5LA6B

Tubulin-pironetin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
427
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Pironetin Binds Covalently to alpha Cys316 and Perturbs a Major Loop and Helix of alpha-Tubulin to Inhibit Microtubule Formation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 422
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5la6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5la6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5la6B01
3JALB 4WBNB 3M89A 1JFFB 3HKEB 4IIJA 5JH7A 1FFXB 3E22A 5J2TB 4F6RB 1FSZA 1TVKA 3N2GA 4B45A 5EYPA 3RYFA 3WGMA 4YJ2B 4TV9B 1TUBB 4X1KB 4ZOLA 5CA1A 4TV8B 5JQGA 1SA0B 3N2KA 3JATA 4ZI7A 2Q1YA 5CB4B 4M8IA 2RHLA 4I50B 4FFBA 5KX5A 4YJ3A 4XCQA 4I55A 5MN6A 2VXYA 5ITZB 4X1YB 4O4IA 1Z5WA 2XKBA 3HKDA 1Z5VA 3HKBA 5EZYA 4LNUB 3RB8A 1W59A 3JALA 3RYHB 1JFFA 2Q1XA 1W5FA 2BTQB 1OFUA 4O2BB 1FFXA 4U3JA 5J2TA 4EI8A 4ZHQB 4F6RA 3JASB 4TUYB 5LOVB 4O4LA 5EIBC 4YJ2A 4TV9A 1TUBA 4X1KA 4DRXB 5LXTA 3JARB 5LYJB 4E6EA 4X20B 4TV8A 5J2UB 4X1IA 2RHHA 3R4VA 4IHJB 1RQ7A 4HNAA 1RQ2A 4EB6A 5JVDB 5CA0A 3JAWA 4I50A 5C8YB 3HKCB 4I4TA 3RYCB 2GVIA 4EI7A 3V3TA 3C8LA 5KMGA 5ITZA 3JAKA 4O4JB 5IYZB 5FNVB 1W5EA 4LNUA 5IJ0B 2BTOA 4IIJB 3RYHA 5JH7B 5IJ9B 5LP6B 3ZBPA 4WBNA 1RLUA 3VO8A 2BTQA 3HKEA 4O2BA 2VAWA 3WGJA 5MN5A 5EYPB 4O4HB 2R751 1W5BA 4TUYA 2R6R1 4EI9A 4O2AB 3UT5B 5LA6B 4ZOLB 3RYIB 5CA1B 3WGKA 4DRXA 5JQGB 3JARA 3N2KB 4ZI7B 5BMVB 3VOAA 4IHJA 1SA0A 2RHJA 4FFBB 3ZIDA 1W5AA 5KX5B 5CB4A 2VAPA 4KWEA 3M8KA 5MN4A 4I55B 5GONB 3ZBQA 5C8YA 3HKCA 5M7EA 5JCOA 3HKDB 4X1YA 5IJ0A 3WGNA 4DXDA 5LP6A 5IJ9A 4U3JB 3E22B 4U39A 3VPAA 3WGLA 4O4LB 1TVKB 3N2GB 4O4HA 4ZHQA 3RYFB 3JASA 4O2AA 5LOVA 3UT5A 5LA6A 5LXTB 4B46A 3RYIA 5JCOC 4X1IB 5LYJA 4X20A 5BMVA 4HNAB 5EIBD 3JATB 5J2UA 4EB6B 5CA0B 3JAWB 5LP6C 2RHOA 2XKAA 4I4TB 2VAMA 3VOBA 5JVDA 4YJ3B 1W581 5GONA 5KMGB 3JAKB 3RYCA 3VO9A 4O4IB 3HKBB 4O4JA 5EZYB 3CB2A 5IYZA 5FNVA
chains in the Genus database with same CATH superfamily
4PBRA 5KSYA 3OIWA 4ZDKA 4OXKA 3B1ZA 2NYRA 3S2EA 5AW8A 4KQEA 3S7TA 5DBEX 2IEIA 4OSOA 3AWDA 1QHYA 5KUTA 1OCZB 1ZI6A 1UBLS 2GK7A 1H2FA 3U44A 3O8BA 1RRMA 4W1RA 2QN9A 2Q9LA 3C7KA 1JU3A 2FX5A 1ESNA 1LDEA 4HAUA 4DRZA 4A73A 4TMTA 3VR2D 2WYHA 3KWFA 5AM1A 2BSXA 3FNRA 2AE1A 3U0ZA 3OLCX 1U2SA 1EDOA 2ZJ8A 3T0IA 3RFVA 2UXDB 1NW6A 1Y8CA 4TLEA 4B8ZA 4PYLA 3R65A 2KPOA 1UK8A 1FDSA 4NE7A 3GJXC 1V47A 4LW8A 3ES9A 3GLUA 4B3JA 1IXRC 5MDHA 1Y74B 3HY3A 4Q1BA 3U1TA 3WKDA 3ZX5A 3IMCA 3KOZA 4J80A 4G24A 2ZT9B 4I1SA 3AG5A 1F6WA 3F5WC 1E9DA 3T9EA 4MJLA 5E3IA 1AKEA 5EVJA 5AKJA 1IDOA 4IGEA 4LHVA 4LY0A 2PK3A 3RPEA 3RROA 4XXHA 4G1FA 4E5SA 1QVZA 1TUGA 2C3MA 2AGVA 3WA7A 2HQRA 2ISSD 5KNCA 4Q20A 1N5OX 2EBWA 1P4SA 1EQ2A 2YQ4A 3GFFA 4GPTA 2JHAA 2BSAA 5AHRA 1DT3A 1Z25A 2X5JO 3AVTA 3PHGA 2RDCA 2X5OA 1S2LA 3ZHXA 3K9AA 2OBYA 4JXJA 3QFRA 1D6MA 3OT1B 4B48A 2AW3A 3QO5A 2NO9A 2OCDA 1LXCA 3H2KA 1JDBB 4KAXA 1YJBA 1XA0A 2GKSA 1B8UA 4L8YA 5B57C 3RGBA 2BR5A 8ABPA 5FUBA 1FP1D 2ZYDA 3JVDA 1R0SA 2WYOA 4X8MA 4BV3A 3PC3A 3GX1A 1J07A 3IBFA 5F76A 1HP8A 2JRIA 3ZMUA 4I55A 3QXJA 2BE7A 1I6LA 1V54C 5DMXA 1UAGA 2QMHA 3HYNA 1Q6UA 4A1FA 3CB4A 2IYXA 5HFMA 4H7JA 2YFQA 3LWPC 1PJ3A 3WDLA 1IY8A 1LW7A 1XX6A 2QD3A 5JEEA 3UB4A 3B5IA 3KS9A 1H8HG 1OTYA 1FRNA 3ZE8A 5BR8B 4XZ3A 1O6ZA 1ZPDA 4YIHA 1EN4A 3WGQA 1K4CC 5CVJA 1UR5A 3WKCA 3L6EA 1IN4A 1KHHA 4FFLA 1WSDA 3K12A 1XVVA 4JTDB 1T9AA 2XT9A 1FMJA 1QRTA 3K0SA 5FP0A 3J7TA 5L9AA 4RWUA 1CNEA 1N2CA 4C6RA 4M1ZA 5DOZA 3BSWA 3RSQA 1GKFA 2GN8A 1TQHA 3CZ4A 2Z6QA 3C5CA 1RHKA 2ZTMA 1N4AA 1FLNA 4I5DA 3JYCA 4CUZA 2FUG1 5CYPA 1KMHA 4CNQA 5D7NA 1CK4A 3DMTC 1GPAA 3WSWA 4PJ0Z 4N0EA 1QJCA 4IV5A 3EC7A 1UPUA 4FM1A 4FFWA 2ZAYA 1B06A 3UV3A 5F78A 4GUDA 5H70A 3WXBA 4F1JA 2Z43A 5KKAA 1JMKC 1L7OA 3A28A 1REQA 5TEWA 1YRLA 2ZT6A 2ZKIA 4LC1A 1DXYA 2V0GA 5FTJA 3R0ZA 3W7WA 2D2EA 4WSOA 2CHSA 2ZSFA 5LOVF 3KJZA 3QY0A 3C43A 2CUGA 1JLMA 1HLGA 4YX9A 1BFDA 4J8PA 5CT6A 3BXPA 2H51A 3NIDB 3EY4A 2RGDA 3QLVC 3UPTA 2WTBA 1J0XO 1KHTA 1RLIA 2ZSBA 4EABA 3RUPA 3OPNA 4R50A 2JGUA 4CQNA 4DA7A 4OPAA 4K6OA 1W44A 2I2CA 4JBHA 2G0NA 4M37A 4QLAA 1EA7A 2ODMA 1TEHA 5BR7A 2OTCA 2NN3C 1S2GA 1W35A 5HJ7A 5GIPC 4P38A 4F4CA 5HFLA 1QO7A 2HBRA 4N3GA 1WW2A 2WAXA 5AKXA 3HXQA 4PGAA 2I6RA 4PA3A 4H6WA 4G0UA 4JLKA 2OYSA 4WFIA 3ZDAA 1OLSA 2UXCB 2PS9A 4PO9A 3GYQA 1TCUA 2ZIMA 4JUDX 4XDZA 1NQTA 5B1AC 3EFFK 3O75A 1O1YA 4WPGA 5FTWA 3UT5B 4G5HA 1YS4A 4KSCA 1U2PA 4U7FA 3D1JA 1SA0A 4ENTA 5K0NA 1YJNF 3NIWA 3OBIA 5B3JA 1JQKA 1FD9A 3Q88A 4ERXA 4BUCA 3H9GA 3PXDA 4L72A 3ZKWA 3P9CA 4DV5O 2VPXA 1Q8IA 3VHXA 2WRZA 2FVXA 3UW3A 2GOYA 3EZ7A 2EKQA 3B12A 3I2JA 4F12A 1H8EG 1I94O 1ZY2A 1E0JA 1RFYA 1X1CA 5BV1A 4AUKA 2ZRKA 1H66A 1GL6A 2OFFA 3BCSA 5FBWB 1G63A 4UAVA 1YQEA 1Q50A 3R7AA 1ENPA 1XP5A 1K6EA 4QHTA 2PCLA 2YHAA 2WLLA 2EKLA 3QXGA 4IR7A 3CUSA 2VNIA 4MTXA 1IJEA 2I1LA 3NKFA 2DKOA 3U48A 1P4HA 1BIFA 3UCXA 3F73A 4UVEA 1AUPA 5KJCA 4BUZA 1IU9A 1U40A 1KKUA 3W5JA 3W2TA 5JJJB 2A2ZA 3AZPA 4R9UC 4UASA 4MGIR 1M1YB 1UJBA 4LPKA 3PXCX 3CCLF 1QVVA 4F8EA 2ODPA 2O2CA 1EFPB 4MAAA 4F2WA 1WP4A 3KC2A 3L1IA 2W11A 2PL5A 4M9QA 3EULA 2A06H 3ZW9A 1BEEA 1AKNA 3PNSA 3DMYA 4BB9A 4HVAA 4CIAA 3IQDB 1U8FO 4C43A 3H86A 4EVQA 1MO4A 3RT9A 5KTOA 2AXTZ 3UHPA 4MUMA 3LQFA 3CMAF 5CXXA 2O06A 4MVRA 2J5XA 2YYSA 2CJXA 1MOQA 1EG7A 4CG0A 2V7TA 4MYRA 2DQ0A 5KU7A 1OFUA 3RSLA 2JL1A 5J63A 5FV4A 3D54A 5KHKA 4QBIA 3AW8A 2PLRA 2YFKA 4IKEA 3AYXB 2N46A 4BCDA 2C9MA 2I7TA 2HP3A 4CF6A 2XTMA 5ERXA 1LF5A 2EZTA 3W8DA 4E5NA 4TTAA 2PMKA 5KYXB 3N05A 2LBPA 2V7PA 1KVUA 1N0WA 5AVVA 2LCAA 3BDAA 5H68A 3V7EA 1Q1NA 4NVPA 3THYA 2P90A 4J7CA 2OAEA 1KQ3A 2GCNA 3T7SA 4FK8A 4UOQA 1A7AA 4EKDA 3V2GA 2O1SA 5AKEA 2HMUA 2FWNA 3EGCA 4C07A 4PGFA 4YALA 4WFAV 2X6TA 3MCVA 2FGYA 3O9OA 2DBZA 5E7IA 2AE2A 5TQ0B 2AI3A 3TMYA 2GRUA 1XMVA 3CHXA 3HUTA 4XCVA 1DJPA 1S02A 3R3SA 3P97A 4TS1A 2J9FA 5D51S 3U7JA 2GEFA 3EFBA 3MHSC 2J32A 3DBRA 4NDNE 3ZDRA 1JG1A 2NSDA 1SZTA 4ZHQB 4MLPA 5JDIC 5HDBB 4E4YA 3TQCA 4DN6A 4L4XA 4J2OA 3CRMA 4RY2A 1JX9A 1KVTA 5I8ZA 5BXYA 4EVRA 2DU8A 3ZZTA 3WDSA 4QQKA 2HRRA 3GAZA 1XTRA 5CDHA 4L8JA 1KO5A 4BY9E 2CXHA 4RSRA 2NSLA 3E53A 1SIBE 4EYOA 2FMFA 5I3CA 5EQDA 2H4JA 3RS4A 4YY3O 3WWPA 2NW6A 1IB6A 4GM1A 4M7OA 4NS4A 1FFCA 4JI8B 4XB6B 1OTXA 5AYVA 5GTHZ 1Q5PA 3U5ZB 1XMIA 4U7GA 6LDHA 5LYJA 1GEEA 1L7EA 2XCSB 2X0NA 2ES4A 1JQJC 1XL1A 4I5FA 1D9XA 2CNNA 5HKOA 2BEUB 2F1HA 1ID8A 2BUBA 5LNK1 3TFOA 5KOJA 1V3QE 2JHCA 4PTZA 3OM3B 1R6AA 5K6AA 3BTOA 3E3AA 1Z5PA 3IMFA 3L70H 4K03A 4ZIBA 1PWYE 2XITA 1XQWA 5EWLB 1B93A 3OIYA 2JVIA 4O2BB 3F5DA 2VYFA 2XF2A 4Q4HB 3ROKA 2QWOB 4JB2A 1YI8A 4X3CA 3UOAB 3PX2A 2PJZA 2FPOA 4QDXA 5I7FA 2NR5A 1JEJA 3FYHA 2PJDA 1ZLXA 1P0PA 5IBPA 1BU5A 3NXKA 3LQKA 3PF9A 4QREA 1M6WA 2Y0DA 1VGVA 1PL7A 1C5KA 1A9RA 1RHUA 3EVGA 5K1ZA 2CT8A 2X9GA 3A1VA 2IOHA 4YJFB 4MWDA 4ASUG 1F6DA 4JWKA 5DM2A 4M8KA 2L2QA 4R98A 4EDFA 4H0FA 2XGMA 2IPNA 2IDKA 1W76A 2JFPA 2EINC 3OM9A 3U60B 1PG5A 3IJPA 1W49A 3MM4A 4D9CA 4C30A 4NFHA 2AX4A 1ARZA 5ES3A 5J58A 3D6FA 4U7NA 3D4BA 4YAKA 4WBXC 1TUBA 4Y9UA 2ZF8A 5LD2B 4PV7A 3KSDO 2J0QA 4WEQA 5AJZA 4CCSA 2YOHA 4KLAA 2ZRMA 2A4MA 3TLGA 3BB3A 1W0CA 4ZC8A 4BTVA 2EBHX 2WKRA 3U7GA 3RHTA 3R5FA 1W5AA 5KX5B 1T6YA 4C6HA 1GAXA 1AF4A 1H93A 3V2HA 5HGXA 1NJIW 3K0HA 3IH5A 4L74A 5JS7A 2OCHA 4DNFA 3W6OA 2H85A 4NVRA 3BBLA 3CCSF 3O3CA 5JCJA 3LHSA 1BD3A 3TXSA 4PINA 4BVKA 2BDEA 3SJBC 5CURA 4FM2A 1ZZGA 1IPEA 3ICOA 1E1CB 3FVVA 4JT2A 2F6RA 4FVMA 4DUZO 2O8DA 1OROA 4KE7A 2F9LA 3H2HA 3JQFC 1O97C 4DBVO 4IGKA 3I01M 3ZU4A 3H9CA 3QENA 3AR5A 1T43A 5HRAA 2B1RA 1DPFA 3CP1A 2GRAA 4ND8A 4XFKA 2IZOA 2A35A 3KELA 5F4BA 4OQ4A 3DC2A 4PDVA 4TV9A 1F12A 4DMGA 1RYHA 1YZLA 5GPBA 2G07A 2VTBB 1TQ8A 4XW2A 1X52A 4C0QC 1I7QB 4N5LA 1GZHB 5D5HA 4N9WA 3WK5A 2X58A 4RVHA 2FPKA 3K9BA 4U9IS 4RPLA 2QRVA 2M6YA 2J1LA 3JQAB 5I8PA 3A1DA 5BYBA 1G9SA 2NNLD 4HZGA 4MW6A 4IEFB 2FY8A 3K05A 1X19A 4OHYA 3QLEA 4PTLA 2XCUA 4ARZA 3GNSA 2AV6A 1ADBA 2I2BA 3CR8A 4DRYA 3KJIA 2ZRHA 4FR0A 1SQQH 4MA4A 3EASA 4JDUA 2X7JA 3WLEA 1PQYA 1U0BB 3BHJA 4Q12A 3GCXA 1IOLA 4D4KA 2WEKA 4W4KA 3NH9A 1S6YA 2C7QA 3P9XA 5JMOA 2ZDIC 3GPBA 3RVKA 1GTSA 4X60A 3HAXD 1ZD1A 4NCIA 2YRXA 1Y37A 3I58A 2YCLA 3CPHA 3KQYA 1WDMA 3QQPA 4LRYA 3HKCB 2I7DA 1UK7A 2DETA 4UTVA 4OBEA 3T4DA 2AIZP 2RGUA 1GZDA 4L57A 1XD2A 4PLZA 3IEUA 3K70B 2QX6A 3LDDA 4HFRA 2VHJA 1E1QA 1UEXC 1EGMB 3UO8B 5FL7A 1A4UA 1N32O 1PK8A 1UC4B 3TD6A 2A5DA 2BOBC 3UXHA 3VZPA 4ZRDA 5IDQA 2HPZA 3EH2A 5LLTA 1XRJA 3CEMA 3I4FA 2VP4A 3MTDA 5GJCA 4IHQA 2HLDA 4PLWA 5FUYA 5AI5A 4O4LF 2XNHA 2NTYC 4X9QA 3H1EA 2R5FA 2NVUB 1DEHA 5ENZA 3CSXA 4M54A 4X1KB 4AULA 4EZBA 1L4NA 4PICA 1JLRA 3DV2A 5HMMA 4FYHA 4E7PA 1GQSA 1ZNQO 1NQ3A 3CX7A 2IYAA 4RO2A 2BR4A 4YQYA 4XQ0A 4YUZA 4P0PB 2P1ZA 4ENWA 2DYRB 3L5OA 4EYKA 1KO1A 1OOEA 4PPGA 2ZD9A 3QI7A 5E9JA 1MH9A 4CMCA 1EN6A 3GBPA 5JD5A 1H9CA 5DM4A 1OU4A 5TPWB 4Q9IA 1ACMA 2VAXA 1FQJA 1KDZA 1Q2UA 3D2BA 2H1RA 1GPUA 5KHJA 3DXXA 1CLIA 4KACA 5DEOA 3GJTA 3BWVA 3AF3A 1ZGAA 1GM5A 2JDIG 3HB3B 5KYKA 1OH6A 1H22A 1UBRS 1O5IA 2F00A 1YBAA 1YMVA 2AG1A 3ZCSA 3IMPA 1NR1A 4N5IX 4OQPA 1KC1A 1XRRA 1SHTX 1OFHA 3PHBE 1ISPA 3QXXA 3OESA 1K4YA 3AFNA 3SYQA 4I36A 4NS1A 1XZ8A 2C3PA 3HY4A 1T6ZA 3AT1A 2A1TR 3AG7A 3ASOC 5BMVF 3W2FA 2NQTA 5KUKA 4G1BA 2AFHB 4LZWA 4OHKA 2X8JA 5JCXA 3D6HA 1M1NA 4YK7A 2QZJA 2RGAA 1VI5A 4PBTA 4HN9A 5DYYA 1VCOA 3SYMA 4B79A 4L7QA 3PXEA 4JR0A 3AUAA 4M1QA 1CSEE 2X0JA 1JN1A 1U99A 2QTHA 2C3YA 4ARIA 1SO8A 3DH0A 3C7DB 1QOZA 1V1MB 4IJ6A 2VSYA 4WZAA 3ESDA 2YN2A 1IBLO 1VG9B 8ATCA 1KI6B 3KSBC 2HMWA 1PZFA 3MN1A 3WRXA 3K1YA 2ORIA 1Y76A 4AF7A 4DV7O 3QVXA 3ZWDA 2JVKA 1DEAA 3AF1A 4AG5A 1IZ7A 5L51A 5F5NA 4LFBB 3DJFA 4FOPA 1Q6HA 5FOVA 2ZYHA 1GU0A 1WQ1R 1LBTA 1CEEA 2Q67A 1CJTC 4NSNA 4IIJB 4WXRA 4N3BA 4ZVOA 4YIPA 3HU5A 2DT8A 4I9QA 2NUAA 1NYLA 3WB0A 4KO2S 1GK9A 1NVGA 1X7YA 2PX2A 3N86A 4ND5A 3LFTA 2IOQA 2G9IA 4CMKA 1S8AA 1WSAA 3LWDA 2CJWB 3UK6A 4HNQA 4YBZA 1V16A 2ZRIA 3UOWA 5I48A 2PMPA 1U2ZA 4F71A 4CTOA 1PT8A 1C1HA 4R31A 3IKEA 4RADA 5K45A 4DBLE 1AZLA 4UPDA 4AKGA 3IJ4A 1VQOV 4QSMA 1N6IA 3BMNA 3JS5A 1R10A 2L69A 3CNNA 3COYA 1NRWA 4GOJA 2FR1A 3RFFA 2HRCA 2HYIC 2AL7A 2QD1A 2WMNB 4Q9DA 5LXTA 4DQUA 3MIZA 4BO7A 1M0TA 2R0QC 4N49A 2LW7A 1KE1A 4OJMX 4JGIA 2HU8A 1PZMA 2W8ZA 2WTMA 4YRNA 3VTKA 1GGEA 2XUDA 2OCAA 3D6NB 2FB9A 6YASA 3I3SR 4KDCA 4DZRA 3NFYA 3LY5A 3WYCA 5PNTA 2P3SA 1NJ2A 2MW2B 3KB1A 2Y3IA 4CKEB 3EGXB 4MW0A 2J5QA 4OSPA 4WN9B 3L7MA 2GS9A 2WKQA 3VYUB 3D4OA 2QMUA 4L78A 4QFDA 4FS3A 3SYNA 3TCUA 3AG2C 1H4VB 1KJ8A 1N1DA 2IX3A 5I4KA 2PLAA 1J5EB 5CLFA 1VJ0A 2R8RA 1G291 2CBZA 2QTZA 2NZVG 1QKIA 3GJ3A 2DFLA 4LF9O 2OHVA 1H65A 2PZFA 5HFJA 5B5EZ 5BQ5A 3VH3A 1E3QA 5CVEA 4EY7A 1LSJA 4ERHA 1RQ2A 1A8UA 2VL7A 4KEAA 5DI3B 2O20A 4D74A 1H85A 3OEEG 5AWFC 4HUJA 4X54A 2XSZD 2Q9BA 2OGSA 3GD5A 3VNAA 3DULA 4KWHA 3RI3A 4PG4A 5DHPA 1SUIA 5JWRA 4O2AB 1LV7A 1AXGA 4NB5A 3MTGA 5HNKA 4E1VA 5JZBA 2GCPA 5A5DA 2YHIA 2E18A 2HP0B 2R3SA 3EFEA 3W6UA 3KE9A 3QPBA 4WADA 2QNRA 2WV9A 4CYMA 1I94B 3FLBA 2QKYA 1RWXA 5FWXB 3EBPA 2CW5A 1NQWA 1X3LA 1T2EA 2GZ3A 4C7OA 3UB2A 4UUNA 2V54A 3S1AB 4Q3AA 4L8VA 1FSZA 5J9FA 2P7TC 3CX4A 5C34B 1USVA 4LZJA 1NWCA 1WUKS 3CH7A 1Z4MA 1N9KA 2AFIE 3M4ZA 3UAZA 2MYNA 3PXBA 3FSJX 1E2GA 2F17A 1VQ8V 2Z9CA 1ZK1A 4CLRB 3VBBA 2G88A 1GV1A 2A7QA 4G5SA 4RA6A 3NANA 4FGUA 3DL7A 1IDSA 1GNVA 2OGZA 1U1EA 4ENRA 3PNVA 4NHEA 2OCCC 2J09A 3DFZA 3K09A 4DR4B 1HWYA 1MPTA 2RH8A 2E74B 3H04A 4B6SA 3OJFA 1MXHA 4DDKA 3DBVO 2PQ0A 2CC2A 3CNQS 3QPAA 1NZJA 1NVMB 5IYZF 3UCSC 1RFLA 4PZYA 2WPDD 3RH0A 2GTAA 1Z3IX 3VUEA 4N3AA 1V4VA 2V9CA 1NQVA 2D7JA 4ZOBA 2D3WA 2K9PA 3VIUA 4BGVA 1YA8A 3I92A 3T2MA 1MO2A 3KIPA 1GGHA 1W36D 3TGWA 3AUUA 4EY3A 4DLTA 2Z8ZA 2JJ2G 2YYZA 1FRZA 1ECLA 3HVJA 4E5VA 3L5KA 2QVXX 5DX0A 2RK3A 1IN5A 1E69A 9LDBA 2J33A 3KZXA 2XA1A 3Q7IA 2HNKA 4Q4AB 2H4HA 4RFLA 1VH8A 4PAWA 1HYHA 2ZXWB 3A70A 1P1JA 1MU0A 1EFCA 3SEQA 3DTVD 3GHZA 4NZ9A 5HK9A 1Z75A 2XVYA 4X90A 4EHFA 4DWOA 4I9UA 2R6CA 1ADGA 2V7XA 1T2FA 4GE0A 5EY5B 2QTRA 1QNLA 4HGPA 3BX1A 3OCYA 4FEYA 3DGEA 3OGCC 1SB9A 3FZQA 3TOVA 2HSJA 3QKRA 4MROA 3FTPA 3URMA 1BSMA 1DQPA 2PX5A 3RJZA 5GONB 4WY2A 3I2GA 3GLIB 4RGQA 4RK5A 4QJ3A 1SAYA 1RAIA 2ATCA 3SKYA 1R4NB 5D85A 5AJUA 1T8YA 1N8RH 4UTXA 5TIIA 5M04A 2RJOA 4YMGA 1PL6A 2QM0A 3O8OB 3UICA 1N34B 2FSHA 2GV9A 3GDOA 3T5PA 3FUCA 4TXHA 4F11A 5IYBO 4DJ5X 4GRIA 3A4YA 3KYDA 4OGKA 1E2QA 1CP2A 2ZZNA 3WLMA 3E8HA 4JJ4A 2F1OA 2NU7A 3B7GA 5A6VA 1ZOSA 5AW2A 4ESHA 1A71A 3QLJA 4C9BA 4X89A 1T34A 3QHDA 1SXJD 1WMDA 1LEHA 1NXWA 1Z26A 3VMFB 2QYSA 3AG3C 1JKJB 2AOTB 2C88A 3F4LA 4TQ9A 4E94A 1W2HA 2YV5A 3OOEA 4XEUA 2YIVX 3A0UA 2CBGA 2RGEA 3CUWA 4ZKIA 4M1MA 2QKSA 2ID9A 3A4IA 3VPAA 3LWRC 3K8YA 2YRWA 2C2GA 2DBYA 5FULA 3K5IA 4F91B 4JNCA 1BYIA 2VT7A 1MBZA 4Z9AA 3FDFA 3M9LA 1UBGA 4YHBA 5IYDO 5IEBA 1VB5A 1YMUA 2ZI5A 1A32A 1S3IA 2WJPA 3TGPA 3OM0A 4BFUA 1DKMA 4IHJF 1N5KA 5HF9A 4CL2A 4CWAA 2XVMA 2OCGA 4FDTA 3GGGA 1YIAA 5B2ZA 1V5WA 4BX2A 2NP6A 2XE6A 5IT9A 1P0IA 1IOVA 4R1NA 4QNMA 4QULA 4FFPA 1PFKA 3WK8A 2R72A 3ABMB 3NBAA 3WLTA 4NULA 4DA0A 4E5YA 2ZS9A 4R2JA 4DIKA 4RHXA 3LKZA 1QP4A 5JNTA 4BWFB 1QGAA 2FZGA 4PLYA 2P35A 3TN7A 4G0WA 1M6EX 3LYBA 1NSFA 5FBVB 3D36A 4XM1A 2Q2NA 3AR3A 3GFPA 4HJXA 2RK6A 1EE1A 1K63A 1GA6A 1JH9A 1S4MA 1C9DB 3DMRA 3ZTYA 4V38A 4KUEA 4DT1B 3BTUA 3Q2KA 1FNBA 3A1FA 2I1WA 1JA1A 3IP9A 4YPOA 5EC1C 3ZLBA 3WS7A 1N8NA 4R1MA 4BWGA 3T9AA 3AV3A 3GD7A 1E0AA 1VJTA 1T9GR 1XPJA 4NTWA 1AHPA 4TQAA 1YZNA 1MORA 2ZCVA 3O6VA 3UMYA 2EOAA 3WYGA 4UXJA 2H08A 2YXDA 3GIDA 3DOFA 1IWBB 3AL2A 4G5XA 3DXRA 1WCIA 4AUMA 2JEOA 2V7BA 2IPAB 5T41A 1BX1A 1JAZA 1USWA 3EA5A 2XZOA 3B6KA 3ZCCA 1PZXA 4M9ZA 1E4EB 3T6KA 1DT5A 4FQ5A 2WKPA 3V1TC 4J7XA 5G4LA 3RYIA 3WLNA 6Q21A 4HNAB 2XXAB 5IAGA 5EP2A 1KI7A 1POXA 2P69A 3W4JA 5E4TA 4BNLA 4BT6A 1RPNA 4BVRA 2CUZA 4YJ3F 3L46A 2P30A 4W8OA 2CHVA 4JT4A 3VTZA 2PZAA 3AGKA 1MO5A 3NHYA 1J8FA 2AC4A 1Z2CA 2BBOA 3U62A 4DMUB 5JWPA 1Z4JA 1ZM9A 4J11A 1P31A 1QGED 4UHEA 3ELUA 5L8VA 3DLAA 3AY0A 3GF4A 4BBAA 4EBFA 1QYXA 2O8CA 1GHTA 1UBEA 4ZZ1A 3TPFA 1AR5A 4KDFA 1UXKA 3T4EA 5HF8A 2ZCEA 1JWLA 4MUFA 4KI7A 1W30A 2N75A 2BUAA 4UARA 2W00A 2G83A 2ADMA 2FRDA 4A0FA 1H47A 1J09A 4M55A 1VPVA 5LP6C 4DXHA 3Q9UA 1YR8A 3JAKB 5HP8A 3IKFA 3ZN2A 1TTHA 2ZYAA 3MFYA 1O7JA 1H8HA 2EJRA 4TWKA 1KARA 1JTVA 1M5UA 2MHCA 5TQ2B 3L1KA 2JFVA 4MVJI 1P4GA 1FFYA 2CL7X 4AY4A 4JYPA 3R3HA 5I45A 4B4DA 4JXKA 3GVMA 1CJMA 4EKNB 4PQFA 2BTQB 2WAOA 1I5YA 1Y1KE 1JDTA 5ADHA 2PX3A 4ENPA 4BFYA 1LC3A 1ADFA 3QPWA 4DXAA 3AUYA 5AJTA 1M4UA 5HR5A 5JBIA 4MRRA 4GZLA 1FP2A 2HHAA 2G17A 1GSIA 3UAYA 3UFXA 1LF0A 3JR7A 3BXXA 1DAGA 1T15A 4H7PA 2D5IA 3RTAA 5LZ8A 3ZE9A 1WBJB 4WCFA 4OP1A 1I4DD 3NGXA 3ZE0B 3M4NA 5EZQA 2J0SA 3Q12A 2NAPA 1EXMA 2PRSA 3L8CA 1GCAA 2O3RA 1E20A 2LIPA 3DBLB 1N1GA 3HP1A 1UFIA 4UCWA 1O57A 5F1OA 4IJ5A 3W5HA 3C3CA 4WK2B 4M38A 3PFKA 4LJ4A 1SRYA 4A1OA 3ZWNA 2ZYIA 3DVLA 1N6PA 4NU0A 3ZWVA 2DYSC 3TLEA 1E5XA 4QRDA 1RBYA 3W6ZA 5BSFA 1ZEMA 4A91A 4MWGA 4TZZA 3T4UA 5HIKA 1DMSA 2OKGA 1K33A 1ST2A 2FYTA 4QU9A 3JAMA 2CHTA 4GKKO 3L7IA 3GBSA 4C0WA 2DJIA 3CW9A 2CXNA 1RADA 1U7OA 5JTTA 3CVOA 3BTVA 3AFGA 3Q11A 4DR5O 4JDPA 3PWZA 4RC9A 4OGGA 2JD0A 4GD3Q 5AVUA 1EHIA 1HT0A 2UXNA 1U2EA 2B20A 2Z0MA 1WLEA 1YOVA 4AO7A 5IPFA 5GTDA 2EL7A 2XUPA 1PGNA 3AHJA 5FWYA 1J2UA 4CV3A 5A7GA 5CG1A 4Y2YA 4TTSA 3EW7A 1MIOB 1CE8A 3KL4A 4NTZA 3J7AR 2XHZA 4HT3B 1NW4A 1HA3A 5IK2D 3AUXA 4Q1AA 4QXQA 4EY5A 3VI4B 3G6EF 1E79G 4BTEA 3RYHB 2H1OA 1XI2A 1U65A 2FETA 4BO2A 3WFVA 4MV7A 5J1TB 2GZMA 3VH1A 3KPYA 1WXHA 3ICEA 1KIMA 2ZJAA 1CJCA 4U0JA 2OCBA 2DN9A 4HYEA 1P4JA 3H1JH 2CH7A 4LF7O 2YZKA 4YQEA 4II3A 1VQLV 5GIOC 3C85A 4D9BA 4U7JA 1EVJA 2YWEA 4FUTA 4E0BA 4F9FA 1S4QA 2FW9A 4KIUA 3OUSA 1E2PA 2BGNA 1IBCA 7REQB 5DHAA 4NF2A 1CLUA 2D5BA 3LWQC 2Z1NA 1P1IA 4BNNA 4PLTA 2QMEA 3ZHSA 2V7QG 1QGZA 3WB2A 5DB4A 3JWHA 4YWJA 1AJPA 1G4UR 1Y4SA 2ZETA 2GZLA 2HQ1A 4ZAFA 3RA5A 3PKIA 1OZHA 4FLTA 1JJ7A 1KVRA 5G2OA 3ZCPA 3FE2A 3ZE7A 2FR8A 4V3BA 1GSOA 3EDQA 2LFRA 5ICGA 3HSKA 3H5VA 3PX3A 2GDZA 3EAFA 4GAEA 4G4YA 2WSSG 5GQSA 3SFVA 1UBNA 3NGMA 2ZG6A 1EUYA 1E9RA 3EYAA 2FF5A 1XJ5A 1RM4A 3UGTA 1WETA 3VR4H 4C3OB 3DOEA 2XQIA 3QPDA 4XSVA 2IW3A 5CB4A 2NG1A 4Q4CA 4Z1MG 4PWYA 3LJKA 5CD9A 2V6JA 4G07A 3LSYA 1VCMA 2MTBA 1B0ZA 1FFBA 4RIFA 1VQOF 4URFA 3OAAG 2G1JA 1T9CA 2ECPA 4L0CA 1HGXA 4CODB 1L4BA 2H9IA 4XDHA 3WADA 1KD1H 1U6JA 3OPYB 4XD7D 3ENVA 2NVBA 3UG7A 3DCNA 3GJ4A 3ON5A 3C2QA 4RJLA 5GZ6A 4FFBA 2IHZA 5MN6A 5LZ4A 4GX2A 1Y7TA 4OG2A 2C4TA 3QW4B 5C7OO 4BLWA 3UTDA 2F8LA 3D4LA 2WF7A 5KNBD 3SS8A 3WGIA 4WZZA 3G8BA 4K6KA 4Z6KA 3G5UA 3G8DA 4AY5A 4C6TB 3U7EB 3ENKA 3HV0A 2WINI 1ADYA 4I8XA 1ADCA 3MXTA 4PDMA 4NABA 3SSOA 3TLJA 2YJNA 2QDKA 4YXWD 3MMXA 1T4MA 3WNCA 5TNXA 5C8YA 2XYQA 3STVA 3C0KA 1BX0A 3CLKA 4JJEA 4NBTA 3IALA 3D8BA 4U39A 4WRRA 1AGNA 4I81A 2ZJOA 2DFPA 3PWTA 2PZKA 1EP1B 1WXEA 1FFDA 3KUCA 3RWOA 2GZDA 3QEKA 1VBFA 2O1WA 1KRXA 4ZGBA 2AG8A 4KQFA 3OCJA 1BAPA 5EK0A 1E6KA 3DAYA 5BQPA 1E9VA 3F2IA 4LWZA 3DUFB 1RCTE 3CUTA 3N6RA 1NBIA 1ZJJA 2OBXA 3JPYA 3CZAA 3TIFA 3RIMA 3IAM1 3KG2A 4LXIA 1Z0UA 3FRJA 1XCJA 3N8NA 2HMVA 1XYGA 4KFSA 2G9NA 2CVHA 5KCZA 1W36C 2VHUA 4DNXA 3DBHB 5HRCA 4ZPJA 4Q7KA 3OLYA 3NH6A 1LLQA 1WF6A 3L0IB 3AXSA 1RIFA 4DIOA 5CPBA 5DN6D 4MEJA 1E3SA 5BW4A 3OZAA 1EQUA 1L4HA 1PT7A 4LF8B 3CG0A 3CVJA 4GMHA 1RLMA 4US0R 4C03A 3PPXA 2Y1CA 5DGTA 2OIEA 2ZJ0A 1ZJ4A 4RY0A 3SIXA 2JJ1A 3KOUA 2QDOA 1VQ8F 1SEPA 3SFZA 2H06A 1V26A 2SKDA 2Z95A 3SC2B 1WMEA 5I5EA 1K4KA 3PITA 1P9NA 2C7VA 4DV6O 5FWNA 1N2EA 4DYDA 1T8RA 2O8BB 1KBHA 1UM9A 2JFWA 4XCQA 4AHCA 2GLUA 3QTCA 5BVGA 4AJOA 4R3UC 4EAAA 5FB3A 3UHAA 3SK0A 4ZI5A 4F46A 4FSHA 2IS2A 1GTZA 1ST3A 1SZXA 1Y4AE 3CIFA 1J42A 3B48A 5TLSA 4J29A 4KE6A 1RPZA 2HEGA 2FVYA 4S1WA 4CE6A 2C54A 3WOHA 4ASUA 3WI7A 4RPJA 1VJCA 3H05A 3ZJVA 2HY7A 3IHLA 4D81A 3N53A 2WK1A 3VU9B 3DPIA 1EDZA 5JS8A 1W2WB 1S3JA 4KK3A 2RJZA 5I9MA 4RQAA 1J0BA 1SXJC 1NAHA 3O03A 1JHMA 1L5LA 2HIHA 5F3WB 3SJAA 2BFCB 3R0IA 2QTSA 5CLLA 4ZU1X 4PM4A 5ES4B 3SC4A 5K6RA 2RCYA 4DB4A 3TLAA 3FUVA 2COUA 3H19A 3L75H 2OBFA 4LJ5A 2VWQA 2V6BA 3I37X 3KKKA 3SZGA 1EM8A 2IA5A 1KJYA 1ULBA 3P26A 2AKAB 2QM7A 3ECSA 4A4DA 1KQPA 3W7UA 2XDWA 3NR2A 4AZVA 3Q3EA 4MX8A 1JEQB 2J3MA 2O1EA 1EVEA 4OFBA 4R2KA 4A10A 3A27A 1R1DA 3GIWA 1LFAA 2GEUA 3MJCA 1OWMA 2PYDA 5AESA 1W87A 1E99A 3LCCA 3UWSA 1RCFA 4MR8A 4F3KA 3DE2X 3OUZA 1I5OA 2Q3DA 2EJUA 1BGXT 1TAUA 2I4OA 2DMXA 1JEYB 4YT2A 5KAIZ 3O31A 2VA8A 4P6VF 3EWIA 3HVKA 3WFJA 3RYFB 3KETA 3H5NA 5CH5A 1Y8ZA 3QMPA 3TAUA 3MWEA 2Y77A 1LJUA 2AK2A 1H2AS 5DT2A 2CV0A 1HQCA 1HXHA 1C9JA 2W2LD 2XDQA 3SLGA 4CPDA 1SC1A 1JYFA 4DV2O 5SYNA 3BPSA 3FMVA 4G4VA 1V7QA 3DD5A 4NY1A 1E3IA 4P7BA 4L85A 3TVDA 1KY2A 4HFMA 1YCHA 5D8DA 3IDQA 1L1RA 1RM1B 2FYUH 4UM9B 3FX7A 5JR3A 3H42B 2OQ2A 1HETA 2P5SA 3DC5A 1E0SA 1XEAA 5K3CA 1I30A 5TDHA 4WKGA 1F1BA 4QIHA 1NULA 2YHBA 3MTEA 3PLRA 3RTEA 1MMFB 5MN5A 4W5JA 1WB4A 2W0MA 1P61B 3ND9A 4L28A 4BP1A 4FHFA 1UXIA 1R3UA 5B64A 4GOMD 1RP7A 3D6MA 3WGNA 1UL1X 1OVMA 1URFA 2BY4A 4HVLA 4X97A 4NZPA 2QXTA 1J8MF 2YMLA 5CTJA 3IB6A 4NH0A 1RXYA 1NVPD 2O3JA 1F1JA 1E2IA 2OO3A 4R2WA 4AX4A 4AIRA 1PLLA 1V8PA 4W5OA 4CEHA 5BUZA 4FFSA 4MO9A 1KY4A 3MB5A 2AHZA 4ZFNA 2AUTA 1VIMA 3DT9A 4I4IA 2WF9A 3RDPA 4R8LA 1JUDA 1YL7A 2VXBA 5E9QA 1DAPA 1E7RA 1JILA 1ZM3A 1XNQO 1GLNA 2P4KA 5IAOA 3ZI0A 2VFAA 4URUR 5JVDB 1SUDA 2Q7OE 2RNBA 4A16A 5TJ9A 3WOVA 5HF5A 4P3NA 1Z4NA 2BLLA 5SV2A 3TL6A 2NVWA 3FUXA 2GI4A 3KVOA 3GUCA 5KYUB 4QYTA 4EVSA 1FLAA 1SVSA 2A58A 3ABUA 3EVNA 4TXJA 1LDYA 4M98A 4XGKA 2AEEA 2E4YA 4ZI2A 3GPIA 1OXUA 4ZHSA 2CDNA 3QWFA 3WYDA 2QW8A 3DHWC 4R8SA 2GN1A 3K20A 2REBA 3GELA 3U49A 4N48A 4QYXA 3MBIA 3O21A 4D9GA 2I76A 1P1FA 3KCQA 2VAMA 3H2GA 1N2BA 5KYWA 3M1LA 4DIUA 3U4IA 3RNOA 4F06A 4RIIA 5I8WA 1OV9A 1J90A 3SZLA 2OOSA 2H5IA 4I4CA 721PA 2MMCA 1Q7EA 4KFCA 3H2ZA 5D1NA 4UXNA 3REOA 4N21A 4KKXB 4EJ2A 3LUAA 1E2HA 3IT2A 4Y1RB 3NVKE 3W8EA 2HM7A 2O0LA 2IU3A 4KHPO 2DFVA 1P8JA 3TM4A 1Z0AA 3TSOA 3BUSA 2A9VA 2CE4A 3CZPA 1TYBE 2A1UB 1WUHS 1I1QB 1TMYA 2UYGA 4DPLA 4HYOA 3A6DA 2JDIA 4D3SA 3FYUA 1KY3A 4RVFA 1BC5A 1IZ8A 1LBHA 4XGQA 3TOSA 3HXLA 4MUBA 3M4JA 1NHGA 5CFNA 3ICVA 4B4KA 2NXEA 1LUWA 1KBOA 1B1CA 4KPGA 4EVIA 1YK0A 3VVMA 1FMFA 2XKAA 5CVTA 3AY6A 1KC3A 2YW2A 3IODA 2GN9A 3Q3JB 3TNDA 1QGYA 2HDHA 2ACKA 4MUAA 2NUPA 1XL4A 4D9NA 4ABTA 3FR7A 1A8IA 5G0VA 3FTEA 3OZWA 1JDUA 1JQ5A 1L5KA 4EA8A 2DPHA 1L1FA 4CQMB 3PUZA 3AIKA 2GZ1A 1JZTA 3ANXA 4QECA 5BOSA 3VOUA 3I32A 3BORA 3TW4A 4XGRA 4GKJB 4OPHA 1HG1A 2WT4A 3AZQA 4YGYA 3A9UA 2EIMB 1F7UA 5HBRA 4IKOA 4DUGD 4TYWA 5J1SB 3LLMA 3NDRA 4IV8A 2WIFA 3DWGA 3CKYA 2PZLA 3TW8A 1I4OA 4MKHA 2WFAA 3A31A 1C1XB 3PNPA 1JE0A 4CI9A 1FX0A 4BJ3A 3EDOA 1DQSA 3MMNA 4WVLA 4M4SA 2R8BA 1J2JA 4RESA 4IDQA 2JS7A 4DTCA 3RD5A 2EJTA 4MVCA 3S2FA 4LWOA 1B73A 4FZJA 4PZAA 5BSWA 3O4IA 1YAJA 3RG2A 3PC8A 3AUTA 3VC2A 1IIRA 1YJXA 1IXKA 1GG8A 3UYLA 4QGPA 4FEEA 5LU9A 1FFXA 1FXKA 4O1HA 4S05A 1NA5A 4GBED 5COQA 3KTFA 2JLBA 1D1TA 3V2UA 3KDAA 3OQIB 1N0HA 4HNSA 3GLKA 2K4MA 2E1PA 5DSTA 2GDSA 1NVEA 2XQFA 2ISCA 4G37A 3IX7A 3N2KB 3BKWA 1LS1A 2X1LA 2RHJA 4FNAA 5HFAA 1M1KW 3TZBA 1HT2E 2PKXA 3HYLA 2JGFA 4EHBA 1EM1A 3JVEA 1RACA 1T0JB 2P6OA 1S9DA 1W19A 1W0KG 4XQGA 3E9ZA 2QG4A 4PW0A 2Z1EA 3Q8WA 2QMOA 1U97A 1NTOA 2PT5A 4A7PA 1L8QA 1FYEA 3LKBA 1D6JA 5JTUA 3WSVA 2QSZA 3R0XA 2XMDA 2X7RB 4KPFC 1XCOA 2ZB4A 3AEKB 2FN9A 3U56A 1A4XA 4F3NA 4G5RA 4LBVA 4DW8A 1KEZA 4GKKB 3WO1A 3BIJA 3NATA 3F46A 3BXOA 1V55B 1VL2A 1QPZA 1LNSA 3EXIA 5J40A 4CCYA 1D7AA 1MB2A 4JC5A 2EDCA 4MS4A 4MMZB 3LOUA 5JSYA 5NULA 3ROZA 3TOZA 1CR4A 5CX1B 1KZ1A 1R4ZA 4RA9B 1NLYA 4JVMA 1YFLA 1T5HX 3V8QA 3ZNPA 3TEJA 4R1PA 1JI3A 4LWSB 4QDZA 4YBRA 4Q6GA 1ISGA 2VEOA 2GUWA 2BVNA 4V0RA 4AJLA 3DLIA 4CHTA 2OENG 4DF3A 2UYOA 4UHFA 3WLSA 1OI2A 4QDKA 4IMJB 3WBBA 3QG1A 1NVAA 4MP6A 1N77A 5EJ9A 1F0NA 1QU2A 1V8OA 2HRYA 3OEEA 1WV0A 3MWDB 4LHXA 4QDOA 1SKVA 4ZQBA 3BJEA 3KWLA 3QEMB 4EITA 2G28A 3KAKA 1JR3D 1ZGBA 1VQLF 2H9YA 2E76B 5BURA 3AGQA 4AL4A 1QHXA 2V8BA 4OBXA 1EU1A 3KSUA 1R15A 1TKRA 1KFKB 1I2CA 3OZTA 2E75B 3O3NB 2HO4A 3WGJA 3ZXUB 1G7TA 3H2JA 3HU2A 4G5FA 3JWGA 1GPNA 3IP6A 1G3RA 3INTA 1VLQA 5F9FA 4J2HA 1CUJA 2AZ2A 2YWJA 3ZWPA 4P4NA 2C2KA 2ADQB 4GZMA 1GTG1 3V4DA 5G0SA 1WG8A 4E70A 1RD4A 1X9HA 4YLGA 4I3HA 2JIDA 1X15A 2HIMA 3AL3A 2H1WA 4Z4IA 1M9NA 5HY1A 1R5JA 4JHXA 5K0CA 4KV7A 1TU4A 3GAAA 3GLGB 1UKYA 4QAJA 2HR1A 1JFSA 3HTNA 3DAOA 3X1XA 1P7VA 3U3MA 3HLTA 2OKCA 4YR9A 1EG2A 4HWPA 3K9FC 4IV0A 2YVQA 4YDSA 4EL5A 1D2EA 5AXCA 4CIYA 4BS9A 3SF8A 4P82A 1LJLA 2CLFB 2JJ2A 1POWA 4X9XA 3U17A 2P62A 4YP6A 1GM9A 4N8EA 1UDXA 4EKEA 4D9IA 4B6RA 1BH6A 4MVJD 2XOKD 1N2CE 4M60A 1T3SA 1XUQA 3LU1A 5F23A 3C90A 2ODWA 4NQ3A 1Y5MA 4U3FH 1QWSA 2XGGA 4KNYA 1X59A 2IHVA 3COZA 5TJHA 2ZPUA 1WMSA 3VPHA 4RQEA 2PSJA 2X23A 4MZXA 2MIIA 5KWIA 4L5JA 1NU6A 4KFMA 2ERYA 1H7MA 1O58A 3F5FA 2VZLA 2XVAA 3E9RA 1DCTA 1YQXA 1D0IA 1Q15A 2AFRA 4KDEA 3V4OA 4WACA 2V6FA 3W2IA 4X1IA 1C8BA 4UV9A 3EXHA 1IRXA 2LCQA 1QMPA 4DR2O 2VPIA 2BGRA 4Y6QA 3MRVA 3MVEA 3EDCA 4J1TA 2G25A 1TNDA 2EZ9A 3TCNA 4BNMA 4ZC1A 2YVAA 1HM5A 1GAEO 4KSYA 1DIBA 3OIDA 3EIEA 4K9RA 3K1AA 1B2LA 4RX1A 1YS9A 1SEVA 2JFBA 4U6NA 1HLPA 1XPRA 3I9MA 3LLUA 3BZBA 1L7AA 5DGHA 3OWHA 4ENVA 2C4WA 1ZIPA 3A3OA 3ONWA 1AH2A 3EVFA 3R8FA 4U5XA 3WMFA 1XIVA 4RF3A 3X1ZA 5JSFA 2VK2A 3EMVA 1VI2A 1E4OA 1NMQA 2FMLA 3HK2A 1UJ5A 3KKNA 1EB9A 4JT8A 1G8PA 4TT8A 1M6NA 1Z5UA 2J5KA 2KQUA 1D4FA 2KB1A 2YTZA 2I1QA 3IIIA 3TE7A 2OBNA 3UC9A 4TV9F 2DCUA 1R37A 3G6EV 1WXGA 3TVTA 1PS0A 2WZDA 3ITNA 3CBGA 3ENWA 1FDWA 2OV1A 3VVCA 3GEMA 1U94A 2QX9A 5KREA 3L0CA 2DTDA 1J8DA 2WM3A 1TYAE 1HEUA 2R2AA 2VQFO 1KYQA 5AQ1A 2YJ4A 1Z5NA 4D92A 4NTXA 1TC2A 2DPLA 2HAEA 1FS5A 1DCMA 1XCLA 3NDJA 5AXDA 4FHZA 3ZK8A 3E3OA 1NVKA 1G8JA 4ZVSA 4KL8S 4CN9A 4C3VA 1K5HA 1HFWA 2XAJA 2H1VA 2Q5LA 2BTUA 3ROMA 1VHQA 4DLUA 4FBLA 1Q0LA 3M82A 2ZE6A 4DV6B 3H9JA 2W2PA 5CFLA 1KSHA 1PUXA 4R0VA 4RVDA 5I9TA 4X3PA 3QU4A 2CFSA 3VMMA 2O6HA 5LBUA 5UKDA 3AR7A 1RWPA 1SCDA 1O6CA 2OZPA 4MR7B 1B23P 3I04A 4QEDA 3R3XA 3G80A 2GAIA 2R11A 1XTTA 4QYIA 4H6PA 1A9ZA 4CF7A 3LTNC 4N8DA 4BT5A 3S0HA 4QRIA 2KYRA 5JD6A 1NWHA 3T61A 1M56C 5CB6A 4RFSB 1EFVB 3N70A 1QQCA 3OICA 3MHPA 5ALFA 4GI2A 4YPVA 1TTPB 1T1RA 1M1ZA 3D4PA 2VH2A 4QLBA 1ZK4A 1P5FA 2RGYA 3EUFA 5EWMA 4PHZA 3C3MA 1HFKA 3FUTA 4RGVA 2BKLA 5HOQA 5GW7A 5GM1A 1E1RG 3PG5A 3DAHA 3AKDA 1BMFA 4BIUA 4GYJA 3ZV3A 4KXQA 1VQ1A 1BA2A 4CMHA 3HZHA 4A3SA 2OZLB 5E4JA 2C9CA 3LPDA 4K28A 3D31A 3E8FA 1AZWA 4I50F 2GPNA 3I53A 4NZYA 4QWMA 1G2QA 3NM6B 4JAAA 3FFAA 3DXFA 4WBNF 3VV2A 4WTOA 3WLLA 1LR1A 4ZTUB 1FK8A 5E8JA 4Y18A 2Z4SA 3SGIA 1MOZA 3MJVA 1U8UA 1F6BA 4RXTA 4JTAB 2FJPA 2IXAA 4G86A 1IN7A 4OOEA 2FQYA 2V8OA 5KNDA 1C7JA 1NX6A 1N5MA 4PG6A 4D0LB 5FNVB 1USKA 4OF4A 1SQBH 4DEXA 1M1UA 4HWOA 4GYYA 4JMLA 4OAQA 1LCIA 3FI9A 1ZOLA 1JYEA 1YE3A 4IXDA 2MINB 2H6LA 5A5VA 4X6YA 1PAUA 3QFSA 5CAEB 3D8TA 3C1OA 4OATA 1Q7BA 5J4KA 1GQOA 8GPBA 2H1HA 2NO7A 4P36A 1GUYA 5DXJA 4DV2B 3LC2O 1NRJB 3LUGA 5LUBA 1FA9A 4OX9Y 1K4DC 3U16A 1I9CA 4YFVA 1CFZA 1S8FA 4NV1A 4XRGA 1AKRA 1PR2A 2QAGC 2O7VA 5L4SA 5BY1A 4U9HS 3OW2U 2V65A 4RF5A 3SDBA 1HE2A 1KYTA 2ECQA 1MRSA 4J0JA 3ICPA 5LM3A 3I34X 4DV5B 2G4VA 4YCAA 5CBPA 3PEVA 1SUFA 1LK0A 2VQ3A 4IQ0A 2Z4TA 4UBIA 1E7MA 2I55A 4JI1O 4QO8A 2LZ0A 3KFVA 3DTTA 1F9AA 4A2QA 4TYPA 2BFNA 2G36A 3RABA 4Z9XA 1SBIA 2UYPA 4M9SA 3D8RA 2AG0A 2D13A 1EZZA 3BFJA 1UMCB 1W85A 3S0YA 1XZBA 1EXDA 4F7WA 1GZ5A 1TQ4A 4OQDA 1UZAA 2QTWB 4G89A 2PRZA 1P5JA 4YAGA 4G0PA 4COOA 3MGAA 2J3KA 3HO6A 1HDEA 4IEEA 2NXJA 1AUXA 4ABYA 1GOTA 4HNTA 4JS0A 1MG1A 1XNQB 5CA1A 1R0KA 5IP5A 4PBSA 4DHEA 2O48X 3W79A 3ER6A 1B0AA 1I7NA 3A1NA 3FPHA 4PO3X 2HMSA 3EDRA 2X2OA 4IVRA 4AMYA 3B82A 1S89A 4D80A 1Z63A 5F2NA 1QLEC 2WSLA 4GSKA 4HDSB 4CKWB 5LL6P 3EZXA 4R69A 2A9RA 5SICE 1P0QA 4FDMA 5SY4A 3D4IA 1OV4A 5LGTA 4R83A 4TYYA 3DF9A 2QYOA 5C3UA 3KQKA 3I3FA 4NH4A 4C78A 1BOOA 3DE7X 4GEKA 1E2JA 4G88A 5DEDA 1BRTA 1Q1QA 4N5HX 1GZ4A 1SC9A 2VQ6A 2AKEA 3OETA 3FH0A 3ICQB 4J3NA 1MJHA 4YRMA 3FCCA 3TBFA 4B5KA 5DYNA 4DSAA 1ORWA 4KNWA 1T3ZA 4ZO8A 2E5LO 1R8XA 1KYIA 1DBRA 5CIWA 1D5AA 3FROA 3KV3O 2FWPA 4IIXA 4KHPB 1L5GB 3TIIA 3RF7A 1DTEA 4LV5B 4B6JA 3STTA 2Z3YA 4LN1A 3SVTA 5LBIA 1T9ZA 2WTNA 5EP3A 2VF2A 4BNZA 4G0ZA 4DY6A 4ZVTA 3JQRA 1RPAA 5B6IA 3RS5A 4H2DA 1P29A 3E4CA 4WE3A 1SU6A 5DCLA 1WA8B 4L4RA 1RSOA 1V5FA 1XROA 2AG6A 1OIVA 1Q17A 1U3GA 4X63A 1XVTA 2OY0A 2HG5C 4R7ZA 2OPBA 3RVNA 1E7YA 3APQA 4DXWA 2IHTA 2Q21A 4IIDA 3D3EA 5JNLA 1E79A 4B46A 2YUTA 3K94A 3DOUA 1GNQA 3T3NA 1VQ4V 3ZZUA 3MLEA 1DKPA 2KGWA 1U0GA 2IHUA 3BWEA 3UK0A 4RZ3A 3TQHA 3DLCA 3QZUA 5HTKA 4QG7A 5GV7A 2M1XA 2GLTA 4B0OA 4TWJA 5CRIA 3SPHA 1NRIA 5HIAA 4KUMA 3N8IA 3FSGA 1F2UB 2KG7B 4PYOA 5EP1A 4IDPA 1DIOB 4YY3B 3MDSA 3AEQA 4MICA 1H6BA 5JNVA 2HBQA 3WB9A 1FPQA 1X1AA 2GILA 4CKBB 5H7XA 1OVGA 1QH0A 1QQ6A 2RKBA 3SDSA 5M2QA 3BRQA 2JS3A 3I55V 3PHCA 3NIBA 4F04A 4DCPA 2R8XA 2OD7A 4LTNA 4UZSA 1QIIA 2Z98A 5KYGA 4XGNA 2VKTA 2VSFA 3DKKA 4FIDA 3IRUA 1TA8A 4LF6O 3TZEA 4RK4A 4NPHA 1E8MA 1MHPA 5ELLA 5CT8A 3PFIA 3UMCA 4E5UA 5J2UA 2IYUA 4B6OA 2O2HA 1CUCA 2WSSA 4ABMA 2AW5A 1QZXA 5KYYB 3AVQA 4PD4F 2UYKA 4MEBA 1TX4B 2C8LA 2CNBA 1XAJA 4JOBA 4RETA 2O2XA 2Y1GA 3KQUA 2P4VA 3N2LA 3OMWA 4HNGA 4UXIA 4YRGA 3KTDA 5AW0A 3GJ5A 2Y66A 5FAKA 3R9KA 4V0KA 1QIDA 4LBYA 1UXHA 1I7LA 5CVCA 3L0PA 3OTGA 1VG0B 2A1TS 2I87A 2XQKA 3DVAA 3A1TA 2JRCA 2QW1A 1RRFA 3T5BA 4OB8A 1MXFA 4FMCB 3INYA 4JX9A 3WZ2A 1BW9B 1I7PA 3LWBA 2H54A 4MRNA 1T1IA 3I9LA 1X92A 2NT3A 1UT8A 3AERB 2BGUA 1MA1A 4WN3A 2Q0OC 2JVDA 4FGLA 1NPTO 3D6TB 2RQ6A 1NAIA 4L6CA 4S1TA 4BEWA 3LH5A 2CEKA 4HAVA 3KKZA 3TOCA 1ZM2A 3OU7A 2BGWA 3BCRA 3ROEA 5LDDC 4QFBA 1CIVA 2Y2UA 3F6PA 3A4NA 3DOCA 4FZ5A 2HSEA 2WOOA 3ZCUA 4K40A 3R3VA 4BB0A 3L02A 1V43A 4PDLA 4BNDA 1V6CA 5H5NA 1K7FB 4FYIA 3OQPA 1EFAA 3LWZA 1W94A 3S8YA 2YV4A 1XDSA 4Z8XA 5A1TA 3GNQA 3UJ6A 4INOA 5EEHA 5LIRA 3FHLA 3WLPA 1YT5A 3S0WA 4BVEA 3LX5A 4IMPA 2OOKA 3WB1A 4IAOA 3IV9A 3D7RA 4HTAA 1H0RA 4DUZB 1C7RA 1U4NA 4CH4A 2OLJA 2GM5A 2VS0A 4LI3X 3D5QA 3H84A 4MIOA 3RSZA 4GSYA 4MWCA 4EPWA 4QX6A 5C93A 1AKYA 2NZJA 3A9SA 3NK7A 4G01B 2BOVA 3MRXA 4CLHA 1Z18A 4TVBA 5U4XA 4MVZA 2BFFA 3JSXA 3H75A 1BHJA 3KUXA 3K72B 2PT9A 4BIZA 2H1IA 4MV4A 2CFTA 2G0AA 3C45A 4NU8X 3STLC 4I9FA 1A9OA 3F67A 4B2YA 5GZ1A 4N0QA 4IDBA 1U4SA 3LSUA 1EBBA 3ZZNA 5J2TA 4BQPA 2GR9A 4X84A 2GCOA 3AKCA 1CBUA 1NT4A 2DC1A 2R65A 4XLLA 2VSNA 2K1SA 5FI3A 1BVHA 3R3ZA 1HDIA 3TR6A 1TQ6A 4XTCS 1UIRA 3FETA 2QJTA 5HEKA 3OE7G 1DC4A 1I3OA 3LRTA 1XWIA 4D46A 5CM2Z 1WB8A 1BQZA 4AJ1A 2OV2A 4Q3BA 1N6NA 2V7VA 3IS3A 4L8GA 2ZJ2A 1XUOA 1WV1A 3BWBA 4IIFA 3W8FA 4G4JA 2OYRA 3O8NA 3OEYA 3C74A 3VR6D 4S1PA 4HAYA 4IJUA 3LC1O 4EUKA 3UUEA 3UWDA 4HH1A 4WZAE 3T3PB 2FW7A 2WD9A 2P5UA 1O4WA 3MHHC 4C4SA 1G5RA 3URKA 1QFXA 1JDZA 4B1FA 1DKNA 1N32B 1JA9A 3EEBA 1ZNYA 1XWWA 4HN4B 4BZWA 4ZVNA 3IKVA 4KJXA 4NKGB 1VA5A 3GGJA 3EFOA 4RSHA 3MFQA 621PA 1AY0A 521PA 3MB8A 1YTFB 5K3FA 3ECAA 1V1RA 1AXEA 1ORIA 4AWXA 4WF9V 1WR8A 3C8ZA 1PHRA 1CTQA 3IEQA 5B1EA 1T1GA 3HCPA 4KMOA 5IFKA 3HJGA 1EBUA 2RDMA 1BHAA 3FNBA 4X44A 3DM5A 2LR0A 5KTTA 4WZBA 4NBSA 2JAQA 1SZJG 4FYJA 3CCBA 2F3TA 1K08A 2VN8A 2C59A 3SQWA 4IOMA 4BO5A 1P8AA 1P44A 1OXVA 3L1JA 3PXUA 2DFKB 4LMPA 3SKXA 1TO6A 2AH5A 1T2AA 5ER9A 3K79A 4NXNO 4Q03A 3K5PA 4M1YA 1S0VA 1APBA 4J16C 2ZROA 1ODKA 1KZ9A 2ZLBA 3T7IA 4UBNA 5SZJA 1PIWA 4FN5A 4U63A 2QZ4A 1V7PC 2VPYA 4Z3OA 5IARA 1UJ2A 2NQ8A 4RZIA 3FG9A 4DCNA 2JZOA 2JHFA 1X0XA 1WHSA 4I4TA 2IXGA 1NXXA 1X7WA 3D2CA 4O4JB 2JIRA 2A0XA 2C8VA 4S04A 2Y27A 1SKMA 2BGTA 4RD4A 1P75A 1AUQA 3A6HA 5T5QA 3FGPA 5FORA 4FXOA 1RP1A 2IP4A 4OHVA 3SJQC 1SC4A 1XTVA 2W6NA 1FS4A 2RSLA 4GNKA 1XZLA 3K9GA 5DNEA 1F38A 4K3AA 4ZTBA 2RMKA 4B17A 3VOBA 4BZQA 3KCNA 1Y3CE 3AI2A 3UC5A 1NYRA 4Q93A 1SDSA 5F7JA 5C5CA 3LVRE 1J20A 1RJ9B 3VBCA 3QKSA 3E8SA 2Z5VA 1UC9A 4HXYA 4BVAA 1AHIA 1H5UA 2WLJA 2I34A 2P9CA 1PX2A 2JASA 3FIUA 4CKCB 3GA5A 3GA7A 2J48A 3LL4A 3I6QA 1XMPA 4XX0B 3HB9A 3PGJA 1H8EA 2DM6A 1HE8B 3Q3CA 2WUDA 2C98A 1H5NA 2JFXA 4IZOA 3VC7A 2QKAA 1ORDA 4RPCA 3DBOB 4I8IA 4JJZA 4B3XA 1ZP6A 1IBLB 2ZJ4A 1JDVA 1PZNA 4FMBB 3U11A 1IZ9A 1HNWO 4DV7B 4MGYR 5CD1A 3IDOA 2ZBPA 4KE9A 4ZZ3A 4MPRA 2I65A 5J4HA 3EF1A 4BLPA 1ONOA 3GJYA 2A0FA 1R73A 5E3HA 3L0ZA 4Z1OA 4EF6A 2EFCB 2REQA 1Q0UA 3LVFO 2P7IA 3BK7A 1RI4A 1Y7HA 2ZBDA 2RI1A 4FLUA 3VYTB 1P2BA 3AG6A 3LMEA 3PENA 1MJGM 1XSEA 3QU7A 4F3YA 2GFIA 3KLMX 5AOBA 4Y2SA 4P34A 2HJHA 3CFYA 3PICA 1NZ6A 3QVKA 3EE6A 1KC8H 5LBQA 1Y5NA 4C08A 1CP3A 2EFJA 3J81N 3A9TA 3HJBA 4EBBA 3QA3E 3ZS8A 3TSZA 5LA6F 1ISSA 1FYVA 4M0LA 3GVPA 4BBPA 2I7CA 4FSXA 4DLLA 4CEIA 2FUG6 3BIOA 4K81B 1JBQA 1L5OA 2OQRA 5LWHA 4BT2A 5FO0A 1YIDA 5IXJA 1NU1H 2NZWA 3RVBA 5ER6A 1MRZA 4AKSA 4B09A 3RADC 2I99A 3E9NA 4LRTB 2G76A 5C4GB 1FAFA 1NKSA 4HDNA 1SKQA 4DIEA 1GNTA 1YRYE 1JDNA 1PT5A 1I5RA 1ESZA 1GTJ1 4FTWA 2CGOA 3RBZA 3IRVA 5EBLC 5BSHA 3B5EA 5A9SB 1UKEA 5IWAO 2I6FA 3OZIA 4PSVA 3TLCA 4GWGA 1Z22A 2BI4A 2NWQA 5FA5A 1U0LA 2QY6A 5C51B 3EVCA 4J03A 3A9CA 3M49A 5AI9A 1F5NA 2EWCA 2QL7A 4G23A 2QNBA 4TSFD 3ZWMA 1U28C 2VDKB 3BL6A 1JKIA 4UNNA 4RJ2A 3T5AA 1U4OA 2ZTSA 4K86A 4OXQA 3RSFA 1JNXX 4A8JB 5BWNA 3HYSA 1PT6A 4NYKA 2KBFA 4LF9B 4R4JA 1KDOA 4QNHB 3IIMA 4HQRA 1KMNA 1M8PA 2FW6A 2W6PA 5MGNA 3GJ0A 5AVYA 4B82A 1C3JA 5ALTA 2JLQA 2FQWA 1PE0A 5AUQA 3TB6A 1JPNA 2NU9A 2W2VA 1XV5A 1YJ8A 4LVUA 4O59O 1CXZA 4GW3A 1SC3A 1AS3A 2NIPA 5CXQA 4RSGA 3LUBA 4R9RA 3CUKA 5JE8A 1NPDA 1BA3A 4ZZ0A 3ETDA 4LV6A 4BN4A 1T9GS 5LQAA 3A11A 3V4ZA 5C4MA 1FS6A 2ZIOA 1HC7A 4A5UB 1H2YA 4ZVUA 4HNUA 4LOHA 5EKUA 3U3KA 2F23A 3E84A 4DSTA 4FHGA 4OH7A 1PGPA 2GSWA 3I52A 2WFMA 4BNFA 4YRBA 4I2VA 4GIBA 3LAWA 1XHZA 3KAPA 4EZIA 5FUMA 3IPRA 1B4DA 4JLSA 4X6UA 3JCZA 1TFRA 2N1BA 4DIFA 2FDXA 4XVHA 4DEYA 2RGBA 5JLAA 3HPRA 1OFIA 4A92A 2OK7A 1P2UA 5F3DA 5H9VA 3IILA 4F38A 2ZT8A 3I09A 3JVIA 1CS0B 4JYMA 3NXSA 2BISA 5HZGA 2AIFA 5F77A 4C76A 1ANKA 3IP5A 3LMKA 5CNIA 3OOWA 5EFOA 2HK6A 3DP9A 4ILEA 1H9BA 1QIHA 2Q0HA 3KKMA 3OHSX 3HKBA 1M57C 2JCGA 4OHCA 2XT0A 1RWWA 3S4YA 4HPXB 4F7DA 3EQ9A 4BC0A 1PRYA 1NUUA 1YULA 2XUMA 4EA9A 4XWWA 1M6HA 3SG0A 2EHJA 3ZHUA 3NFRA 4EG4A 2O5CA 2EDAA 3CVWA 3ZGXA 3MK31 5F35A 1W0JG 3T0FA 2QA4F 1YDEA 3CPEA 4E5MA 1H6CA 4I0XA 3J81M 1SQGA 1MEJA 3S2UA 2LW1A 4D7SA 4XARA 3HEAA 3KQPA 2J31A 2VP9A 2E5LB 4PVCA 5K8VA 3IAHA 3WU2Z 1HLFA 4PTYA 3I9KA 3PPYA 4BOYA 2R84A 2EFDB 1Z39A 1NBMG 1B41A 4NU5A 4WOPA 4D9FA 2ODTX 2CTRA 3W3AA 1KP9A 3TXQA 2ANBA 3VO2A 2GUZA 1V2GA 1QRDA 3R74A 1LSUA 1JBKA 1L8LA 1XFAA 1MQAA 2GHRA 1SUEA 2QTCA 5EGNA 2C58A 1JEDA 4D9EA 3D7NA 4MVJM 1EGHA 3DEJA 3EGDA 2QP3A 3HUUA 3MYYA 4JH0A 1QM5A 2RD2A 5C8YF 4EI9A 1QV7A 3TRJA 4CM3A 1RTKA 1U7HA 2X14A 4EGQA 1EFRG 1MX1A 1VQ4F 5LP1A 2R7AA 3P0FA 1K89A 4BP8A 5EIWA 3PIIA 3IVXA 3TXAA 5LZ5A 2PV0A 2WP8J 2X8AA 3K04A 2GZHA 4BX3A 3L6OO 4LHWA 4P33A 4E1AA 1H2NA 1BZKA 5A2GA 2ZPTX 1ATZA 2B82A 1XU9A 2X9VA 2JHGA 3ST7A 2BGIA 3ZX4A 4W9RA 2CZWA 1WD7A 1SVOA 4J9YB 4R6XA 3R5HA 1I08A 4RZ2A 4D9HA 3P96A 1II8A 3I55F 1KZ4A 2BO1A 5KTYA 1EIWA 2CLKB 1NATA 4D1YA 4G0XA 4BVTA 3Q7EA 5JD4A 1K5QA 3DTUB 3Q8MA 1X8KA 4LF6B 2W2KB 2I2FA 2JZCA 1P3Y1 3VRHA 4RS3A 4LJ8A 2BN4A 1K7SN 2YMQA 4E31A 3OMXA 3IXLA 2NVOA 3T3EA 1B43A 1IG3A 1B8NA 5LNK6 3TIVA 1KI1A 3I8XA 5BQFA 3O74A 1PNTA 5KSZA 1GAJA 3AG1B 2QTBA 2BEKA 1Q16A 4S2UA 1TVKB 1GLVA 4RELA 3TPCA 4I55F 4CM4B 1XTBA 1U96A 3NEYA 2F9ZC 3AR8A 1W7AA 4F3CA 3R8XA 4WXEA 1EVKA 4PG8A 3A7EA 2RC6A 3O73A 2OWDA 4P35A 4DBLC 3BVPA 3UWMA 4Q48A 2JH9A 4ZK6A 2XAAA 1T2NA 1YA4A 3I5AA 2BYTA 4NRDA 1T1SA 4HXFB 4IUYA 5FFMA 2AJTA 2F62A 1NQ5A 1BDMA 1ZM4A 2J5BA 3B1XA 2VYQA 2WDZA 3VYSC 4YRFA 1MC5A 3IUQA 1OZFA 2DXIA 2W6QA 2EF0A 1OZAA 3T5DA 1BS2A 2YJGA 3QGMA 4BJ5A 4LI0A 3SXPA 3WWCA 3ICXA 1WP9A 4PC2A 4QT0A 5F64A 2ALEA 4QXAA 2WJHA 3O4VA 3GR6A 3NJ8A 2YIBA 1YDMA 1V25A 1L6IA 2WU8A 2I6QA 4RULA 5L3VA 2VOJA 4OM8A 5KQPA 5DV9A 4NENB 1DIRA 2Z1DA 3FZYA 2E37A 4FT4A 4Q47A 3WLOA 3JSLA 4C8GA 3U26A 4AN1A 4WZBE 5CJPA 1FDOA 5EOVA 4OMDA 3DB2A 4MS3B 2HF2A 3IBYA 5C0OE 3HZZA 4OD0A 5FA6A 4YGXB 1L0BA 5FPSA 2HEPA 4I7EA 1H0SA 1KJNA 1IWOA 2YMMA 4J90A 1ICEA 4OK5A 4R3WA 3VKVA 4C4ZA 3VHQA 4L02A 4N6GA 2EX4A 2B1GA 1ODCA 4EJSB 2CYAA 3T38A 4RPGA 1JPVA 5KAPA 4X20B 1JALA 2Q5OA 4W7SA 3OZVA 3K31A 1OCRB 2GQ0A 4BFVA 1X7ZB 4JB3A 4J4BA 4NAHA 2PSSA 2WC1A 2HK7A 3OURA 4H4EA 2ZINA 4QT4A 1RXEA 3UY4A 4FMDB 1EUCA 1P1RA 3H4MA 5AI6A 5I01A 4IS3A 2OD2A 3HBAA 3NX4A 3QSYA 4LGCA 1NNSA 3KQTA 1G19A 4I1YA 3G88A 4XYLA 1KAOA 3OG9A 2DH6A 1J2TA 3STYA 5CMUA 1EGVB 2ZTVA 2FZ4A 3EPKA 3HXTA 2Z2ZA 4F4LA 4MV0A 1M7GA 1XL6A 4BQSA 2QQ5A 3PRKE 1Z4IA 1XHFA 5GANK 1C9YA 3G2HA 3GLVA 1J25A 2QT0A 1BGYH 2GAOA 3DPSA 3SVZA 5TGTA 3IBSA 2EVWX 5DOVA 5EWJB 3HB4X 2PWBA 4IJVA 1OF1A 3K5WA 4M0EA 2Q5ZA 2LP4Y 2G1AA 3B9BA 1ZEJA 1XXHB 2X1MA 2HOQA 3SY8A 2J4FA 3S2IA 4LWQA 5EIFA 2W2XA 3PHLA 3DL0A 1CZOA 4PYQA 4JUAA 1JLLB 3VX4A 1XEXA 1QOPB 5JRJA 1A8PA 3N2NA 2WJ4A 2BCGY 4II7A 4DADA 3IT3A 3B8EA 3DONA 5E6SB 5A62A 1MTOA 1SQ5A 1G8MA 4Q02A 2IJJA 3L06A 1Q86W 4CS3A 2GUGA 3TJRA 2V3VA 2PS3A 2AZ4A 5FPTA 4S12A 5IUJC 2CY0A 3R1IA 4I4NA 1V48A 3NC0C 1PEYA 3LO8A 2IH1C 3AR4A 4J4HA 1UBUS 4Y2QA 3BFKA 3HP4A 3HUEA 2AQIA 1E1RA 1NVXQ 4NYMR 4K8RB 2HMAA 4GGPA 4G4WA 5KWEA 4FD3A 4LY3A 2KB0A 1BEZA 2GN0A 2VJYA 4WCDA 3UTCA 1T0HB 1QD9A 2C2XA 5T4HA 1E6CA 1F0YA 3ASNC 3GDFA 5L4LA 3M2TA 3SQLA 4NXNB 2HJDA 1CRZA 1P2VA 4FJ2A 1MQSA 2IU4A 1NFFA 4NEHB 4KP4A 3H6KA 1R4MA 2Q50A 5E2IA 1UAAA 2CNWD 3UWPA 3RBVA 3T1NA 3OZEA 2TMGA 3JSNA 4A2PA 1LPNA 1E0KA 2JF0A 2WHQA 4L50A 5FOUA 1N1EA 2OXEA 3GG9A 2C20A 3ADPA 4DR5B 1F20A 3UK2A 1SCJA 3FX2A 4J0KA 3UA3A 4DYLA 1RRGA 4PN7A 5LQMA 3W6NA 1DQYA 2IXDA 4FYMA 3VR1A 1RM5A 3AJEA 5CFRA 4C05A 1R5NA 221PA 1RQNA 3HXPA 4M6WA 3D1VA 5ED0A 3AY7A 3UKOA 2VA9A 2R6R1 5HJ2A 2C5SA 1M6VA 4GLBA 1F8XA 2PXAA 1NN0A 4KQMA 1AI7A 4PZCA 3K5OA 2ZOVA 2B8TA 1J8YF 2ZB3A 3TCKA 3CA8A 4PYRA 3WL3A 5EGSA 1DC5A 1KYXA 4QUHA 3Q98A 2P9FA 3F47A 3P19A 4CM1A 2J07A 2VPWA 1L2TA 3T3GA 1EJ0A 5G02A 3PLAC 1HYBA 2Q28A 1FE8A 1EWYA 4LJLA 5KQGA 3L04A 4LF7B 2C78A 5BV2P 2AN5A 3GRRA 2IBMA 1ADJA 1H2ZA 1B04A 4LXHA 4AY6A 2BZ0A 2WJZB 4MUEA 2O4UX 4HDMA 3G2IA 4GICA 2Z5FA 5AXAA 1P45A 4IF4A 3FR8A 4EHJA 1SPBS 1VYHA 4AJKA 3MWLA 2WHEA 3WIOA 1OXTA 1L5ZA 5FBRB 5L7YA 2J3EA 3IAUA 4O63O 4OV6B 1G4AE 3I9JA 2HA2A 2WHRA 5E4YA 3HP7A 4S3MA 5LYJF 4LNUA 5HY4A 3H9EO 3JSAA 1Q77A 4ZRNA 5JZ9A 3AIMA 4PPYA 3BA1A 2C7BA 3IBGA 2R9IA 3L7YA 1T2VA 4CMIB 4BVJA 2QTLA 4XPIB 1XPUA 1LW6E 1HEYA 3JQ7B 1SU7A 2OSBA 2VYCA 4JGBA 2VTEA 1TMGE 2ZSIA 4OOFA 2ITCC 2D2IA 3M6XA 3O9ZA 2HA4A 4CU5A 4QUGA 1QFYA 4ALJA 1X7XB 2J3DA 2EYUA 3ERCA 4NQZA 4QOFA 4J42A 4TYMA 3CKKA 3I4LA 2J9GA 4L9RA 1RQRA 2DWUA 4ED9A 1V54B 2Z6UA 4BR6A 4IX1A 5FHQA 5ICSA 1U8XX 1NLMA 1RZUA 3RS9A 2P65A 4MDEA 4Y9SA 2L18A 4X1OA 3HR8A 3BL5A 3G0HA 3ZRWB 1PBNA 5CHEA 1WY5A 3PI7A 1XXLA 3DDSA 3RVLA 4B84A 1NUTA 1DPGA 4WKPA 3UJNA 4BUJA 2EJ7A 3GHYA 1KU9A 1ZCAA 1X3SA 2WFLA 5KHAA 2QUBA 1GXSA 3HABA 4MUYA 3HTXA 5C1DA 1FDTA 1PNOA 3LBFA 5HQ3B 3N4YA 1M3SA 5L3QA 5HG0A 3U19A 5HKLA 4K9OA 4MP3A 1R0WA 2P2NA 3DLBA 3BWMA 5LLDA 3W8RA 4HB4A 1CY0A 6ADHA 1NC3A 3PJGA 4ZEOA 2R6FA 4BGEA 1YFZA 3WGLA 3W90A 1MV8A 4Y2HA 3NT2A 4GUNA 2OC9A 1R0RE 4YMUA 1YU9A 2A0WA 3S28A 1MZPA 5AOCA 3WP1B 3DHEA 4IH9A 2H2FA 3MS4A 3ADCA 2NT4A 5IWAB 3KEGA 3UM7A 1B00A 3ABOB 3OU6A 2XNKA 5ALYA 3QF4B 4R84A 1QQAA 1OUMA 3UJ7A 3EPJA 1KNQA 1W59A 4W5WA 3PVZA 1KAMA 1BCSB 3AFOA 3G2LA 2YX1A 2DOKA 2QI9F 3ILVA 1II9A 1LJ8A 5D3MA 1YVRA 2LKCA 4K9PA 4G28B 4MI6A 2NO6A 4H6VA 3GLFB 4QTXA 2HDNB 3M8KA 4RHAA 3WMWA 2YRFA 4JJ8A 1B0PA 2QVYX 1YZTA 4MW8A 2HS0A 2VWJA 2HWWA 3U6BA 2VRWA 2HCRA 3IYLW 1PWHA 1M2GA 2R8ZA 3RHFA 5G4VC 3KV1A 2DUMA 4D99A 4JEMA 1FUUA 1V8DA 2JRLA 4QPNA 4DLSA 3DOJA 4GKVA 2HLHA 1L8XA 4B3GA 3VKUA 3L0YA 4HH3C 2OC4A 2FRXA 1W2GA 4FMTA 2JIZG 5KO2A 1NIJA 2RKOA 4XWAA 1T6BY 1ZZEA 4ZYUA 3VJLA 1Q74A 1P5HA 4K6GA 3LHKA 1MQ8B 2PD4A 1QIFA 3V3TA 3AI1A 1QYWA 2Q2VA 5K09A 2HWUA 1QO0A 1KWGA 2HHLA 1FFHA 3MBOA 1GGNA 2FP4A 3O0TA 1U8YA 4QOHA 3BMOA 4OEHA 4HS4A 1MKYA 5HMLA 1FSGA 1CZKA 2WG2A 1UT5A 2BHTA 5JSZB 4KOAA 1P19A 1CVRA 1TA0A 1NVDA 2QWXA 3BJZA 1V5GA 3SQXA 3HBMA 4BY9D 4XVRA 1YF2A 4DV3O 4ZO6A 1UMBB 1PGOA 2XKKA 1KFCB 3HLKA 4RTKA 1CZRA 5FAXA 1L4MA 1XELA 4QOGA 1I7FA 2XCRB 1AO3A 2I67A 3D0RA 5EYPA 1GO3F 1Q22A 5FBHA 2FE1A 3U0BA 3G23A 2H48A 4OBBA 1XZIA 2XECA 3RFXA 1NI8A 1QVFF 2VGNA 2BBTA 2VPZA 2VWGA 4GBGA 2JCSA 1URPA 3C5VA 1MABB 3AONB 2E4WA 3NBFA 5EZYA 1GR0A 3RKRA 2ASVA 3QFHA 2FEAA 5HUQA 2CFIA 4C4PA 2H4YA 3SS7X 3T9FA 2JEZA 3I0NA 3V5NA 3ECCA 2ODQA 3AZOA 1Z2OX 3CHYA 4S35A 2IPXA 3JYOA 4JZ2A 1AZTA 1OYWA 3FOFC 4HQOA 2QBYB 4YJGB 1F4NA 4YR7A 3CCJV 4R41A 4RF2A 1YE8A 4EGFA 1VMDA 4AYWA 4UTNA 3K6RA 2YS6A 3VHRA 3PBKA 3FN4A 5DWDA 1I5XA 2VG8A 1SCUB 1DOAA 4PDRA 4LYFA 2R9AA 4H1WA 3CY6A 4FB5A 3LVBA 3QHQA 1G0NA 2P1DA 3AV0B 4LDZA 3UOGA 5IN5A 2R48A 1YCFA 5DH9A 2JIOA 2QZPA 2AR9A 3CV3A 4NJEB 4IWYA 4QYSA 2WWXA 2HJVA 2Y0IA 5DT9A 1F4VA 2HLPA 2MQEA 5AIBA 2HO5A 1EK1A 3O94A 4RSMA 3UJAA 2XB8A 1LX6A 3NM5A 2GJ9A 4TV8A 4ZCRA 1ZGZA 3VAYA 1KY5A 2EZ8A 2X5KO 4H17A 3Q7SA 1ZL8B 2WOJA 2I33A 4WIAA 3R6DA 3TTWA 2VRCA 3IDAA 4BNUA 2VS1A 3IUEA 3LZCA 3ZG6A 5EN4A 4J94A 3K92A 5K3EA 2HF8A 4JVOA 4PAQA 5KHLB 2Q62A 2ZR9A 2FZKA 1CIJA 3LM8A 3A3PA 3GVXA 3JQPA 4BKUA 3SC6A 2AN4A 1NNEA 3JQEA 1NIPA 1QR2A 1NMSA 3KOWA 1QX3A 2XWJI 3F7OA 3KJHA 3OE7A 4H18A 3CCMV 3NHUA 3RJ9A 3QJGA 5EXPA 2CHEA 1M2WA 4IH4A 2PUWA 2CAZC 2BCCH 2I4NA 1WPGA 5EZ6B 5E6UA 1A5AB 3HI6A 3E61A 2OO7A 1CC1S 1JVSA 3KEOA 3S6JA 3E7WA 3WG7B 4CMEC 1YI2V 3HBJA 3GYBA 1L5VA 1FXUA 1F2DA 3EUAA 1X80A 4BYMA 4DPKA 2VLIA 2LO1A 2QIPA 2FSVA 1TZCA 4CU2A 2QPLA 4XRRA 4LHSA 1QFSA 2Z01A 3CCEV 1UP7A 1EUQA 1HNXO 4UZFA 3N8GA 4WFKA 4MIEA 4B2PA 1DI0A 3BHNA 1AE1A 3WWOA 2MR6A 3P2KA 3E0QA 4J3JA 3H01A 2FWMX 1A4IA 1P4AA 3MQ4A 4PPQA 1T4CA 2WWWA 3O65A 5JD3A 4DK1A 3MUFA 3BHIA 2XE8A 5LGNA 3I2IA 3W5IA 3LYUA 1RBZA 1A5ZA 2RGNC 3S2YA 5CEEA 5T8KA 5CK5A 3FJYA 3ZJUA 2MK3A 5BNIA 4BT4A 4XB2A 1CVIA 4NNPA 3IULA 3T3OA 5KOIA 2DT4A 1J22A 1WHTA 1V8ZA 2PUEA 3W2HA 4QQ8A 5K0FA 3IPLA 4O29A 3F6CA 1XZJA 2WU4A 3KX2A 3P9IA 4HXEB 2QA4V 3V00A 5MN4A 2G70A 4CM8A 1TYCA 2I7XA 4N0PA 1RWOA 2FPGA 4DGQA 4FLYA 5LSAA 3ZVLA 1TJPB 5LXTF 1P33A 4DUYO 1LVGA 1OCCB 4FU0A 5EMLA 1EK6A 2V6GA 2PGAA 4NTYA 4QJIA 4Q4DA 2VPTA 1AK2A 2FG7C 3UJ3X 1WAMA 1IHXA 4N5NA 2FL4A 4IJMA 3ZI4A 3BVOA 5ECWA 2JI8A 2GBLC 3ONDA 1LX7A 3TO5A 2QT9A 3BFXA 4Y7CA 1P9LA 4CM9D 1GEGA 1OWLA 2CHUA 3TLMA 3DF7A 4D79A 1JHAA 1WD5A 2IIBA 1HZZA 2YEVB 2ETVA 2AZTA 4CIXA 2EERA 1O94A 3BZWA 5JSHA 3K16A 1EGAA 5CB0A 5JJCA 4R7CA 3FOEC 2ZQMA 3VJKA 1NZDA 2H9AA 3FKSG 1VIVA 2PV7A 3RSGA 5FD8A 1VA4A 4ALMA 2I6XA 4AX8A 2H7XA 2ZWMA 1U0OC 5DNWA 1PT9A 2FG6C 4DG5A 2WSMA 5IKXA 5L45A 3ML1A 1U9JA 3G7NA 3P9SA 3IV6A 5HVNA 5CT9A 1VF7A 4F6EA 4QXPA 2ZRCA 3HPQA 1PTJA 4ZDJA 2IODA 4JV5O 2KMLA 3RE3A 2P6PA 1GQRA 2V7QA 2WWVD 2L42A 1G8GA 1C3XA 1F8GA 3T7CA 1HQYE 4LQCA 4P83A 1FYXA 1SCKA 5DULA 1FTQA 5AH0A 2JJ8A 1ZM7A 5H6QA 3QXHA 4KUGA 1MA3A 1XZAA 4Y0NA 2G80A 3AHEA 3QV2A<