5LA6B

Tubulin-pironetin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
427
structure length
422
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha-1B chain
publication title Pironetin Binds Covalently to alpha Cys316 and Perturbs a Major Loop and Helix of alpha-Tubulin to Inhibit Microtubule Formation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 165
structure length 422
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5la6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5la6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5la6B01
3JATB 1JFFB 2RHLA 5LYJA 2VAPA 1RLUA 5GONB 4KWEA 5EYPA 4XCQA 2RHOA 1Z5VA 3HKBA 3N2KB 3VPAA 4DRXB 4O4JA 5CA1A 4ZI7A 1W581 5IJ0B 3JALA 3RYHA 3JAKA 4ZHQA 4TV8A 1TVKA 4TV9A 5IJ9A 4TUYA 5LA6A 4WBNA 1TUBA 5CA0B 4EI9A 5KMGA 3RYIA 3JAWA 5C8YA 4ZOLB 1FFXB 5JVDA 4EI8A 5FNVA 3JARA 4X20B 3VO8A 4O4HA 4EI7A 3HKEB 5JCOA 3UT5A 4I50A 5JCOC 3V3TA 5LYJB 5KX5A 5LOVA 5EIBD 3HKBB 1OFUA 5J2TA 3VOAA 3M8KA 3RB8A 4O4JB 2R751 3E22A 5CA1B 3WGMA 2Q1YA 3HKCA 4U3JA 3JALB 2GVIA 3HKDA 3JAKB 4O2BA 4YJ3A 4ZHQB 4TV8B 3VOBA 1TVKB 4TV9B 5IJ9B 4TUYB 1FSZA 1SA0B 5LA6B 4WBNB 1TUBB 5JQGA 5KMGB 2BTQA 3JAWB 4IIJB 5JVDB 5LP6A 5FNVB 3JARB 5MN6A 4O4HB 5LP6C 4X1YA 4X1IA 1W5AA 5IYZB 5LXTB 2RHHA 4YJ2A 3UT5B 4I50B 4F6RA 3RYCA 5KX5B 3VO9A 5LOVB 1W59A 3C8LA 3JASA 4IHJA 3N2KA 5EYPB 5J2TB 4O4LA 4DRXA 2VAWA 3E22B 3WGNA 2BTOA 3HKCB 4U3JB 5BMVA 4I4TA 4ZI7B 4E6EA 3HKDB 5M7EA 4YJ3B 5ITZA 2XKAA 3R4VA 3RYFA 3RYHB 3CB2A 4DXDA 4LNUA 5J2UA 4EB6A 1W5FA 5CB4A 5JH7A 1RQ2A 5JQGB 4I55A 4O4IA 4U39A 4X1KA 4O2AA 2BTQB 3RYIB 3N2GA 4FFBA 2Q1XA 5C8YB 5EZYA 4X20A 4M8IA 3WGJA 4HNAA 3HKEA 4X1IB 4X1YB 3WGLA 4YJ2B 4F6RB 3RYCB 5MN4A 3JATA 1JFFA 4B45A 3ZBPA 5EIBC 3JASB 2VXYA 4IHJB 5GONA 1Z5WA 4O4LB 2R6R1 5MN5A 3ZBQA 5BMVB 4I4TB 4B46A 1W5EA 5ITZB 5IJ0A 3RYFB 4LNUB 4O2BB 3WGKA 5J2UB 4EB6B 1RQ7A 5CB4B 1SA0A 5JH7B 2RHJA 4I55B 2XKBA 4O4IB 4X1KB 4O2AB 5CA0A 3N2GB 4FFBB 2VAMA 1W5BA 4IIJA 5EZYB 4ZOLA 1FFXA 5LP6B 4HNAB 3M89A 5IYZA 5LXTA 3ZIDA
chains in the Genus database with same CATH superfamily
1QLJA 4OHFA 3TLMA 2ZYAA 5JSZA 2B8NA 4N7MA 2C4HA 4QD3A 1A5BB 1X2EA 4ZVVA 1ILWA 1NY6A 3OZUA 1DTSA 5HE9A 3U61B 4EBBA 4QE3A 3K31A 3K0AB 5GTIZ 3HKBB 2CSUA 2UYPA 2B0JA 2F95B 4A0RA 2PGIA 3K70B 1HETA 3WA6A 3Q3JB 4MTXA 3PIDA 3R4CA 4OLAA 2VJMB 4P53A 1OYWA 4JI0O 4C3UA 3VUFA 1OC2A 2DX7A 4PZPA 1GPKA 2F3RA 3E1YA 4TX1A 2B98A 1RYBA 4FLUA 1J8MF 1RKUA 2QN3A 4LPKA 1FRZA 3HJTA 1WN7A 4HT3B 3AJ9A 1ISMA 3CUKA 3JASB 3H9JA 2WJPA 1G5PA 4NBTA 1EDBA 2I2WA 3RW0A 1SERA 3V42A 2BGKA 3DB1A 1OXXK 4V3BA 3NPAA 3TNFA 4BT6A 5HBGA 4OMCA 2XXAB 1IJEA 3ZOZA 1I6LA 1IZ9A 4BV2A 4FFNA 4Y0VA 1S3GA 3ZCCA 3HUDA 1B0ZA 4IFEA 1TM7E 3A1EA 2IXTA 3DFFA 2ZJFA 3GUVA 3H0KA 4Q9AA 3RFFA 1DELA 3F5QA 4RK6A 1VQ4F 3VNVA 1IPHA 5L9AA 1LWNA 1F0YA 3W8DA 4QC2A 4F6EA 1T26A 3QU2A 3OTWA 3DXYA 2R44A 3O8DA 3GGDA 2VL7A 3H86A 4IJ5A 1TM2A 2B21A 1ENOA 3L1JA 5IDXA 3I0ZA 3TTXA 1KEEA 4ZCPA 1QE0A 4EZBA 1FTWA 4RHCA 3ICWA 3RYIB 1EVJA 1CRPA 1TXGA 1TAEA 3LH5A 4ZJPA 2C5LA 1M93A 2PUWA 4IYHA 3NVIB 2J7PA 4JB8A 1FJHA 2B1GA 4P80A 4D41A 2J8ZA 1WV0A 1BN7A 1KDTA 2HF7A 1PVVA 1CQPA 4K8XA 4EKWA 3QEMA 1NI4A 2GCOA 2FFQA 4MCAA 1S4QA 3U1VA 3JY6A 1E96A 1NV9A 3G3EA 4QIHA 3DWGA 2OFFA 1SQQH 3LF2A 3CX7A 4MTFA 1V54B 1E7KA 4H6XA 2I62A 4PTLA 4CKYA 3GAMA 5FUMA 1OBCA 3NT5A 5B4VA 2J7PD 4E2LA 5IT9M 4MS4A 1ECGA 5A02A 4KXXA 3DYBA 3EZGA 4UM7A 1WF6A 4BLQA 1CHNA 3CUYA 2UU9B 4OI1A 2H1RA 4I6JA 4OCZA 3SQDA 1U3VA 1R6NA 1VBFA 1RYDA 4JVOA 3WNQA 3SFVA 3IUSA 2ZUVA 4G65A 1T6XA 5J9FA 1TCBA 3G79A 4P5DA 2ZDHA 1ZN7A 4DJTA 4G1EB 4DV3O 1MB3A 1OXVA 1B93A 4MV7A 5DSXA 3QVNA 3A2LA 3V7FA 1LF0A 3UO8B 1QZ3A 4KO2S 4C76A 1FNMA 5BSHA 2YBEA 3GJZA 4TKMA 4CV0A 4D8VA 4UVGA 5FWXB 2P7TC 3I4CA 2XNKA 3QX7A 2AIRA 3H13A 1Z6XA 4CQMA 4LJ9A 1BS1A 3K79A 3F9CA 3GFGA 5JRDS 4GKKB 2I7VA 1XN4A 1U7WA 1MG1A 3BHPA 3QTLA 1I5EA 3ZHOA 2PYJA 2Q8QA 4X64B 3TBHA 2DQ3A 3N58A 1JKXA 3R8CA 3OW2U 1MABB 3BIFA 2XUHA 3ZWXA 3G9UA 3STYA 3BA9A 1SETA 1FJGO 1KQSU 1N5DA 2J5RA 2ONCA 2PD6A 1FA9A 4TRNA 3S0JA 3R3UA 1JLRA 2QJRA 4CQMD 5K0ZA 2V7VA 1U9IA 4IIVA 1CS0B 2RD2A 1FNBA 4UM5A 1RJGA 1NN5A 4QQFA 4P4LA 2JJ2G 3K53A 2GN2A 2C1XA 2HWXA 3FFXA 3J80A 3OLQA 1Z5GA 2H94A 3IT2A 4AJ2A 1IHXA 3SYOA 4JI5O 2IXAA 3IPLA 2KE5A 3KXKA 4OVKA 2MK3A 4JLPA 3RFTA 3M4YA 4XX0B 5B64A 1DZIA 1R4MB 3ONNA 2QEXF 2IYPA 1RAFA 3WV4A 3VNBA 3NBKA 1NASA 3U3OA 3A28A 3KV3O 1KL7A 3WO1A 3CD6F 3DW1X 2FG6C 1V3UA 4Q9KA 3HC7A 4RVUA 3CQ9A 3D8HA 2JIPA 1QG6A 1ONPA 3NKFA 3F7TA 4X60A 3OFSA 3SF8B 3ICCA 1M8FA 1XMQO 5KHKA 3ITEA 4TXHA 4CMGA 3IA2A 4LTMA 4F1JA 2PQMA 4KYVA 4D02A 2GPSA 1BU8A 3CSXA 4CQNA 4QUBA 1H2RS 1NTMH 5COAA 1CY0A 2V7UA 3HVKA 1BCSB 2X6RA 2OV4A 4JR1A 5AHWA 3WGLA 3IGAC 1X8JA 1UFOA 3G7UA 1K4MA 1IRIA 2A0FA 5J4YA 4TKUB 4DV0B 1LJLA 1P2BA 3HQ4O 2XWSA 3IUJA 1ZIOA 3USES 4JK3A 5KWJA 3AG1C 1XTQA 2YYYA 4ZC8A 4KG7A 2OPBA 4LDPA 1N36B 1A5ZA 3EGXA 5BWCA 4NARA 3UAYA 1Y3FE 2YXDA 1RJEA 3LBIA 4EPXA 2D74A 4JB2A 3QV1A 1L5ZA 1T0PA 2AJ8A 8LDHA 2A1TS 4YP7A 3J7AU 3IEIA 3NDPA 2K7FA 1SBNE 4GGPA 2WWFA 1JHMA 1L4LA 2CFSA 2CSXA 4IDOA 3LUPA 1JSZA 1RWOA 2KYRA 3I39X 4Z4GA 4A8PA 3N3BC 2CE4A 3R20A 3L2OB 4P30A 4LC0A 4OGKA 1PJZA 2Z3WA 3IQFA 3H83A 1QHHB 1JAYA 2XUQA 2EDAA 5JJBA 3VAYA 4IIFA 4EX6A 1H65A 3GLHA 3KG2A 3K5LA 3O95A 1H69A 2JL1A 3INGA 3SR4A 5JS8A 4R81A 2OXIA 2HSZA 4DR1B 3H05A 1GM9A 2R8BA 1Q22A 1OAPA 4DA8A 2P5YA 3KUDA 5GONF 5F78A 4EHLA 2IH1C 4OBXA 1ODLA 1RYHA 1KZYC 1J39A 4ZA2A 3TTWA 4NONA 3V7UA 4HGOA 2YWXA 3KKKA 1UPBA 3MGCA 5D1NA 3EK2A 3C6ZA 1JH8A 2WUDA 1AXEA 2QN9A 2RMKA 5EPUA 2MMGA 5MGBA 3K9AA 1YTFD 1Z88A 2QSYA 3SSNA 3U7IA 3B1YA 1UBKS 3DG9A 1JDUA 4E6EA 1Y81A 1BQ0A 2XR1A 1E0DA 3W4JA 4IEIA 3WISA 4TL6A 4KTVE 5TT0A 4YIOA 2O3JA 1OFHA 3LYHA 2JJMA 2OMKA 1IEQA 5F23A 2Q8PA 4FSXA 3ZMSA 5KYGA 3I64A 4QBKA 1QKKA 1D6NA 3IB6A 2MR5A 1E66A 4LDQA 1F8GA 1KYTA 3HV0A 1M1KH 3A9RA 3U0ZA 5LYJA 3GGSA 3VX4A 1QYVA 4DK0A 2IITA 3FB7C 4LNAA 2QVZX 2PX5A 4IH4A 2VQEB 4MGHA 5AK4A 2AS0A 4A6DA 1IBMB 3HKEB 5DYWA 4DMFA 4F2WA 3IXQA 3U1BA 4LZZA 3T80A 3CJHA 2ZR3A 3QEBZ 4F2PA 5G1NA 1GRJA 3VTIC 2VBCA 5FPTA 1MQ8B 4Y30A 4PC3A 3RR2A 4Z0NA 3T95A 4L6CA 4J16C 3NRBA 4MEAA 2IA5A 1PV1A 4KXQA 4NBUA 1RI2A 1MQAA 4OBBA 1JLHA 1ZR4A 3I8SA 3LXXA 4B4KA 5CK4A 3TAUA 3AY7A 2PXAA 2P1RA 2C61A 3NDJA 5AM5A 2JGAA 1ML3A 7MDHA 2HKOA 3MS2A 3M1XA 3A6JA 3O2QB 2HP0B 4EUSA 3I9FA 3A0RA 2Q9CA 4QOGA 3O47A 4CKCB 2EIJB 3NWJA 4DNQA 1GUAA 4P7JA 3O3NB 3OLXA 1CJCA 3PKIA 1ZKMA 3CCJF 3QBTA 3PVZA 4CM4B 1RYFA 2PMPA 3EHEA 4BMZA 1BW9B 2PWPA 1IUPA 3R0QA 2K7ZA 3ZLVA 3I09A 3IP8A 5I9LA 4R8RA 3THWB 4ZI7F 1T8YA 3LHKA 3NBQA 2MHCA 4FYYA 4WBNF 5A6VA 2PKCA 1AVMA 4HDSA 3F4BA 5JD3A 2EYQA 4DV4O 5DJ5A 3RKUA 4J2TA 3KPUA 2PBFA 1N4DA 3R3HA 3QI2A 3BGWA 2B99A 3H2GA 4GWGA 4JI8B 3G85A 3HHPA 3A2KA 1V16A 4E1VA 3DPIA 4YV2A 5EUQB 4MGIR 4CH3A 3WIOA 4QAQA 1VE6A 1R66A 3AB7A 3DTTA 5JE8A 1EIZA 4COKA 3OKFA 1ZSVA 3ILHA 4B08A 3THXB 4NYIQ 1AI5A 3STTA 2WKWA 3NDIA 4X90A 5BVGB 3RRFA 1LCIA 4QUDA 1O8CA 2HPZA 3GT7A 4PAQA 2EQAA 2CMFA 5ENDA 1DCFA 4FXOA 2BWJA 2VP0A 4K6KA 2G0TA 3KFLA 4JODA 4TV9B 4L9AA 2ATEA 4BWGA 2HS3A 4RL6A 4YHHO 1FP2A 3U7QA 4ZHVA 1R3UA 2JJ8A 3OLYA 5KX5B 1SVOA 4OU4A 5EXPA 2ZPAA 3PKZA 3LPDA 4HVLA 3RU3A 1AKYA 4C7BA 4LRUA 1Y1SA 4Y67A 4QLAA 1YB6A 4Q1BA 1XQ9A 3MK31 2DUJA 3V4FA 2P2GA 1MX9A 1ZOOA 1OYOA 1RRFA 2AT1A 3HXMA 3WI7A 3O4JA 4JUIA 1G6UA 1Y7IA 1YA6A 1JQDA 3LL4A 2O2GA 3A1TA 16PKA 1Z7YA 2CH7A 4PGAA 1UFKA 3GRPA 3UMGA 2B3DA 1YL5A 1FP4B 3CCEF 4HAWA 1XPJA 1WY7A 3K14A 4OHMA 3CUWA 1Y3DE 4C29A 5E2BA 1RI4A 3LXUX 2JRIA 5E9WA 3KIPA 2WMOB 5AVZA 4UNIA 4UCFA 4ERNA 4DM3A 3A6EA 1DFHA 5IKPA 5SY4A 5B3SB 3T7SA 4XVQA 5ICSA 1DBRA 1GUDA 1VRCA 3UH1A 3NC0C 4RSHA 3CINA 1ZLXA 1ZD1A 4V0KA 2BFDA 3UHJA 4E30A 1P1CA 4R6WA 5CHEA 1GPLA 2LXNA 1Z33A 1PFYA 1RCTE 2JD1A 4AZ3B 2MJLA 5KNDH 4BNNA 4PC7A 1JA8A 2HDOA 1G6KA 1UT5A 4RLFA 4U7FA 2HP3A 4HBNA 4F3YA 1TECE 1JG6A 2R7NA 2I67A 3M4JA 2F8LA 2L35A 4I7ZB 3LNCA 1XRRA 3BCHA 4WF9V 2P3QA 3UWDA 4PS0A 3NHUA 3L74H 4Q9DA 1U1DA 5IYDO 1WXFA 4KWEA 1VIVA 1MJHA 3F5MA 2OM6A 4BFTA 1K68A 2NYVA 3U4IA 1SVIA 2BHSA 4DWVA 3R0IA 3RGBA 2HSGA 5AXDA 3MRVA 4YWJA 4L75A 4L4XA 1JXOA 3RC3A 1XRMA 3UJCA 3BSYA 1IY9A 3KD3A 5KKAA 2OM2A 4I1YA 3ZBUA 1T5TA 4M6WB 3WHPA 3AGPA 1GWNA 3VI3B 2J3QA 2D1FA 1QNMA 3M6MD 1ZX1A 4I5GA 2IZ6A 2PLWA 1LDNA 2HFEC 5EL0A 2I8AA 1RTKA 5DBFA 1DC4A 4RLSA 3EASA 4N7RA 4WLEA 5CG1A 1OFUX 2YV2A 4ND5A 1CRLA 2HWUA 3MAQA 1Y63A 1CBUA 3NIGB 5K0JA 1KNKA 5TE9A 3N0VA 4MWOA 1ZQ1A 3IOEA 1IATA 1L9KA 1UF9A 1JQAA 4EFLA 5EP2A 4B74A 2Z2JA 2AI3A 5GM2A 2GKOA 1P5HA 1QIGA 3VYVA 3I34X 2E37A 5ADWA 1EVZA 3OZFA 5L3FA 2H7CA 4ZYXA 3PNLA 2PJUA 3TLAA 2HLHA 4FYXA 1T9AA 3GUUA 2FQ1A 4V2UA 2FHPA 1JH9A 1THZA 1NSFA 1PZMA 4R2KA 2AMFA 1TK2A 2OVFA 4PFQA 1JV2B 4X66O 2PLNA 4XFDA 3I3FA 5K1PA 2EARA 2NXCA 1U2PA 3DBLA 3QFTA 5EHNA 1HQDA 5SZHB 1DO0A 3F78A 2EL7A 2F3QA 5CFOA 5LHIA 3LQFA 3O6VA 4BV3A 1G8GA 9ABPA 2J3IA 3WA7A 3P9XA 4ZU3A 3KC2A 1UZLA 2DBYA 2ZR9A 3QVVA 1QE5A 3HYNA 1F48A 4UTPA 1CT9A 1JHRA 4AJ1A 4BUJA 2OFWA 4CI9A 4BNIA 3M4ZA 3W5HA 3RSQA 4M83A 3PPYA 2FWRA 4LC9A 3VR5H 2WLSA 1UR5A 5KYYB 1YZYA 4DIOA 1EFCA 4V3CA 3U17A 2ZBPA 2ZWOA 4P7KA 4ILEA 4NESA 4BLVA 3HADA 4JH0A 4ITVA 2B61A 4BUCA 1RXIA 1Y1LA 1QUFA 1A1SA 1VF6A 5CGZA 4H4EA 1TF2A 2OZVA 2W7TA 3PL5A 2EEZA 3D8NA 3PUIA 3LCCA 3IKMB 2F6RA 3W90A 3W8EA 1PEDA 2ZB7A 2Z4TA 3R4VA 2GHYA 3SK0A 4YIPA 3RKSA 5CX4A 1GGHA 3CW8X 3OOYA 1SQSA 3GUZA 1T5OA 5KLVH 2Z5LA 4FUQA 2GESA 5JARA 2LW7A 1FUIA 3QYJA 3SEQA 1ISFA 2QORA 3O8RA 3MT7A 2RBKA 1YDEA 2HA6A 5A7GA 2WJWA 2VPXA 4TTQA 3ULKA 3W8FA 3FVWA 1XNRO 4EG5A 1XL1A 2QIOA 3RGWS 1GKYA 4TVOA 1ZUNB 3FYDA 5JR3A 2N04A 3ANTA 2RI0A 4ZQFA 2Q1SA 2JGIA 2A7QA 1B76A 4HS4A 4U7GA 2PRYA 1ZAYA 3HBJA 3ORYA 1QO7A 2YN4A 3GX1A 1YGYA 3EF1A 1LSSA 2PMKA 1P0MA 3T3OA 2JLZA 1II0A 3AEQB 1UT6A 1CFJA 4XEHA 2ZBEA 3NWEA 2E5LB 3AG6A 5CB4A 1VQPF 4KN6A 4UTNA 3TSAA 4DC1A 1N32O 3GU3A 2O8DB 2HX1A 2H8KA 1GEGA 1PFKA 3QFHA 3CCSF 2NOAA 3C48A 1OCRB 5D00A 3TLXA 5K99A 2IL1A 3OC6A 1FYJA 1EZJA 2RGNA 1MGOA 4DR6B 1HGXA 3FPAA 3S4YA 5IUJC 1EVIA 4B81A 2IPAB 1E64A 1NU1H 2ZYIA 5ALTA 2GYUA 4JMPA 1LUWA 2PX8A 4NDAA 2DLCX 2JGDB 4WOBA 3EA4A 2X7XA 3GOHA 4R1SA 3RBZA 2HCTA 3EBLA 5IDJA 3HB7A 3PRHA 5LQCA 4MIKA 3IHKA 4KGDA 4P84A 3DZ8A 3UT5A 2VDOB 2UVPA 3DE7X 1NSTA 3EE6A 4XLLA 2ZUDA 3I01A 3NEPX 1YJNF 1HQCA 4RENA 4MHOA 4OJQA 4LJLA 1XMVA 1Y8AA 4M22A 3CUTA 2G17A 1CJTC 4R8CA 2EULA 3F7NA 4ZEOA 5JW6A 3ED1A 3F6RA 1U3CA 3TQHA 2A6PA 2Z1EA 1QHIA 2VPIA 3ZCUA 5C8YF 3GLIA 4FR5A 1EEHA 1OBOA 2Q2QA 3ABKB 1E6WA 5K3AA 2JNWA 1TJYA 2NO6A 1QU7A 1CUXA 4ZOQI 3QF4A 3AF2A 2RCYA 2YWCA 3STZC 5ADHA 4FYPA 3O85A 4B83A 2YL2A 1FSPA 3JCUZ 3NXKA 4AZVA 4JF3A 4QPJC 3FX7A 2GAAA 3KELA 4IRUB 1QZXA 1PNRA 1BGYH 4JR0A 1CCWA 3KQTA 1X13A 3RTCA 1RHJA 3NYWA 5EE0A 2O57A 4WESB 5EI5A 5ED4A 5C35A 4JNCA 2G8LA 1W47A 3MJHA 5FUBA 2H17A 3Q3CA 1H9BA 1H8HA 1I1HA 1M6NA 3E82A 2H54A 2WJ3A 3FYUA 4O3MA 3EZFA 4NH0A 5F2OA 2QOEA 1D8AA 2DSTA 2CKMA 3JAKB 1U0RA 3PA8A 3U37A 3T5TA 1U2SA 5G40A 1WW3A 1V6AA 3KJGA 1QBKC 3PNPA 1JIQA 4WKNA 3O84A 3WB0A 3KETA 1IQUA 4B9EA 3FUCA 4I2NA 2ZCUA 3ROZA 1ZVQA 2LRHA 5ELXA 1JG2A 1H8HD 4BVBA 5DI3A 3KE9A 2IUSA 3JV7A 3T38A 4YXWA 3GA0A 3K9WA 2NU9A 4H33A 3PQEA 2H1CA 1E79A 1XOIA 2BGWA 1DT5A 1VA4A 1MC8A 4AJLA 3IUQA 3M84A 1DWQA 4R9VA 4DZTA 3TVDA 1HE5A 3RUAA 1TA4A 5G0VA 2JLRA 3VH2A 4RCZA 1S7CA 1Z39A 4KL8S 1H0KA 5JTUA 1UZUA 5BR8O 3ZHCA 4W7HA 1VJGA 4RIFA 2I3BA 3FFTA 4Q82A 4EEQA 2IYSA 1QRAA 2XUMA 1W85A 4YXWD 3D8BA 5FUWA 5KUKA 1RSOB 2RC6A 4D0GA 1KZ7B 2OV8A 4P92A 4EG3A 1IDN1 4L3OA 4Q9JA 5DNWA 4QA9A 4RMGA 1ZJ6A 4MAAA 1NUTA 3O1JC 3NHWA 3OJXA 3BBLA 3RIMA 3A8TA 3B09A 4BT3A 4L95C 2BSAA 3TIIA 2P1ZA 5D8DA 2MMCA 1F4VA 1T2CA 5LMNB 1NNLA 3ITDA 3EXHA 1CEXA 4JP3A 5DYYA 2ZBGA 4E2WA 5F9HA 4PLWA 1F14A 4DBLE 3JAMM 2WT4A 1G17A 5LUBA 4AWBA 1DJNA 1H93A 4G0OA 1DFIA 1M8KA 4RSGA 1UJMA 2HF9A 2P9CA 3ASUA 3G2HA 4I55F 3Q7TA 5E6RA 4MQ5A 1I3LA 2V6BA 3I8OA 4WD3A 3DF9A 5JXGA 3GEGA 5LZ2A 1WXHA 3UUFA 2WLKA 5E6SA 2P0EA 5DDIP 1EBBA 4WA8A 3OIFA 3DBOB 2IS1A 1FBNA 4E15A 1Y4UA 1FS5A 3FVQA 5K0GA 1XAIA 3O7WA 4YAKA 1RP3B 4DKJA 3HNRA 4UNSA 3RT1A 5BV8A 1NVDA 4KXLA 1UEJA 3ND6A 4WFIA 1E4VA 1WCIB 3AHGA 4B3RB 3SXUB 4D99A 3ZP4A 3HRHA 3DEFA 4IRXA 1OV6A 4A15A 1I4TD 1U2ZA 4LHXA 4A3SA 5KHJA 2OO3A 5AK3A 5ALSA 4JCCA 4EQ6A 2ORVA 3ERNA 2J3KA 2ZATA 3T3HA 4LWZA 2FN9A 2H00A 3OQ6A 5ILQA 4MDFA 2CWDA 3A26A 5EOVA 3RTGA 2GZ3A 3BBPA 2H2GA 1U7HA 3HXOA 2JARA 4URWR 3CCLF 5L8VA 3W2HA 1DBVO 2BSKA 3FSEA 2CHFA 1QAOA 1UBSB 4V0OA 1W8DA 3A4NA 4F38A 3QOYA 4M38A 5KYXB 3OEHG 3QEAZ 2IOHA 5FBVB 4BJ3A 2XT9A 2QQ0A 3JR7A 1PQPA 1N6OA 3ESBA 3FCCA 5CRIA 1P72A 3ORHA 1C4XA 1NN3A 4TSKA 2YMQA 3IDSA 4UM9D 4TWJA 3MWEB 4TMZA 2BCGY 5C1DA 5EKDA 4LFAB 1LGYA 2GCGA 1EA7A 1ODKA 1XDUA 2BKUA 3WBJA 1HZZC 2Y2UA 1OIXA 4E2FA 1M2KA 5JZVA 3UMYA 1Z8FA 4F84A 3RYFB 4R41A 1H4SA 3A6KA 1M5UA 2P69A 2WWYA 3AX6A 3AVUA 4CTOA 4CQLA 5HZKA 4WZZA 2F8SA 2E21A 1LC3A 4N41A 2XBMA 4DNOA 2WG1A 1CVIA 1ISRA 3FPLA 2QVBA 4RF4A 4A26A 4RULA 2VRNA 3W06A 3LFHA 2OYRA 5DGCA 1NM5A 1E1YA 1E2LA 5EIFA 1XAJA 3VM6A 4B2LA 5C52B 5EBMC 2PT5A 4G89A 2CJPA 3WZMA 3SC4A 5CDSA 3CISA 2ZUFA 4UNNA 2Q0SA 3QE9Y 4IEEA 4JI0B 1DXHA 2KB0A 5LQAA 1VJRA 1EUDB 1N2ZA 1S9DA 3KAPA 3CMCO 2JA2A 5GVRA 5J1SB 3A4MA 3K8ZA 3DAHA 1JNYA 2BL4A 2XBUA 3WDLA 1IIRA 1JYSA 3BCRA 1NRXA 2H48A 1TVMA 1MLDA 5C5IA 1EJ0A 4H6WA 3SJBA 1VLLA 1OYYA 2VYNA 5E79Z 3CE9A 3AV3A 4UMEA 1G2OA 2YN2A 2GHTA 4EIWA 5KOJB 4FMDF 3EISA 1GFWA 4WXHA 4QYSA 3U80A 1KS9A 2G7MC 4ZARA 4YRGA 1KOJA 3FROA 4DR4O 3PHLA 2GZRA 2QT0A 3ZXSA 3ZEDA 3VYWA 1BSMA 2A9VA 3LUBA 2CFRA 2R4TA 3FPGA 5FOXA 4RV9A 3EZ2A 1LTHR 4KSBA 3J7AC 3S3WA 4W99A 5A9SB 5AKLA 1TGVA 4GYKA 4JV5O 3RYCA 2W2KA 3C9RA 5EPOA 1BE6A 2VYND 3H4MA 3I5XA 4BZZA 1W36B 2W37A 4QEDA 1W96A 1V95A 3AO0B 3D3NA 3TW4A 1PYOA 1SXJA 2FW6A 4MRMA 4KIUA 1U6JA 1BFUA 1C1XB 1SESA 2Y1FA 3HCOA 3NHFA 4RTRA 1IXBA 3U7GA 4G67A 4CW7A 2B94A 3AR9A 3C8HA 4LEIA 2OIGA 3DVSX 3OM9A 2VP3A 4PFKA 3PEEA 3QTCA 5DNYB 3L0CA 2OCGA 2Z2IA 1JHXA 4K6FA 4P35A 4KE9A 4IDNA 5FJJA 5CVJA 4KV7A 1TB4A 3DFZA 1HI9A 3REFA 1LDYA 2ICAA 2G72A 2C97A 4WNAA 5IAAA 1UK7A 2J07A 4YV1A 5EINA 3OUTA 1ULZA 4Y1EA 4JBWA 4FHZA 2V7TA 3UAXA 1NOIA 1A2QA 1JDNA 3EAQA 4PX9A 1ISSA 4JUCA 3VAZA 3ZHYA 1R18A 4L5JA 3CVYA 1U04A 2EGUA 2XYGA 3DZFA 1RJ9B 4YAOA 3TEJA 3QX8A 4JLSA 3NCHA 1L7MA 2BVNA 3APOA 2BMVA 1I2ZA 2BFBA 1ZVMA 1BHAA 1E4EA 1HT2E 5KHGA 4GR4A 2VBFA 4UPDA 1R6XA 4YJ3B 5ALOA 3HS3A 2GLTA 3P0JA 4ABYA 4QDOA 3ER8A 4C4SA 3OD5A 2O1WA 3F96A 3CYQA 5BT8A 4HJXA 3B13B 1YOBA 2EFGA 3VYTB 4EAAA 1GP2A 2JIZG 2XUAA 3OMLA 5KNDA 4YCJA 4DV3B 1FL9A 2HPAA 2YVUA 2QUHA 3AVQA 4R2IA 4CUZA 2FPGB 4BCDA 1I4OA 1AR4A 3EXFB 1EZVH 2LNDA 5HXUA 3JVIA 1WW2A 3AI1A 2Q9LA 4LNHA 5CVDA 4ZPXA 4DVGA 2BBWA 4RD0A 5GY7A 2XRYA 1U3FA 2IPLA 4WKGA 2IIPA 5IWAO 4M9ZA 3RQIA 2MYNA 1AP6A 1Q43A 2RGYA 4YQZA 1XRPA 2JK0A 4DCTA 4OSPA 1UFVA 2A9QA 4ZRMA 5BRJA 3PT9A 3ZXUB 4TVBA 3N76A 3I1IA 1T36B 5FI1B 5FORA 4GE0A 1CUIA 2O2XA 1TUGA 4HLQB 1N0IA 1A9ZA 1SVMA 1DC3A 4BQFA 1FJGB 1NE2A 1X9IA 3A1CA 1E1LA 4I4TA 3KCNA 1H2FA 2XDQA 4D98A 3NTVA 4Q4CA 3FGOA 3H6KA 1QTNA 2J5BA 2H7XA 3RTEA 5KINB 2PKWA 1QJ4A 1XHFA 3RJMA 4C9BA 1TVCA 4XLTA 2BSQA 3PUHA 3S40A 3P0FA 1DUVG 3BXOA 3ZNPA 3IT0A 5EZQA 2H0QA 4NBSA 1JFVA 1G41A 1E2GA 3DJFA 4W8OA 3JWPA 4D6PA 4JI5B 5ITWA 3JZDA 2ERYA 5U4QA 4JX8A 3Q4HA 1BC5A 4LZAA 2ACEA 4ZC1A 2B1RA 1AQJA 1LVHA 1A69A 3H8SA 2C4UA 4BWVA 2FMFA 2YWDA 2O5RA 4BCCA 4YCBA 1DGSA 4AY2A 3PHHA 4FS8A 4RK5A 1ESCA 1J7HA 4XUGB 4C8IA 4HUTA 3LLSA 1IWBB 3ERCA 4G0YA 1RA4A 1E2MA 1XD8A 3U5ZB 3TBFA 3KQSA 1U65A 2ZW9A 1XMQB 4YMIA 1AMNA 1CETA 5DFAA 4B7EA 4ZI7B 4HVTA 1V8FA 2GBGA 1JDJA 1HDJA 1FLVA 5DCUA 1XDDA 5DBHX 2AZ2A 3DCYA 5BW4A 1QF6A 2PX0A 4KGVA 1A88A 4AZWA 3AKEA 4MZDA 3TJRA 1MW8X 2G1PA 4HUJA 1QHSA 2P7IA 2UYYA 2Y69B 3ZWWA 5KPDA 4ZK6A 2ILVA 3U56A 4PZDA 4CM7A 4RKYA 2WFZA 3AUUA 2GRAA 1AZWA 2PUGA 2NGRA 3GNSA 2AFHB 1GCIA 3R76A 1M1XB 3W5CA 2ZRBA 3N7TA 2Q9AA 4S05A 2W8ZA 2QMYA 2AYZA 1C8VB 3VR5A 2IPNA 3CXCU 2IP1A 2EZPA 4ZV9A 2Z6QA 3K9SA 5BSWA 1JHUA 4EO7A 3LDTA 2OESA 3RROA 3PX7A 4NOMA 3CY6A 2WZDA 3GB7C 3T0FA 4UVAA 4PXYA 1SCIA 4UEWA 3ZLTA 2HPHA 3H6GA 3R6DA 1N78A 3H1HH 3HUEA 4DLWA 5A7HA 4PGGA 3KSDO 3M1AA 3GMDA 1NP3A 2YQZA 5DHQA 3BGOS 1DV2A 5TQ0B 4Z3OA 2DTXA 4EP1A 3ML1A 2QU8A 2KB1A 2QAGC 3DPUA 2QRPA 2OL4A 4PR0A 3O38A 2QTHA 1ZICA 1EK2A 4RZIA 3VQTA 3FNFA 3UVEA 3E4CA 1TJ4A 1Y1KE 5J58A 3QVJA 1WPBA 2FGYA 1UIRA 1F17A 3K9NA 4EG1A 5IDYA 5CNJA 3TZHA 4KOEC 2O23A 4KITB 2HGSA 3PNMA 4XPIB 4CNQA 4LA4A 2JGJA 1KBOA 4K9RA 2Q49A 1N33O 2LVBA 2QMHA 3BE6A 2GAIA 3IAFA 1YL7A 4DO2A 2OLKA 4IMIB 2CYCA 2D2IA 3PQ5A 4EGFA 2IKQA 1USUA 1TT5A 1Q8RA 3BFKA 4QVGA 1W6UA 3S2UA 3JAWB 3PPWA 2UUAO 3PFWO 4J0GA 4UUBA 2QRUA 4JYBA 3SYPA 1IYZA 4UHKA 3K6SB 2ODNA 2RIRA 1J24A 4DILA 2OCDA 3VVLA 2L26A 2HCJB 1E9RA 1NP7A 2VT2A 4CLOB 1K7EB 1XFDA 4V0ME 5ELMA 2SICE 4R8SA 1RU3A 5LNK6 4DSNA 3N8GA 3H3FA 4ZOLA 4U3FH 1QR9A 5IM5A 3G80A 4G3XA 4ZDKA 3KVNA 3JQ8A 4LRQA 3QO7A 1N5IA 5DYGA 4BVLA 1N4CA 3SIUA 3UQZA 1WS6A 4MEBA 3CLSD 1BEEA 1GCAA 3L1UA 1JKJB 5KJCA 4R2HA 1HNNA 3LUHA 2VDWA 3QFSA 4UCSA 3DVLA 4LCKA 5HS4A 2GJAA 1KBQA 3L8EA 1W34A 4PHGA 3O74A 3MM4A 1URPA 2N46A 1Y7LA 1UDBA 1R3IC 1Q11A 3UMMA 4WT7A 2P27A 4C1BA 4X8MA 3LK6A 4L0CA 2JFPA 2SKDA 4IHQA 2MWMA 3N2KA 3SHWA 4E5MA 5CEJA 4BJ5A 4TWAA 1L8OA 4XCVA 3B7GA 4NYJQ 2FEXA 5B7GA 4XYGA 1LEHA 4Z51A 3KKZA 1Z34A 4ZVKA 2QW1A 5EWMB 4OHVA 2YY7A 4K26A 1N92A 4LY0A 3BQMB 1FPQA 3MUEA 3K9GA 3KU4A 3V2GA 1GPBA 2ZTUA 2GCPA 1BEUB 2J6BA 4KXWA 4B33A 3K4HA 5IG2A 3GEIA 3NVKI 1QFZA 3CZPA 2RBGA 1F51E 3AG7A 1Q17A 3TNYA 3GLGB 1PNLA 3L7KA 3BWCA 3VR0A 3HJBA 5I9BA 3B48A 2FETA 1ZHOA 4PCUA 4ENTA 3MT0A 1Z2DA 1N9GA 1LFDB 2K1EA 1WKVA 1JEYA 1EUYA 1LC0A 1RJWA 2JFUA 5CIWA 2P9YA 1NWHA 4DV4B 4F85A 1P74A 1MKYA 3SYMA 3FKSA 3IGFA 2O8FB 2LJ2A 1DUSA 3X2QC 1VJDA 4UTRA 1AV6A 1ZESA 1XZGA 3W8RA 2KBFA 4B4VA 1SWVA 3MWDA 4NSNA 5G0TA 4BUZA 4QULA 4I9FA 3K12A 4JI6O 3C87A 2LIPA 1AHIA 3NETA 1T2EA 2FH5B 5AI9A 4F8YA 1J2UA 2KHZA 1PLKA 2R25B 4CG0A 2Z3ZA 4JA2A 3FB6C 4BT5A 1L4FA 3I2KA 1MB0A 5IULC 1G7SA 1MX1A 3KCQA 1JEJA 3MHTA 3FKSD 3S1AA 5BN3A 2MDTA 1LTKA 4FOSA 4NY1A 5BN5B 2R8XA 1IG0A 4YHHB 4CN8A 2CTPA 2PRIA 2YJGA 1B6TA 1W41A 2X9GA 4NJOA 4UARA 1NQOA 4ZCSA 1GGEA 1Y5NA 2Q0QA 2HLDA 4CMBA 1CP2A 1Q57A 3D7NA 1L3IA 1XTZA 2JLQA 4H7JA 2GBCA 4FBMA 3TUIC 4FIPC 1PQUA 1FB5A 3P26A 4MRVA 4QPZA 1M1KW 4MVQA 4N82A 2X6CA 4TLDA 5KDOA 1WA8A 4WRRA 2QD5A 3RS4A 2Z09A 4F93B 3L4BC 2P9TA 4C21A 1W5BA 5F4BA 1H42A 2XZTA 4CKWB 1KK1A 1M2WA 2FLWA 1D4ZA 1CUCA 2GHQA 4UHFA 1I1OA 4CIAA 1GZ6A 2HLDD 4CLEA 1T3GA 1QCYA 4C0HA 3ASZA 5F2NA 2CNLA 3S06A 4Q34A 3FHJA 1FTGA 4GPEA 1BVYF 1QIKA 4RK0A 3GFOA 1ENVA 1JX9A 1X7HA 3QKUA 3N6RA 4MVCA 3T41A 3P2KA 3LV8A 5F73A 3LY7A 5LZ5A 4IP0A 3FNBA 3JD1A 2P68A 1RRMA 3JQGB 3O8CA 5J2TB 1KP3A 1V7PC 3OT4A 3F6EX 2CL0X 4AQ7A 4TMYA 3UV3A 4ZVRA 3G0IA 1ZDMA 1YZGA 2WD7B 5F2VO 3WHLA 2E49A 1G38A 3MRSA 3FDXA 4QOJA 1KVTA 1UQUA 4BFSA 4PGHA 3H2KA 1E8NA 3ESYA 5E4JA 2I3ZA 4RORA 5CDYA 2E89A 1LA2A 2QUBA 1UZMA 2A35A 2RB9A 3IT1A 3N28A 1UJNA 3IRUA 1ZD8A 3QMWA 2FMTA 1G21A 2CTRA 1UJ5A 5A0VA 5FUXA 3PXEA 3SX0A 2WILA 3AI7A 5DLEA 1N7JA 4DIDA 1EESA 4OXXA 3D6VA 3O2JA 4P5PA 1TQ2A 2O8BA 3LDCA 3OEWA 2NTEA 1E8MA 1IV2A 4IL5A 3GYGA 3CLHA 1DF5A 1O0CA 1VCIA 1GEEA 1BWSA 4JBNA 1QCZA 2A14A 3VDRA 2ZJ0A 5HFMA 5K3CA 3EOAI 4BXOA 3GPDG 3ZR4B 5C8YB 4A23A 3UB2A 2Y4OA 3JATA 3B1VA 3MTQA 2M7WA 3C3TA 1VQLV 4HAMA 1XU4A 4D0SA 4RZSA 2JIOA 5HGXA 4UHJA 3ZK9A 3TRKA 1Z0AA 3JVHA 1TJ3A 2GN0A 2PL5A 2DGDA 3IUPA 3MBKA 3F1KA 4I8IA 4XOUA 3ZCVA 5JDIA 2XLBA 4U9HS 1V43A 4J2OA 5EJIA 4EMSA 2G9UA 3TOZA 3AIMA 2AKYA 3KVYA 1VM6A 1K8AH 2KTUA 4Y9DA 3IAXA 3S2YA 5B53A 4FOOA 4X66B 3CC7V 4B7KA 1FTQA 2I4TA 3LC2O 2WICA 3K92A 3MCQA 1GU0A 2L17A 4HSEA 3DP9A 1T2VA 3DCJA 4ZCLA 2FTKE 4BGEA 1CR6A 1NXXA 3BMQA 4P3XA 4C7OA 2EW8A 4D4MA 4I0XB 5AJXA 4G4XA 3RU2A 1P7BA 5CIQA 4Z1MG 1FMTA 4XAQA 5BMVB 3AEUB 1QQ7A 2DHCA 5H6QA 4B09A 5DTMA 1T34A 3I61A 2PFKA 1G9XA 4O25A 2Q1UA 3LWBA 5AUNB 1TCCA 3CSSA 4JEMA 1JB1A 3LHDA 1W4RA 2AGVA 5DEDA 1CERA 2CNKA 3QVOA 4XDKA 5KCZA 2IQ5A 1RHRA 3EOZA 5FP0A 3SQMA 4INOA 5JUWA 4M0PA 1Y1RA 5DKFA 1C9MA 1AI4A 1YBHA 2GARA 3RA6A 4WAUA 5EMJA 1IQPA 1J42A 1OFUA 1CF4A 1KJ8A 4Z4EA 2OCYC 3X2SA 3EPLA 1NVVQ 3BMNA 1XVAA 4YROA 3FKQA 5LMZA 1UODA 4N5MA 1TIKA 1V71A 3KYDB 5HP8A 4KUMA 1SUPA 2R00A 4PZUA 1CEQA 1I4LD 1P2UA 2XF2A 4XWGA 2EWMA 3EFBA 4K9SA 3B5IA 1Y3HA 4OHOA 3CNEA 3HVRA 5ECGC 3B36A 4ZT6A 3L70H 2XTZA 3OH8A 3DFMA 1Y7TA 2EQ5A 4MWGA 1HDXA 1ZCJA 1JAIA 4GKJO 3WSWA 2VAMA 3EQ2A 4EFMA 1DXYA 2XGJA 4C03A 1A9YA 3D7MA 3D0KA 3ZV3A 1NU8A 3K20A 2H65A 1PVOA 4M8SA 5IMBA 4E03A 3FDFA 1OE0A 4F5ZA 3IVRA 1XNRB 2M1XA 4B3TB 3KB2A 1N77A 4GX1A 4PPGA 1CUBA 2VTBB 3SR3A 2NMVA 2JVDA 1QDUA 3BAFA 3OZVA 3ICOA 3LQ4A 3UW1A 2HIAA 1XCLA 1QYRA 1MZVA 1GNQA 4PJ0Z 2ZTVA 2X41A 4CHTA 3AK1A 5DV9A 5DN9A 4NQ3A 2FSPA 3FCUB 4X9XA 2PMBA 5EN4A 3PTLA 2OHOA 2M9MA 1EXMA 1M1YA 1SPXA 4I50F 2C2ZA 3Q8XB 1N32B 2HMAA 4G4YA 1XL0A 3J81k 2QG4A 1TC1A 4LSZA 4N48A 4YGYA 1JHOA 4MV1A 1TRHA 5HP4A 5JHHB 4CL3A 2NU8A 4EF5A 3HH8A 4Y1RA 2QRQA 1VQ7V 1R9GA 3OT7A 2PUFA 3KYCB 3QF7A 2HRYA 2H4JA 4WXPA 4ER5A 1T1RA 4I8XA 5GZ1A 3AGQA 3PRYA 2XGGA 2NW6A 3C7TA 4EA6A 1KAHA 2CJWB 1JHDA 1JSXA 4TQFA 1WR8A 3MLBA 3FUWA 3B3FA 1Y7PA 5CXUA 5K4AA 4J6FA 1EDZA 2RH5A 1XXHE 2QF7A 3EIHA 4O1IA 1M2VA 4O4JF 2Z56A 5AH0A 4QGPA 3LXRA 4OO3A 5CAEB 4ES6A 4UUAA 1SVKA 1KI6A 1F3LA 3NU1A 3P2MA 3OPYB 4MWSA 1ZL8A 1OCEA 1I80A 1U31A 5EQJB 3W2GA 5LDHA 2B36A 4OTZA 4ALLA 1YL6A 1GNSA 3G1UA 3T5AA 2JK5C 5DM6V 2Z5FA 1YJXA 4RDHA 5IBPA 3HDQA 2CBXA 2YNMD 3PHGA 4YJ2F 2HXGA 2PL1A 4FEAA 5HQTA 3CPWF 3TTYA 2GF2A 4OQFA 1LU9A 5BMOA 2Q5CA 3G13A 4QSHA 1HDIA 5CMLA 5JAQA 1XMIA 2FPSA 2AR9A 2EBHX 3TLEA 2HJDA 2QX8A 1FIUA 2W0SA 4AN4A 4M0CA 3DE6X 1VPDA 3WWDA 5LQNA 1O03A 5KI6A 1WPGA 2JFQA 4I4CA 1A8HA 3A0UA 1FFWA 1K8RA 3F2VA 3HXQA 2BFFA 1HP8A 3N5KA 2H63A 5JJLA 4D92A 5L3BA 4QJ5A 1VLVA 3OF3A 1ZD5A 2J0UA 4QTXA 3CWBH 3OZIA 4YACA 2EP5A 4C3VA 2A59A 3BHMA 5JZMA 1F7UA 3Q1LA 2HV8A 4QPNA 1VQKF 3U49A 1N2SA 4TVSA 4ALNA 3AR4A 2PXHA 2QP3A 4LSGA 3RSLA 1XCOA 4N3AA 4UUMA 1DKMA 3DF7A 2LGWA 1FYXA 2X9LA 3W5VA 4XFJA 3WFJA 4OGLA 1XCPA 4YUZA 3B1XA 1NY5A 1T8UA 1QLEB 1JMVA 1A7JA 1S76D 4XB2A 1FXVA 5BR8B 5DGIA 1JN0A 1CQIA 2CEAA 2ZTLA 6YASA 2P0AA 1VMDA 4CDMA 4DQDA 2OB1A 1UM9A 4WLOA 1W5AA 1GX1A 3O4IA 2AV6A 2FN7A 5DHFA 2ZEJA 2JJ1G 4DBLC 2O8EA 3JVEA 3JD2A 1PR5A 1HKHA 1DBQA 4FEEA 3AIKA 1MDFA 1BGXT 4F1KA 3IELA 5L7YA 2C3YA 5MN4A 4R2JA 4EL0A 5ICCA 4DA7A 3TD9A 3V4VB 3SPXA 3HYSA 5EP3A 5FOWA 5CN0A 5EXDA 5DM4A 2G7ZA 4A8JB 2Y8EA 4LIPD 3ZUGA 4DC0A 1KORA 4HRVA 4MPPA 4ENUA 1W48A 1Z5VA 1ZINA 3K0FA 3U4QA 3QPCA 3PSHA 3MTAA 3IAYA 5KYWA 4A10A 1NMXA 3ZW8A 1A96A 1NLMA 3IOMA 3BUSA 2VATA 3FNEA 2VN8A 1BT8A 3QI7A 1NS1A 1UOQA 1IZ7A 4PG8A 4G4WA 4MQ6A 4HX2A 1SOAA 3Q8KA 2P9FA 1O94C 3A6LA 4CKBA 2FEPA 4AO7A 5CYPA 3NG1A 3P8ZA 2BHTA 3HB1A 3FBGA 1VF7A 3FYCA 5A2QN 1W5FA 2NT4A 3QE3A 1Q1AA 4FSHA 2V9PA 4JXXA 1EEXB 5HZMA 5K3OA 4C0AC 2O2YA 1SB9A 1VMAA 1RSZA 5ARDA 5G0WA 3GH3A 4Q3CA 4U7NA 1E9AA 5K0BA 1TKRA 2Q4RA 4R9UC 2FMXA 3EGDA 4R1MA 2HQRA 1S7GA 2ZVZA 1NMEA 3FUTA 1NFFA 5AKEA 2PYIA 4PC2A 2XMRA 5K8TA 1GPJA 1IEWA 1XROA 4L5IA 3QJYA 4FVTA 4MIEA 1RYNA 1XD2A 1RVDA 3M5PA 3ELBA 1I0ZA 1AB6A 1HTTA 1Z4NA 2IGTA 3K03A 3L0BA 3KEFA 2LW1A 5GV8A 3PQ3A 2HMUA 3ZNQA 4XZ3A 5HUJA 2RHWA 2J9ZB 4Z0PA 4EHKA 3D36C 2ET6A 1Z5UA 3L1IA 3DV0B 5LA6B 3IVCA 3HCWA 1YKSA 1BO6A 5IKEA 2PMFA 3ZD6A 1Z74A 3DEYX 1A9RA 3HI4A 3BF8A 3H5LA 1ULUA 2ZOSA 3GH1A 4TTVA 4RZXA 1RXEA 1Z2PX 1IXSB 1IEVA 1K73H 2OB2A 5G4KA 5MN5A 1JJOA 2O2SA 1Z8DA 4P83A 5J2UB 2QX7A 1N2BA 3K8QA 3RSGA 2LDXA 1OCOC 4JI2O 1U8XX 1MZFA 3NW9A 1CB7A 1RT9A 3U4AA 4FNMA 4F6CA 2HYDA 1E7WA 4JJ6A 2YOFA 1WQ4A 4BJ1A 2R9IA 3LDHA 1Z47A 5I7FA 3CONA 3U3XA 2XMDA 3QE4A 1OBVA 1FJ2A 4IJVA 3ZOKA 1QHGA 4X8HA 1NX6A 3RODA 4F5DA 1U7DA 5A7FA 3ABRB 3LHIA 1V26A 3TG8A 4K6MA 1RYEA 2FY8A 3KBOA 5FNVB 3L1HA 4IO0A 2KG7B 4IOKA 1WNSA 4W5HA 3CVOA 1V35A 1U28C 2Z1TA 4HQLA 2OGUA 3SCZA 5DE3A 1QV6A 5IHXA 1H1LA 3LQ1A 4ZALA 3CRNA 4HAOA 4PAWA 4CLRA 4LJRA 1QF9A 3GRKA 5G0SA 1PNVA 2WSIA 2IPMA 3QVKA 2W2OA 4QOEA 1OWOA 2YRFA 1DC5A 1CG6A 1W30A 2AE2A 1PGNA 3VSDA 4EVQA 5H16A 2J5QA 2G06A 4YALA 4OP2A 1U0NA 4D96A 4W8HA 2H52A 1I2MA 3Q98A 1P9WA 4PA4A 1AC5A 3G2NA 4EF6A 1EQ2A 2FUCA 4DR4B 4MSUA 1RM1B 2Z8ZA 5T4HA 3G5MA 4KQIA 1VYHA 3F8SA 2CNDA 1S0UA 3GNTA 5EC2C 4LRYA 2O2EA 4IVNA 3WLFA 5IT9N 2ZDIA 2IJHA 5IP5A 2ZSEA 2FX2A 1J9EA 4JJ4A 4BVTA 3TX2A 1GGKA 2EQBA 4JV5B 4EQZA 1HNZO 5CD1A 2G1KA 1FVFA 1DJOA 3JRNA 1G60A 2K6GA 1NBAA 1XD9A 5AWFC 4QTUB 4O2AA 3AESA 4WY8A 4B3MO 2NM0A 1CRQA 3WWOA 1SHKA 2A9HA 5FWYB 4BO1A 2HJHA 3GLFE 3RIHA 2P5OA 2VVTA 2JHPA 3H84A 4BLWA 1NVWQ 1E8DA 3P2OA 2Z98A 3HY6A 2ILMA 1VQMF 1DAMA 4CTKA 3NVKE 4MCIA 2D0DA 3FVRA 2XWBF 1VLQA 1YJ9V 1ZSNA 3CCQF 2HT6A 3KZVA 4E3ZA 3AVYA 2RHOA 1BSVA 1KGDA 3V46A 1H47A 4CHGA 1JIUA 4LVNA 5LC1A 3HXKA 1K2WA 1W2GA 5HFNA 3CEPB 1ZG3A 4I99A 4YYZA 3SSOA 2CNWA 3T5GA 3IEXA 1KFJB 1Z7WA 3MGBA 1JD1A 4G4GA 4C2UA 3SBOA 3ND9A 4I1VA 4YIHA 3FYEB 2B8JA 3C97A 1T4CB 3L7JA 2GN4A 1P17A 3MGGA 5DT2A 3IQZA 4MVOA 4DB4A 2W6CX 2QTGA 3DUWA 1RIIA 3OP4A 3HXLA 2BR5A 1DC7A 1B41A 3ZBQA 2WUWE 4NU6A 2CNWD 4RO2A 1Z06A 1TU4A 4JASA 1IAVA 1Z4PX 2DUUA 1CEZA 1E99A 1QV7A 2I7XA 4TTJA 2WLIA 1ZCBA 1WHTA 3T12A 2QZJA 3G9ZA 2L82A 5GINE 1BGVA 1PW5A 3LYUA 5K5EA 1Y74B 2DWOA 3FZGA 4CH5A 1LPNA 5IWAB 1MAAA 2G88A 1TO1E 3R9XB 4OM8A 1AUVA 1Z7EA 5CEEA 2XNJA 2TMYA 1G8JA 4MV9A 1Y9ZA 1USWA 1EHYA 4LK2A 2P06A 4WVFA 1ZH0A 5LXTF 5TVKA 2WLMA 2BN4A 3T5BA 1XHOA 3HU1A 3PX2A 3GB9A 1KOGA 3T5MA 3N2ZB 1ULAA 2QGZA 4U3JB 1FU7A 4M88A 2BEWA 1BVHA 4O4IA 3FTNA 2B37A 3M6AA 4BZXA 1H2AS 1QCDA 1T9GR 3HZRA 3O83A 5ALGA 2RI1A 1JVNA 1NKDA 4FZ5A 3D3WA 5IS2A 2WJ4A 3A06A 1W0JA 3QBVA 2B82A 4YAGA 1DEAA 1KYQA 3FW1A 4HXEB 4JNKA 4KMOA 1EA5A 2X0KA 1XZIA 3LY9A 2D1TA 4RK1A 3E6AA 4EW6A 5EVJA 1E32A 2ZJOA 1SIWA 3GDOA 2FG5A 1STOA 2DWCA 1W0JD 1JLKA 2PUEA 3BFRA 4E12A 3C5HA 1OX5A 2QR3A 3KKYA 5HY4A 3E8XA 3TI9A 4MPRA 5E4TA 1WPQA 2P4VA 2OGSA 2H5IA 4YECA 2C57A 4IYJA 2GXUA 2EIHA 1XRGA 4GX2A 1HFJA 1C7IA 1RBZA 1JTFA 1I5OA 3ROXA 2EJRA 4CMCA 1BMDA 1AUPA 4AZ0A 2C2OA 2X7HA 4CM8A 4AZSA 3GEBA 2HRRA 3OT1B 3QELB 1Z63A 4BP9A 4B43A 3S2SA 3TD4A 4PX2A 1QGUA 3EVBA 1GMGA 3CCVF 4C5BA 4EFNA 3HJHA 3Q7SA 4WJZA 2Z3VA 2D0PB 5CH3A 4UXHA 3SJAC 3M81A 4MGEA 1MO2A 1JSCA 3W5JA 4X85A 1FYWA 1DAFA 4FK5C 1TNDA 4I3HA 4CG3A 1RM4A 4HWSA 4NC9A 3P0RA 3USZA 1FE8A 1EE1A 2JGLA 2ARKA 4CM9A 3UHOA 4X1YA 3ISTA 1JSRA 4BQSA 4QXMA 5JMWA 3PV0A 1P2FA 3QTYA 2A30A 2G25A 4NR0A 4DCNA 1D1PA 4ZEWA 5FTWA 5JC1A 3A2MA 4Q1EA 1T5SA 3FUUA 2HEIA 2PS0A 2QDXA 4W63A 2VSNA 4ZI5A 5IVKA 4DSUA 4LTDA 2HRUA 1V0JA 2FSVA 2OGZA 2PUBA 5TDHA 2Y05A 4NMHA 4FYMA 3IDZA 2PMCA 1W75A 1XLTA 4J80A 1HYBA 3PXAA 3CC2V 2PQ0A 1VQ6F 1K6JA 1OH7A 4CWAA 1L4MA 3SWWA 4CM9D 5C9ZA 2XQIA 4RTKA 1N8TA 4ZZ2A 1OC4A 1E2IA 4YH1A 2BMWA 5HX7A 2CVQA 4Q4HA 5EBLC 5B4TA 2QE7A 4CI0B 3R7WA 3V8RA 5ESRA 2XHZA 1KMQA 1EH5A 1RMTA 4AIRA 4I5IA 4Y7CA 3CPQA 3ELWA 3CRMA 2FB5A 2UUAB 3DMTC 4QUGA 2OBBA 3DWFA 4S1PA 2X9VA 3MB8A 4H7KA 4K05A 3DDSA 1VSVA 3ETEA 3HM9A 2CW4A 1NLFA 2EZ4A 4NCHA 5FLXM 5K8JB 3FPHA 2IYQA 4NNJA 3JPYA 5BW5A 2QE7D 3P1JA 5FLKA 2ERCA 4HGNA 1QZZA 2BDTA 1KYWA 2OOSA 3RWMB 4LQDA 4MQEB 1GN8A 4ZT4A 5G53C 5KYVA 3ZJ4A 4TLMB 4IHJF 1VSUA 1YNOA 2GEVA 5AXCA 3JYHA 2Y3IA 5DLYA 1W88B 3IHLA 3DGEA 4A92A 2FPUA 1JAZA 1B8NA 1RRKA 1S72F 5EJ4A 3MPOA 3TLBA 5KWSA 1L5SA 3R7FA 2AMYA 2HP8A 4FOTA 1W73A 3ZQUA 1ZNWA 1XVTA 4KC0A 2PWBA 2X5JO 1B14A 3FE2A 2XBLA 4HNRA 3H99A 3LIPA 3M1IA 2WWGA 3HB5X 1LLCA 2ZSBA 2WINI 4ZQIA 4A16A 4TSFG 1G42A 2X6AA 2QROA 3RTBA 2V96A 1JKMA 5HF6A 5CTJA 3O90A 1XNJA 2IJIA 5B1AB 3NYQA 5K0SA 2HQ1A 1XBLA 4UBIA 3BFXA 1XMSA 3WPWA 2FUKA 4DTCA 1VIYA 2OBFA 4J9YB 2ATIA 3OIYA 1QCCA 1K27A 2RHGB 4IMPA 5CYGA 3GAZA 2NPOA 1YVWA 2PL9A 3O91A 1YQNA 4F71A 1GZVA 1ISPA 3QWIA 1X39A 5JRJA 3V8VA 1Z4MA 1L1FA 4D80A 3L6RA 1T35A 2P2LA 5IASA 3TL3A 5DBIA 1FXUA 1V55C 1Q95A 5E2IA 4RA6A 1NKTA 3PFBA 1M67A 1UPCA 1MHPA 1AHPA 2JH9A 5AHRA 4F3CA 2HSWA 1U8UA 4PZEA 4B8WA 1FMLA 4ARUA 3L9XA 2CNNA 4GOOD 1HE4A 1DUIA 3AUFA 3WLLA 1JZSA 1SCUA 4D4JA 4B6SA 2ZRDA 2XOXA 3KQVA 5C1PA 3V7WA 3CYPB 2QRMA 4ZAZA 3EW7A 1YJAA 3R3YA 2EILB 4W7IA 1G4YB 1BS9A 1QRRA 1RKBA 2H51A 4MVYA 4IJUA 3SHOA 4HVCA 2VUTA 5GZ3A 3V3KA 5A1JA 1YIJF 4R5MA 1B6RA 5HZGA 3DZJA 1WAZA 6GPBA 1N7GA 4S1OA 3E8FA 3QITA 1W93A 4JI6B 4PZYA 5DYIA 5GONB 3WGZA 3H18A 4Q03A 2P9GA 2W9XA 1TA8A 4GLFA 1OA0A 4GLLA 5E1MA 1NT2B 1AHNA 1DAKA 1V11A 1DEKA 2V03A 3O92A 4XJXA 3VX3A 4TS3A 5JASA 4CF4A 3BSFA 4DCGA 2G77B 3EG9A 3AF0A 4IWYA 1NDQA 2BE3A 1YJCA 5TEVA 1ESEA 2JATA 3N05A 5LL6Y 2QTSA 3JYCA 3UA3A 4FXPA 1W46A 3ICPA 3DA8A 3NR7A 1BHBA 3BABA 1SZPA 4LHEA 9LDTA 1Y6JA 4KKVA 2VTEA 4DADA 2Y1CA 2X0EA 2FP4A 4L87A 3UG7A 4EELA 1C7ZA 2PKEA 1H2BA 2QNRA 3ZE0B 4DIUA 2IZ0A 421PA 4EHIA 2FYTA 4A2CA 4DB2A 3ZJUA 4P4UA 4KWHA 3UUEA 4O4LF 1E1CB 1BXGB 4P4NA 2HZ7A 3UBTA 3GRAA 1KMIY 3SU8A 3RUCA 5EK0A 4G8DA 4Y18A 1UJBA 3OESA 4ZZ0A 1MO6A 3HB0A 3CMEF 1YZTA 5ILOA 3C6YA 4AF6A 3T15A 4ETIA 2VHYA 3C90A 2YHBA 1M57C 2Y6VA 4G36A 3BYZA 3ENZA 4M7RA 1BJRE 1K4KA 3LRXA 3IEQA 1EM1A 2QUZA 2OK7A 4FKZA 1CDEA 3QIVA 5DSTA 1OZHA 3EFFK 1W4LA 1COWG 3TCKA 2I65A 3P9KA 4LDRA 2AE1A 4Z1OA 3K2EA 1XZPA 2H8GA 5DNDA 3F4LA 1NUSA 4J9UE 4LRXA 3OW2F 4N47A 2BF7A 5HCUA 2E9SA 3PFCA 2LKDA 3NC1C 3UUGA 3B2EE 2XMGA 1C1HA 2PSJA 3ZXIA 3PXDA 1KQSF 3K0AA 3HKBA 4HGPA 1OKKA 4KIJA 4M0EA 3QFCA 4EECA 4C4TA 4J03A 3EFEA 3K7EA 3KX2A 2CHGA 1T2FA 3M6XA 2VJMA 4AJOA 2IAFA 2EWWA 3QA3E 1NW4A 2Q3BA 4DV6O 4NQZA 3MLEA 2W2LA 4YWHA 2W2NA 3MDOA 4F0JA 3I1JA 4WBNB 4ZO7A 1RLTA 3QUTA 5DCVA 2A1UB 2OEPA 3DE5X 2QRVB 4P82A 3JASA 1GTG1 3GCWA 2QTZA 1AGRA 1UKEA 1OKKD 3K70D 4Z0TA 1NXTA 2CZCA 5HVNA 4MROA 2O3RA 2R0QC 4A73A 2DPHA 1BD3A 5EWLB 1VKJA 3FRHA 1VG0B 4BTVA 2XXAA 2PTMA 4FYKA 4D7SA 3U9LA 1C3JA 4QICA 3AP1A 2BHNA 2W2LD 1JNXX 1HQKA 4XTCS 4XWOA 1ZFNA 3OUFA 1L4EA 1SD2A 1N8RH 3IH5A 4MW7A 1QIDA 2OXRA 1TM5E 1NV8A 1USIA 1ZJWA 1A7AA 1WJZA 4PYLA 3ZX6A 1CWUA 4MW9A 1KQ3A 3RW9A 2G5TA 2QM0A 3T7CA 2I4RA 5GTDA 4IDGA 5HF8A 1NMYA 5JNLA 4F2DA 3OJWA 3PFFA 1L7OA 1VZ3A 1E1MA 2O3QA 2GF0A 1RE0A 3R9WA 1F6WA 1LZLA 5LQUA 4F45A 3B9BA 3DZGA 4PCVA 4Q6GA 1RFLA 5B6JA 2BKXA 2DW4A 3WQSB 1V3QE 3R2JA 1ZVVA 1NVAA 5AI5A 4OYYA 3UYKA 5H9CA 3F5SA 4L0QA 3DQPA 5CTAA 1KJJA 2PS3A 4UZFA 2A33A 4YI5A 1TKBA 1HDZA 2GRUA 3BEHA 2JG3A 4HYTA 1JG1A 2DEUA 3L84A 2BFMA 1VGRA 3DC7A 3CXRA 1YE3A 3H9UA 5EXEA 3PAFA 2XNSA 3JVDA 5B8FA 1JF8A 3MAAC 3OFNA 1HRKA 3CCRF 5CCBA 1VGQA 1DAOA 2RHLA 2FLVA 2VG8A 1GM7A 3R40A 4JXJA 3L7BA 3RC1A 3X2EA 4HNGA 4HP8A 2QZSA 4DLSA 2ODTX 1PUXA 1ZR2A 3FNHA 1XJ5A 1J5PA 1DL5A 3O9OA 3B6ZA 2JS5A 3TW8A 4W5QA 3B7WA 4PDLA 5EO3A 4XRGA 1C0IA 1FX1A 4HMQA 1H1TA 4IPTA 1TF5A 2ECKA 1QF7A 2XQFA 1MX5A 1ZAKA 1KXJA 2VS0A 5F2EA 1I8TA 4LF9O 1RM0A 4RZHA 5IPFA 5TJHA 3GIWA 3OFND 1JQKA 3TPFA 3ECAA 4UFZA 4QO8A 1KBZA 3IDFA 4FX5A 4Y9TA 4IL6Z 1XTJA 2NWQA 3MLAA 3LSSA 5FWXA 4UVIA 3B20A 1DDGA 1Z17A 3CX3A 5KSWB 3SXPA 2VJQA 3LTNC 2F3UA 5K8VA 3KEGA 3OOWA 4Z9FA 3PPXA 4GKJB 3U60B 2C7RA 2NXNA 4F97A 1VPVA 1JR3E 4URZR 4AHCA 4MW2A 2C77A 3I5YA 1GYQA 1ZVKA 4JI3O 2WQZA 2Q4EA 1MABA 5DM70 2NQTA 4YRCA 4IBOA 1CW2B 3T3PB 3QH4A 3JALB 4KN5A 3CIFA 5LD2C 1L7PA 4I1IA 2ONYA 2CF6A 4MUFA 1FTYA 2C00A 2FR0A 1PTKA 2ZB8A 2ZI7A 4HDAA 1CS0A 1YFZA 2JEOA 3DBIA 2C9ZA 1KNQA 4PLFA 5FOQA 4XIJA 3CB2A 2OMEA 4FLFA 2YHUA 4BT2A 4AJIA 5LOVF 1N7IA 3CLTD 3WOVA 3R65A 3EGCA 1F4MA 2Q5OA 3ESDA 5C2JB 1X3LA 4JEHA 4KO1S 4LS3A 1U2RA 4AU1A 1R4MA 4OQYA 1MN6A 4OI2A 1Y4ZA 2WU4A 3KT3A 5AG2A 1XRSB 3I8XA 4WLUA 4MMXB 3UGKA 4PIVA 1K8AW 4F3NA 3ZGVA 1RI5A 3A9SA 3EVNA 1Y8RB 3DTVB 4GMFA 2YI8A 4WOCA 2ASVA 4Z9BA 3RV4A 3E7WA 1SWWA 3D2AA 2QYTA 2I6QA 3OKAA 1ULHA 3V8NA 5HFAA 3G5AA 2WLTA 3PGLA 3ETQA 1N6LA 1JHAA 2AG5A 3KJIA 1ZMOA 4LCJA 1UPAA 3JARB 1YS1X 3ZV7A 5BQXA 3KJQA 2DBQA 2FEWB 1K9MW 2AOWA 1MVNA 3NFYA 4DYDA 4GBJA 2QDKA 4KDFA 4TKUA 4DJFC 4J3NA 1QAMA 3CCUV 1AF4A 1BHSA 4I4LA 3HYRA 5GW7A 2CLIB 2FFAA 5EQTA 5AW9A 3K9BA 1HMPA 4UTVA 1VCMA 2OE2A 2Q7DA 2VWKA 1WUJS 4XQGA 3EIXA 1JHQA 2CBGA 5K8UA 3KQHA 5F5NA 1VE3A 5BNTA 2O52A 3K9FC 1RYMA 3DKVA 3A3OA 1IB6A 5I9IA 3UKJA 3L02A 3IBCA 1IE3A 5BRNA 2CHVA 2UVQA 1GZ7A 2GZ2A 1Z75A 3B78A 3CRCA 1AK9A 1CE8A 4A6PA 3ASOB 1FFXB 4JBIA 4HDMB 1UI9A 3OA2A 2ZT8A 4YRSA 3I30X 2OCAA 3AUTA 2I1QA 3GFRA 3CUVA 3GHZA 3KOXA 5A9GA 3ACDA 3HGQA 1QHHA 4DIKA 2PRSA 1M56C 3RU7A 3P4XA 2BFPA 1CZUA 2PT9A 4M1QA 2D1SA 1JJBA 3K5PA 3DEIA 4IQ0A 4OGQB 3UPUA 1X19A 4RUFA 4C7JA 2AZTA 4DYVA 4DQKA 2HT1A 2DM6A 1DKUA 1S0VA 2IXBA 3TECE 4GEGA 2GBLA 2RJ3A 1NJFA 4KBFA 3JAMN 3U40A 4FGKA 1L7VC 2ONKA 4CEHB 1F5SA 3RREA 2HK9A 1L7DA 1WUIS 2XB6A 3JZMA 5CXXA 3K9CA 1GDDA 1P44A 2XMSA 3IVGA 2A7XA 5JG7A 4W9MC 2G08A 3LQQA 3EODA 4NZZA 1QVRA 1D03A 4K9PA 2UZIR 2PGGA 3ZHVA 3VO8A 2LCIA 1B15A 2REOA 1G291 1JT9A 1OWNA 4I4IA 4DA9A 3ETDA 3SS7X 4IDPA 4YGXB 3VSBA 4X00A 1PSZA 4Q05A 1AX9A 1QK5A 1WU8A 4ZQCB 3HMKA 4PC1A 4BGDA 1XDCA 4F9GA 2H31A 4JSRA 2QVLA 3V9PA 3T4UA 1KBHA 4G25A 4LBEC 1ZGAA 1BX3A 4YREA 3DR3A 3I9NA 4BP3A 3LHFA 4X6UA 3RS7A 5T4FA 4CL0A 2V55B 2IDMA 4BGIA 1GGNA 3MS7A 4I9QA 1YMVA 4LISA 3NNSA 1YA8A 3W4KA 2JLCA 2ADMA 4ZCQA 2QRGA 1VMKA 4Q47A 3OE7G 2WG0A 3C45A 4MKGA 4CGYA 1TZCA 3RVPA 2HR1A 2TYSB 1NUHA 4ZMSA 2YIVX 4JWKA 4CTMA 4YN3A 2W6IA 4ZT2A 3FG9A 2VHQA 1F06A 2GK3A 3QKRA 2D2VA 1YIDA 2BM8A 2Z95A 3LXMA 1EFPA 1WU7A 4HAIA 2V7XA 2P9EA 1FXKA 5EJ2A 3ETLA 4W8GA 1WPRA 1QGDA 4QJIA 4C4PA 2HAEA 2CY0A 1EFVA 1SUCA 3CR7A 4RJJA 4ZEXA 4B7CA 4P9OA 2ZR8A 4RXMA 4KE8A 3P4YA 3OPVA 1NU6A 4JY7A 3L4JA 4Y2VA 5FT9A 1SU7A 2W6ID 1I3CA 5F9FA 5HIAA 5KTKA 2HP0A 1TDJA 4CKCA 1IY0A 2Q3HA 5J5AA 2GXQA 2FZLA 1J2TA 3OFKA 1JB9A 2WV9A 4CMEA 1JKFA 4OI4A 4CM4A 1FNNA 5G2OA 5SZIA 1XPOA 4NG5A 3E89A 2ZJ3A 4RFLA 1OBHA 2WV7A 2QRJA 1GZDA 1E1QG 5FOTA 1NF2A 3U44B 4D9CA 2VZ8A 1FYVA 5FL7A 4ZU6X 3CO0S 4DQ0A 4G27B 3DCIA 1EFRG 1YDGA 4WJLA 1IRXA 1SOMA 1F9EA 1V5FA 4CM6A 3LP6A 4F8JA 1J2RA 2PGOA 2HA2A 1Y80A 5LXTB 2ZZKA 1K9MH 3HCNA 4RHTA 1KIMA 1PHRA 4GWKA 2Y1LA 4I5DA 1NHGA 2A0YA 3AUAA 1BE1A 3ABLC 1E59A 4CFSA 2WM2A 5FL7D 3A31A 1VHTA 3THXA 5JCZA 3I04M 3VYUC 2HKIA 5BVGA 4DOMA 3F6MA 4I1UA 3R5XA 3V9AA 2OCBA 3VZBA 4LRTB 2YW9A 1BE0A 2ZAUA 4JI2B 4HC4A 3BS4A 2NZVG 4BEJA 3PQDA 4XYLA 4EUFA 4AQDA 2WM8A 2GLZA 4LWQA 3AEXA 3NK7A 1KJIA 4TV9A 4MVJI 1RPZA 3OF5A 5K8IA 1HEYA 4CKEB 4XUEA 5KX5A 1F7VA 2IXGA 2QP4A 1XTIA 3VQXA 4CXMA 2R48A 3KQQA 4LJKA 5ITVA 3W0LB 2ODEA 2O50A 2X2FA 4B35A 3C7DB 3AHDA 3DVAB 4OOEA 4PQYA 3NANA 5HKBA 4R1PA 4WIAA 3EARA 4HKTA 2AR0A 5KSYA 1E2HA 3DL0A 1KHHA 1MOZA 2ZAOA 4DQVA 4J91A 5DX0A 2XZLA 4UMFA 1LPMA 4NFSA 3RC9A 4CODB 1UJ6A 3M3DA 1JHZA 5DWQA 2BFWA 1WLEA 1U2DC 2HU2A 1FP4A 4LNUB 1XZCA 4I55B 3PQ2A 1S5HC 5AHKA 4C4AA 1USVA 4HEJA 3STUA 1T29A 4CYMA 2WI8A 2VQFO 4B62A 5J4HA 4EEKA 3ZDCA 5F4ZA 3H65A 2VF4X 3NDBB 4ME6A 1K0FA 2AG1A 4BNWA 1XQ6A 4OHYA 2V7BA 4NEQA 2HCFA 1BJTA 5I4CA 2Z5GA 5LUAA 4IIJF 2F9FA 2NPFA 5AK5A 1Z4QA 1SKAA 3LU1A 4HBGA 3HN6A 1AMUA 4PSUA 2IYYA 3F6SA 5JOQA 2YSUB 1HNZB 4GMDA 1QVWA 1SQFA 1R5JA 2KSDA 5KYTA 4FGJA 1KVQA 1ZU4A 2JZNA 4N3NA 2E3JA 4IJMA 2DKFA 2CFCA 3LW7A 5BSGA 4B3MB 1LLDA 2RGXA 1JDBC 1ZOPA 1C3XA 1VLZA 2YW2A 1PJ8A 3R0PA 1VE9A 2CXHA 3L5OA 4AICA 2ZCEA 4QYMA 4C82A 3WGKA 1E18A 3IP3A 3GA5A 4CC5A 1GQOA 2UXCO 3A4YA 2E6KA 3E5MA 3MRTA 1OASA 4KR2A 2C42A 2YNMA 1YVPA 3IOCA 1ZJ5A 2CNOA 1AKUA 4M6WA 1ZH6A 3JWIA 4WK0B 3REQB 5L4LA 2JGUA 5CNIA 4EI2A 5AM4A 2DOSA 3ZY4A 3CF0A 3AM3A 4HPJB 1G3IA 4Y2YA 4MB0A 8MHTA 2H4FA 2ZBQA 2ZSAA 1TVKB 1J33A 1WETA 3WIVA 5IAJA 2VGMA 3LBYA 2L42A 4XVUA 2WSSG 4J11A 1K73W 1RAGA 1XMOO 1JAXA 4QHSA 4WBXC 3VO2A 2MT9A 4F3RA 1D4OA 1ZM2A 3B3GA 2Y68A 3E3LA 2ZLBA 4EOGA 2QQEA 4BV8A 1E0KA 2FFJA 1PJTA 5TGDA 3APQA 5CBGA 2HGZA 5GINC 3RC8A 5FUQA 1NQTA 1QU9A 5AVQA 5DXFA 5A5FA 4QDZA 1XZDA 1H7MA 1TCVA 2NU7B 4NBNA 1Q7CA 2QLNA 2EVWX 2Q46A 4DF3A 1BQ3A 1P4SA 5FUYA 3LVRE 1Z0ZA 1HT0A 1MQSA 3EYAA 2A9JA 4X7PA 4RF5A 3QFFA 5IZCA 1T4BA 6REQB 3IIJA 2DLDA 4AQYO 1NOKA 4E11A 2BF4A 1H2YA 2QL6A 4M8NE 1ZL0A 4TTTS 1E0AA 4DMGA 1CULC 1GLNA 2Y66A 4PYIA 3FYHA 5K0EA 4JQCA 3L8ZA 3KD2A 3MN1A 3D4PA 4CMIA 3VH1A 1YZNA 1FVHA 3U9SA 1MRNA 4R7TA 5F3DA 4TUYF 4AN0A 3BFPA 5EYPB 4DG9A 1NI8A 2CXQA 3ZQKA 5I7SA 3EXEB 3UAOA 5D01A 2JAQA 3EEOA 3W1VA 2ZITA 4JS0A 1N5OX 3LOPA 3AUSA 3UXEA 4YV0A 5B3AA 5KYYA 1BWQA 2AMVA 2WALA 4FMDB 2Z1NA 2PRZA 3VRHA 1NN0A 1HDCA 4G6ZA 1Z7BA 4K86A 1P7CA 5CW1A 5CXQA 3G89A 4TN5A 3SBDA 3OWXA 1T8RA 1G20E 4CIDA 2JNBA 2CV2A 3P45A 3PPIA 1YJBA 1P33A 4HPWA 2XRFA 1QQ6A 1H2EA 4BNJA 2G8NA 1V1MB 2KWIA 4JKIA 2XWPA 2QVYX 2CDRA 4QWMA 3NIFB 2WUGA 5M7EA 3EMKA 3HJGA 5TMDA 3ZU4A 4JJKA 5AVJA 3N59A 1OGIA 4DCJA 1GRVA 3G9XA 2AFIB 4DJJA 1X1TA 2VOJA 3Q8LA 3EIFA 4OXSA 1OIVA 2IYNA 2PU7A 1ZUNA 5DW3A 3C6MA 1O95A 1XCGB 2ZI9A 4TS1A 2FWBA 4RV5A 3JYPA 1X77A 4HXFB 3TRHA 5ICMA 5G1OA 4OXRA 4ND4A 3S7ZA 5FDFA 5I5GA 4JL5A 4JJ8A 3CA8A 3B70A 1BS3A 4Z49A 1D5NA 4RW0A 1NW9B 3FKJA 1YC5A 1X1DA 2V6JA 4KNYA 3ANSA 3AEQA 1F2TB 3QGMA 4TS4A 1JL3A 2B9EA 5MDHA 1MPTA 1NXWA 5ESXA 2O8DA 1XZ8A 2WDPA 3QNWA 3WXBA 4JI4O 4WGFA 4ISCA 1O95D 1Q7YH 3QXSA 2C29D 4HN9A 4Y7DA 3KZKA 5H80A 1XHLA 4B5KA 5DHPA 2R6FA 4QOIA 3E86A 4C7XA 2DFTA 2ZUTA 4TOIA 1VIMA 2FHSA 3ETCA 2JS7A 4N21A 5JNTA 5L6LB 2JGDA 2GHRA 2YZKA 3V7NA 1KU6A 4OU5A 2IHTA 4D9GA 5FEMA 2F1HA 1E1RG 1Y66A 5JEDA 3DHNA 1RXSA 4DKXA 3FCAA 3CWZA 4HDQB 4GI3A 1IM2A 4LBYA 2B2XA 4EG8A 4ND8B 2ZIXB 3C9UA 2CXXA 1MIOB 1ZNQO 2I2XB 4LC1A 2BUCA 2KGWA 4KH1A 4NECA 4RJIA 4G63A 4MDYA 4HMPA 4MHTA 1XT6A 3F5DA 4BVAA 2H9IA 5KOHB 1Y6XA 1WO8A 3D8CA 1ADJA 4JC4A 4TKZA 1T15A 1N2GA 3ZUPA 3OZTA 5JI2E 4URHA 1R6VA 1M2FA 2I5PO 3OOHA 3RC7A 1C50A 4LZJA 1K7DA 3JQBC 3ZCSA 1TQHA 3SX4A 4UZSA 2LGJA 1KZ4A 4IZHA 2B8TA 1WP9A 3HDYA 3QNEA 1Z16A 3D7RA 5DM0A 3GWKC 1JSLA 3B6MA 1FBTA 4Q37A 4CLHA 3RS3A 4REOA 4TRJA 5TB5A 3L4EA 4WESA 1SA0A 2XCIA 1G1MA 2A4MA 3QKSB 4NTWA 4PA9A 3A70A 3ZE1B 1EWRA 2NR5A 4Q7KA 4R2XA 1C5KA 2ZSDA 2H3OA 3KHNA 3QPBA 3OPMA 1NC1A 3ABIA 3RYHA 3JAKA 1TF7A 1ZHHA 2DUWA 3RS8A 3SP1A 4HB2A 3DKPA 3QG1A 4PX5A 1CUFA 3UEOA 3DAPA 7ABPA 1CJUC 3V8BA 3ZZMA 3MTJA 3PJGA 3RE3A 3IR5A 3ZV6A 1ZOIA 4E5YA 1QYCA 3T1NA 4BTLA 1OJLA 2PD4A 3PWSA 3DGFC 2WWXA 1XI1A 4QARA 4TYMA 4IHAA 4YLGA 1JFRA 3D4BA 1XK7A 3I9V6 1C0KA 3OFJA 5T4BA 4IGIA 1XCJA 5ERXA 4MA4A 3HNOA 5KOYA 2OO5C 4UV8A 3X2FA 5CDFE 2IIQA 3LDDA 3E70C 1NZDA 1SQBH 3LYLA 1K8YB 3IO3A 1G4UR 5SICE 4KFSA 4FBLA 3V7EA 2BOCC 1M54A 1HFWA 1YTUA 4PSKA 3SG0A 1HDGO 4G5OA 2ZJ5A 4NFHA 4BNGA 2JGMA 1SNYA 4OQNA 1EX9A 5D86A 1RSOA 3IERA 2K9PA 2D2CB 2Q9BA 2XYVA 3G0BA 3AKZA 1FFDA 5CITA 4WUVA 4PI2A 1O0SA 3NHKA 4NZPA 1GG8A 2ZIUB 4JLKA 3H7AA 2XY4A 5CVVA 2QMOA 4QGHA 3LP5A 4K6HA 4DBZA 3S2FA 3IJRA 3KJJA 5BWLA 1AKTA 1M6VB 1RWVA 4OX9O 3CX6A 1KJQA 3GWGA 2YTZA 2H7YA 2LGQA 1HLPA 5GJVC 1XQWA 2B83A 2JAUA 3ND8A 1AT1A 1IN7A 1EQAA 1J4AA 3IPCA 1NG1A 3H42B 3SXJA 5BY2A 1UKAA 2SCUB 4BB6A 4KQXA 3TDNA 2OT5A 1ONIA 5KHIA 1B8VA 1U81A 2IEAA 1MD9A 1OXSC 2Y77A 3BDVA 2R4QA 3QUCA 3Q3VA 1DXQA 2OQ2A 2NP6A 2RHRA 1IIBA 4DIMA 3H19A 1DO8A 1RM3A 1JVMA 2WIAA 4Q39A 3EUEA 3GLUA 3SXUA 3K0SA 3QNUA 4Q1AA 1LSJA 1BA3A 1J95A 2DJIA 4RQUA 4R1NA 1C4WA 3O21A 1A8SA 4RAOA 3ASNB 4QU8A 1YRQA 3URKA 2XAUA 4WINA 1RAAA 2IH4A 2JEYA 4X63A 1WCV1 2A7WA 4DLBA 2VUHB 5BSUA 3FOFC 4HB0A 4D8UA 1SCKA 1S02A 2FVXA 4JT9A 3LPMA 2GN1A 2DYSB 1GZHB 4JU9A 1XZLA 3K16A 4EKGA 4XRRA 1JE1A 3SDSA 1P3JA 1K1EA 3ZU5A 2EIKB 1XSEA 3V6LA 2WHEA 1XZQA 4ZOAA 5KYXA 5IKMA 3KIZA 1U6KA 3P97A 4KPUB 2XAAA 3DL2A 5EHXA 3N0WA 2AVDA 5B2ZA 3WRYC 3VYRB 4KRFA 3E8MA 3P96A 4UD2A 2CK3A 4KRXA 3MWEA 1HBJA 1KO1A 3NV9A 2W0MA 1IVYA 2GEFA 4BASA 3G02A 1C7FA 1SQGA 3UWPA 1BIFA 4MS3B 4G07A 4KWTA 2ZSJA 3RYFA 5IXYA 4RBNA 4RQAA 1J70A 2ECFA 2QWQB 2QWRB 3M7MX 1GZ5A 2OT3B 4KX3A 1WKCA 3QXCA 3PVCA 1UP4A 2AQ8A 3GRYA 4JLOA 2VUUA 5DULA 3K2IA 2CK3D 4V2IA 4EPYA 1ZGGA 1DAIA 1H4VB 5I7OA 2FQXA 1LUAA 3I62A 1I0IA 1BH2A 5CBPB 4S0XA 2BBTA 1SZTA 2WAMA 3BTVA 4UFNA 1AF7A 3CYOA 3VDNB 4RYLA 2VYQA 4IILA 4EY5A 3T35A 4EUNA 3GLVA 1KFBB 3CPJB 1UWKA 1Q6YA 4FM9A 4BLOA 3DLAA 4F4DA 3G2QA 4DV6B 1SR8A 2VNIA 3J81A 2A0WA 1OAAA 3EZLA 4NCKA 5JIBA 5TLSA 3ZRWB 1F8YA 3TB6A 1X1CA 3PFKA 3PCRB 1R37A 3CF2A 1K3FA 4DXDA 2Q28A 1SQVH 1KQFA 2REBA 3CX4A 1R7RA 1KY3A 1OFVA 2VI5A 4HH1A 3DOOA 4G5FA 2PKQP 2C9DA 2DHDA 4F6RB 3KR0A 1JR9A 3T9DA 1UXOA 3LDUA 1ETHA 3LYBA 2AN1A 5KOJA 2VRZA 2H1WA 4NJMA 2QDOA 3F9IA 6ABPA 1NX9A 2V3CC 1JJAA 5J23A 3ZD9A 3OY2A 1DX6A 1D2MA 1SQPH 2JS3A 3SJCA 1QH0A 1QC5B 5T3YA 1XPRA 5A9SA 3SR2C 3VNAA 1BE3H 4HQKA 1WTAA 3ESCA 1TM1E 4QU5A 1VL2A 2IZOA 3V34A 3B8NA 3T9FA 3W2EA 1C1XA 2YC0A 5D2CA 1ISHA 3Q2OA 3ZQ6A 1TADA 2QI9C 1U1CA 1ZJ4A 4BCBA 4KO4S 1U0GA 1I08A 5B57C 5CURA 2W2XA 1YDWA 4HX5A 1AZSC 1YZKA 3CXCF 4ZK7A 1JR4A 2H2HA 2WU8A 1OCZC 1FTSA 1U96A 1D1QA 1W0CA 1WZ2A 2Y48A 3W4IA 1O97D 2LCAA 1N33B 3SKVA 3KCXA 5K45A 5KAMA 4RLHA 3T3MB 3R5TA 3S03A 5HYVA 4MWEA 3SN6A 1KKCA 3OPQA 1QHYA 3DDNA 3QTBA 4HEQA 1ZWZA 4X7RA 1RJ9A 5HY2A 2XTNA 3PNSA 3D6MA 1E4OA 4DCVA 1TQDA 3M8KA 2GX6A 4MTLA 2Y0DA 1HDOA 3LM8A 1ZMTA 4YJ3A 3THSA 1PR6