27A 1DSNA 1PB7A 1SVXB 4YAHX 3VLWA 1LB9A 1RYOA 4QSDA 3UGWA 1PC3A 2OJTA 1NMUA 4HTGA 3HHFA 2Z22A 4OXVA 2OWTA 4GFRA 4Q8RA 3UIFA 3TZAA 1H44A 1US4A 2QJEA 1YTVA 3K2DA 4G8NA 4WXJA 5AA4A 2XXPA 4IB2A 5TP9A 1SW2A 2O6AA 3PD9A 3T66A 1MPBA 1RKMA 3TQWA 2Z8FA 2ZNUA 1PEBA 4JWOA 4XKNA 1XOCA 3MVYA 4EQ9A 2QS1A 3U8QA 4TLLB 4ZE9A 3RGYA 4DLDA 3R7XA 4AB6A 4NF4B 1QUJA 2Z23A 2O1MA 2Y7KA 4X1DA 3C33A 4IO6A 4TLMB 1TFAA 5CMCA 3U92A 4NWDA 4OETA 1MXXA 1JVXA 5I59A 2D5WA 4OWDA 5JTYB 5I2NB 3H6TA 1VFDA 3GXAA 3JYRA 4H8JA 1B0HA 3KOTA 4OHNA 1SDXA 3K6UA 3PD8A 3MWBA 4KHZE 4BDNA 1MY1A 1LFGA 4NF6B 2GHAA 1DPPA 2ZNTA 1WDNA 4F3BA 4QFKA 3N94A 3OMBA 4F39A 3BBRA 4I9DA 3TYHA 2AL5A 2A5TA 1MPDA 1A7LA 3E4RA 2HCAA 4O3BA 1FCKA 2I6EA 3OO6A 3RT6B 3IR1A 4QFLA 4FJPA 2ANJA 4Z0IA 5A5XA 3IJOB 3PUYE 1FQFA 3KG2A 1T0KA 1HSJA 4BLAA 2UVHA 1MY3A 3FATA 3TCFA 2F6GA 2OBGA 3FGSA 1HSEA 1P1NA 4G68C 1IUDA 2W7YA 3N5LA 2O1LA 3S9NC 1LCFA 3DELB 4QSEA 4P0IA 4DXCA 5CMKA 3N6UA 3W9WA 3TCHA 1ELJA 5DVJA 5I56A 4YICA 4BDMA 1ZIUA 1SW4A 2I4CA 2ZYNA 4EXKA 1Y3NA 1NNFA 2F5XA 2KLFA 1URDA 2NUVA 3G3KA 4LQ5A 1IXCA 1FQEA 1I6QA 4OEUA 5H8FB 3SEWA 4GQOA 2I4BA 3IL1B 3MP6A 2DVCA 5LOMA 4HCYA 2OLBA 5H8HB 4KYSA 3LUYA 2ONSA 1AH5A 3B6QA 1IIWA 3KFMA 4OZ9A 1OVTA 3I5OA 1Q35A 3U1OA 1N3WA 1R1NA 3H6UA 3M3KA 5AE4A 4JBZA 1ZBMA 1Z7NE 2HQ0A 3C9HA 1IXIA 3CG3A 5F1QA 4R74A 1J1NA 3HO7A 1P99A 3RQTA 3DM0A 1HSLA 3TTLA 1B1XA 3Q25A 4MFIA 4RY1A 3H3GA 3CIJA 3HN0A 2XXWA 2V25A 4U4SA 4AB5A 4Q0CA 4F3SA 5TPAB 1MQIA 5B70A 3TAJA 2IA4A 5CMMA 3W15C 1BP5A 3FV2A 2I49A 3OD7A 1LBBA 5CBRA 4TOZA 5FHOA 4EQBA 4EXLA 1BTJA 4IO5A 5IAIA 3IAZA 3WAFA 3GBBA 1B05A 1WVJA 3TMGA 2P2AA 4I8CA 3FXQA 4RK9A 5BUUA 5CI5A 3PMVA 4YKIA 1S7YA 3T93B 3A09A 3M8UA 5B7DA 1MY0A 3FXRA 4ZE8A 4F1YA 3IORA 3HPIA 4DZ1A 1MM7A 1B3LA 3RPWA 3KN7A 3QUJA 1MM6A 4H67A 1FTLA 1ZMGA 2G29A 3TELA 2QMWA 3DP4A 2QMXA 1O7TA 1P1OA 2E0SA 4LA9A 1MS7A 1EZPA 2VOZA 2A5SA 4ZEIA 1PB9A 1SI1A 1A54A 2HAUA 2VGQA 2F7BA 3K01A 1US5A 4PQJA 3IJXB 4OTEA 2XXQA 4RK2A 1MY2A 1FTMA 3IOVA 1OMPA 2NOOA 4OYVA 3CFXA 4DCYA 1B0LA 2F97A 2XXUA 1UIVA 4JDFA 3SESA 4PETA 1POY1 5BWJA 4L17A 3OELA 5HBCA 3I6VA 3PUVE 3B6WA 4TQUQ 1ZU0A 5FTHA 4NWCA 1RYXA 4PE5B 1JEVA 1NFTA 3CFZA 2O69A 2HZKA 4RPNA 3O97A 4X1BA 4ZEFA 5DTBA 2Y7RA 4ELOA 2H5YA 1GGGA 4IO2A 1NNPA 3HV1A 2DSFA 3OO9A 2RCAA 5ITPA 4F2QA 4PFUA 2HZLA 4K3FA 1B7HA 1GVCA 3OSQA 3S2VA 2DWIA 3CR9A 3RLFE 1LGBC 1PBQA 1UTHB 4IY5A 3FIRA 3ZKLA 5AA2A 2XX9A 3H7MA 2RINA 3K1PA 1B3EA 1MXWA 1B3FA 2GH9A 1JVYA 2DYXA 2UYFA 1N76A 1JW5A 2B65A 1USYH 4OEVA 1OQGA 3Q26A 1UTBA 4OMBA 4FEDA 4QRZA 1ANFA 2QS2A 3CFLA 5FTIA 1IZ1A 4JXIA 1Z7ME 4RPOA 3MJNA 4XKRA 4KQPA 5TU0A 3UN6A 4X9TA 5KZTA 4P0GA 4GXSB 1XHYA 1LFHA 4H0WA 1QUIA 2VD3A 2DWAA 1SW1A 2Q88A 3JZJA 5DEXA 1B7ZA 1FQCA 2XX7A 2NVUB 5HM4B 5DEXB 1LFIA 3FVGA 2O68A 2OZZA 4OESA 4R2FA 3AXFA 1SQYA 3KSJA 4ISUA 3PMWA 4GRKA 3PPQA 3MW0A 3N6TA 1JNFA 3E13X 3C4MA 4GLIA 1Y4TA 4LZ7A 2DOJA 2DXRA 3U94A 5I2NA 5JTYA 2Y7IA 2DXYA 4NEDA 4M1VA 2O7UA 3OSRA 3HSTA 1IEJA 2FNCA 5L9MA 1QJMA 3FZVA 4ZS9A 5EYFA 1XC1A 3K02A 3MPLA 3OOAA 1L5TA 5I2KA 1B6HA 3IB1A 3FD3A 3H06B 3CVGA 4IO4A 3RUMA 1XVXA 4EF1A 4H8IA 1URGA 1B32A 3KOSA 1GR2A 1B4ZA 3IB0A 3SEYA 5L9OA 3LC8A 3SEXA 4QHQA 1PBPA 2RKMA 2WKYA 4KR5A 1PDAA 4OQOA 3K6WA 3GLBA 4GIZA 1XVYA 3D4CA 1N0TA 5KDTB 3I3VA 1YAEA 4OFOA 1Y9UA 3O29A 2PMSA 2LAOA 1B5HA 3C35A 4KYDA 3PPOA 3EHTA 1TT1A 3ILTB 3G3HA 3QUFA 4PFWA 1B40A 3GZGA 1LAXA 2RC7A 2XXTA 1O64A 5I59B 2ZYMA 1Y3PA 3O6HA 2B3BA 4U22A 2THIA 4F2OA 3G3JA 2DWJA 4Q30B 3VVEA 3WAEA 2F6PA 4UA8A 1N7WA 2R9JA 4KCDA 3EN3A 3PV0E 3T9HB 3VVDA 4DE8A 2CZLA 4I62A 3QK6A 2DE3A 3VFJA 3BFUA 2XXRA 3OXNA 3S9EA 1OIBA 4R2BA 3SDFA 3K1MA 3KZGA 4ESWA 3DP6A 4QF9A 3USDA 2X7QA 2PBWA 3SERA 2DE2A 2ZYOA 3VVFA 4C1UA 5FHMA 1I6BA 1QULA 1CE2A 3Q28A 4R9GA 2ZMBA 5ELVA 4F19A 5I57A 5ICTA 2QRYA 1VSOA 1Y1MA 1PB8A 3OENA 4JSOA 5TPAA 3EQ1A 3IOWA 1GTKA 4NMYA 3VDFA 2VD2A 2Z8EA 3U72A 3TPAA 4DIGA 3T9XB 2PYYA 3T9VA 1NH8A 1B9JA 1LB8A 1MQGA 3ILUB 4ZDMA 3OEMA 3IOTA 4H1XA 4JSDA 5DT6A 2Q2AA 5AA2B 4ZEKA 1O63A 4POXA 1MXYA 4ZECA 3ECRA 5H8FA 4FORA 3UK4A 3PPRA 3LSXA 1A8FA 3E9XA 1B52A 5JEIA 3PPPA 5KCJA 2UYEA 1POTA 1MH3A 3PU5A 2I3WA 2ZXTA
chains in the Genus database with same CATH superfamily
4NF5A 4MX6A 3LSWA 4KD5A 4LONB 1FPBA 3A29A 4H5GA 1NL5A 3CHGA 4NAPA 1JW1A 4ONYA 1UQWA 3BIHA 4DI4B 4GBVA 2RF1A 4U23A 4R6HA 3EHUA 4NF8A 1TXFA 1F9BA 2CEXA 4RXLA 2A5TB 4NTLA 2GHBA 1FPGA 5ICQA 4N8YA 1G0HA 3H4ZA 1MPCA 4RYAA 3H6VA 1MXVA 4WKMA 5K2YA 4N6PA 4MMPA 4X04A 2RC8A 4LZ8A 4ELQA 4MNPA 1YPNA 3FBPA 2OWSA 3L6HA 4EUOA 4XFEA 3K0VA 3FUZA 3BFTA 4PBHA 2Y84A 3MUQA 2GRVA 3QMFA 4NF5B 4EQ7A 3VLUA 1BLFA 4YKKA 2H4IA 3QSLA 4P9KA 1P1QA 4KCCA 1LBVA 1BKAA 3FASA 1N7XA 1M5DA 2VPNA 2I3VA 5I57B 3KN3A 4PTKA 3QYTA 5IKBA 4MLVA 3PGFA 1NUZA 4QFNA 4LATA 3FVOA 2OK2A 4IO3A 2ZZWA 4ELPA 4ZE9A 2BJJX 2QS3A 4FBPA 1VR5A 4PC9A 2DVZA 4C0RA 1NNKA 4R6YA 1ZTYA 2XXHA 1MY4A 3S9LC 3EHSA 4GXAA 5H8QB 4FE8A 3C31A 4IGTA 4MH5A 1D3KA 3U65A 4DCXA 4U1ZA 2WYKA 4JWYA 1MQDA 1R9LA 2FA7A 2FHYA 2F3BA 3V89B 2OWZA 1EZOA 1XI6A 4LN5A 2F34A 4F3PA 1A40A 5L8DA 3C36A 5TP9B 4MNCA 3V5AA 1MDQA 4LZ5A 3VV5A 1JP4A 1MXUA 3FVKA 1GV8A 1D9QA 4NF6A 2UVJA 2ONKE 1NV1A 4KI0E 1N84A 2F8DA 2B3FA 1M5CA 2H99A 1LSTA 2QSXA 2ZYKA 3QIMA 4OFJA 4H6DA 3FVNA 3KGCA 3F11A 3E3KA 4G8HA 3IO6A 4U21A 3S9MC 1B5JA 4OVTA 2H98A 4RJZA 1Q9DA 3O6IA 3SEVA 1NV2A 4MLQA 3TTNA 3K1NA 3MC2A 4N6DA 2I0BA 3MVXA 4O3CA 2H25A 3BKIB 1QW0A 2ONRA 2GFEA 4PFYA 3IFCA 2P0SA 2REJA 5HPQA 1OLCA 4HXVA 1B7UA 1MH4A 2Q2CA 3Q27A 1PB7A 1RYOA 1NMUA 2Z22A 3UIFA 1H44A 1US4A 1YTVA 5TP9A 4IB2A 5B7DA 2ZNUA 1PEBA 4EQ9A 3U8QA 2WEFA 4DLDA 1YYZA 4MEVA 1QUJA 4IO6A 1MXXA 4OWDA 4H8JA 4OHNA 1SDXA 3MWBA 3NOHA 5J16A 4NF6B 1DPPA 1WDNA 4N81A 4I9DA 2AL5A 4O3BA 1MPDA 2JJKA 2HCAA 5A5XA 4Z0IA 3KG2A 4BLAA 2F6GA 2W7YA 2O1LA 4QSEA 5EQ9A 4P0IA 4DXCA 5CMKA 3W9WA 5I56A 4BDMA 1NNFA 1URDA 3SEWA 3RPLA 4GQOA 3IL1B 5H8HB 3LUYA 2ONSA 3E79A 4JBZA 1K9YA 1Z7NE 3C9HA 1IXIA 1J1NA 3RQTA 4OA4A 1HSLA 4PDDA 3Q25A 2Y5KA 2XXWA 4U4SA 2KR0A 4Q0CA 5TPAB 2IA4A 3FV2A 5FHOA 1RDYA 4N17A 4O7MA 1NV6A 3A09A 2HHMA 3HPIA 3IORA 1B3LA 2WBDA 4GWSA 1O7TA 2E0SA 1MS7A 2WBBA 1PB9A 1A54A 2HAUA 2XXQA 4PCDA 1FTMA 4HE2A 4GWWA 5I5PA 1POY1 1AWBA 1ZU0A 5FTHA 4NWCA 4X1BA 2O69A 4ELOA 4OANA 5ET7A 1GGGA 1NV4A 3OO9A 5ITPA 4K3FA 3OSQA 2DWIA 1LGBC 2QVRA 3K1PA 1MXWA 2DYXA 1JW5A 1USYH 3Q26A 4FEDA 3CFLA 5TU0A 3MJNA 3UN6A 4X9TA 5KZTA 4GXSB 1LFIA 5EYHA 4ISUA 3KSJA 3PPQA 3MW0A 3E13X 3C4MA 5I2NA 5JTYA 2DOJA 2Y7IA 2DXYA 4NEDA 1NV7A 3FZVA 1KA1A 3IB1A 3CVGA 3KOSA 4PE3A 4QHQA 2RKMA 3SEXA 3D4CA 1YAEA 3O29A 2PMSA 2LAOA 1B5HA 3QUFA 3G3HA 3GZGA 1O64A 1Y3PA 1DBZA 4KCDA 3EN3A 4OVPA 3T9HB 4I62A 4ESWA 3DP6A 3USDA 2PBWA 4P8BA 3SERA 2DE2A 1QULA 4R9GA 5ICTA 4JSOA 1NUXA 3VDFA 4PAIA 2Z8EA 3TPAA 4DIGA 3T9XB 2R8TA 1B9JA 5CBRA 2Q2AA 5LDZA 3LSXA 2XWVA 3E9XA 2UYEA 2PCRA 4I40A 3QXMA 5KDTA 2R6GE 3V8XB 3KJTA 2CMOA 4YMBA 1D4NA 1AMFA 4DXUA 5CMBA 2P3VA 1EH3A 1DPEA 5H8QA 2UVGA 2BJIA 3SETA 3SEUA 5A5LA 1B3HA 1OLAA 1Q1KA 2V84A 3RN8A 3LBSA 4WEDA 3K6VA 1URSA 4ZEBA 1INPA 5I58A 5EHMA 1FBPA 1QUKA 2ZZVA 3KBZA 3UP9A 3FJ7A 4U4XA 4GF8A 2AL4A 1QKAA 1ZJLA 3MBPA 1MQHA 4LP2B 3LSLA 4OVQA 3TDJA 3V83A 1KA0A 2QS4A 1FBGA 1FQAA 3HCQA 1SBPA 4LVQA 1YCJA 1R9QA 4YU0A 1Y1ZA 4N6KA 3MAMA 2DE4A 4XIGQ 1SYIA 1MDP1 1FPDA 1N04A 3G3IA 1I6AA 2KQZA 2ABHA 5ISUA 3H6WA 4DXBA 2B4LA 4BDRA 5ET6A 1B58A 4KYEA 4POWA 3RY3A 4G68B 1AIVA 1OQHA 2Q89A 2YPNA 2PT1A 4BDLA 2XXIA 4NQ8A 1A55A 3E78A 3CI8A 4LUBA 2ALUA 2I48A 4XKPA 5L9SA 1CNQA 3UA8A 4NF4A 3LV0A 4E0WA 4FEBA 1EYKA 3A3CA 5CM6A 1B3GA 4BDQA 3B50A 3C34A 4OVRA 1LBCA 2VHAA 3MZ1A 3JV9A 1EU8A 4O8MA 2Y7PA 1MXZA 3FXUA 3MZBA 4FAJA 3TKDA 2HXWA 1II5A 4H45A 1M5BA 4PGPA 2X7PA 5AA1A 2P1SA 3ROJA 4YKJA 3H03A 3ZSFA 2I58A 4FIMA 3A3UA 4I1DA 1LAHE 1S9TA 1Y4CA 3PTYA 3KN8A 4IGRA 1H76A 3OO7A 3PMXA 4GOTA 3TUSA 1SVXB 5IZ1A 3HHFA 4Q8RA 4OVSA 2QJEA 2Y5LA 4G8NA 4WXJA 4MIJA 4PFIA 3PD9A 2PFZA 2ZZXA 4XKNA 1XOCA 4P1LA 3RGYA 3U92A 4NWDA 2D5WA 2Q8MA 3JYRA 3KOTA 3PD8A 1LFGA 3KC1A 2ZNTA 4F3BA 4QFKA 4F39A 1FRPA 3TYHA 3RT6B 4ESXA 5A5XB 1FCKA 2I6EA 4QFLA 1HSJA 3TCFA 1MY3A 4G68C 1IUDA 1IMFA 3N5LA 1LCFA 3N6UA 3TCHA 5DVJA 2I4CA 2NUVA 5IM2A 3T1BA 2OLBA 1AH5A 1IIWA 3KFMA 1Q35A 4PFBA 1N3WA 1R1NA 5AE4A 1FBFA 4R74A 1P99A 3TTLA 4MFIA 4RY1A 2V25A 3OD7A 1LBBA 4EXLA 4EQBA 4IO5A 1WVJA 3TMGA 5BUUA 5IGAA 4YKIA 3M8UA 4N4UA 1MY0A 4ZE8A 4F1YA 2VPOA 3RPWA 1NUYA 3KN7A 1G0IA 1MM6A 1FTLA 2G29A 2QMWA 5EYGA 4LA9A 2A5SA 4GWXA 2F7BA 4RK2A 1MY2A 1OMPA 2NOOA 3CFXA 1UIVA 4PETA 5BWJA 4L17A 3OELA 5HBCA 3I6VA 4TQUQ 1RYXA 4ZEFA 2Y7RA 4PGNA 2H5YA 2DSFA 3SZPA 1B7HA 4XF5A 3RLFE 4GBWA 3ZKLA 1DK4A 2GH9A 2B65A 4OMBA 4OEVA 1UTBA 4QRZA 1ANFA 1Z7ME 4HE1A 4RPOA 4KQPA 1XHYA 1LFHA 2VD3A 2DWAA 4QBAA 2XWIA 4MCOA 5DEXB 2OZZA 4OESA 1SQYA 3N6TA 4LZ7A 1Y4TA 1FPKA 2O7UA 3OSRA 1L5TA 3FD3A 3RUMA 4H8IA 1URGA 5EQ7A 3SEYA 2WKYA 4KR5A 4OQOA 3GLBA 2F3DA 1XVYA 1IMCA 4OFOA 1Y9UA 3VFJA 1TT1A 3ILTB 4PFWA 1B40A 2XXTA 5I59B 2B3BA 3EKIA 1FBHA 4U22A 3G3JA 3VVEA 4F2OA 1N7WA 3VVDA 4DE8A 2CZLA 5I3SA 3VVFA 1CE2A 1FPFA 2DDKA 3EQ1A 3IOWA 1GTKA 4NMYA 2VD2A 3U72A 1MQGA 3ILUB 3OEMA 4H1XA 1FTAA 4ZECA 3ECRA 5H8FA 2Q74A 4FORA 1B52A 1MH3A 3BIGA 2ZXTA 3T22A 2XXXA 3CSGA 1DCUA 3RTWB 1OVBA 4OVJA 3C32A 4P1EA 1QVSA 3MP8A 3PUWE 3ZKKA 1M5FA 4PAKA 3FJMA 4UABA 1M5EA 2OX3A 1JQFA 3R6UA 1VDWA 1B51A 1FTOA 4R75A 4JWXA 5K2XA 4PF6A 5H8NA 4THIA 1B46A 1TFDA 3FXBA 2OCUA 4UACA 5CC2A 3M3LA 3VXBA 1MRPA 1P1UA 3MPKA 3TTRA 3TODA 1LLSA 4H46A 2F7AA 5FHNA 4F18A 2HFBA 1I69A 1DMBA 1S50A 4G2ZA 4LQ2A 4GWZA 1SD3A 1FTKA 2HAVA 3K4UA 4EDPA 1BIYA 1QGXA 1EZ9A 2DP8A 4YB6A 5I84A 1FQDA 2VP1A 5F7VA 2F35A 3FJGA 1UIUA 5M2VA 4PFTA 1FW0A 1KWHA 3CSBA 2DQVA 4DDDA 1FTJA 4YB5A 4GWOA 1LCTA 3K00A 5DVIA 1IMBA 1LBXA 4M4GA 3TFLA 1SI0A 4FECA 3TCGA 4OFLA 3S4UA 4MJOA 4H65A 2H9BA 3EPEA 4GL0A 2D21A 2X26A 4KFQA 4QFOA 3ZS6A 4FATA 3TTKA 3B6TA 1R6ZA 3G3FA 4O3AA 2V3UA 4C1TA 1ZLQA 1UTHA 1IXGA 3ONMA 3VLVA 4NE4A 4ZZEA 5JK4A 4NX1A 3EF7A 3KBRA 1ATGA 2FVZA 4PFRA 3MP1A 2Q9TA 4YB7A 3LSFB 5J1DA 3KEIA 3UORA 4PAFA 4RNSA 2Z8DA 4H5FA 1IQ7A 4R72A 2V93A 2XD3A 3IO4A 4P3LA 4ZEDA 3L6GA 4G8MA 2QVUA 1B5IA 2YLNA 3B8BA 4F29A 3PUXE 3R26A 1AOVA 1MQJA 2XWOA 4P11A 2NXOA 4GD5A 1NKXA 2CZHA 1NH7A 1B2HA 1P1WA 1RDZA 3B7DA 2Y7WA 4G4PA 3ISPA 5H8NB 3PUZE 5AA3A 1SW5A 4BDOA 3TEPA 3RT8A 1CB6A 2QPQA 2XHDA 1AL3A 2XXKA 2O7IA 3SKPA 4I3EA 3UGWA 4QSDA 4HTGA 4HE0A 4GFRA 3TZAA 3K2DA 3T66A 2Z8FA 4JWOA 3MVYA 2QS1A 4TLLB 3R7XA 2Y7KA 4X1DA 3C33A 1JVXA 5I59A 5JTYB 5I2NB 3GXAA 3K6UA 1YXIA 4BDNA 2GHAA 5ET5A 3N94A 3OMBA 3BBRA 1A7LA 3E4RA 4DI3D 3OO6A 3PUYE 1FQFA 4MHFA 2UVHA 3FGSA 2OBGA 1FJ6A 1P1NA 3S9NC 1ELJA 5ESYA 3RYDA 1ZIUA 2ZYNA 3MSTA 2F5XA 4LQ5A 2KLFA 4OEUA 1I6QA 2I4BA 2DVCA 5LOMA 4HCYA 2PFYA 4KYSA 3B6QA 4OZ9A 1OVTA 3I5OA 3U1OA 2HQ0A 3CG3A 3HO7A 3DM0A 1B1XA 3CIJA 3HN0A 1RDXA 1MQIA 5B70A 3W15C 2I49A 2XA5A 1BTJA 1FJ9A 1FPJA 3IAZA 3GBBA 2P2AA 4I8CA 4RK9A 3T93B 4O94A 4DZ1A 1MM7A 1IMEA 3QUJA 4H67A 2QMXA 1P1OA 2V4CA 1EZPA 2VOZA 1SI1A 3KC0A 3K01A 1US5A 3IJXB 4OTEA 4OYVA 1B0LA 2F97A 1NUWA 1NFTA 4RPNA 3O97A 4IO2A 1NNPA 3HV1A 4I3YA 2RCAA 4PFUA 2HZLA 1GVCA 3S2VA 1PBQA 4IY5A 2XX9A 2RINA 1B3EA 1JVYA 5IZZA 5FTIA 1IZ1A 4JXIA 1BK4A 1NI9A 4GX4A 4H0WA 1SW1A 2NVUB 1FPIA 4R2FA 2WYPA 4GRKA 4M1VA 1IEJA 2FNCA 5EYFA 4ZS9A 1XC1A 3MPLA 3OOAA 1B6HA 4IO4A 3H06B 4NF0A 3GYYA 1GR2A 3IB0A 5L9OA 1PBPA 1PDAA 3K6WA 4GIZA 2MKZA 3PPOA 3EHTA 2RC7A 3O6HA 2THIA 2R9JA 3QK6A 3S9EA 1OIBA 4QF9A 4C1UA 5FHMA 1I6BA 5ELVA 2ZMBA 4F19A 5I7IA 4GX3A 2QRYA 5TPAA 1PB8A 3OENA 1IMDA 1LBYA 3LUZA 2PYYA 3T9VA 1LBZA 3IFAA 4ZDMA 3IOTA 5AA2B 4PDHA 1O63A 4N8GA 2HXRA 3PU5A 2I3WA 5AA4B 1FBDA 4RA1A 2UVIA 1ZKBA 4F3GA 4O7IA 1SPIA 1LAGE 4ELRA 4OERA 4YMAA 4EF2A 1NNTA 1Y20A 4GWUA 2V3TA 3MQ9A 2V3QA 2HEUA 2PVUA 2PX1A 1FPLA 3VXCA 4X48A 3LR1A 5AA2D 1JEUA 1YZ0A 2DWHA 4NGUA 4ECFA 3O2AA 5I56B 4IY6A 5LTCA 2F78A 4YZZA 3GBAA 4QSCA 2AIXA 3TTMA 4GX6A 3RTFB 2XXYA 4GVOA 1QKBA 1DTZA 5DYHA 2F7CA 4HS7A 2O84X 4PP0A 1D9VA 4N07A 1B1HA 4N13A 3T96B 4E0XA 4G68A 4NF8B 2E1SA 3MVZA 4MF3A 4P47A 4Q5TA 4JVIA 2D3IA 2DS9A 3P7IA 5H8SA 2O51A 3D4GA 1XS5A 2ESNA 5IZ3B 4U2RA 5FBPA 5IZ3A 1A8EA 3IX1A 3IB2A 4QXDA 4MBPA 4F31B 2AYSA 2R71A 5ET8A 1JETA 2GQ1A 3DP8A 4MNIA 2FYIA 4X8RA 4XKQA 5CRYA 3O28A 1IITA 5EHSA 1FQBA 1JW4A 1XT8A 3O6GA 1MG1A 1D9YA 4N91A 2REGA 2M8CA 4QFPA 3RNNA 3CG1A 2WX9A 3TQLA 2YJPA 3O9PA 4ZZAA 1DTGA 2RC9A 4JVDA 3MVWA 2XX8A 3HHGA 1N3XA 2RCBA 4KPTA 3HFUA 4U1OA 1FPEA 2F36A 3G7WA 3OEKA 1H43A 2QL3A 2I0CA 1IXHA 4GL8A 5CBSA 2UXAA 5F24A 2XD2A 3IOUA 4R9FA 4IR8A 1H45A 1VE4A 3N26A 3KJ7A 3ODBA 2G93A 3THIA 4F1UA 2NWJA 1NV0A 3O66A 1Y3QA 2XWKA 3VE1B 4Z7EA 3IK6B 4AQ4A 1DOTA 4R73A 3T9UA 3DLNA 3U93A 2B4MA 4NN3A 1WODA 3G3GA 1A99A 4WEPA 3OO8A 4NHBA 1USYE 4JB7A 2IEEA 4OENA 5DVFA 4XTCQ 3MYUA 5ITOA 3W9VA 2PT2A 5I58B 3FV1A 1LAFE 3CRBA 3PPNA 4HCWA 1UTBB 4IO7A 1FBCA 1H3DA 3KSXA 4R6KA 5H8HA 1SYHA 4F22A 1B4HA 3M3FA 2CZKA 1TWYA 1VFEA 3K6XA 3MZ9A 3QAXA 4YKPA 4HW8A 4G77A 2XXVA 4XXUA 2Q8JA 3Q29A 2FIXA 4ND9A 4F1VA 5I2KB 2ZNSA 4YAHX 1DSNA 3VLWA 1LB9A 1LBWA 1PC3A 2OJTA 4OXVA 2OWTA 5AA4A 2XXPA 1SW2A 2O6AA 1MPBA 1RKMA 3TQWA 5EQ8A 2P3NA 4AB6A 4NF4B 2Z23A 2O1MA 4TLMB 5CMCA 4AS5A 1TFAA 4OETA 3H6TA 1VFDA 1B0HA 3T0JA 4KHZE 1MY1A 1NV5A 2CEYA 2A5TA 1K9ZA 3IR1A 4FJPA 2ANJA 3IJOB 1T0KA 3FATA 1HSEA 2QFLA 3DELB 1EYJA 4YICA 1EYIA 1SW4A 5T3JA 4EXKA 1Y3NA 3G3KA 4PF8A 1IXCA 1FQEA 5H8FB 3MP6A 3H6UA 3M3KA 1ZBMA 5F1QA 3H3GA 4PBQA 4AB5A 4F3SA 4NG7A 3TAJA 5CMMA 1BP5A 1FSAA 1FBEA 4TOZA 1IMAA 5IAIA 3WAFA 1NV3A 1B05A 3FXQA 2VT5A 5CI5A 3PMVA 1S7YA 3FXRA 4G61A 3TELA 1ZMGA 3DP4A 4GWYA 4ZEIA 2VGQA 4PQJA 3IOVA 4DCYA 2XXUA 4JDFA 3SESA 3PUVE 3B6WA 4PE5B 1JEVA 3CFZA 2HZKA 5DTBA 1KZ8A 4JVCA 4F2QA 3CR9A 1UTHB 5AA2A 3FIRA 3H7MA 1B3FA 2UYFA 1N76A 4AS4A 1OQGA 2QS2A 2L5VA 4XKRA 4P0GA 2HPGA 1QUIA 2Q88A 3JZJA 5DEXA 1B7ZA 1FQCA 2XX7A 5HM4B 3FVGA 2O68A 3AXFA 3PMWA 1JNFA 4GLIA 2DXRA 3U94A 4P56A 2FBPA 3HSTA 5L9MA 1QJMA 3K02A 1LEVA 5I2KA 1XVXA 5DW8A 4EF1A 4KXPA 1B32A 2QVVA 1B4ZA 3LC8A 1N0TA 5KDTB 3I3VA 4KYDA 3C35A 4N15A 1LAXA 2ZYMA 4Q30B 2DWJA 3WAEA 2F6PA 4UA8A 2CZIA 3PV0E 2DE3A 3BFUA 2XXRA 2FIEA 3OXNA 4R2BA 3SDFA 3K1MA 3KZGA 4XEQA 2X7QA 2ZYOA 4MAGA 3Q28A 3D1RA 5I57A 1VSOA 1Y1MA 1NH8A 1LB8A 4JSDA 5DT6A 4ZEKA 4POXA 1MXYA 5EQAA 3UK4A 3RPLB 3PPRA 1A8FA 5JEIA 3PPPA 5KCJA 1POTA 5KCJB
chains in the Genus database with same CATH topology
4NF5A 5A5XB 4RA1A 3T22A 2XXXA 2UVIA 3CSGA 3LSWA 3QXMA 5KDTA 4KD5A 2R6GE 4LONB 1ZKBA 3RTWB 4H5GA 1OVBA 4OVJA 3C32A 3KJTA 3V8XB 2CMOA 4F3GA 1LAGE 1NL5A 4ELRA 4OERA 4YMBA 1QVSA 3MP8A 4YMAA 3PUWE 1JW1A 4ONYA 1D4NA 1AMFA 1M5FA 1NNTA 1UQWA 2RF1A 3ZKKA 4EF2A 3FJMA 4U23A 4DXUA 1M5EA 1JQFA 3R6UA 5CMBA 4R6HA 3EHUA 1Y20A 4NF8A 1EH3A 1B51A 1FTOA 2V3TA 1DPEA 1TXFA 1F9BA 3MQ9A 4R75A 2V3QA 4JWXA 2HEUA 5H8QA 2PVUA 5K2XA 2UVGA 4RXLA 5H8NA 2A5TB 4NTLA 1B46A 2GHBA 4THIA 3SETA 1TFDA 2PX1A 5ICQA 2OCUA 4UACA 3H4ZA 5CC2A 3VXCA 4X48A 3SEUA 3LR1A 1MPCA 3M3LA 3H6VA 4RYAA 1MXVA 3VXBA 1B3HA 1JEUA 1OLAA 4WKMA 1MRPA 1Q1KA 4N6PA 5K2YA 1P1UA 2RC8A 2V84A 3MPKA 3TTRA 4LZ8A 2DWHA 3TODA 3RN8A 1LLSA 4ELQA 3LBSA 4WEDA 4ECFA 1YPNA 3K6VA 1URSA 2F7AA 4ZEBA 3O2AA 5FHNA 5I58A 5EHMA 5I56B 2OWSA 3L6HA 4IY6A 4EUOA 4F18A 2HFBA 4ESXA 3K0VA 1QUKA 2F78A 3FUZA 1I69A 3BFTA 1DMBA 3GBAA 4YZZA 2Y84A 1S50A 3MUQA 4G2ZA 4LQ2A 2GRVA 3UP9A 1SD3A 4NF5B 2AIXA 4QSCA 3TTMA 3VLUA 4EQ7A 1FTKA 1BLFA 2HAVA 3FJ7A 4YKKA 2H4IA 3RTFB 2XXYA 4U4XA 4GVOA 3K4UA 4EDPA 1QKBA 1DTZA 3QSLA 5DYHA 4GF8A 2F7CA 1BIYA 1P1QA 2AL4A 4KCCA 1EZ9A 2DP8A 4YB6A 4HS7A 1BKAA 1QKAA 2O84X 3FASA 1N7XA 1FQDA 1M5DA 1ZJLA 4PP0A 5I84A 1D9VA 4N07A 2I3VA 1B1HA 2VP1A 1MQHA 3KN3A 3MBPA 4N13A 3T96B 4E0XA 4G68A 5I57B 4NF8B 2E1SA 3MVZA 4MF3A 4Q5TA 5F7VA 2F35A 3FJGA 2D3IA 3QYTA 2DS9A 1UIUA 3LSLA 4LP2B 3TDJA 3P7IA 5IKBA 5M2VA 5H8SA 2O51A 4PFTA 3V83A 1FW0A 1KWHA 4MLVA 3PGFA 3CSBA 2QS4A 1FQAA 3HCQA 1SBPA 3D4GA 1XS5A 2ESNA 1YCJA 4LVQA 4QFNA 4LATA 4U2RA 1A8EA 1R9QA 4YU0A 3FVOA 2DQVA 2OK2A 4IO3A 3IX1A 4DDDA 1FTJA 3IB2A 1Y1ZA 4GWOA 4YB5A 1LCTA 5AA2D 3MAMA 3K00A 2DE4A 4MBPA 4XIGQ 5DVIA 4ELPA 4F31B 2AYSA 2R71A 2BJJX 1SYIA 2QS3A 1JETA 5AA4B 1MDP1 1VR5A 4M4GA 3DP8A 1N04A 2DVZA 3G3IA 3TFLA 1I6AA 1SI0A 4FECA 4C0RA 2ABHA 1NNKA 4R6YA 2FYIA 3TCGA 1ZTYA 4OFLA 4XKQA 2XXHA 1MY4A 5ISUA 5CRYA 3O28A 1IITA 3EHSA 4GXAA 5EHSA 1FQBA 3H6WA 3S4UA 5KCJB 4DXBA 4BDRA 5H8QB 1JW4A 4H65A 1XT8A 1B58A 4FE8A 3C31A 4IGTA 4MH5A 3O6GA 2H9BA 3EPEA 1D3KA 1MG1A 4GL0A 4DCXA 1D9YA 2D21A 2X26A 4KFQA 4QFOA 4U1ZA 4KYEA 3ZS6A 4FATA 2REGA 2M8CA 4QFPA 4POWA 3RNNA 3B6TA 3CG1A 4JWYA 3TTKA 3RY3A 4G68B 1MQDA 1R9LA 1R6ZA 2FA7A 3G3FA 3TQLA 2YJPA 4O3AA 3O9PA 4ZZAA 3V89B 2V3UA 1AIVA 4C1TA 1DTGA 1EZOA 1ZLQA 2RC9A 1UTHA 1IXGA 1OQHA 2F34A 3ONMA 2Q89A 3MVWA 3VLVA 2XX8A 3HHGA 1N3XA 2YPNA 2RCBA 4NE4A 4ZZEA 4F3PA 2PT1A 1A40A 5L8DA 4BDLA 4KPTA 2XXIA 4U1OA 5JK4A 1A55A 2F36A 3G7WA 3OEKA 1H43A 2QL3A 3EF7A 2I0CA 1IXHA 3C36A 3KBRA 4GL8A 5TP9B 5CBSA 2UXAA 1ATGA 3CI8A 4LUBA 2ALUA 3MP1A 2I48A 2Q9TA 3LSFB 4XKPA 4YB7A 2XD2A 3V5AA 5J1DA 5L9SA 3UA8A 3IOUA 4NF4A 4E0WA 4R9FA 4FEBA 1MDQA 3KEIA 3UORA 4LZ5A 4RNSA 2Z8DA 1H45A 4H5FA 1VE4A 3VV5A 3N26A 3A3CA 1IQ7A 1MXUA 3KJ7A 3FVKA 2G93A 3ODBA 1B3GA 4R72A 1GV8A 2NWJA 3THIA 2V93A 3O66A 1Y3QA 4BDQA 4F1UA 2XD3A 4NF6A 2UVJA 3VE1B 4Z7EA 3IK6B 2ONKE 3C34A 3IO4A 4AQ4A 1DOTA 4KI0E 3L6GA 4R73A 4ZEDA 3T9UA 3DLNA 4G8MA 1LBCA 1B5IA 1N84A 2YLNA 2F8DA 3U93A 1WODA 2B3FA 2VHAA 1A99A 3G3GA 3MZ1A 4WEPA 3JV9A 1EU8A 3OO8A 1M5CA 4F29A 2H99A 1LSTA 2QSXA 3PUXE 2Y7PA 1MXZA 2ZYKA 3FXUA 3QIMA 1USYE 3R26A 4JB7A 5CM6A 1AOVA 2IEEA 1MQJA 4OFJA 4OENA 3MZBA 4H6DA 3FVNA 3KGCA 4P11A 4XTCQ 2NXOA 5DVFA 5ITOA 4GD5A 3W9VA 4FAJA 3F11A 1NKXA 3TKDA 2HXWA 1II5A 2PT2A 1M5BA 3E3KA 5I58B 3FV1A 4G8HA 1NH7A 3IO6A 4U21A 1B2HA 1LAFE 2X7PA 3CRBA 2P1SA 3PPNA 5AA1A 3S9MC 4YKJA 1P1WA 1B5JA 1UTBB 3B7DA 2H98A 3H03A 4HCWA 4IO7A 4RJZA 3ZSFA 1H3DA 2Y7WA 3O6IA 3KSXA 4G4PA 4R6KA 3SEVA 4MLQA 5H8HA 1SYHA 3TTNA 3S9LC 4F22A 2I58A 3K1NA 4FIMA 3A3UA 3MC2A 1B4HA 2I0BA 3MVXA 3PUZE 3M3FA 2H25A 4I1DA 4O3CA 3BKIB 1QW0A 5AA3A 5H8NB 1SW5A 2ONRA 4BDOA 2GFEA 3TEPA 1LAHE 1S9TA 1TWYA 4PFYA 3RT8A 1VFEA 1CB6A 3K6XA 1Y4CA 2QPQA 2P0SA 2XHDA 3KN8A 3MZ9A 4IGRA 2REJA 3QAXA 5HPQA 1H76A 3OO7A 3PMXA 4YKPA 4HW8A 4GOTA 1AL3A 4G77A 2XXVA 4XXUA 2Q8JA 3Q29A 1OLCA 2O7IA 4ND9A 3SKPA 4F1VA 3TUSA 1B7UA 5I2KB 1MH4A 2Q2CA 2ZNSA 3Q27A 1DSNA 1PB7A 1SVXB 4YAHX 3VLWA 1LB9A 1RYOA 4QSDA 3UGWA 1PC3A 2OJTA 1NMUA 4HTGA 3HHFA 2Z22A 4OXVA 2OWTA 4GFRA 4Q8RA 3UIFA 3TZAA 1H44A 1US4A 2QJEA 1YTVA 3K2DA 4G8NA 4WXJA 5AA4A 2XXPA 4IB2A 5TP9A 1SW2A 2O6AA 3PD9A 3T66A 1MPBA 1RKMA 3TQWA 2Z8FA 2ZNUA 1PEBA 4JWOA 4XKNA 1XOCA 3MVYA 4EQ9A 2QS1A 3U8QA 4TLLB 4ZE9A 3RGYA 4DLDA 3R7XA 4AB6A 4NF4B 1QUJA 2Z23A 2O1MA 2Y7KA 4X1DA 3C33A 4IO6A 4TLMB 1TFAA 5CMCA 3U92A 4NWDA 4OETA 1MXXA 1JVXA 5I59A 2D5WA 4OWDA 5JTYB 5I2NB 3H6TA 1VFDA 3GXAA 3JYRA 4H8JA 1B0HA 3KOTA 4OHNA 1SDXA 3K6UA 3PD8A 3MWBA 4KHZE 4BDNA 1MY1A 1LFGA 4NF6B 2GHAA 1DPPA 2ZNTA 1WDNA 4F3BA 4QFKA 3N94A 3OMBA 4F39A 3BBRA 4I9DA 3TYHA 2AL5A 2A5TA 1MPDA 1A7LA 3E4RA 2HCAA 4O3BA 1FCKA 2I6EA 3OO6A 3RT6B 3IR1A 4QFLA 4FJPA 2ANJA 4Z0IA 5A5XA 3IJOB 3PUYE 1FQFA 3KG2A 1T0KA 1HSJA 4BLAA 2UVHA 1MY3A 3FATA 3TCFA 2F6GA 2OBGA 3FGSA 1HSEA 1P1NA 4G68C 1IUDA 2W7YA 3N5LA 2O1LA 3S9NC 1LCFA 3DELB 4QSEA 4P0IA 4DXCA 5CMKA 3N6UA 3W9WA 3TCHA 1ELJA 5DVJA 5I56A 4YICA 4BDMA 1ZIUA 1SW4A 2I4CA 2ZYNA 4EXKA 1Y3NA 1NNFA 2F5XA 2KLFA 1URDA 2NUVA 3G3KA 4LQ5A 1IXCA 1FQEA 1I6QA 4OEUA 5H8FB 3SEWA 4GQOA 2I4BA 3IL1B 3MP6A 2DVCA 5LOMA 4HCYA 2OLBA 5H8HB 4KYSA 3LUYA 2ONSA 1AH5A 3B6QA 1IIWA 3KFMA 4OZ9A 1OVTA 3I5OA 1Q35A 3U1OA 1N3WA 1R1NA 3H6UA 3M3KA 5AE4A 4JBZA 1ZBMA 1Z7NE 2HQ0A 3C9HA 1IXIA 3CG3A 5F1QA 4R74A 1J1NA 3HO7A 1P99A 3RQTA 3DM0A 1HSLA 3TTLA 1B1XA 3Q25A 4MFIA 4RY1A 3H3GA 3CIJA 3HN0A 2XXWA 2V25A 4U4SA 4AB5A 4Q0CA 4F3SA 5TPAB 1MQIA 5B70A 3TAJA 2IA4A 5CMMA 3W15C 1BP5A 3FV2A 2I49A 3OD7A 1LBBA 5CBRA 4TOZA 5FHOA 4EQBA 4EXLA 1BTJA 4IO5A 5IAIA 3IAZA 3WAFA 3GBBA 1B05A 1WVJA 3TMGA 2P2AA 4I8CA 3FXQA 4RK9A 5BUUA 5CI5A 3PMVA 4YKIA 1S7YA 3T93B 3A09A 3M8UA 5B7DA 1MY0A 3FXRA 4ZE8A 4F1YA 3IORA 3HPIA 4DZ1A 1MM7A 1B3LA 3RPWA 3KN7A 3QUJA 1MM6A 4H67A 1FTLA 1ZMGA 2G29A 3TELA 2QMWA 3DP4A 2QMXA 1O7TA 1P1OA 2E0SA 4LA9A 1MS7A 1EZPA 2VOZA 2A5SA 4ZEIA 1PB9A 1SI1A 1A54A 2HAUA 2VGQA 2F7BA 3K01A 1US5A 4PQJA 3IJXB 4OTEA 2XXQA 4RK2A 1MY2A 1FTMA 3IOVA 1OMPA 2NOOA 4OYVA 3CFXA 4DCYA 1B0LA 2F97A 2XXUA 1UIVA 4JDFA 3SESA 4PETA 1POY1 5BWJA 4L17A 3OELA 5HBCA 3I6VA 3PUVE 3B6WA 4TQUQ 1ZU0A 5FTHA 4NWCA 1RYXA 4PE5B 1JEVA 1NFTA 3CFZA 2O69A 2HZKA 4RPNA 3O97A 4X1BA 4ZEFA 5DTBA 2Y7RA 4ELOA 2H5YA 1GGGA 4IO2A 1NNPA 3HV1A 2DSFA 3OO9A 2RCAA 5ITPA 4F2QA 4PFUA 2HZLA 4K3FA 1B7HA 1GVCA 3OSQA 3S2VA 2DWIA 3CR9A 3RLFE 1LGBC 1PBQA 1UTHB 4IY5A 3FIRA 3ZKLA 5AA2A 2XX9A 3H7MA 2RINA 3K1PA 1B3EA 1MXWA 1B3FA 2GH9A 1JVYA 2DYXA 2UYFA 1N76A 1JW5A 2B65A 1USYH 4OEVA 1OQGA 3Q26A 1UTBA 4OMBA 4FEDA 4QRZA 1ANFA 2QS2A 3CFLA 5FTIA 1IZ1A 4JXIA 1Z7ME 4RPOA 3MJNA 4XKRA 4KQPA 5TU0A 3UN6A 4X9TA 5KZTA 4P0GA 4GXSB 1XHYA 1LFHA 4H0WA 1QUIA 2VD3A 2DWAA 1SW1A 2Q88A 3JZJA 5DEXA 1B7ZA 1FQCA 2XX7A 2NVUB 5HM4B 5DEXB 1LFIA 3FVGA 2O68A 2OZZA 4OESA 4R2FA 3AXFA 1SQYA 3KSJA 4ISUA 3PMWA 4GRKA 3PPQA 3MW0A 3N6TA 1JNFA 3E13X 3C4MA 4GLIA 1Y4TA 4LZ7A 2DOJA 2DXRA 3U94A 5I2NA 5JTYA 2Y7IA 2DXYA 4NEDA 4M1VA 2O7UA 3OSRA 3HSTA 1IEJA 2FNCA 5L9MA 1QJMA 3FZVA 4ZS9A 5EYFA 1XC1A 3K02A 3MPLA 3OOAA 1L5TA 5I2KA 1B6HA 3IB1A 3FD3A 3H06B 3CVGA 4IO4A 3RUMA 1XVXA 4EF1A 4H8IA 1URGA 1B32A 3KOSA 1GR2A 1B4ZA 3IB0A 3SEYA 5L9OA 3LC8A 3SEXA 4QHQA 1PBPA 2RKMA 2WKYA 4KR5A 1PDAA 4OQOA 3K6WA 3GLBA 4GIZA 1XVYA 3D4CA 1N0TA 5KDTB 3I3VA 1YAEA 4OFOA 1Y9UA 3O29A 2PMSA 2LAOA 1B5HA 3C35A 4KYDA 3PPOA 3EHTA 1TT1A 3ILTB 3G3HA 3QUFA 4PFWA 1B40A 3GZGA 1LAXA 2RC7A 2XXTA 1O64A 5I59B 2ZYMA 1Y3PA 3O6HA 2B3BA 4U22A 2THIA 4F2OA 3G3JA 2DWJA 4Q30B 3VVEA 3WAEA 2F6PA 4UA8A 1N7WA 2R9JA 4KCDA 3EN3A 3PV0E 3T9HB 3VVDA 4DE8A 2CZLA 4I62A 3QK6A 2DE3A 3VFJA 3BFUA 2XXRA 3OXNA 3S9EA 1OIBA 4R2BA 3SDFA 3K1MA 3KZGA 4ESWA 3DP6A 4QF9A 3USDA 2X7QA 2PBWA 3SERA 2DE2A 2ZYOA 3VVFA 4C1UA 5FHMA 1I6BA 1QULA 1CE2A 3Q28A 4R9GA 2ZMBA 5ELVA 4F19A 5I57A 5ICTA 2QRYA 1VSOA 1Y1MA 1PB8A 3OENA 4JSOA 5TPAA 3EQ1A 3IOWA 1GTKA 4NMYA 3VDFA 2VD2A 2Z8EA 3U72A 3TPAA 4DIGA 3T9XB 2PYYA 3T9VA 1NH8A 1B9JA 1LB8A 1MQGA 3ILUB 4ZDMA 3OEMA 3IOTA 4H1XA 4JSDA 5DT6A 2Q2AA 5AA2B 4ZEKA 1O63A 4POXA 1MXYA 4ZECA 3ECRA 5H8FA 4FORA 3UK4A 3PPRA 3LSXA 1A8FA 3E9XA 1B52A 5JEIA 3PPPA 5KCJA 2UYEA 1POTA 1MH3A 3PU5A 2I3WA 2ZXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NF5 A;  5A5X B;  4RA1 A;  3T22 A;  2XXX A;  2UVI A;  3CSG A;  3LSW A;  3QXM A;  5KDT A;  4KD5 A;  2R6G E;  4LON B;  1ZKB A;  3RTW B;  4H5G A;  1OVB A;  4OVJ A;  3C32 A;  3KJT A;  3V8X B;  2CMO A;  4F3G A;  1LAG E;  1NL5 A;  4ELR A;  4OER A;  4YMB A;  1QVS A;  3MP8 A;  4YMA A;  3PUW E;  1JW1 A;  4ONY A;  1D4N A;  1AMF A;  1M5F A;  1NNT A;  1UQW A;  2RF1 A;  3ZKK A;  4EF2 A;  3FJM A;  4U23 A;  4DXU A;  1M5E A;  1JQF A;  3R6U A;  5CMB A;  4R6H A;  3EHU A;  1Y20 A;  4NF8 A;  1EH3 A;  1B51 A;  1FTO A;  2V3T A;  1DPE A;  1TXF A;  1F9B A;  3MQ9 A;  4R75 A;  2V3Q A;  4JWX A;  2HEU A;  5H8Q A;  2PVU A;  5K2X A;  2UVG A;  4RXL A;  5H8N A;  2A5T B;  4NTL A;  1B46 A;  2GHB A;  4THI A;  3SET A;  1TFD A;  2PX1 A;  5ICQ A;  2OCU A;  4UAC A;  3H4Z A;  5CC2 A;  3VXC A;  4X48 A;  3SEU A;  3LR1 A;  1MPC A;  3M3L A;  3H6V A;  4RYA A;  1MXV A;  3VXB A;  1B3H A;  1JEU A;  1OLA A;  4WKM A;  1MRP A;  1Q1K A;  4N6P A;  5K2Y A;  1P1U A;  2RC8 A;  2V84 A;  3MPK A;  3TTR A;  4LZ8 A;  2DWH A;  3TOD A;  3RN8 A;  1LLS A;  4ELQ A;  3LBS A;  4WED A;  4ECF A;  1YPN A;  3K6V A;  1URS A;  2F7A A;  4ZEB A;  3O2A A;  5FHN A;  5I58 A;  5EHM A;  5I56 B;  2OWS A;  3L6H A;  4IY6 A;  4EUO A;  4F18 A;  2HFB A;  4ESX A;  3K0V A;  1QUK A;  2F78 A;  3FUZ A;  1I69 A;  3BFT A;  1DMB A;  3GBA A;  4YZZ A;  2Y84 A;  1S50 A;  3MUQ A;  4G2Z A;  4LQ2 A;  2GRV A;  3UP9 A;  1SD3 A;  4NF5 B;  2AIX A;  4QSC A;  3TTM A;  3VLU A;  4EQ7 A;  1FTK A;  1BLF A;  2HAV A;  3FJ7 A;  4YKK A;  2H4I A;  3RTF B;  2XXY A;  4U4X A;  4GVO A;  3K4U A;  4EDP A;  1QKB A;  1DTZ A;  3QSL A;  5DYH A;  4GF8 A;  2F7C A;  1BIY A;  1P1Q A;  2AL4 A;  4KCC A;  1EZ9 A;  2DP8 A;  4YB6 A;  4HS7 A;  1BKA A;  1QKA A;  2O84 X;  3FAS A;  1N7X A;  1FQD A;  1M5D A;  1ZJL A;  4PP0 A;  5I84 A;  1D9V A;  4N07 A;  2I3V A;  1B1H A;  2VP1 A;  1MQH A;  3KN3 A;  3MBP A;  4N13 A;  3T96 B;  4E0X A;  4G68 A;  5I57 B;  4NF8 B;  2E1S A;  3MVZ A;  4MF3 A;  4Q5T A;  5F7V A;  2F35 A;  3FJG A;  2D3I A;  3QYT A;  2DS9 A;  1UIU A;  3LSL A;  4LP2 B;  3TDJ A;  3P7I A;  5IKB A;  5M2V A;  5H8S A;  2O51 A;  4PFT A;  3V83 A;  1FW0 A;  1KWH A;  4MLV A;  3PGF A;  3CSB A;  2QS4 A;  1FQA A;  3HCQ A;  1SBP A;  3D4G A;  1XS5 A;  2ESN A;  1YCJ A;  4LVQ A;  4QFN A;  4LAT A;  4U2R A;  1A8E A;  1R9Q A;  4YU0 A;  3FVO A;  2DQV A;  2OK2 A;  4IO3 A;  3IX1 A;  4DDD A;  1FTJ A;  3IB2 A;  1Y1Z A;  4GWO A;  4YB5 A;  1LCT A;  5AA2 D;  3MAM A;  3K00 A;  2DE4 A;  4MBP A;  4XIG Q;  5DVI A;  4ELP A;  4F31 B;  2AYS A;  2R71 A;  2BJJ X;  1SYI A;  2QS3 A;  1JET A;  5AA4 B;  1MDP 1;  1VR5 A;  4M4G A;  3DP8 A;  1N04 A;  2DVZ A;  3G3I A;  3TFL A;  1I6A A;  1SI0 A;  4FEC A;  4C0R A;  2ABH A;  1NNK A;  4R6Y A;  2FYI A;  3TCG A;  1ZTY A;  4OFL A;  4XKQ A;  2XXH A;  1MY4 A;  5ISU A;  5CRY A;  3O28 A;  1IIT A;  3EHS A;  4GXA A;  5EHS A;  1FQB A;  3H6W A;  3S4U A;  5KCJ B;  4DXB A;  4BDR A;  5H8Q B;  1JW4 A;  4H65 A;  1XT8 A;  1B58 A;  4FE8 A;  3C31 A;  4IGT A;  4MH5 A;  3O6G A;  2H9B A;  3EPE A;  1D3K A;  1MG1 A;  4GL0 A;  4DCX A;  1D9Y A;  2D21 A;  2X26 A;  4KFQ A;  4QFO A;  4U1Z A;  4KYE A;  3ZS6 A;  4FAT A;  2REG A;  2M8C A;  4QFP A;  4POW A;  3RNN A;  3B6T A;  3CG1 A;  4JWY A;  3TTK A;  3RY3 A;  4G68 B;  1MQD A;  1R9L A;  1R6Z A;  2FA7 A;  3G3F A;  3TQL A;  2YJP A;  4O3A A;  3O9P A;  4ZZA A;  3V89 B;  2V3U A;  1AIV A;  4C1T A;  1DTG A;  1EZO A;  1ZLQ A;  2RC9 A;  1UTH A;  1IXG A;  1OQH A;  2F34 A;  3ONM A;  2Q89 A;  3MVW A;  3VLV A;  2XX8 A;  3HHG A;  1N3X A;  2YPN A;  2RCB A;  4NE4 A;  4ZZE A;  4F3P A;  2PT1 A;  1A40 A;  5L8D A;  4BDL A;  4KPT A;  2XXI A;  4U1O A;  5JK4 A;  1A55 A;  2F36 A;  3G7W A;  3OEK A;  1H43 A;  2QL3 A;  3EF7 A;  2I0C A;  1IXH A;  3C36 A;  3KBR A;  4GL8 A;  5TP9 B;  5CBS A;  2UXA A;  1ATG A;  3CI8 A;  4LUB A;  2ALU A;  3MP1 A;  2I48 A;  2Q9T A;  3LSF B;  4XKP A;  4YB7 A;  2XD2 A;  3V5A A;  5J1D A;  5L9S A;  3UA8 A;  3IOU A;  4NF4 A;  4E0W A;  4R9F A;  4FEB A;  1MDQ A;  3KEI A;  3UOR A;  4LZ5 A;  4RNS A;  2Z8D A;  1H45 A;  4H5F A;  1VE4 A;  3VV5 A;  3N26 A;  3A3C A;  1IQ7 A;  1MXU A;  3KJ7 A;  3FVK A;  2G93 A;  3ODB A;  1B3G A;  4R72 A;  1GV8 A;  2NWJ A;  3THI A;  2V93 A;  3O66 A;  1Y3Q A;  4BDQ A;  4F1U A;  2XD3 A;  4NF6 A;  2UVJ A;  3VE1 B;  4Z7E A;  3IK6 B;  2ONK E;  3C34 A;  3IO4 A;  4AQ4 A;  1DOT A;  4KI0 E;  3L6G A;  4R73 A;  4ZED A;  3T9U A;  3DLN A;  4G8M A;  1LBC A;  1B5I A;  1N84 A;  2YLN A;  2F8D A;  3U93 A;  1WOD A;  2B3F A;  2VHA A;  1A99 A;  3G3G A;  3MZ1 A;  4WEP A;  3JV9 A;  1EU8 A;  3OO8 A;  1M5C A;  4F29 A;  2H99 A;  1LST A;  2QSX A;  3PUX E;  2Y7P A;  1MXZ A;  2ZYK A;  3FXU A;  3QIM A;  1USY E;  3R26 A;  4JB7 A;  5CM6 A;  1AOV A;  2IEE A;  1MQJ A;  4OFJ A;  4OEN A;  3MZB A;  4H6D A;  3FVN A;  3KGC A;  4P11 A;  4XTC Q;  2NXO A;  5DVF A;  5ITO A;  4GD5 A;  3W9V A;  4FAJ A;  3F11 A;  1NKX A;  3TKD A;  2HXW A;  1II5 A;  2PT2 A;  1M5B A;  3E3K A;  5I58 B;  3FV1 A;  4G8H A;  1NH7 A;  3IO6 A;  4U21 A;  1B2H A;  1LAF E;  2X7P A;  3CRB A;  2P1S A;  3PPN A;  5AA1 A;  3S9M C;  4YKJ A;  1P1W A;  1B5J A;  1UTB B;  3B7D A;  2H98 A;  3H03 A;  4HCW A;  4IO7 A;  4RJZ A;  3ZSF A;  1H3D A;  2Y7W A;  3O6I A;  3KSX A;  4G4P A;  4R6K A;  3SEV A;  4MLQ A;  5H8H A;  1SYH A;  3TTN A;  3S9L C;  4F22 A;  2I58 A;  3K1N A;  4FIM A;  3A3U A;  3MC2 A;  1B4H A;  2I0B A;  3MVX A;  3PUZ E;  3M3F A;  2H25 A;  4I1D A;  4O3C A;  3BKI B;  1QW0 A;  5AA3 A;  5H8N B;  1SW5 A;  2ONR A;  4BDO A;  2GFE A;  3TEP A;  1LAH E;  1S9T A;  1TWY A;  4PFY A;  3RT8 A;  1VFE A;  1CB6 A;  3K6X A;  1Y4C A;  2QPQ A;  2P0S A;  2XHD A;  3KN8 A;  3MZ9 A;  4IGR A;  2REJ A;  3QAX A;  5HPQ A;  1H76 A;  3OO7 A;  3PMX A;  4YKP A;  4HW8 A;  4GOT A;  1AL3 A;  4G77 A;  2XXV A;  4XXU A;  2Q8J A;  3Q29 A;  1OLC A;  2O7I A;  4ND9 A;  3SKP A;  4F1V A;  3TUS A;  1B7U A;  5I2K B;  1MH4 A;  2Q2C A;  2ZNS A;  3Q27 A;  1DSN A;  1PB7 A;  1SVX B;  4YAH X;  3VLW A;  1LB9 A;  1RYO A;  4QSD A;  3UGW A;  1PC3 A;  2OJT A;  1NMU A;  4HTG A;  3HHF A;  2Z22 A;  4OXV A;  2OWT A;  4GFR A;  4Q8R A;  3UIF A;  3TZA A;  1H44 A;  1US4 A;  2QJE A;  1YTV A;  3K2D A;  4G8N A;  4WXJ A;  5AA4 A;  2XXP A;  4IB2 A;  5TP9 A;  1SW2 A;  2O6A A;  3PD9 A;  3T66 A;  1MPB A;  1RKM A;  3TQW A;  2Z8F A;  2ZNU A;  1PEB A;  4JWO A;  4XKN A;  1XOC A;  3MVY A;  4EQ9 A;  2QS1 A;  3U8Q A;  4TLL B;  4ZE9 A;  3RGY A;  4DLD A;  3R7X A;  4AB6 A;  4NF4 B;  1QUJ A;  2Z23 A;  2O1M A;  2Y7K A;  4X1D A;  3C33 A;  4IO6 A;  4TLM B;  1TFA A;  5CMC A;  3U92 A;  4NWD A;  4OET A;  1MXX A;  1JVX A;  5I59 A;  2D5W A;  4OWD A;  5JTY B;  5I2N B;  3H6T A;  1VFD A;  3GXA A;  3JYR A;  4H8J A;  1B0H A;  3KOT A;  4OHN A;  1SDX A;  3K6U A;  3PD8 A;  3MWB A;  4KHZ E;  4BDN A;  1MY1 A;  1LFG A;  4NF6 B;  2GHA A;  1DPP A;  2ZNT A;  1WDN A;  4F3B A;  4QFK A;  3N94 A;  3OMB A;  4F39 A;  3BBR A;  4I9D A;  3TYH A;  2AL5 A;  2A5T A;  1MPD A;  1A7L A;  3E4R A;  2HCA A;  4O3B A;  1FCK A;  2I6E A;  3OO6 A;  3RT6 B;  3IR1 A;  4QFL A;  4FJP A;  2ANJ A;  4Z0I A;  5A5X A;  3IJO B;  3PUY E;  1FQF A;  3KG2 A;  1T0K A;  1HSJ A;  4BLA A;  2UVH A;  1MY3 A;  3FAT A;  3TCF A;  2F6G A;  2OBG A;  3FGS A;  1HSE A;  1P1N A;  4G68 C;  1IUD A;  2W7Y A;  3N5L A;  2O1L A;  3S9N C;  1LCF A;  3DEL B;  4QSE A;  4P0I A;  4DXC A;  5CMK A;  3N6U A;  3W9W A;  3TCH A;  1ELJ A;  5DVJ A;  5I56 A;  4YIC A;  4BDM A;  1ZIU A;  1SW4 A;  2I4C A;  2ZYN A;  4EXK A;  1Y3N A;  1NNF A;  2F5X A;  2KLF A;  1URD A;  2NUV A;  3G3K A;  4LQ5 A;  1IXC A;  1FQE A;  1I6Q A;  4OEU A;  5H8F B;  3SEW A;  4GQO A;  2I4B A;  3IL1 B;  3MP6 A;  2DVC A;  5LOM A;  4HCY A;  2OLB A;  5H8H B;  4KYS A;  3LUY A;  2ONS A;  1AH5 A;  3B6Q A;  1IIW A;  3KFM A;  4OZ9 A;  1OVT A;  3I5O A;  1Q35 A;  3U1O A;  1N3W A;  1R1N A;  3H6U A;  3M3K A;  5AE4 A;  4JBZ A;  1ZBM A;  1Z7N E;  2HQ0 A;  3C9H A;  1IXI A;  3CG3 A;  5F1Q A;  4R74 A;  1J1N A;  3HO7 A;  1P99 A;  3RQT A;  3DM0 A;  1HSL A;  3TTL A;  1B1X A;  3Q25 A;  4MFI A;  4RY1 A;  3H3G A;  3CIJ A;  3HN0 A;  2XXW A;  2V25 A;  4U4S A;  4AB5 A;  4Q0C A;  4F3S A;  5TPA B;  1MQI A;  5B70 A;  3TAJ A;  2IA4 A;  5CMM A;  3W15 C;  1BP5 A;  3FV2 A;  2I49 A;  3OD7 A;  1LBB A;  5CBR A;  4TOZ A;  5FHO A;  4EQB A;  4EXL A;  1BTJ A;  4IO5 A;  5IAI A;  3IAZ A;  3WAF A;  3GBB A;  1B05 A;  1WVJ A;  3TMG A;  2P2A A;  4I8C A;  3FXQ A;  4RK9 A;  5BUU A;  5CI5 A;  3PMV A;  4YKI A;  1S7Y A;  3T93 B;  3A09 A;  3M8U A;  5B7D A;  1MY0 A;  3FXR A;  4ZE8 A;  4F1Y A;  3IOR A;  3HPI A;  4DZ1 A;  1MM7 A;  1B3L A;  3RPW A;  3KN7 A;  3QUJ A;  1MM6 A;  4H67 A;  1FTL A;  1ZMG A;  2G29 A;  3TEL A;  2QMW A;  3DP4 A;  2QMX A;  1O7T A;  1P1O A;  2E0S A;  4LA9 A;  1MS7 A;  1EZP A;  2VOZ A;  2A5S A;  4ZEI A;  1PB9 A;  1SI1 A;  1A54 A;  2HAU A;  2VGQ A;  2F7B A;  3K01 A;  1US5 A;  4PQJ A;  3IJX B;  4OTE A;  2XXQ A;  4RK2 A;  1MY2 A;  1FTM A;  3IOV A;  1OMP A;  2NOO A;  4OYV A;  3CFX A;  4DCY A;  1B0L A;  2F97 A;  2XXU A;  1UIV A;  4JDF A;  3SES A;  4PET A;  1POY 1;  5BWJ A;  4L17 A;  3OEL A;  5HBC A;  3I6V A;  3PUV E;  3B6W A;  4TQU Q;  1ZU0 A;  5FTH A;  4NWC A;  1RYX A;  4PE5 B;  1JEV A;  1NFT A;  3CFZ A;  2O69 A;  2HZK A;  4RPN A;  3O97 A;  4X1B A;  4ZEF A;  5DTB A;  2Y7R A;  4ELO A;  2H5Y A;  1GGG A;  4IO2 A;  1NNP A;  3HV1 A;  2DSF A;  3OO9 A;  2RCA A;  5ITP A;  4F2Q A;  4PFU A;  2HZL A;  4K3F A;  1B7H A;  1GVC A;  3OSQ A;  3S2V A;  2DWI A;  3CR9 A;  3RLF E;  1LGB C;  1PBQ A;  1UTH B;  4IY5 A;  3FIR A;  3ZKL A;  5AA2 A;  2XX9 A;  3H7M A;  2RIN A;  3K1P A;  1B3E A;  1MXW A;  1B3F A;  2GH9 A;  1JVY A;  2DYX A;  2UYF A;  1N76 A;  1JW5 A;  2B65 A;  1USY H;  4OEV A;  1OQG A;  3Q26 A;  1UTB A;  4OMB A;  4FED A;  4QRZ A;  1ANF A;  2QS2 A;  3CFL A;  5FTI A;  1IZ1 A;  4JXI A;  1Z7M E;  4RPO A;  3MJN A;  4XKR A;  4KQP A;  5TU0 A;  3UN6 A;  4X9T A;  5KZT A;  4P0G A;  4GXS B;  1XHY A;  1LFH A;  4H0W A;  1QUI A;  2VD3 A;  2DWA A;  1SW1 A;  2Q88 A;  3JZJ A;  5DEX A;  1B7Z A;  1FQC A;  2XX7 A;  2NVU B;  5HM4 B;  5DEX B;  1LFI A;  3FVG A;  2O68 A;  2OZZ A;  4OES A;  4R2F A;  3AXF A;  1SQY A;  3KSJ A;  4ISU A;  3PMW A;  4GRK A;  3PPQ A;  3MW0 A;  3N6T A;  1JNF A;  3E13 X;  3C4M A;  4GLI A;  1Y4T A;  4LZ7 A;  2DOJ A;  2DXR A;  3U94 A;  5I2N A;  5JTY A;  2Y7I A;  2DXY A;  4NED A;  4M1V A;  2O7U A;  3OSR A;  3HST A;  1IEJ A;  2FNC A;  5L9M A;  1QJM A;  3FZV A;  4ZS9 A;  5EYF A;  1XC1 A;  3K02 A;  3MPL A;  3OOA A;  1L5T A;  5I2K A;  1B6H A;  3IB1 A;  3FD3 A;  3H06 B;  3CVG A;  4IO4 A;  3RUM A;  1XVX A;  4EF1 A;  4H8I A;  1URG A;  1B32 A;  3KOS A;  1GR2 A;  1B4Z A;  3IB0 A;  3SEY A;  5L9O A;  3LC8 A;  3SEX A;  4QHQ A;  1PBP A;  2RKM A;  2WKY A;  4KR5 A;  1PDA A;  4OQO A;  3K6W A;  3GLB A;  4GIZ A;  1XVY A;  3D4C A;  1N0T A;  5KDT B;  3I3V A;  1YAE A;  4OFO A;  1Y9U A;  3O29 A;  2PMS A;  2LAO A;  1B5H A;  3C35 A;  4KYD A;  3PPO A;  3EHT A;  1TT1 A;  3ILT B;  3G3H A;  3QUF A;  4PFW A;  1B40 A;  3GZG A;  1LAX A;  2RC7 A;  2XXT A;  1O64 A;  5I59 B;  2ZYM A;  1Y3P A;  3O6H A;  2B3B A;  4U22 A;  2THI A;  4F2O A;  3G3J A;  2DWJ A;  4Q30 B;  3VVE A;  3WAE A;  2F6P A;  4UA8 A;  1N7W A;  2R9J A;  4KCD A;  3EN3 A;  3PV0 E;  3T9H B;  3VVD A;  4DE8 A;  2CZL A;  4I62 A;  3QK6 A;  2DE3 A;  3VFJ A;  3BFU A;  2XXR A;  3OXN A;  3S9E A;  1OIB A;  4R2B A;  3SDF A;  3K1M A;  3KZG A;  4ESW A;  3DP6 A;  4QF9 A;  3USD A;  2X7Q A;  2PBW A;  3SER A;  2DE2 A;  2ZYO A;  3VVF A;  4C1U A;  5FHM A;  1I6B A;  1QUL A;  1CE2 A;  3Q28 A;  4R9G A;  2ZMB A;  5ELV A;  4F19 A;  5I57 A;  5ICT A;  2QRY A;  1VSO A;  1Y1M A;  1PB8 A;  3OEN A;  4JSO A;  5TPA A;  3EQ1 A;  3IOW A;  1GTK A;  4NMY A;  3VDF A;  2VD2 A;  2Z8E A;  3U72 A;  3TPA A;  4DIG A;  3T9X B;  2PYY A;  3T9V A;  1NH8 A;  1B9J A;  1LB8 A;  1MQG A;  3ILU B;  4ZDM A;  3OEM A;  3IOT A;  4H1X A;  4JSD A;  5DT6 A;  2Q2A A;  5AA2 B;  4ZEK A;  1O63 A;  4POX A;  1MXY A;  4ZEC A;  3ECR A;  5H8F A;  4FOR A;  3UK4 A;  3PPR A;  3LSX A;  1A8F A;  3E9X A;  1B52 A;  5JEI A;  3PPP A;  5KCJ A;  2UYE A;  1POT A;  1MH3 A;  3PU5 A;  2I3W A;  2ZXT A; 
#chains in the Genus database with same CATH topology
 4NF5 A;  4MX6 A;  3LSW A;  4KD5 A;  4LON B;  1FPB A;  3A29 A;  4H5G A;  1NL5 A;  3CHG A;  4NAP A;  1JW1 A;  4ONY A;  1UQW A;  3BIH A;  4DI4 B;  4GBV A;  2RF1 A;  4U23 A;  4R6H A;  3EHU A;  4NF8 A;  1TXF A;  1F9B A;  2CEX A;  4RXL A;  2A5T B;  4NTL A;  2GHB A;  1FPG A;  5ICQ A;  4N8Y A;  1G0H A;  3H4Z A;  1MPC A;  4RYA A;  3H6V A;  1MXV A;  4WKM A;  5K2Y A;  4N6P A;  4MMP A;  4X04 A;  2RC8 A;  4LZ8 A;  4ELQ A;  4MNP A;  1YPN A;  3FBP A;  2OWS A;  3L6H A;  4EUO A;  4XFE A;  3K0V A;  3FUZ A;  3BFT A;  4PBH A;  2Y84 A;  3MUQ A;  2GRV A;  3QMF A;  4NF5 B;  4EQ7 A;  3VLU A;  1BLF A;  4YKK A;  2H4I A;  3QSL A;  4P9K A;  1P1Q A;  4KCC A;  1LBV A;  1BKA A;  3FAS A;  1N7X A;  1M5D A;  2VPN A;  2I3V A;  5I57 B;  3KN3 A;  4PTK A;  3QYT A;  5IKB A;  4MLV A;  3PGF A;  1NUZ A;  4QFN A;  4LAT A;  3FVO A;  2OK2 A;  4IO3 A;  2ZZW A;  4ELP A;  4ZE9 A;  2BJJ X;  2QS3 A;  4FBP A;  1VR5 A;  4PC9 A;  2DVZ A;  4C0R A;  1NNK A;  4R6Y A;  1ZTY A;  2XXH A;  1MY4 A;  3S9L C;  3EHS A;  4GXA A;  5H8Q B;  4FE8 A;  3C31 A;  4IGT A;  4MH5 A;  1D3K A;  3U65 A;  4DCX A;  4U1Z A;  2WYK A;  4JWY A;  1MQD A;  1R9L A;  2FA7 A;  2FHY A;  2F3B A;  3V89 B;  2OWZ A;  1EZO A;  1XI6 A;  4LN5 A;  2F34 A;  4F3P A;  1A40 A;  5L8D A;  3C36 A;  5TP9 B;  4MNC A;  3V5A A;  1MDQ A;  4LZ5 A;  3VV5 A;  1JP4 A;  1MXU A;  3FVK A;  1GV8 A;  1D9Q A;  4NF6 A;  2UVJ A;  2ONK E;  1NV1 A;  4KI0 E;  1N84 A;  2F8D A;  2B3F A;  1M5C A;  2H99 A;  1LST A;  2QSX A;  2ZYK A;  3QIM A;  4OFJ A;  4H6D A;  3FVN A;  3KGC A;  3F11 A;  3E3K A;  4G8H A;  3IO6 A;  4U21 A;  3S9M C;  1B5J A;  4OVT A;  2H98 A;  4RJZ A;  1Q9D A;  3O6I A;  3SEV A;  1NV2 A;  4MLQ A;  3TTN A;  3K1N A;  3MC2 A;  4N6D A;  2I0B A;  3MVX A;  4O3C A;  2H25 A;  3BKI B;  1QW0 A;  2ONR A;  2GFE A;  4PFY A;  3IFC A;  2P0S A;  2REJ A;  5HPQ A;  1OLC A;  4HXV A;  1B7U A;  1MH4 A;  2Q2C A;  3Q27 A;  1PB7 A;  1RYO A;  1NMU A;  2Z22 A;  3UIF A;  1H44 A;  1US4 A;  1YTV A;  5TP9 A;  4IB2 A;  5B7D A;  2ZNU A;  1PEB A;  4EQ9 A;  3U8Q A;  2WEF A;  4DLD A;  1YYZ A;  4MEV A;  1QUJ A;  4IO6 A;  1MXX A;  4OWD A;  4H8J A;  4OHN A;  1SDX A;  3MWB A;  3NOH A;  5J16 A;  4NF6 B;  1DPP A;  1WDN A;  4N81 A;  4I9D A;  2AL5 A;  4O3B A;  1MPD A;  2JJK A;  2HCA A;  5A5X A;  4Z0I A;  3KG2 A;  4BLA A;  2F6G A;  2W7Y A;  2O1L A;  4QSE A;  5EQ9 A;  4P0I A;  4DXC A;  5CMK A;  3W9W A;  5I56 A;  4BDM A;  1NNF A;  1URD A;  3SEW A;  3RPL A;  4GQO A;  3IL1 B;  5H8H B;  3LUY A;  2ONS A;  3E79 A;  4JBZ A;  1K9Y A;  1Z7N E;  3C9H A;  1IXI A;  1J1N A;  3RQT A;  4OA4 A;  1HSL A;  4PDD A;  3Q25 A;  2Y5K A;  2XXW A;  4U4S A;  2KR0 A;  4Q0C A;  5TPA B;  2IA4 A;  3FV2 A;  5FHO A;  1RDY A;  4N17 A;  4O7M A;  1NV6 A;  3A09 A;  2HHM A;  3HPI A;  3IOR A;  1B3L A;  2WBD A;  4GWS A;  1O7T A;  2E0S A;  1MS7 A;  2WBB A;  1PB9 A;  1A54 A;  2HAU A;  2XXQ A;  4PCD A;  1FTM A;  4HE2 A;  4GWW A;  5I5P A;  1POY 1;  1AWB A;  1ZU0 A;  5FTH A;  4NWC A;  4X1B A;  2O69 A;  4ELO A;  4OAN A;  5ET7 A;  1GGG A;  1NV4 A;  3OO9 A;  5ITP A;  4K3F A;  3OSQ A;  2DWI A;  1LGB C;  2QVR A;  3K1P A;  1MXW A;  2DYX A;  1JW5 A;  1USY H;  3Q26 A;  4FED A;  3CFL A;  5TU0 A;  3MJN A;  3UN6 A;  4X9T A;  5KZT A;  4GXS B;  1LFI A;  5EYH A;  4ISU A;  3KSJ A;  3PPQ A;  3MW0 A;  3E13 X;  3C4M A;  5I2N A;  5JTY A;  2DOJ A;  2Y7I A;  2DXY A;  4NED A;  1NV7 A;  3FZV A;  1KA1 A;  3IB1 A;  3CVG A;  3KOS A;  4PE3 A;  4QHQ A;  2RKM A;  3SEX A;  3D4C A;  1YAE A;  3O29 A;  2PMS A;  2LAO A;  1B5H A;  3QUF A;  3G3H A;  3GZG A;  1O64 A;  1Y3P A;  1DBZ A;  4KCD A;  3EN3 A;  4OVP A;  3T9H B;  4I62 A;  4ESW A;  3DP6 A;  3USD A;  2PBW A;  4P8B A;  3SER A;  2DE2 A;  1QUL A;  4R9G A;  5ICT A;  4JSO A;  1NUX A;  3VDF A;  4PAI A;  2Z8E A;  3TPA A;  4DIG A;  3T9X B;  2R8T A;  1B9J A;  5CBR A;  2Q2A A;  5LDZ A;  3LSX A;  2XWV A;  3E9X A;  2UYE A;  2PCR A;  4I40 A;  3QXM A;  5KDT A;  2R6G E;  3V8X B;  3KJT A;  2CMO A;  4YMB A;  1D4N A;  1AMF A;  4DXU A;  5CMB A;  2P3V A;  1EH3 A;  1DPE A;  5H8Q A;  2UVG A;  2BJI A;  3SET A;  3SEU A;  5A5L A;  1B3H A;  1OLA A;  1Q1K A;  2V84 A;  3RN8 A;  3LBS A;  4WED A;  3K6V A;  1URS A;  4ZEB A;  1INP A;  5I58 A;  5EHM A;  1FBP A;  1QUK A;  2ZZV A;  3KBZ A;  3UP9 A;  3FJ7 A;  4U4X A;  4GF8 A;  2AL4 A;  1QKA A;  1ZJL A;  3MBP A;  1MQH A;  4LP2 B;  3LSL A;  4OVQ A;  3TDJ A;  3V83 A;  1KA0 A;  2QS4 A;  1FBG A;  1FQA A;  3HCQ A;  1SBP A;  4LVQ A;  1YCJ A;  1R9Q A;  4YU0 A;  1Y1Z A;  4N6K A;  3MAM A;  2DE4 A;  4XIG Q;  1SYI A;  1MDP 1;  1FPD A;  1N04 A;  3G3I A;  1I6A A;  2KQZ A;  2ABH A;  5ISU A;  3H6W A;  4DXB A;  2B4L A;  4BDR A;  5ET6 A;  1B58 A;  4KYE A;  4POW A;  3RY3 A;  4G68 B;  1AIV A;  1OQH A;  2Q89 A;  2YPN A;  2PT1 A;  4BDL A;  2XXI A;  4NQ8 A;  1A55 A;  3E78 A;  3CI8 A;  4LUB A;  2ALU A;  2I48 A;  4XKP A;  5L9S A;  1CNQ A;  3UA8 A;  4NF4 A;  3LV0 A;  4E0W A;  4FEB A;  1EYK A;  3A3C A;  5CM6 A;  1B3G A;  4BDQ A;  3B50 A;  3C34 A;  4OVR A;  1LBC A;  2VHA A;  3MZ1 A;  3JV9 A;  1EU8 A;  4O8M A;  2Y7P A;  1MXZ A;  3FXU A;  3MZB A;  4FAJ A;  3TKD A;  2HXW A;  1II5 A;  4H45 A;  1M5B A;  4PGP A;  2X7P A;  5AA1 A;  2P1S A;  3ROJ A;  4YKJ A;  3H03 A;  3ZSF A;  2I58 A;  4FIM A;  3A3U A;  4I1D A;  1LAH E;  1S9T A;  1Y4C A;  3PTY A;  3KN8 A;  4IGR A;  1H76 A;  3OO7 A;  3PMX A;  4GOT A;  3TUS A;  1SVX B;  5IZ1 A;  3HHF A;  4Q8R A;  4OVS A;  2QJE A;  2Y5L A;  4G8N A;  4WXJ A;  4MIJ A;  4PFI A;  3PD9 A;  2PFZ A;  2ZZX A;  4XKN A;  1XOC A;  4P1L A;  3RGY A;  3U92 A;  4NWD A;  2D5W A;  2Q8M A;  3JYR A;  3KOT A;  3PD8 A;  1LFG A;  3KC1 A;  2ZNT A;  4F3B A;  4QFK A;  4F39 A;  1FRP A;  3TYH A;  3RT6 B;  4ESX A;  5A5X B;  1FCK A;  2I6E A;  4QFL A;  1HSJ A;  3TCF A;  1MY3 A;  4G68 C;  1IUD A;  1IMF A;  3N5L A;  1LCF A;  3N6U A;  3TCH A;  5DVJ A;  2I4C A;  2NUV A;  5IM2 A;  3T1B A;  2OLB A;  1AH5 A;  1IIW A;  3KFM A;  1Q35 A;  4PFB A;  1N3W A;  1R1N A;  5AE4 A;  1FBF A;  4R74 A;  1P99 A;  3TTL A;  4MFI A;  4RY1 A;  2V25 A;  3OD7 A;  1LBB A;  4EXL A;  4EQB A;  4IO5 A;  1WVJ A;  3TMG A;  5BUU A;  5IGA A;  4YKI A;  3M8U A;  4N4U A;  1MY0 A;  4ZE8 A;  4F1Y A;  2VPO A;  3RPW A;  1NUY A;  3KN7 A;  1G0I A;  1MM6 A;  1FTL A;  2G29 A;  2QMW A;  5EYG A;  4LA9 A;  2A5S A;  4GWX A;  2F7B A;  4RK2 A;  1MY2 A;  1OMP A;  2NOO A;  3CFX A;  1UIV A;  4PET A;  5BWJ A;  4L17 A;  3OEL A;  5HBC A;  3I6V A;  4TQU Q;  1RYX A;  4ZEF A;  2Y7R A;  4PGN A;  2H5Y A;  2DSF A;  3SZP A;  1B7H A;  4XF5 A;  3RLF E;  4GBW A;  3ZKL A;  1DK4 A;  2GH9 A;  2B65 A;  4OMB A;  4OEV A;  1UTB A;  4QRZ A;  1ANF A;  1Z7M E;  4HE1 A;  4RPO A;  4KQP A;  1XHY A;  1LFH A;  2VD3 A;  2DWA A;  4QBA A;  2XWI A;  4MCO A;  5DEX B;  2OZZ A;  4OES A;  1SQY A;  3N6T A;  4LZ7 A;  1Y4T A;  1FPK A;  2O7U A;  3OSR A;  1L5T A;  3FD3 A;  3RUM A;  4H8I A;  1URG A;  5EQ7 A;  3SEY A;  2WKY A;  4KR5 A;  4OQO A;  3GLB A;  2F3D A;  1XVY A;  1IMC A;  4OFO A;  1Y9U A;  3VFJ A;  1TT1 A;  3ILT B;  4PFW A;  1B40 A;  2XXT A;  5I59 B;  2B3B A;  3EKI A;  1FBH A;  4U22 A;  3G3J A;  3VVE A;  4F2O A;  1N7W A;  3VVD A;  4DE8 A;  2CZL A;  5I3S A;  3VVF A;  1CE2 A;  1FPF A;  2DDK A;  3EQ1 A;  3IOW A;  1GTK A;  4NMY A;  2VD2 A;  3U72 A;  1MQG A;  3ILU B;  3OEM A;  4H1X A;  1FTA A;  4ZEC A;  3ECR A;  5H8F A;  2Q74 A;  4FOR A;  1B52 A;  1MH3 A;  3BIG A;  2ZXT A;  3T22 A;  2XXX A;  3CSG A;  1DCU A;  3RTW B;  1OVB A;  4OVJ A;  3C32 A;  4P1E A;  1QVS A;  3MP8 A;  3PUW E;  3ZKK A;  1M5F A;  4PAK A;  3FJM A;  4UAB A;  1M5E A;  2OX3 A;  1JQF A;  3R6U A;  1VDW A;  1B51 A;  1FTO A;  4R75 A;  4JWX A;  5K2X A;  4PF6 A;  5H8N A;  4THI A;  1B46 A;  1TFD A;  3FXB A;  2OCU A;  4UAC A;  5CC2 A;  3M3L A;  3VXB A;  1MRP A;  1P1U A;  3MPK A;  3TTR A;  3TOD A;  1LLS A;  4H46 A;  2F7A A;  5FHN A;  4F18 A;  2HFB A;  1I69 A;  1DMB A;  1S50 A;  4G2Z A;  4LQ2 A;  4GWZ A;  1SD3 A;  1FTK A;  2HAV A;  3K4U A;  4EDP A;  1BIY A;  1QGX A;  1EZ9 A;  2DP8 A;  4YB6 A;  5I84 A;  1FQD A;  2VP1 A;  5F7V A;  2F35 A;  3FJG A;  1UIU A;  5M2V A;  4PFT A;  1FW0 A;  1KWH A;  3CSB A;  2DQV A;  4DDD A;  1FTJ A;  4YB5 A;  4GWO A;  1LCT A;  3K00 A;  5DVI A;  1IMB A;  1LBX A;  4M4G A;  3TFL A;  1SI0 A;  4FEC A;  3TCG A;  4OFL A;  3S4U A;  4MJO A;  4H65 A;  2H9B A;  3EPE A;  4GL0 A;  2D21 A;  2X26 A;  4KFQ A;  4QFO A;  3ZS6 A;  4FAT A;  3TTK A;  3B6T A;  1R6Z A;  3G3F A;  4O3A A;  2V3U A;  4C1T A;  1ZLQ A;  1UTH A;  1IXG A;  3ONM A;  3VLV A;  4NE4 A;  4ZZE A;  5JK4 A;  4NX1 A;  3EF7 A;  3KBR A;  1ATG A;  2FVZ A;  4PFR A;  3MP1 A;  2Q9T A;  4YB7 A;  3LSF B;  5J1D A;  3KEI A;  3UOR A;  4PAF A;  4RNS A;  2Z8D A;  4H5F A;  1IQ7 A;  4R72 A;  2V93 A;  2XD3 A;  3IO4 A;  4P3L A;  4ZED A;  3L6G A;  4G8M A;  2QVU A;  1B5I A;  2YLN A;  3B8B A;  4F29 A;  3PUX E;  3R26 A;  1AOV A;  1MQJ A;  2XWO A;  4P11 A;  2NXO A;  4GD5 A;  1NKX A;  2CZH A;  1NH7 A;  1B2H A;  1P1W A;  1RDZ A;  3B7D A;  2Y7W A;  4G4P A;  3ISP A;  5H8N B;  3PUZ E;  5AA3 A;  1SW5 A;  4BDO A;  3TEP A;  3RT8 A;  1CB6 A;  2QPQ A;  2XHD A;  1AL3 A;  2XXK A;  2O7I A;  3SKP A;  4I3E A;  3UGW A;  4QSD A;  4HTG A;  4HE0 A;  4GFR A;  3TZA A;  3K2D A;  3T66 A;  2Z8F A;  4JWO A;  3MVY A;  2QS1 A;  4TLL B;  3R7X A;  2Y7K A;  4X1D A;  3C33 A;  1JVX A;  5I59 A;  5JTY B;  5I2N B;  3GXA A;  3K6U A;  1YXI A;  4BDN A;  2GHA A;  5ET5 A;  3N94 A;  3OMB A;  3BBR A;  1A7L A;  3E4R A;  4DI3 D;  3OO6 A;  3PUY E;  1FQF A;  4MHF A;  2UVH A;  3FGS A;  2OBG A;  1FJ6 A;  1P1N A;  3S9N C;  1ELJ A;  5ESY A;  3RYD A;  1ZIU A;  2ZYN A;  3MST A;  2F5X A;  4LQ5 A;  2KLF A;  4OEU A;  1I6Q A;  2I4B A;  2DVC A;  5LOM A;  4HCY A;  2PFY A;  4KYS A;  3B6Q A;  4OZ9 A;  1OVT A;  3I5O A;  3U1O A;  2HQ0 A;  3CG3 A;  3HO7 A;  3DM0 A;  1B1X A;  3CIJ A;  3HN0 A;  1RDX A;  1MQI A;  5B70 A;  3W15 C;  2I49 A;  2XA5 A;  1BTJ A;  1FJ9 A;  1FPJ A;  3IAZ A;  3GBB A;  2P2A A;  4I8C A;  4RK9 A;  3T93 B;  4O94 A;  4DZ1 A;  1MM7 A;  1IME A;  3QUJ A;  4H67 A;  2QMX A;  1P1O A;  2V4C A;  1EZP A;  2VOZ A;  1SI1 A;  3KC0 A;  3K01 A;  1US5 A;  3IJX B;  4OTE A;  4OYV A;  1B0L A;  2F97 A;  1NUW A;  1NFT A;  4RPN A;  3O97 A;  4IO2 A;  1NNP A;  3HV1 A;  4I3Y A;  2RCA A;  4PFU A;  2HZL A;  1GVC A;  3S2V A;  1PBQ A;  4IY5 A;  2XX9 A;  2RIN A;  1B3E A;  1JVY A;  5IZZ A;  5FTI A;  1IZ1 A;  4JXI A;  1BK4 A;  1NI9 A;  4GX4 A;  4H0W A;  1SW1 A;  2NVU B;  1FPI A;  4R2F A;  2WYP A;  4GRK A;  4M1V A;  1IEJ A;  2FNC A;  5EYF A;  4ZS9 A;  1XC1 A;  3MPL A;  3OOA A;  1B6H A;  4IO4 A;  3H06 B;  4NF0 A;  3GYY A;  1GR2 A;  3IB0 A;  5L9O A;  1PBP A;  1PDA A;  3K6W A;  4GIZ A;  2MKZ A;  3PPO A;  3EHT A;  2RC7 A;  3O6H A;  2THI A;  2R9J A;  3QK6 A;  3S9E A;  1OIB A;  4QF9 A;  4C1U A;  5FHM A;  1I6B A;  5ELV A;  2ZMB A;  4F19 A;  5I7I A;  4GX3 A;  2QRY A;  5TPA A;  1PB8 A;  3OEN A;  1IMD A;  1LBY A;  3LUZ A;  2PYY A;  3T9V A;  1LBZ A;  3IFA A;  4ZDM A;  3IOT A;  5AA2 B;  4PDH A;  1O63 A;  4N8G A;  2HXR A;  3PU5 A;  2I3W A;  5AA4 B;  1FBD A;  4RA1 A;  2UVI A;  1ZKB A;  4F3G A;  4O7I A;  1SPI A;  1LAG E;  4ELR A;  4OER A;  4YMA A;  4EF2 A;  1NNT A;  1Y20 A;  4GWU A;  2V3T A;  3MQ9 A;  2V3Q A;  2HEU A;  2PVU A;  2PX1 A;  1FPL A;  3VXC A;  4X48 A;  3LR1 A;  5AA2 D;  1JEU A;  1YZ0 A;  2DWH A;  4NGU A;  4ECF A;  3O2A A;  5I56 B;  4IY6 A;  5LTC A;  2F78 A;  4YZZ A;  3GBA A;  4QSC A;  2AIX A;  3TTM A;  4GX6 A;  3RTF B;  2XXY A;  4GVO A;  1QKB A;  1DTZ A;  5DYH A;  2F7C A;  4HS7 A;  2O84 X;  4PP0 A;  1D9V A;  4N07 A;  1B1H A;  4N13 A;  3T96 B;  4E0X A;  4G68 A;  4NF8 B;  2E1S A;  3MVZ A;  4MF3 A;  4P47 A;  4Q5T A;  4JVI A;  2D3I A;  2DS9 A;  3P7I A;  5H8S A;  2O51 A;  3D4G A;  1XS5 A;  2ESN A;  5IZ3 B;  4U2R A;  5FBP A;  5IZ3 A;  1A8E A;  3IX1 A;  3IB2 A;  4QXD A;  4MBP A;  4F31 B;  2AYS A;  2R71 A;  5ET8 A;  1JET A;  2GQ1 A;  3DP8 A;  4MNI A;  2FYI A;  4X8R A;  4XKQ A;  5CRY A;  3O28 A;  1IIT A;  5EHS A;  1FQB A;  1JW4 A;  1XT8 A;  3O6G A;  1MG1 A;  1D9Y A;  4N91 A;  2REG A;  2M8C A;  4QFP A;  3RNN A;  3CG1 A;  2WX9 A;  3TQL A;  2YJP A;  3O9P A;  4ZZA A;  1DTG A;  2RC9 A;  4JVD A;  3MVW A;  2XX8 A;  3HHG A;  1N3X A;  2RCB A;  4KPT A;  3HFU A;  4U1O A;  1FPE A;  2F36 A;  3G7W A;  3OEK A;  1H43 A;  2QL3 A;  2I0C A;  1IXH A;  4GL8 A;  5CBS A;  2UXA A;  5F24 A;  2XD2 A;  3IOU A;  4R9F A;  4IR8 A;  1H45 A;  1VE4 A;  3N26 A;  3KJ7 A;  3ODB A;  2G93 A;  3THI A;  4F1U A;  2NWJ A;  1NV0 A;  3O66 A;  1Y3Q A;  2XWK A;  3VE1 B;  4Z7E A;  3IK6 B;  4AQ4 A;  1DOT A;  4R73 A;  3T9U A;  3DLN A;  3U93 A;  2B4M A;  4NN3 A;  1WOD A;  3G3G A;  1A99 A;  4WEP A;  3OO8 A;  4NHB A;  1USY E;  4JB7 A;  2IEE A;  4OEN A;  5DVF A;  4XTC Q;  3MYU A;  5ITO A;  3W9V A;  2PT2 A;  5I58 B;  3FV1 A;  1LAF E;  3CRB A;  3PPN A;  4HCW A;  1UTB B;  4IO7 A;  1FBC A;  1H3D A;  3KSX A;  4R6K A;  5H8H A;  1SYH A;  4F22 A;  1B4H A;  3M3F A;  2CZK A;  1TWY A;  1VFE A;  3K6X A;  3MZ9 A;  3QAX A;  4YKP A;  4HW8 A;  4G77 A;  2XXV A;  4XXU A;  2Q8J A;  3Q29 A;  2FIX A;  4ND9 A;  4F1V A;  5I2K B;  2ZNS A;  4YAH X;  1DSN A;  3VLW A;  1LB9 A;  1LBW A;  1PC3 A;  2OJT A;  4OXV A;  2OWT A;  5AA4 A;  2XXP A;  1SW2 A;  2O6A A;  1MPB A;  1RKM A;  3TQW A;  5EQ8 A;  2P3N A;  4AB6 A;  4NF4 B;  2Z23 A;  2O1M A;  4TLM B;  5CMC A;  4AS5 A;  1TFA A;  4OET A;  3H6T A;  1VFD A;  1B0H A;  3T0J A;  4KHZ E;  1MY1 A;  1NV5 A;  2CEY A;  2A5T A;  1K9Z A;  3IR1 A;  4FJP A;  2ANJ A;  3IJO B;  1T0K A;  3FAT A;  1HSE A;  2QFL A;  3DEL B;  1EYJ A;  4YIC A;  1EYI A;  1SW4 A;  5T3J A;  4EXK A;  1Y3N A;  3G3K A;  4PF8 A;  1IXC A;  1FQE A;  5H8F B;  3MP6 A;  3H6U A;  3M3K A;  1ZBM A;  5F1Q A;  3H3G A;  4PBQ A;  4AB5 A;  4F3S A;  4NG7 A;  3TAJ A;  5CMM A;  1BP5 A;  1FSA A;  1FBE A;  4TOZ A;  1IMA A;  5IAI A;  3WAF A;  1NV3 A;  1B05 A;  3FXQ A;  2VT5 A;  5CI5 A;  3PMV A;  1S7Y A;  3FXR A;  4G61 A;  3TEL A;  1ZMG A;  3DP4 A;  4GWY A;  4ZEI A;  2VGQ A;  4PQJ A;  3IOV A;  4DCY A;  2XXU A;  4JDF A;  3SES A;  3PUV E;  3B6W A;  4PE5 B;  1JEV A;  3CFZ A;  2HZK A;  5DTB A;  1KZ8 A;  4JVC A;  4F2Q A;  3CR9 A;  1UTH B;  5AA2 A;  3FIR A;  3H7M A;  1B3F A;  2UYF A;  1N76 A;  4AS4 A;  1OQG A;  2QS2 A;  2L5V A;  4XKR A;  4P0G A;  2HPG A;  1QUI A;  2Q88 A;  3JZJ A;  5DEX A;  1B7Z A;  1FQC A;  2XX7 A;  5HM4 B;  3FVG A;  2O68 A;  3AXF A;  3PMW A;  1JNF A;  4GLI A;  2DXR A;  3U94 A;  4P56 A;  2FBP A;  3HST A;  5L9M A;  1QJM A;  3K02 A;  1LEV A;  5I2K A;  1XVX A;  5DW8 A;  4EF1 A;  4KXP A;  1B32 A;  2QVV A;  1B4Z A;  3LC8 A;  1N0T A;  5KDT B;  3I3V A;  4KYD A;  3C35 A;  4N15 A;  1LAX A;  2ZYM A;  4Q30 B;  2DWJ A;  3WAE A;  2F6P A;  4UA8 A;  2CZI A;  3PV0 E;  2DE3 A;  3BFU A;  2XXR A;  2FIE A;  3OXN A;  4R2B A;  3SDF A;  3K1M A;  3KZG A;  4XEQ A;  2X7Q A;  2ZYO A;  4MAG A;  3Q28 A;  3D1R A;  5I57 A;  1VSO A;  1Y1M A;  1NH8 A;  1LB8 A;  4JSD A;  5DT6 A;  4ZEK A;  4POX A;  1MXY A;  5EQA A;  3UK4 A;  3RPL B;  3PPR A;  1A8F A;  5JEI A;  3PPP A;  5KCJ A;  1POT A;  5KCJ B; 
#chains in the Genus database with same CATH homology
 4NF5 A;  5A5X B;  4RA1 A;  3T22 A;  2XXX A;  2UVI A;  3CSG A;  3LSW A;  3QXM A;  5KDT A;  4KD5 A;  2R6G E;  4LON B;  1ZKB A;  3RTW B;  4H5G A;  1OVB A;  4OVJ A;  3C32 A;  3KJT A;  3V8X B;  2CMO A;  4F3G A;  1LAG E;  1NL5 A;  4ELR A;  4OER A;  4YMB A;  1QVS A;  3MP8 A;  4YMA A;  3PUW E;  1JW1 A;  4ONY A;  1D4N A;  1AMF A;  1M5F A;  1NNT A;  1UQW A;  2RF1 A;  3ZKK A;  4EF2 A;  3FJM A;  4U23 A;  4DXU A;  1M5E A;  1JQF A;  3R6U A;  5CMB A;  4R6H A;  3EHU A;  1Y20 A;  4NF8 A;  1EH3 A;  1B51 A;  1FTO A;  2V3T A;  1DPE A;  1TXF A;  1F9B A;  3MQ9 A;  4R75 A;  2V3Q A;  4JWX A;  2HEU A;  5H8Q A;  2PVU A;  5K2X A;  2UVG A;  4RXL A;  5H8N A;  2A5T B;  4NTL A;  1B46 A;  2GHB A;  4THI A;  3SET A;  1TFD A;  2PX1 A;  5ICQ A;  2OCU A;  4UAC A;  3H4Z A;  5CC2 A;  3VXC A;  4X48 A;  3SEU A;  3LR1 A;  1MPC A;  3M3L A;  3H6V A;  4RYA A;  1MXV A;  3VXB A;  1B3H A;  1JEU A;  1OLA A;  4WKM A;  1MRP A;  1Q1K A;  4N6P A;  5K2Y A;  1P1U A;  2RC8 A;  2V84 A;  3MPK A;  3TTR A;  4LZ8 A;  2DWH A;  3TOD A;  3RN8 A;  1LLS A;  4ELQ A;  3LBS A;  4WED A;  4ECF A;  1YPN A;  3K6V A;  1URS A;  2F7A A;  4ZEB A;  3O2A A;  5FHN A;  5I58 A;  5EHM A;  5I56 B;  2OWS A;  3L6H A;  4IY6 A;  4EUO A;  4F18 A;  2HFB A;  4ESX A;  3K0V A;  1QUK A;  2F78 A;  3FUZ A;  1I69 A;  3BFT A;  1DMB A;  3GBA A;  4YZZ A;  2Y84 A;  1S50 A;  3MUQ A;  4G2Z A;  4LQ2 A;  2GRV A;  3UP9 A;  1SD3 A;  4NF5 B;  2AIX A;  4QSC A;  3TTM A;  3VLU A;  4EQ7 A;  1FTK A;  1BLF A;  2HAV A;  3FJ7 A;  4YKK A;  2H4I A;  3RTF B;  2XXY A;  4U4X A;  4GVO A;  3K4U A;  4EDP A;  1QKB A;  1DTZ A;  3QSL A;  5DYH A;  4GF8 A;  2F7C A;  1BIY A;  1P1Q A;  2AL4 A;  4KCC A;  1EZ9 A;  2DP8 A;  4YB6 A;  4HS7 A;  1BKA A;  1QKA A;  2O84 X;  3FAS A;  1N7X A;  1FQD A;  1M5D A;  1ZJL A;  4PP0 A;  5I84 A;  1D9V A;  4N07 A;  2I3V A;  1B1H A;  2VP1 A;  1MQH A;  3KN3 A;  3MBP A;  4N13 A;  3T96 B;  4E0X A;  4G68 A;  5I57 B;  4NF8 B;  2E1S A;  3MVZ A;  4MF3 A;  4Q5T A;  5F7V A;  2F35 A;  3FJG A;  2D3I A;  3QYT A;  2DS9 A;  1UIU A;  3LSL A;  4LP2 B;  3TDJ A;  3P7I A;  5IKB A;  5M2V A;  5H8S A;  2O51 A;  4PFT A;  3V83 A;  1FW0 A;  1KWH A;  4MLV A;  3PGF A;  3CSB A;  2QS4 A;  1FQA A;  3HCQ A;  1SBP A;  3D4G A;  1XS5 A;  2ESN A;  1YCJ A;  4LVQ A;  4QFN A;  4LAT A;  4U2R A;  1A8E A;  1R9Q A;  4YU0 A;  3FVO A;  2DQV A;  2OK2 A;  4IO3 A;  3IX1 A;  4DDD A;  1FTJ A;  3IB2 A;  1Y1Z A;  4GWO A;  4YB5 A;  1LCT A;  5AA2 D;  3MAM A;  3K00 A;  2DE4 A;  4MBP A;  4XIG Q;  5DVI A;  4ELP A;  4F31 B;  2AYS A;  2R71 A;  2BJJ X;  1SYI A;  2QS3 A;  1JET A;  5AA4 B;  1MDP 1;  1VR5 A;  4M4G A;  3DP8 A;  1N04 A;  2DVZ A;  3G3I A;  3TFL A;  1I6A A;  1SI0 A;  4FEC A;  4C0R A;  2ABH A;  1NNK A;  4R6Y A;  2FYI A;  3TCG A;  1ZTY A;  4OFL A;  4XKQ A;  2XXH A;  1MY4 A;  5ISU A;  5CRY A;  3O28 A;  1IIT A;  3EHS A;  4GXA A;  5EHS A;  1FQB A;  3H6W A;  3S4U A;  5KCJ B;  4DXB A;  4BDR A;  5H8Q B;  1JW4 A;  4H65 A;  1XT8 A;  1B58 A;  4FE8 A;  3C31 A;  4IGT A;  4MH5 A;  3O6G A;  2H9B A;  3EPE A;  1D3K A;  1MG1 A;  4GL0 A;  4DCX A;  1D9Y A;  2D21 A;  2X26 A;  4KFQ A;  4QFO A;  4U1Z A;  4KYE A;  3ZS6 A;  4FAT A;  2REG A;  2M8C A;  4QFP A;  4POW A;  3RNN A;  3B6T A;  3CG1 A;  4JWY A;  3TTK A;  3RY3 A;  4G68 B;  1MQD A;  1R9L A;  1R6Z A;  2FA7 A;  3G3F A;  3TQL A;  2YJP A;  4O3A A;  3O9P A;  4ZZA A;  3V89 B;  2V3U A;  1AIV A;  4C1T A;  1DTG A;  1EZO A;  1ZLQ A;  2RC9 A;  1UTH A;  1IXG A;  1OQH A;  2F34 A;  3ONM A;  2Q89 A;  3MVW A;  3VLV A;  2XX8 A;  3HHG A;  1N3X A;  2YPN A;  2RCB A;  4NE4 A;  4ZZE A;  4F3P A;  2PT1 A;  1A40 A;  5L8D A;  4BDL A;  4KPT A;  2XXI A;  4U1O A;  5JK4 A;  1A55 A;  2F36 A;  3G7W A;  3OEK A;  1H43 A;  2QL3 A;  3EF7 A;  2I0C A;  1IXH A;  3C36 A;  3KBR A;  4GL8 A;  5TP9 B;  5CBS A;  2UXA A;  1ATG A;  3CI8 A;  4LUB A;  2ALU A;  3MP1 A;  2I48 A;  2Q9T A;  3LSF B;  4XKP A;  4YB7 A;  2XD2 A;  3V5A A;  5J1D A;  5L9S A;  3UA8 A;  3IOU A;  4NF4 A;  4E0W A;  4R9F A;  4FEB A;  1MDQ A;  3KEI A;  3UOR A;  4LZ5 A;  4RNS A;  2Z8D A;  1H45 A;  4H5F A;  1VE4 A;  3VV5 A;  3N26 A;  3A3C A;  1IQ7 A;  1MXU A;  3KJ7 A;  3FVK A;  2G93 A;  3ODB A;  1B3G A;  4R72 A;  1GV8 A;  2NWJ A;  3THI A;  2V93 A;  3O66 A;  1Y3Q A;  4BDQ A;  4F1U A;  2XD3 A;  4NF6 A;  2UVJ A;  3VE1 B;  4Z7E A;  3IK6 B;  2ONK E;  3C34 A;  3IO4 A;  4AQ4 A;  1DOT A;  4KI0 E;  3L6G A;  4R73 A;  4ZED A;  3T9U A;  3DLN A;  4G8M A;  1LBC A;  1B5I A;  1N84 A;  2YLN A;  2F8D A;  3U93 A;  1WOD A;  2B3F A;  2VHA A;  1A99 A;  3G3G A;  3MZ1 A;  4WEP A;  3JV9 A;  1EU8 A;  3OO8 A;  1M5C A;  4F29 A;  2H99 A;  1LST A;  2QSX A;  3PUX E;  2Y7P A;  1MXZ A;  2ZYK A;  3FXU A;  3QIM A;  1USY E;  3R26 A;  4JB7 A;  5CM6 A;  1AOV A;  2IEE A;  1MQJ A;  4OFJ A;  4OEN A;  3MZB A;  4H6D A;  3FVN A;  3KGC A;  4P11 A;  4XTC Q;  2NXO A;  5DVF A;  5ITO A;  4GD5 A;  3W9V A;  4FAJ A;  3F11 A;  1NKX A;  3TKD A;  2HXW A;  1II5 A;  2PT2 A;  1M5B A;  3E3K A;  5I58 B;  3FV1 A;  4G8H A;  1NH7 A;  3IO6 A;  4U21 A;  1B2H A;  1LAF E;  2X7P A;  3CRB A;  2P1S A;  3PPN A;  5AA1 A;  3S9M C;  4YKJ A;  1P1W A;  1B5J A;  1UTB B;  3B7D A;  2H98 A;  3H03 A;  4HCW A;  4IO7 A;  4RJZ A;  3ZSF A;  1H3D A;  2Y7W A;  3O6I A;  3KSX A;  4G4P A;  4R6K A;  3SEV A;  4MLQ A;  5H8H A;  1SYH A;  3TTN A;  3S9L C;  4F22 A;  2I58 A;  3K1N A;  4FIM A;  3A3U A;  3MC2 A;  1B4H A;  2I0B A;  3MVX A;  3PUZ E;  3M3F A;  2H25 A;  4I1D A;  4O3C A;  3BKI B;  1QW0 A;  5AA3 A;  5H8N B;  1SW5 A;  2ONR A;  4BDO A;  2GFE A;  3TEP A;  1LAH E;  1S9T A;  1TWY A;  4PFY A;  3RT8 A;  1VFE A;  1CB6 A;  3K6X A;  1Y4C A;  2QPQ A;  2P0S A;  2XHD A;  3KN8 A;  3MZ9 A;  4IGR A;  2REJ A;  3QAX A;  5HPQ A;  1H76 A;  3OO7 A;  3PMX A;  4YKP A;  4HW8 A;  4GOT A;  1AL3 A;  4G77 A;  2XXV A;  4XXU A;  2Q8J A;  3Q29 A;  1OLC A;  2O7I A;  4ND9 A;  3SKP A;  4F1V A;  3TUS A;  1B7U A;  5I2K B;  1MH4 A;  2Q2C A;  2ZNS A;  3Q27 A;  1DSN A;  1PB7 A;  1SVX B;  4YAH X;  3VLW A;  1LB9 A;  1RYO A;  4QSD A;  3UGW A;  1PC3 A;  2OJT A;  1NMU A;  4HTG A;  3HHF A;  2Z22 A;  4OXV A;  2OWT A;  4GFR A;  4Q8R A;  3UIF A;  3TZA A;  1H44 A;  1US4 A;  2QJE A;  1YTV A;  3K2D A;  4G8N A;  4WXJ A;  5AA4 A;  2XXP A;  4IB2 A;  5TP9 A;  1SW2 A;  2O6A A;  3PD9 A;  3T66 A;  1MPB A;  1RKM A;  3TQW A;  2Z8F A;  2ZNU A;  1PEB A;  4JWO A;  4XKN A;  1XOC A;  3MVY A;  4EQ9 A;  2QS1 A;  3U8Q A;  4TLL B;  4ZE9 A;  3RGY A;  4DLD A;  3R7X A;  4AB6 A;  4NF4 B;  1QUJ A;  2Z23 A;  2O1M A;  2Y7K A;  4X1D A;  3C33 A;  4IO6 A;  4TLM B;  1TFA A;  5CMC A;  3U92 A;  4NWD A;  4OET A;  1MXX A;  1JVX A;  5I59 A;  2D5W A;  4OWD A;  5JTY B;  5I2N B;  3H6T A;  1VFD A;  3GXA A;  3JYR A;  4H8J A;  1B0H A;  3KOT A;  4OHN A;  1SDX A;  3K6U A;  3PD8 A;  3MWB A;  4KHZ E;  4BDN A;  1MY1 A;  1LFG A;  4NF6 B;  2GHA A;  1DPP A;  2ZNT A;  1WDN A;  4F3B A;  4QFK A;  3N94 A;  3OMB A;  4F39 A;  3BBR A;  4I9D A;  3TYH A;  2AL5 A;  2A5T A;  1MPD A;  1A7L A;  3E4R A;  2HCA A;  4O3B A;  1FCK A;  2I6E A;  3OO6 A;  3RT6 B;  3IR1 A;  4QFL A;  4FJP A;  2ANJ A;  4Z0I A;  5A5X A;  3IJO B;  3PUY E;  1FQF A;  3KG2 A;  1T0K A;  1HSJ A;  4BLA A;  2UVH A;  1MY3 A;  3FAT A;  3TCF A;  2F6G A;  2OBG A;  3FGS A;  1HSE A;  1P1N A;  4G68 C;  1IUD A;  2W7Y A;  3N5L A;  2O1L A;  3S9N C;  1LCF A;  3DEL B;  4QSE A;  4P0I A;  4DXC A;  5CMK A;  3N6U A;  3W9W A;  3TCH A;  1ELJ A;  5DVJ A;  5I56 A;  4YIC A;  4BDM A;  1ZIU A;  1SW4 A;  2I4C A;  2ZYN A;  4EXK A;  1Y3N A;  1NNF A;  2F5X A;  2KLF A;  1URD A;  2NUV A;  3G3K A;  4LQ5 A;  1IXC A;  1FQE A;  1I6Q A;  4OEU A;  5H8F B;  3SEW A;  4GQO A;  2I4B A;  3IL1 B;  3MP6 A;  2DVC A;  5LOM A;  4HCY A;  2OLB A;  5H8H B;  4KYS A;  3LUY A;  2ONS A;  1AH5 A;  3B6Q A;  1IIW A;  3KFM A;  4OZ9 A;  1OVT A;  3I5O A;  1Q35 A;  3U1O A;  1N3W A;  1R1N A;  3H6U A;  3M3K A;  5AE4 A;  4JBZ A;  1ZBM A;  1Z7N E;  2HQ0 A;  3C9H A;  1IXI A;  3CG3 A;  5F1Q A;  4R74 A;  1J1N A;  3HO7 A;  1P99 A;  3RQT A;  3DM0 A;  1HSL A;  3TTL A;  1B1X A;  3Q25 A;  4MFI A;  4RY1 A;  3H3G A;  3CIJ A;  3HN0 A;  2XXW A;  2V25 A;  4U4S A;  4AB5 A;  4Q0C A;  4F3S A;  5TPA B;  1MQI A;  5B70 A;  3TAJ A;  2IA4 A;  5CMM A;  3W15 C;  1BP5 A;  3FV2 A;  2I49 A;  3OD7 A;  1LBB A;  5CBR A;  4TOZ A;  5FHO A;  4EQB A;  4EXL A;  1BTJ A;  4IO5 A;  5IAI A;  3IAZ A;  3WAF A;  3GBB A;  1B05 A;  1WVJ A;  3TMG A;  2P2A A;  4I8C A;  3FXQ A;  4RK9 A;  5BUU A;  5CI5 A;  3PMV A;  4YKI A;  1S7Y A;  3T93 B;  3A09 A;  3M8U A;  5B7D A;  1MY0 A;  3FXR A;  4ZE8 A;  4F1Y A;  3IOR A;  3HPI A;  4DZ1 A;  1MM7 A;  1B3L A;  3RPW A;  3KN7 A;  3QUJ A;  1MM6 A;  4H67 A;  1FTL A;  1ZMG A;  2G29 A;  3TEL A;  2QMW A;  3DP4 A;  2QMX A;  1O7T A;  1P1O A;  2E0S A;  4LA9 A;  1MS7 A;  1EZP A;  2VOZ A;  2A5S A;  4ZEI A;  1PB9 A;  1SI1 A;  1A54 A;  2HAU A;  2VGQ A;  2F7B A;  3K01 A;  1US5 A;  4PQJ A;  3IJX B;  4OTE A;  2XXQ A;  4RK2 A;  1MY2 A;  1FTM A;  3IOV A;  1OMP A;  2NOO A;  4OYV A;  3CFX A;  4DCY A;  1B0L A;  2F97 A;  2XXU A;  1UIV A;  4JDF A;  3SES A;  4PET A;  1POY 1;  5BWJ A;  4L17 A;  3OEL A;  5HBC A;  3I6V A;  3PUV E;  3B6W A;  4TQU Q;  1ZU0 A;  5FTH A;  4NWC A;  1RYX A;  4PE5 B;  1JEV A;  1NFT A;  3CFZ A;  2O69 A;  2HZK A;  4RPN A;  3O97 A;  4X1B A;  4ZEF A;  5DTB A;  2Y7R A;  4ELO A;  2H5Y A;  1GGG A;  4IO2 A;  1NNP A;  3HV1 A;  2DSF A;  3OO9 A;  2RCA A;  5ITP A;  4F2Q A;  4PFU A;  2HZL A;  4K3F A;  1B7H A;  1GVC A;  3OSQ A;  3S2V A;  2DWI A;  3CR9 A;  3RLF E;  1LGB C;  1PBQ A;  1UTH B;  4IY5 A;  3FIR A;  3ZKL A;  5AA2 A;  2XX9 A;  3H7M A;  2RIN A;  3K1P A;  1B3E A;  1MXW A;  1B3F A;  2GH9 A;  1JVY A;  2DYX A;  2UYF A;  1N76 A;  1JW5 A;  2B65 A;  1USY H;  4OEV A;  1OQG A;  3Q26 A;  1UTB A;  4OMB A;  4FED A;  4QRZ A;  1ANF A;  2QS2 A;  3CFL A;  5FTI A;  1IZ1 A;  4JXI A;  1Z7M E;  4RPO A;  3MJN A;  4XKR A;  4KQP A;  5TU0 A;  3UN6 A;  4X9T A;  5KZT A;  4P0G A;  4GXS B;  1XHY A;  1LFH A;  4H0W A;  1QUI A;  2VD3 A;  2DWA A;  1SW1 A;  2Q88 A;  3JZJ A;  5DEX A;  1B7Z A;  1FQC A;  2XX7 A;  2NVU B;  5HM4 B;  5DEX B;  1LFI A;  3FVG A;  2O68 A;  2OZZ A;  4OES A;  4R2F A;  3AXF A;  1SQY A;  3KSJ A;  4ISU A;  3PMW A;  4GRK A;  3PPQ A;  3MW0 A;  3N6T A;  1JNF A;  3E13 X;  3C4M A;  4GLI A;  1Y4T A;  4LZ7 A;  2DOJ A;  2DXR A;  3U94 A;  5I2N A;  5JTY A;  2Y7I A;  2DXY A;  4NED A;  4M1V A;  2O7U A;  3OSR A;  3HST A;  1IEJ A;  2FNC A;  5L9M A;  1QJM A;  3FZV A;  4ZS9 A;  5EYF A;  1XC1 A;  3K02 A;  3MPL A;  3OOA A;  1L5T A;  5I2K A;  1B6H A;  3IB1 A;  3FD3 A;  3H06 B;  3CVG A;  4IO4 A;  3RUM A;  1XVX A;  4EF1 A;  4H8I A;  1URG A;  1B32 A;  3KOS A;  1GR2 A;  1B4Z A;  3IB0 A;  3SEY A;  5L9O A;  3LC8 A;  3SEX A;  4QHQ A;  1PBP A;  2RKM A;  2WKY A;  4KR5 A;  1PDA A;  4OQO A;  3K6W A;  3GLB A;  4GIZ A;  1XVY A;  3D4C A;  1N0T A;  5KDT B;  3I3V A;  1YAE A;  4OFO A;  1Y9U A;  3O29 A;  2PMS A;  2LAO A;  1B5H A;  3C35 A;  4KYD A;  3PPO A;  3EHT A;  1TT1 A;  3ILT B;  3G3H A;  3QUF A;  4PFW A;  1B40 A;  3GZG A;  1LAX A;  2RC7 A;  2XXT A;  1O64 A;  5I59 B;  2ZYM A;  1Y3P A;  3O6H A;  2B3B A;  4U22 A;  2THI A;  4F2O A;  3G3J A;  2DWJ A;  4Q30 B;  3VVE A;  3WAE A;  2F6P A;  4UA8 A;  1N7W A;  2R9J A;  4KCD A;  3EN3 A;  3PV0 E;  3T9H B;  3VVD A;  4DE8 A;  2CZL A;  4I62 A;  3QK6 A;  2DE3 A;  3VFJ A;  3BFU A;  2XXR A;  3OXN A;  3S9E A;  1OIB A;  4R2B A;  3SDF A;  3K1M A;  3KZG A;  4ESW A;  3DP6 A;  4QF9 A;  3USD A;  2X7Q A;  2PBW A;  3SER A;  2DE2 A;  2ZYO A;  3VVF A;  4C1U A;  5FHM A;  1I6B A;  1QUL A;  1CE2 A;  3Q28 A;  4R9G A;  2ZMB A;  5ELV A;  4F19 A;  5I57 A;  5ICT A;  2QRY A;  1VSO A;  1Y1M A;  1PB8 A;  3OEN A;  4JSO A;  5TPA A;  3EQ1 A;  3IOW A;  1GTK A;  4NMY A;  3VDF A;  2VD2 A;  2Z8E A;  3U72 A;  3TPA A;  4DIG A;  3T9X B;  2PYY A;  3T9V A;  1NH8 A;  1B9J A;  1LB8 A;  1MQG A;  3ILU B;  4ZDM A;  3OEM A;  3IOT A;  4H1X A;  4JSD A;  5DT6 A;  2Q2A A;  5AA2 B;  4ZEK A;  1O63 A;  4POX A;  1MXY A;  4ZEC A;  3ECR A;  5H8F A;  4FOR A;  3UK4 A;  3PPR A;  3LSX A;  1A8F A;  3E9X A;  1B52 A;  5JEI A;  3PPP A;  5KCJ A;  2UYE A;  1POT A;  1MH3 A;  3PU5 A;  2I3W A;  2ZXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...