5LA6B

Tubulin-pironetin complex
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
427
structure length
422
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pironetin Binds Covalently to alpha Cys316 and Perturbs a Major Loop and Helix of alpha-Tubulin to Inhibit Microtubule Formation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha-1B chain
total genus 165
structure length 422
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5la6B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5la6B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5la6B01
5EZYB 2RHHA 4M8IA 5JCOA 4ZOLB 4EB6A 3JAWB 4TV8A 5LOVA 3JAKA 4ZHQA 3R4VA 4U3JA 4YJ2B 3WGNA 4DRXA 3JALB 4TV9B 1FFXB 3HKDA 5CA0A 3RYHB 3VPAA 4E6EA 4ZI7B 4X1IA 4X1KA 5KMGB 5M7EA 5CB4A 4X1YA 2XKBA 5ITZA 4XCQA 3RYIA 5CA1A 1OFUA 4O2BA 5LA6B 1W59A 4O4LB 4EB6B 4TV8B 5LOVB 1TVKA 3WGLA 1Z5VA 5J2UB 2VAPA 5J2TA 1RQ7A 3CB2A 4WBNB 5KX5A 4O4IB 3RYFA 3RYCA 3HKEB 1FFXA 3RB8A 4O4JA 3ZBQA 5LP6C 1RLUA 4HNAB 3N2GA 2GVIA 4X1YB 3RYIB 5CA1B 3VOBA 1JFFA 3UT5A 1RQ2A 5IJ0B 4O4HA 4EI8A 4EI7A 5J2UA 4B45A 5IYZA 1SA0B 1Z5WA 5LXTA 4FFBA 4I4TB 4ZOLA 4X20B 5LYJA 5IJ9A 1W5EA 4I55A 4I50B 3ZIDA 1W5FA 4EI9A 4U3JB 4TUYA 2R751 5C8YB 2XKAA 5EIBD 3HKCB 4DXDA 3HKDB 1FSZA 5FNVB 3UT5B 3JASA 4IHJA 4ZI7A 5KMGA 3WGKA 3E22A 5JVDA 4LNUA 2VXYA 5JH7B 1W5AA 1SA0A 5EIBC 5LP6B 4O2BB 4O4LA 4YJ3B 4X20A 5LYJB 2RHOA 5EYPA 4I50A 4F6RA 4O4IA 5C8YA 3RYFB 5JQGA 5GONA 2RHLA 3JARA 3JAWA 3HKEA 3JATB 4O4JB 5FNVA 3JASB 4B46A 4HNAA 3N2KA 4YJ2A 1W5BA 2BTQB 4DRXB 4O2AA 5JH7A 3JALA 3V3TA 5LP6A 1JFFB 3M8KA 4KWEA 5IJ0A 5MN4A 4O4HB 4X1IB 4X1KB 3WGMA 3C8LA 5MN5A 5CB4B 2Q1YA 3VOAA 3VO8A 5LXTB 4F6RB 5JQGB 4FFBB 3HKBB 5LA6A 5GONB 4IIJB 4I4TA 3JARB 5IJ9B 2RHJA 1TUBA 5BMVA 3JATA 1TVKB 4I55B 4U39A 1W581 5EZYA 5J2TB 3N2KB 3WGJA 2BTQA 4WBNA 4TUYB 5KX5B 3RYCB 4O2AB 3M89A 2VAMA 3HKCA 3ZBPA 3JAKB 4IHJB 4ZHQB 2R6R1 5MN6A 3N2GB 3E22B 5JVDB 2Q1XA 4LNUB 2VAWA 4TV9A 3RYHA 5CA0B 2BTOA 3HKBA 4IIJA 3VO9A 4YJ3A 5JCOC 1TUBB 5BMVB 5EYPB 5ITZB 5IYZB
chains in the Genus database with same CATH superfamily
3R8FA 3DG9A 1DBQA 5JEEA 3KKNA 4JYYA 2W0MA 4KE6A 3U3ZA 1S5JA 4R9RA 1DGQA 4XVHA 4I2NA 4MJXA 1JHPA 2VUSA 4D97A 2GPYA 4KPYA 4BT6A 4E21A 5JD6A 5FUWA 3QOYA 1L5QA 4ICGA 2KQUA 1P7PA 3OOYA 4GZMA 2W37A 1GM7A 2XIJA 4UZFA 2CB9A 1H9AA 3GFFA 1QIDA 1EN5A 2CHSA 2ZLBA 4QATA 2PZGA 3MJEA 2D1SA 5FWXB 3H18A 1Y3HA 2X42A 1OU0A 2GDZA 1JLHA 2X23A 1EB8A 2IBMA 1H0KA 1LPBB 3Q6IA 4J0CA 1SG0A 1ZI6A 3PGMA 3VJKA 2NNLD 1BRTA 2JVJA 1F8XA 2C20A 3T1QA 1RZRD 4XIJA 2EZUA 2NUBA 1E9RA 1LRKA 3DE2X 3FYEB 4L4ZA 1MT3A 4Q4JA 4RORA 1WNFA 4JTAB 4BQQA 1G59A 2BW0A 4AMVA 5L4LA 1LDEA 3ZV5A 2Q7XA 4WK6A 1VI5A 1J2JA 1OLOA 1YVUA 2EG9A 2A86A 3E9ZA 5FCDA 4GR9A 3QUWA 5JSYA 1KYYA 4FYKA 5JHGB 2I1QA 1PK7A 1GNQA 3SF8B 4LXYA 1L8QA 2DYRC 2UXXA 2D1QA 1HT1E 3H7AA 5GOZA 4GWLA 3ZWCA 3NYQA 1JJAA 4TUYF 4ZKDA 1RKQA 4WI1A 3LLCA 1O1YA 3KVYA 1Z3CA 1AI5A 3JQQA 1R6NA 2QTFA 3U4GA 1RC1A 1RJDA 2H9YA 2VCHA 4V3CA 4OFXA 3TR0A 1N5KA 3WTBA 4ZDKA 4UPVA 3VR5H 4AJ4A 1KAQA 1SXIA 3UC9A 2GXQA 5FR1A 5JNTA 4M0EA 2XMBA 1FNMA 3SSOA 3T41A 4EW1A 3GPLA 1VDZA 3GFSA 2X9VA 4DCJA 1RCFA 3SJCC 2Y92A 4BASA 1ECGA 1CUVA 2WHPB 4N7BA 3TOXA 3GIWA 3DZKA 3M2TA 2R85A 4FR2A 3KHNA 2WE7A 3WLFA 4DNQA 4DTCA 4LNUA 5I5GA 1KZHA 3GT4A 4ENQA 1J9GA 3QFRA 2A0UA 4BLPA 3O4GA 2QAGC 3K2XA 5B2ZA 3HM9A 2IIVA 3VYTB 1ICIA 3KOMA 4G8JA 4NBVA 2AR9A 4ENPA 2L26A 4A6EA 4RANA 3BILA 2ADOA 1H2NA 1QU7A 4YJDA 2C9ZA 2DBVO 3PYXA 1IAVA 3DZIA 3P52A 4WT7A 5ALTA 1CU1A 2FZGA 2N1MA 4ZTBA 3WYBA 5M5BA 4CL8A 5GPBA 1TYAE 2X6AA 2JGKA 4D9BA 5KIAA 3SX4A 3L8FA 3WIEA 1E6MA 1MJGA 2JCBA 3EYWA 4H15A 2GD2A 2OCDA 1MOPA 4RK6A 3PVZA 2OGZA 5IJ0A 2ZSKA 4R1SA 1ML3A 2JASA 3H01A 3RJMA 4JR2A 2C8KA 5H5JA 5JY1A 5EZSA 2W2TA 2ADQB 1I5RA 4PI0A 1B41A 3MTDA 3NB0A 1ZSNA 5K3FB 3J7AR 1O3YA 3M4NA 4CIBA 1A7JA 1XIVA 2VZEA 3O9ZA 3KR0A 3OCJA 3YASA 4E3WA 4FC6A 2QHXA 3L0PA 5KYYB 4YV0A 1U1FA 2P9GA 3I1FA 2OC4A 3VR4H 2IYQA 4JUBA 2QR5A 3P0HA 3U44B 1RLOA 3U9TA 3UK7A 3SF8A 4IXNA 4BN4A 3FPLA 2JAWA 1Y7TA 3CB4A 1QIGA 4NU5A 5AHOA 1EFPB 3E53A 1YS4A 3FROA 2BSXA 1WABA 2JLCA 5DLPA 3R6WA 2ABWA 4AJ1A 1OGIA 2O2CA 3EGVA 3CH7A 3GCXA 4MR8B 4KXUA 1U5BA 2PZMA 1HOTA 2JBHA 4Y98A 4X91A 4HNQA 1RYDA 4XJXA 2P9YA 2WT4A 1P62B 3EIEA 5KQLA 1YTLA 2GHTA 4TV8A 4UTRA 2YWJA 4HVLA 1KKMA 2VSNA 4RO0A 1UKEA 1I4LD 1SXJD 3LC1O 2EJUA 3E84A 1B6TA 5ICMA 4UB6Z 4H7PA 5P21A 4LUCA 1ADYA 1LTHR 2VO1A 3NETA 2NTNA 1C7EA 3OQ1A 1RACA 4PI2A 2A5FA 3C70A 4KO2S 4OJTA 1YIAA 3CF0A 3TZ6A 2PFSA 3GLHE 1V5FA 1GZUA 3R3SA 4G9EA 3T9EA 4AP6A 2Z6AA 3B9PA 4UMEA 2X15A 3ES9A 3H3FA 5EIOA 3D8BA 3VYWA 4W8HA 1PZHA 1U7PA 1FXWF 3Q10A 4N48A 3BS4A 3I04A 5KX5A 3RYFA 3L8ZA 4I7ZB 2PRZA 2YN4A 3VVCA 2FSUA 4F2GA 4GI5A 3CXRA 1QH0A 1KSFX 1XB2A 2CDBA 2A4KA 3TW8A 4M9ZA 4P4SA 3QFCA 4L1KA 3RAJA 4UTNA 1QG0A 2NTJA 3OBWA 1FFDA 2FN8A 3MELA 1Y9AA 5FR2A 3D4NA 1NBMA 2G5PA 4LKRA 3RWMB 4DCNA 2F1IA 3S8EA 3IKTA 2CTPA 2WT8A 3DBLB 3HBMA 2P9HA 1WPQA 4TRMA 2JJ2D 5JASA 3HZHA 1YVRA 2CL6X 4JJIA 3TLGB 1E1CB 1M1ZA 1A9YA 1Z47A 4OIMA 3C5VA 3Q87B 5JAZA 2AFRA 4ZEXA 3T4UA 2V3CC 1TZ2A 1QLNA 4U6QA 5KI6A 1BJRE 1FLVA 1Z5OA 3PVSA 4ZD6A 3GP8A 1R3DA 3VR4A 4XVQA 4PYQA 4EH1A 1N2CB 3W4JA 2JZNA 4LXIA 5CX1A 2ZTSA 3KOXA 4H27A 3QKRB 2P5YA 4ZVSA 2WA1A 1L4YA 3T1CA 1RWBA 5FA8A 1V9SA 4OPAA 1U2DA 2VP4A 3RVKA 3SHOA 3SJAA 4BQIA 3KSZO 5JWPA 1MF7A 1P7ZA 5ITVA 1E69A 4WLEA 4YJHA 3ABTA 4X94A 3WIVA 3CU5A 2PGJA 5C4MA 3FGOA 3F71A 4FN5A 3BWMA 1BCRB 5CUQA 1I2MA 4OYLA 4NNPA 1P31A 4EEQA 1LX6A 4C3OB 5FUQA 3RSQA 3PJRA 1NRIA 2XWPA 2R6FA 3AHIA 3DTNA 3OE4A 4R54A 3B12A 1NASA 3LD9A 5TPWA 3ZU3A 5I7WA 1AD2A 3IBGA 1BXGA 1V5EA 1HDGO 1QU9A 2ZSHA 5A6SB 3VYSB 4MUGA 3R65A 2QRKA 2Z6VA 5AFSA 6PFKA 2O5VA 1RBMA 3AU8A 4FE4A 2AX3A 1QHTA 2Z58A 3MYRA 4JT2A 1LBHA 1PSDA 1XMPA 4K6OA 4D42A 3HP1A 1Q5PA 1TI7A 1DAPA 2SKDA 3H2BA 4WECA 4DS3A 1PJLA 3ZWWA 3JV7A 5GONB 3DEYX 1IDN1 3I2FA 3QUBA 3ORSA 4HPXB 1FRVA 3WSVA 4EG5A 1QX4A 1GZ3A 2Z56A 1S2DA 3NOVA 1AKVA 5TMEA 2C8JA 3IODA 3BM5A 5BN1A 3T9FA 2QY9A 3TQCA 3C9RA 1GZ5A 3QEMB 4JSTA 4FS3A 4HNGA 1WLYA 3AW8A 1N8TA 4J7CA 1MV8A 3TZEA 3NFYA 3W7BA 1RLJA 4F38A 1D6SA 2OENG 2HFJA 1YB5A 1BS9A 5B1OA 5AK5A 2ZIAA 4I4NA 2FWMX 3L7QA 3CUUA 2DCUA 4GI1A 1VGVA 4KO1S 4RYDA 3VPFA 1A7UA 3K0AA 4PYKA 3F78A 5EHXA 1X1DA 5EZYB 3B6IA 4K9DA 4EJSC 5K6AA 3SEZA 5LLDA 2IOYA 1J20A 4NKRA 4QE7A 1DOZA 2X3UA 1ONPA 3MNFA 2OHIA 2EF0A 4MVJG 5ILQA 3V7UA 10MHA 3T3GA 5JJJB 5C2JB 4OHKA 4ZK7A 4FM9A 3VZQA 4TM8A 2FWNA 1YJQA 2JEYA 4BRSA 1HI9A 3RUPA 3AIIA 1JAXA 4CM8B 3AKEA 2LKCA 2IP1A 2ZJ5A 4P3KA 3QO5A 5CNMA 1C4KA 1X87A 1ZSYA 1IBSA 1LD3A 1WO8A 3CBGA 3MMZA 2B8EA 2PTGA 4O33A 5EHGA 4PYNA 1O9HA 3JD2A 2H4JA 2WIJA 3NHJA 4B40A 3PD1A 1P1KA 4PA7A 1IY0A 1M10A 1POXA 3UO2A 4N6OA 1JXQA 4ND5A 3TE7A 3V1YA 2VUUA 3WTCA 4DUPA 2V96A 3JRWA 1HFWA 1Q0PA 5J2TA 1B6GA 1CR0A 3BJEA 3I58A 2C5GA 5BVHA 2RHGB 3M70A 3ME5A 1NVTA 4QDKA 1K68A 1AURA 2WUWE 2LXNA 3L1HA 1X7PA 3B89A 2HFKA 4P82A 2IS1A 4LF4B 2ZUUA 4BNVA 3SPXA 1BHO1 3W5JA 3TINA 3M1IA 1JFVA 3D4PA 4LJ5A 4NCKA 4LYHA 13PKA 2XWQA 5KTSA 3BRWD 4UM5A 1V16B 4XQ0A 3UAOA 4B81A 3T3DA 4BE9A 4U2BA 4P8RA 2JA2A 4LZZA 4YCBA 4DMFA 4DNXA 4BW9A 5CB4F 1AXRA 3OF3A 3EIHA 2X7RB 1BWPA 2C04A 1QWOA 4RJKA 3KLOA 4QWMA 3FOFC 1KO5A 5FA6A 5IVDA 3D81A 5KOIA 3EUWA 4LMAA 4D41A 4F91B 4EGAA 2QUBA 5HIMA 5KVSA 3ZDEA 4EHIA 4DV1O 4UHEA 2QYTA 2CL0X 1KYIA 2Y8EA 2FR1A 3E03A 1OKKD 3EWAA 3F8WA 4RIGA 1G5TA 4UXIA 2YDXA 4AQ7A 4V0RA 1ADCA 1N4CA 3HJWC 1JX6A 2RAFA 1WP9A 2C2XA 1MABA 2EYUA 2XVMA 1IEVA 2Y1OA 3BH6A 4ND8B 1T13A 4PANA 5ALFA 1HUQA 1UAYA 3U1VA 3F5DA 4RH1A 2ZXUA 3CONA 1R6BX 3G1WA 1W6RA 4KPFC 1ZC4A 3GQBB 1M8FA 1NH2D 1IN6A 2IT1A 1NZJA 1AUVA 2GYUA 1IDSA 1ZUIA 2RHBA 2W6IA 3G49A 3EE6A 3JWEA 4KUEA 2NTYC 4WY2A 1DAOA 5C5CA 1WQ1R 1B7GO 1BS1A 3KYCA 3WU2Z 4IG9A 1LBQA 4GLOA 4MO9A 2H17A 4D9CA 1UWCA 2FX2A 4Q3DA 4JKOA 2Z8YM 2VF8A 4JR1A 1IHDA 1FXHA 1ORVA 1UP7A 3MS2A 4Y1RB 3WJ1A 4GYJA 4BFXA 4UNRA 2P7TC 1KQPA 3DNMA 3NG1A 1XJQA 1I5XA 4R2HA 4ALIA 4XTRA 1YRQA 1U2ZA 1YOVA 4B3XA 3CUVA 1IBMB 1S3GA 2N1BA 3L7NA 1MG1A 1SELA 2OOKA 4IDNA 3A1CA 1DXYA 1PZMA 3K0EA 1RWOA 4FLFA 3ETQA 1NPDA 4D8WA 1U8ZA 4QLBA 4MQ4A 4FM1A 5HGXA 2ZTVA 4PA6A 1BU5A 1B15A 2ICAA 5F33A 3VV2A 4DNOA 1ZM3A 3FRHA 1RQPA 1R74A 4FU0A 3N70A 3CXHF 1RVV1 3FYIB 1N0JA 4F5YA 2HP0A 4J76A 2CLMB 1JA1A 3UHJA 1NHWA 5HNKA 1BJTA 4MTCA 1EP9A 4E4RA 2E5FA 1HK7A 2J87A 5GQSA 4C88A 1ZSPA 1CQPA 2W98A 3KOYA 4Q00A 3T5TA 3WGUA 3ZMZA 3CKLA 3RYHA 5T57A 1P45A 5L95A 2WR8A 5DSXA 3VO9A 4RTLA 2XI4A 3NIFB 3THXA 1W2BU 2AWOA 2PYLA 2DUNA 3GRCA 4HEQA 3OFNG 4Q6GA 2X8JA 4UEJA 3RU2A 1M0EA 1T1SA 1L5KA 2H0RA 5FNZA 2VJQA 4I6EA 2GXAA 5EHIA 1EGAA 1B43A 1Y7HA 2YZGA 4HDMB 4QFCA 3REQA 1AS2A 4CM6A 4PBTA 4J03A 4CEJA 3H83A 2OCLA 4XCXA 5LGUA 4IQ4A 4YEDA 3ZWAA 4JOBA 5JYEA 1YGYA 2C2AA 3C0KA 3NBYC 5G4LA 5AXCA 2XD4A 2YZNA 3AR9A 5IKOA 4E70A 4NQZA 3T5MA 3ICVA 2AL7A 4FMCB 1H2AS 4PFKA 1XUQA 1Z7BA 2XUAA 1X2BA 2PUVA 3R0XA 1BS3A 1A8UA 3X1WA 1IM8A 1KVUA 4NK4A 4ZRNA 3U6KA 4B08A 3A4YA 1TFRA 1JMVA 3IB6A 1TC1A 2KKWA 3JQFA 1IPEA 4FMPA 4W82A 2R1VB 2Y2UA 4BAYA 2BKVA 4MCIA 2H8PC 4FGUA 2H6EA 2P0AA 3R7FA 4QUBA 1SWVA 2IGTA 1U96A 2ZWPA 3R2JA 5LYYA 2EILB 5FUVA 4OXIA 1OCRC 1W44A 4UOQA 4PR0A 4BIUA 2ZWVA 3ZJTA 3OLXA 2ZUVA 4HN9A 1II8B 1J7HA 1PFQA 3EHDA 2G9NA 4B3SB 1TLFA 7YASA 3C6BA 3M7MX 5I9TA 2UUAO 3WK7A 1E2DA 2EP5A 3MD0A 1DTSA 5BRJA 4XIGS 3EPKA 4ZALA 1M83A 1QR9A 4HBGA 5EXXA 3WWZA 3HCNA 1PFYA 5AVJA 5I8WA 1FUIA 4MROA 1Y48E 5TT0A 4YX9A 1SBTA 2CSUA 3E5RA 1OVGA 3ILHA 2Q2VA 4IKPA 2B1GA 1AKYA 1FS4A 1WV0A 1OPXA 2XXAA 3WS7A 2VHWA 2YW2A 3OEHA 5LU8A 2PUDA 1QLWA 1NQ5A 4R1PA 3NVIB 4OXQA 5TISZ 2OR3A 3WR5A 3RVSA 2E5WA 5LP6F 1YA6A 1X1BA 1FYWA 5EI5A 3SK0A 3VNSA 2C4KA 4Y2HA 5FPYA 4UEQA 4CEIA 2GBLA 2V8OA 1SHUX 2A5JA 3I6BA 5LYJB 2V55B 3ZVKA 1W85A 4MSUA 5JJIA 1QANA 2XB9A 4AN0A 4HX5A 1S5LZ 1OXVA 1F2VA 2AI1A 2WLIA 2FP4A 2XVXA 2ZAMA 1W4AA 2ZUCA 3R5FA 4OGFA 5FPQA 2Q8NA 2QJWA 4CDMA 1V35A 1MR3F 4HRYA 5I4CA 2E55A 1RLTA 1SC1A 2XQIA 4MHTA 2QTSA 4CMBA 4DXHA 1GUDA 1S8OA 3OUZA 4JCOA 3UOGA 3BX1A 3KFLA 3IOMA 3EZ2A 3H5AA 3O38A 1VP9A 2X4LA 2ONYA 3L0YA 5CA3A 5KJFA 3H9QA 1SRQA 3WJ2A 2B8TA 3GMSA 4QYTA 5ESDA 1GGFA 3V2IA 3OEEG 2IOHA 5GY7A 1HDEA 4CE6A 3CSUA 1VZ3A 4HVCA 5DNVA 4B3CA 5AICA 2R84A 4RF5A 3ZQ4A 1O96B 5EZYA 1QAHA 3JWGA 1VJCA 4CKXA 1JH8A 4MKFA 3VYRB 2CLFB 2MSEB 4H0LB 3DTYA 3WIBA 3N8GA 1Z25A 3P2OA 3SVZA 3Q0TA 2CJYA 1ELOA 1SKYB 3CJQA 3ZGLA 2BGUA 4C2AA 3FHTA 1SQXH 3X1JA 4HMOA 3WADA 1ORWA 4HI0E 1KVQA 4NPAA 5AW5A 2F3PA 2PF4E 2QEXV 4YJ2F 1AKEA 4KQ1A 2FA9A 3BJIC 4R1UA 3IP1A 3V1LA 2DR2A 3AIKA 2DN9A 1GZ7A 3L7YA 2GUWA 3VC3A 3MDSA 2EYQA 4CMKA 3S40A 3C9SA 3ANSA 3VAZA 4MDFA 2FEWB 3MTAA 1H0RA 2VF5X 2HV8A 3MRXA 2AI3A 5DZSA 3JQ7B 3WYGA 4WXPA 4W5OA 1PO7A 3HDQA 4TZ0A 2HJDA 2YV4A 2G17A 2II6A 2V0CA 5K4HA 5KNBA 2IH5A 2Z5UA 4XB6B 3SYCA 4OH1A 1JU4A 5EQTA 1H1LA 4J9VA 4DCGA 5I7HA 2UVQA 1CSEE 3PQFA 5LQDA 1OROA 1L3IA 1Y9EA 1X6VA 2Z8XA 1AO0A 4NXMB 3LBIA 1Z34A 2PXXA 2PIDA 2EIHA 1J8FA 2W2QA 4HGPA 4LC9A 4EELA 5L9AA 3U7FB 2F1MA 1RCTE 2QTPA 3K0BA 1T1RA 4MTLA 3DVSX 4TTVA 5KYUA 3MS4A 1P61B 1NOKA 4M9QA 4K6GA 1NWCA 4EPVA 3W04A 3X1KA 3AG4C 1VCMA 1DKUA 3AP2A 3NWOA 2F59A 5LWQA 1CZOA 1JDBC 5TE9A 3SZLA 3DE3X 2IY7A 4F0JA 2R1TA 4XIYA 1BH6A 3CUEF 1XWIA 1F7VA 3LWZA 3CLSC 1GPNA 4KL8S 5E6UB 4QGSA 1Z6TA 3TLEA 3IHWA 2GO1A 5IYZA 1G5QA 3U48A 4C0WA 5M34A 2ZVYA 5G4UC 3Q5EA 5AW9A 3ZGZA 4YO8A 2J0SA 5EXTA 4QFBA 5CEJA 3UW3A 4I0WB 4QA9A 3QLVC 2CGNA 3I8XA 1P73A 3UXEA 3GBVA 4G89A 2QAGB 1JPNA 5TQ0A 1YI2V 5J4HA 3ZBHA 1M56B 1T0PA 3ZOPA 4JASA 1CULC 2HCTA 2OGWA 2VDMB 2W6PA 1RAEA 2I55A 3ZCRA 3CWCA 4DMMA 4E5PA 2WM3A 3QEKA 3E22A 3N2LA 3FVQA 4YH1A 4TKZA 2CK3A 4BBJA 3EMVA 1Q14A 1KEKA 2H0AA 4P7FA 5DVZA 3FR8A 3R3JA 2BFWA 3MTIA 5TX7A 4PBSA 1G1MA 4E94A 1VMKA 2D0DA 3PXBA 3WV5A 5EXDA 2PY5A 5ETJA 4TSFG 4HGQA 3WGGA 1ZFNA 4K0RA 3GLHA 2ZK7A 3N07A 4E5DA 3Q5GA 1RLMA 3OAAA 2VGMA 2GDJA 1E62A 1YB6A 1T9GR 2CHGA 3M81A 3DXZA 3VUFA 2CNBA 4AL4A 4UUJC 1M8JA 3EZ7A 4BO4A 1CF4A 4K0KO 3CN9A 1XG5A 2R7MA 1A96A 4POAA 4J7ZA 5IABA 1C3JA 3VOAA 1PRYA 1C3XA 2VSOA 1E5XA 3HP4A 3JWIA 4CKZA 1RRFA 3LDEA 3CPEA 2VK8A 1GFIA 2O7NA 1BE6A 2PVCA 3EA5A 3FPGA 1LLCA 1NVAA 1MTOA 2VFAA 2FWPA 3ABIA 1F8GA 2TRSB 4HLCA 4XQGA 3G68A 4E46A 3P5SA 1ZJWA 2QRZA 2XB6A 2XZPA 1KSJA 3TCKA 2NX2A 1ZUNA 2E6UX 1JFRA 2FCAA 4DM4A 5JSFA 3WQSB 2I3BA 2HAEA 1GPAA 4QU5A 2GVNA 5ABPA 1OB2A 1I30A 2ZVDA 1XI2A 1FL9A 4K26A 4RVUA 1WCIA 5LN1A 2YCLA 5KTTA 1YZNA 1JFTA 5C7OO 1CRZA 4LY3A 3K72B 4MWCA 3ML1A 5KKAA 1YJNF 1XTPA 4KLCA 3PUVA 5IT4A 1KI6A 3DBHB 3N39C 4G24A 5E2IA 4JEHA 5C3MA 3GFVA 5BSTA 1T2CA 4TWKA 4QUDA 1XVVA 2BM8A 1KE1A 2PL1A 1MA0A 1YS6A 4UDYX 3S44A 2VJDA 1G5FA 1MCZA 1NVXQ 5KNCH 4AY2A 1F4NA 2IUUA 3GP3A 3TDKA 3H1EA 3T15A 1A88A 4YMVA 2E3JA 1MOSA 3WHLA 1V1RA 3RQSA 1QVFF 4FNOA 1RQRA 1Z88A 4KN9S 3WNDA 5I9LA 5CP8A 1MW9X 1OILA 2PX2A 3E4DA 3VU8A 1A77A 4EB6B 1CR6A 2J08A 5TMPA 4BCBA 3GCWA 3PHBE 3UBMA 1YCHA 3L8GA 2GMWA 3UQ8A 5TRTA 2OD9A 4QNRA 2CJWA 2PZAA 2R68A 4LRXA 3LDTA 1STOA 2WMOB 1XKLA 3A06A 4GVXA 3BHPA 3G1TA 4FKMA 2OKCA 4JP5A 4K88A 1BQ4A 2PM8A 2BGGA 2V6FA 3D6MA 1WNTA 3KZVA 3NUQA 4I9HA 3ZRVA 4RAOA 3MOGA 3BD8A 3DOUA 3KXLA 4KRGA 3QNEA 4HNRA 3HL0A 2AR7A 4PYMA 2ZBQA 3K0GA 1TJNA 1GV0A 2XODA 3FD8A 3IJEB 3LGSA 1FYFA 3I6IA 4K05A 2CSXA 4LCJA 2LFSA 1VDMA 2AYYA 1NATA 1TMOA 1XLUA 1RYNA 1AK2A 1XQ1A 2GEJA 2EKQA 2P65A 2O0LA 3HE3A 4G25A 3IE1A 1WD7A 3V8MA 3NPMA 1I4OA 1NVFA 4BE4A 1ZUWA 3WYAA 3K8QA 2A9HA 4Q02A 1Y5IA 4AJJA 2FP4B 1BZYA 3O2NA 4JUIA 3PQ3A 5GZ1A 2BBTA 4XOIA 2JIQA 3LFUA 4EYOA 4HEHA 2HP8A 5DCWA 1P2UA 3AVXA 2WKQA 1RXSA 2I2CA 5DSTA 1UZMA 5DHSA 3VR5D 4EG0A 3CD6F 1U8FO 2J9GA 4G41A 4GMDA 1PVOA 1HYGA 1PZNA 3WDMA 5HWSA 1MB4A 1ATIA 1C4WA 2HYDA 3E1KA 3MWFA 2NYVA 1AE1A 2AN5A 3LXRA 4G0QA 4RQTA 4TV9F 3IQWA 1HURA 2DPYA 4NU0A 4BJ3A 1RPJA 4J10A 5BUQA 3SGIA 3F67A 6Q21A 3OEHG 1R37A 2DX7A 4JBYA 2DFVA 4XWTA 2CMKA 1Y8RA 3BTSA 4EQZA 1LUWA 2JCSA 4PTLA 4K86A 1VQ8F 1FMTA 2RI6A 2VSFA 1IC6A 3PNMA 3PNPA 5EG5A 4HH1A 4B2LA 4PN3A 1R5BA 4FXOA 1R6DA 4JUFA 2PIAA 4DC1A 4EAAA 3TZHA 1SQ5A 2WJIA 4ISBA 2H7VA 4PHHA 3D4LA 1BDBA 3PPVA 3LZDA 4EQ6A 4KP4A 1GR1A 1OZFA 4LTMA 3ITNA 4MRRA 3AKZA 4I1YA 3F5QA 1US8B 2A0WA 2NGRA 4HAXA 2DQ3A 1NR7A 4MB6A 4DIKA 2AOTB 4ID9A 4ESOA 4X61A 4J1TA 2B61A 5SY6A 5K6RA 3AL0C 2MDTA 4URXR 4N9WA 3D7KA 3QM1A 1V55C 5FRDA 1JR4A 1IOZA 7ADHA 2WSLA 1ND6A 3I9NA 4M1EA 4EJMA 1WAZA 2WK1A 4BTEA 1W47A 1ADBA 4MUKA 4CLRB 5JVDB 2HHJA 4IJVA 2HA3A 5B1YA 3MJSA 4GXQA 3A26A 2D1YA 3V48A 1KYOF 3ZV7A 4NAVA 2ODNA 5IXYA 1L7XA 4QXRA 4JAAA 1ADFA 4CTJA 2W0XA 1IN8A 4PHTA 5DV9A 4KVGA 1YFJA 4ZOCA 2FCRA 4PQYA 5JJNB 1TVCA 1K9VF 4LFAO 4FDLA 3HCRA 1FFCA 1N0VC 2Q4TA 3H4IA 3REGA 3GGPA 1KWKA 2IEBA 3K9WA 4BLVA 4F2PA 2GFIA 4A1OA 1H85A 1JD1A 2BI8A 2P6OA 4IIEA 4UUMA 4UV9A 1X7XB 5TV2A 2HVYD 4WOCA 5MHTA 4FOOA 1P9RA 2F2TA 2VJNA 2PZJA 1U9YA 2PA0A 3KIPA 5K2MA 1KDYA 3H1IH 4LWQA 2HXYA 3WGTA 2FFJA 2ZUDA 3N0RA 4WLUA 1QTQA 3CW2A 4A03A 1JR6A 4FFDA 4QVGA 1DQSA 1UT8A 3SQDA 3NDJA 1I08A 5BY1A 1UXHA 1VSQA 1ZU4A 2BFDB 2VJKA 3BKXA 1LF5A 3X1YA 1JAZA 4MS2A 1VKOA 1Z0IA 2NZUG 2X9QA 3KUDA 4AKSA 4AECA 3CE6A 2J48A 2JGRA 5EINA 3TTXA 1M2NA 3SVLA 1B1AA 1QF9A 1V3QE 3LX6A 3CPWF 4H1UA 2PANA 3JQGA 1NJ8A 4X1YB 2WAMA 1R27A 4IGKA 4I6JA 4LE0A 3RRXA 2XCSB 4HJRA 2FZ5A 2MIIA 3FUWA 4A8JA 3GRPA 3UFXA 4OOFA 5DTEA 3KG2A 1CS4C 2XUJA 3HWX1 1V26A 1DRKA 1XHZA 2H11A 2XGOA 3DXXA 4PXAA 5HK9A 5ED4A 1R3JC 3A0RA 2JIDA 4UMDA 2NLOA 2GA8A 2W43A 4NHOA 2FUEA 2QQEA 2FSVC 2DG2A 1YZGA 1G8KA 2EQAA 1HFJA 5KAMA 4D4LA 3PIIA 1O87A 2ORED 4O2BF 1UFRA 1PHRA 4CUJA 2Z98A 1MU0A 1VF7A 1GGKA 1FSFA 2JLBA 2ZI3A 2A7WA 1XQXA 1TRKA 3R3ZA 4GM4A 4C7JA 5C3UA 2VRCD 1E3EA 4YRLA 5TR9A 1CLUA 3F7TA 4P6VF 2H7YA 3ROPA 5CD9A 2GPNA 2EINB 2XX3A 4CW7A 1IXBA 1NL3A 4GBMA 2BV3A 5BQ5A 4YJ3B 1G66A 4WFAV 2XH8A 4KHPO 1NJIH 2QN7A 1VKRA 3HXOA 1QD9A 3TLAA 5E4FA 2XQJA 4U7DA 5IAEA 1MABG 2JGEA 3JVDA 2HJVA 4Q37A 5EPUA 3V3KA 2P4VA 5C1PA 4OX9Y 4GLLA 2EQBA 2X8AA 1CY4A 1VLLA 1RYMA 2WVGA 3HB5X 3IUQA 4MV5A 5F3DA 5IDXA 3TK1A 1NJ5A 4QBTA 1HC7A 3F5FA 3PGXA 3NHFA 4BJHB 3V46A 1S5PA 3VR2A 3K4PA 4RTRA 2H92A 1HDYA 4FDTA 2JVDA 1AX9A 2BHNA 3K6SA 4D0NA 1MIOB 1ZGAA 2XADA 4C6RA 3KJEA 2ZJAA 3R9XB 1VQKF 1EJBA 1W5SA 4MLDA 2VJMB 2O2JA 2VN8A 4TZ6A 1UBNA 3TBHA 1TUBA 4H6PA 2QN9A 2BT4A 2XKKA 2Q2WA 2X8BA 4O2LA 3SOPA 4TZZA 2Q9CA 2FZCA 2ZBGA 2M6LA 3G6EV 3D8CA 1I8TA 3HAXD 1ZJ6A 3G2OA 3QLJA 1FJXA 3MW8A 5JJ5A 3ZEAA 2I80A 3L1KA 4JYAB 1RTTA 4X93A 5MN6A 2QIPA 1NBMD 3CVOA 2MCFA 3R7DA 3OM9A 2ASEA 2DPMA 3VR1A 3V4LA 1Q0HA 3MMNA 3CVUA 3C3WA 1UPGA 1QCYA 1ZGHA 4J0KA 3OZCA 1NUQA 3TMAA 4DV2B 5CW2A 1JIJA 3CUSA 4E5UA 3P30A 2HSDA 2RG7A 1W41A 2Q5IA 1VXRA 3PR1A 3EZYA 4EW2A 4WXEA 5E95A 1QNMA 2O8CB 3H9CA 4U00A 4CF6A 3FNFA 3GHHA 4POOA 5BORA 5LIRA 4EO4A 2ZS7A 3RODA 4ACAA 3BIOA 1F3LA 1R64A 4TRJA 2P62A 1RPNA 2YUIA 4IL5A 4OG2A 4AURA 3J81M 1HL7A 2I71A 3DMRA 1TJYA 3D0OA 4MYDA 2A94A 4U7PB 1P17A 1BHJA 1V2GA 2Z0MA 2H3EA 4TROA 2CF6A 2RBGA 3OY7A 1ZWLA 2PZKA 2PUCA 4LF8O 2XQFA 3OU2A 5C5IA 1E6UA 1L7MA 4AS3A 4R1OA 3A3NA 3LO5A 2ORIA 1QQAA 1R5NA 2E4XA 2O3RA 2VTBB 2DWOA 1AO3A 3HA5A 2HMTA 1FTGA 4FZ0A 1BT8A 3ZRWB 1D7AA 4Q3EA 4WXYB 3G4SF 1UPCA 3AJ8A 5IYDO 1IPHA 1F9EA 2BCJQ 2RHDA 4RTMA 3IQHX 1T0IA 1HQCA 4D9JA 1RP1A 1YJBA 1EFAA 5KA5A 3EULA 4PLVA 4A82A 3MM4A 3CUTA 4J9ZB 3RSLA 4V24A 1E2FA 3HU1A 3OJFA 4M0PA 4ZODA 1XRJA 4V3BA 3QH4A 4C43A 2R8PA 2C4VA 3UXHA 2JJ8A 3B77A 1KOJA 2NUPA 2EJRA 2HRCA 3C1OA 3GAAA 1SUFA 1ZN8A 1U2TA 5AQEA 3VNQA 2D4AA 3VSAA 1EDBA 1JIXA 3RS5A 5LXTF 4R0MA 1F8UA 3BWXA 4DLNA 1B0ZA 3ELUA 1K4CC 3OQPA 4P54A 1PS9A 4CIXA 4N7MA 1GRVA 3ONNA 1U2RA 2FW0A 3IA2A 4BO8A 4M1SA 5LM3A 1HTTA 1LC3A 3IAS1 1JHDA 2G36A 1A9TA 1GL3A 1O94D 3U3MA 2W8BB 3FBTA 4Z9YA 3H1FA 5J23A 2F55A 5I9IA 1DLIA 4NG4A 3ZKWA 2GPJA 1AK1A 2FQXA 3IEVA 3PC8A 2VDWB 1E0SA 2VQ6A 3TPCA 3IOEA 1EGMB 1K75A 2ACVA 2VSQA 3MSXA 5PGMA 1PT5A 1H38A 1D0VA 1A9QA 2WPDA 2D1FA 2GK4A 4TLDA 2H48A 1I3LA 1OFIA 3ZGOA 4N5NA 3QE9Y 4RFVA 2ZT9B 1L4GA 4KYVA 4UCUA 2HQSC 1RMTA 2G08A 3DMYA 2DBZA 4J16C 1N1DA 2ZTLA 1JL3A 3ELDA 1UT6A 2V4UA 3PX2A 3GRVA 2UUAB 4G4SO 3RIMA 2RE8A 4H35A 3OIYA 1T25A 3NHLA 2WF6A 1ECLA 3JYPA 4YXFA 2A1IA 5G1OA 3KAPA 2GBIA 3G1UA 3AL2A 1D1SA 4WTOA 3L6UA 4J7JA 3QUSA 4XFJA 1E1RD 4QULA 3CFYA 5ENVA 3VO2A 4DMCA 1RQGA 3GT0A 4XFDA 4A0RA 2NW6A 1FXUA 3KQYA 5H9VA 1CDOA 1U3UA 5CXUA 3ELCA 3S29A 2HI0A 3VPXA 3I55F 1KQNA 3PLAE 4MWOA 1M57B 3TTVA 3B1XA 5BNWA 3PXDA 2D1RA 4MR7B 4Y3UA 5CFLA 3L4BC 5DHAA 4DV4B 2LTAA 4X41A 1O9BA 4OHCA 4W5WA 4OLAA 4IG4A 1VB3A 3HRHA 1JG2A 4WRRA 1UBSB 3O65A 1D9ZA 1EGQA 1GPMA 4LNHA 4EF6A 5FF9A 5FADA 5ELLA 3WGHA 3OU7A 1TKRA 1UJ5A 2PLAA 2CLHB 3QPVA 4NC9A 4XDZA 3CXCU 1AMNA 4Q9KA 3AEKB 2EATA 4L5BA 4RS3A 1Y5RA 4ZHVA 3QLTA 5CPBA 3X0DA 4OI0A 1E0AA 2IHUA 5I8ZA 1X19A 1CUCA 2YRWA 1NW4A 2C1XA 4ER6A 4ABMA 3FZYA 3B53X 4QOFA 3R76A 1Z6AA 2BKXA 3LDDA 2I1WA 2KYRA 2R7LA 3BTOA 3HSYA 3IKVA 4QU0A 3PD0A 5DGIA 3ZJVA 4B7ZA 5K5EA 5HTOA 4DR7O 1QGAA 5CDFE 4A8PA 2UKDA 3DZBA 1LW7A 3STWA 3OE7D 5DGDA 5AVYA 2IEDA 1Q6YA 1VQ4F 3C8DA 5IJWA 4TWIA 3GIDA 2PMEA 1TZKA 1Z7EA 3DBRA 3IIEA 3VDRA 4G4SP 4RK1A 4GL2A 4QTYA 4NTYA 5CXXA 2QTTA 1L6IA 1UKAA 4EG4A 1VQNF 4JLOA 2VJLA 3GJ7A 4PGAA 3A0RB 2OCBA 2V7XA 5LWHA 3HSSA 4RPJA 1ZIDA 3KSDO 2VNKA 3JQPA 3R7BA 3RO7A 1H2HA 1DDOA 2GASA 1BEZA 4JB3A 5HGJA 2CN1A 2H4ZA 4F8EA 3FGNA 2BOVA 3DH0A 4KTVE 2ODPA 3G9ZA 3AOGA 3OZ7A 4TKVB 4U2EA 3T3PB 1QV9A 4B47A 4EPYA 2QTOA 1X70A 4ZT7A 3WB0A 3JYLA 3HNOA 3OSUA 1TAEA 1WQ3A 3LOPA 4PGMA 1LPOA 2WTNA 3R3XA 1Z8FA 4DV7B 3EODA 1QZXA 3BE6A 4A6XA 1RJ9A 2P9ZA 1N3BA 1CLIA 4W7HA 4NCXA 1ZWKA 3BFVA 2JBAA 2JGFA 3EG9A 3CLUD 3MLAA 2OCPA 3OTIA 3QPAA 4WE3A 3ZHYA 5F23A 2WIKA 3ET4A 5CNKA 3TNLA 4DZZA 1ZESA 4ZEVA 1UKYA 2WU8A 2JKYA 1FU4A 1AJEA 4FR0A 1YAHA 4RZXA 4TSFA 2XAHA 1Q86W 1BA2A 3VHLB 3LUHA 3P2JA 2PQ0A 1EHCA 2R00C 4H6WA 2ZWAA 1JI3A 3WWYA 4U2KA 5EXEA 4JBHA 2ZM5A 1EH5A 4LFAB 3N6XA 4FHEA 4F5EA 4H37A 1G8JA 3N8KA 3AKDA 1ZN7A 4IVQA 5CR9A 5HF5A 1KZ7B 2B1IA 1REQB 4IWNA 2H1HA 1A9SA 4Q6WA 3TW8B 3ENQA 4G5HA 1CPYA 2QE7G 2R9AA 2HRUA 1AM4D 2ZIVB 2DERA 1RM1C 3WG7C 3HXTA 1SCUB 1K4KA 2H52A 2I6GA 5LP6A 4TT3A 5COAA 5HRAA 3RN4A 2D2FA 1HYBA 2AW3A 1EVLA 3SJBC 3GAFA 4B4OA 4IMJB 5L3FA 5IZ4A 5DRTA 2QJFA 4R8CA 2YVUA 2P77A 5HDQA 3G9TA 3QIAA 2H94A 3L8CA 4GXRA 4A7PA 3AG5A 2FP3A 1X14A 3VU3A 3L2OB 2V3VA 3OZVA 3DHYA 2BE3A 1GNPA 2ZYHA 3AJEA 1WV1A 2HK7A 3FHCB 2D13A 3FF4A 2BR4A 2W5UA 3SY8A 1TZMA 3CCRF 3GV0A 4M8KA 4QPNA 1HE5A 3LMKA 3S8MA 3BWDD 4N6NA 5FUYA 2D0OB 3CNLA 1LJUA 1SK9A 3BF8A 2C2GA 3AWIA 1Q6HA 3K79A 2BCCH 1FDTA 2ZBFA 3HJTA 3I6MA 4US2R 4FFSA 4RJ2A 3WV4A 5AI0A 3MGAA 3T35A 1NJGA 1K6IA 1CUAA 4D3ZA 3NM4A 5ALIA 4RZIA 3D5EA 1OGJA 5GJBA 1YCFA 3S7TA 1I0IA 4K8OA 1CR1A 2SBTA 3GI1A 4JI3B 2JFQA 1EFVA 5C53B 1BSMA 4FIZA 4BHTA 1RPTA 1MRSA 4MDEA 1NBME 3GUYA 3O82A 4LF7O 2CGEA 4IJMA 2VP0A 1XZCA 1SZJG 2V7WA 4LRUA 4PZPA 5H02A 3HEBA 5DGXA 1MJ5A 1HRDA 1V8BA 1MV5A 3QF4A 1SAYA 4RHTA 4C7BA 1XUOA 3RTGA 2JI7A 1Z73A 1P4RA 4E6EA 3K5LA 5IH3A 3D6TB 1PGJA 3JD0A 2QLTA 3N58A 4HDRA 1UEIA 1BC5A 1DO2A 1WPRA 4GYYA 5HUHA 3URKA 3GBPA 3RIEA 4YUAA 4JR0A 3E89A 1APBA 1OHHD 1YJCA 4NG5A 4QDZA 1CUXA 4CL2A 2DR0A 3VKHA 2FWJA 3B2QA 5JV5A 3ZHUA 4W9NC 2HH9A 3ZX4A 3IKFA 5MGBA 3H4VA 4QARA 1AF7A 3DZDA 5AJXA 2X41A 4ZEMA 1V7PC 2IF2A 1PUXA 1G21B 3C3EA 3RS3A 3P94A 4IDDA 4HEJA 4UVGA 1BGXT 4FFRA 4IZ6A 4PLHA 4CVNA 4N3AA 4QEZA 3M33A 5IDQA 3I5MA 4CEHA 3L6RA 2VR1A 3K16A 4GKKB 1PT6A 1T1GA 1ZEMA 5IJ0B 1SOWA 3P4XA 1NFQA 4XASA 1WA5A 2VT7A 3K5PA 4YJFB 3RS2A 1D5WA 1VBNA 2JBWA 4F45A 2I66A 3D8SA 3VDMA 1GK9A 3G71F 2AK3A 1Z5PA 2IX9A 3MAQA 3FWHA 5GAJA 3T7SA 3KLMX 5FLYA 2C7OA 2O2YA 2OHFA 1PE0A 2OCHA 5B3SB 1PLKA 3IEPA 1KMMA 2AGVA 4LN1A 2WJYA 5J5AA 2QAIA 4C0XA 3ZQ6A 4J0JA 5HY1A 5JECA 4ZAXA 3T7RA 3JR3A 4A92A 4BMDA 4J9UE 2Q29A 1C4OA 4GI7A 4PF1A 2IU0A 1IWBB 3PXAA 4M1MA 1N6NA 4NZNA 4W7IA 3PFHA 4S12A 4DC9A 2GK3A 1D6NA 1U0NA 2YV3A 1U11A 5EE9A 2JVKA 3V42A 3FCSB 2PA3A 3HC7A 4OKSA 4EGCB 3WISA 4X20A 4M83A 2H2DA 4OQ4A 1WMSA 3WRYA 3IJ4A 4KP7A 4ZARA 1N6KA 2JCXA 2YNMA 3CO5A 4UBIA 3GLIB 3DLTA 4PSKA 5B6IA 4RZUA 1S2GA 5BPHA 4X3LA 4K9SA 1XFAA 4LXTA 3UHAA 1N8RW 1PW5A 2GTPA 3K1TA 3BFJA 3LWDA 3NM5A 1PZFA 2PZLA 3Q7RA 4HUQB 4YDRA 4ZC1A 3MJ4A 1WE2A 1UIMA 2VXOA 5E6RB 5L3DA 2L69A 2WKPA 3PICA 3RDPA 2RONA 3R6GA 5AW6A 1XRMA 3P2IA 1GIAA 4TYMA 4BEWA 2EV9A 4Y1EA 1Z6YA 2I2DA 1Y4DE 1M90H 3ZQKA 3DJYA 4OK3A 3WWDA 3EZXA 3WY9A 2RHJA 4PICA 3BMCB 2J7KA 3BTVA 3FMOB 4RV5A 1CY6A 2BPOA 4ZYXA 1FB5A 2CWWA 2XCQA 1AU9A 2KI5A 4PHCA 1ODFA 4CMIB 1XYGA 3HJRA 3O4JA 4R3UC 2BFCB 3WJPA 3AF3A 3IUPA 1UXKA 1I5EA 1YWGO 4FJ0A 1EVQA 1CDEA 4U9HS 1EXMA 1PQUA 1IXYA 5AHRA 3E3LA 4ND8A 3Q12A 1NVWQ 2ZI4A 4BUJA 1BW9B 3H87A 2CNWA 1KQSU 4HFMA 4ZZ3A 4N8EA 2I6FA 4ERHA 2JLYA 5JCOC 1TCAA 3LNCA 4Y6GB 1EWRA 2IV2X 2VTEA 2A1UA 3PI7A 1ZYUA 1DX9A 1Z2GA 3A6DA 3L8MA 4XR9A 3Q3EA 4GGPA 2W42A 1OKKA 3HADA 3OE7G 1SMKA 2ZSIA 5COBA 3WSWA 3O73A 1U8EA 3H1PA 3N8HA 1K8YB 2NMVA 5IUJC 1Z5NA 2CXNA 3HB4X 3O2JA 4MI6A 4JBXA 4UNIA 5F76A 1B6RA 4BRZA 1E9FA 2DZDA 4HT3B 1C41A 3L1UA 2XNDA 3ENNA 4RK7A 4ZOQI 5K09A 3D0RA 1NNI1 2IODA 3L77A 4HR7A 1N2CA 1YOVB 4MVUA 3AGQA 4TWZA 421PA 5IU6A 1EFHA 4G1MB 1U9IC 2I6XA 2K5UA 2R1UA 2Q1WA 5HIAA 1T15A 1T9KA 3BVOA 5LGTA 4NS4A 2NO1A 4QBFA 5HE9A 4FBMA 2A0FA 2ZE6A 3D2BA 4D8XA 2CTQA 4KGVA 1SY7A 1U7HA 2FRXA 3HR4A 3JQ7A 3ORHA 4CGYA 3GLIA 2P3QA 5A06A 3B8MA 1BRMA 1A2OA 2A35A 1JKFA 2J6IA 2VBIA 5AK0A 5EFZA 3K31A 3P0ZA 3KVNA 2GKGA 4HD8A 4B6FA 3R24A 4ERXA 4YI3A 1NQAO 4Z49A 4DLLA 3NOOA 2YDYA 3LVFO 1E96A 3R0IA 4X3PA 5I7FA 4N76A 1E1RA 4H13B 2V97A 5FUBA 3DC7A 2PTMA 3KPJA 5G0WA 5BNFA 3SQLA 5EJ8A 3FRIA 4UM9D 4BVKA 5KQGA 1QP4A 4GYCB 1S6YA 3GHZA 1O0SA 4GKJO 2GYWA 2HMSA 2PVSA 3DLIA 3DO6A 4GECA 4AJ9A 1QTRA 5K51A 4F4JA 1DKNA 3EDCA 3KJZA 2H1SA 4IIFA 2NU8B 4CLRA 1DCTA 4HLNA 4IJUA 3OZXA 4ZT2A 5AQ1A 1UBEA 1FKAO 2FN3A 4N12A 1NT2B 1XNRB 2P78A 1AGYA 1HGXA 3SZMA 5HY0A 1FZTA 7ABPA 2C5AA 1M3SA 2QBYB 2FE4A 3OP4A 3ZHBA 1WP4A 3L79A 1H5QA 1HDRA 5A1TA 1UDWA 1J4AA 2AVNA 2QUKA 2WQZA 2YX1A 2DWEC 4DCOA 3HZRA 1K8AW 3HSKA 3ISVA 3W3ZB 1BDHA 4M46A 1DE0A 2HRBA 2P40A 2YS7A 1TAGA 5TJHA 1Y1PA 4XYEA 3SVTA 2L19A 1BDIA 2WM8A 3CZ5A 3H5VA 3DL2A 4V0LA 3O4IA 4W7SA 1NC3A 2CHFA 3C5WP 4C8GA 5AJWA 5DCUA 5KSWB 4CI9A 5LOVF 3TECE 3MB8A 1PEAA 4M9XA 2ECOA 5JNSA 1SPXA 2QVXX 2QUIA 2C2MA 1DC3A 2CNNA 2XEDA 1RXYA 1MG5A 1E5TA 3EDOA 3L05A 3QVJA 5BT9A 1RMQA 3ZWXA 1QX3A 3U81A 4NARA 1WY7A 4G67A 4IIJF 4EVRA 3I34X 2Q8QA 1FBTA 1R7RA 1VRCA 1ZHOA 3L8EA 1LH0A 5G4KA 2K2WA 3CRCA 2P22C 1BKYA 2H54A 3H11A 4IX1A 4HGYA 1EX9A 4J2HA 2AN9A 2OV3A 1YZBA 3BRWA 4AKTA 4ZFNA 5BXYA 1H4QA 1QIIA 2X6TA 5FOXA 4G0WA 1ECFA 1D4AA 3IJPA 4KCGA 5AXDA 3A0BZ 5I51A 2Q73A 3BXHA 1XF9A 1MZVA 5EC1C 3ZWOA 5KUTA 2INGX 2AFIA 3CUYA 3LWBA 3ETNA 4WFKA 3VKVA 4QGPA 5L7TA 5JJLA 1DT5A 2CL7X 4IGGA 2XRZA 2HMWA 4LFBO 3AF5A 2D7DA 2B2NA 4BLRA 2D5AA 1TYZA 5IASA 1UJWB 3ROQA 2PUEA 1QOQB 3V8VA 5K3EA 1J7KA 2PX8A 3HPQA 2J46A 1XFDA 2V54A 3N53A 4R69A 3O92A 4DBLC 4QO7A 1H47A 4TVBA 1PS0A 1Q7TA 1OT3A 2B78A 5DOVA 3TE6A 2F00A 3DHNA 4KACA 3UY4A 1SUDA 1V16A 1K4MA 1B6SA 2CK3D 4CNQA 5L7WA 1OJLA 4QTTB 2K87A 1JHVA 2BMDA 4IRUB 2AA3A 5CCDA 2O7RA 3ENKA 2W2KA 1F3OA 3VR4D 1D2GA 4PDMA 1WMFA 4R2IA 4TTSA 4WAUA 2DPGA 1Z18A 4PQFA 7REQB 3QSYA 3AFNA 4MGEA 4WZBB 3K15A 5HF8A 4DJJA 3BCUA 3FDIA 3D01A 1FFAA 2QN1A 3D6JA 4YJ2B 1KIAA 2FPPB 4RVDA 3GJ6A 1AZTA 1F6BA 1EDDA 1QO0D 1JVMA 3DE7X 5F1OA 4E5VA 2N05A 1A72A 3AZOA 3ZN0A 1BE8A 3H9JA 4QUGA 3A4VA 3QVSA 4OQPA 5ADUS 1FRFS 3HFSA 3QKSA 1I5YA 4IDPA 1E20A 2C7BA 4QE9A 2PSDA 4N3BA 1OCCC 4R8RA 4B84A 1SRYA 1KI6B 2NTVA 3DBHA 3DOCA 1ZW6A 4LJKA 2ISQA 1XKXA 1PR1A 3QWFA 1JQLB 3BAZA 3TJTA 4XM0A 3FNHA 2BEWB 2J33A 4DLWA 5AW7A 3SD7A 4JYAO 1M5RA 4F72A 1AN0A 3ELBA 2IKQA 3KAKA 4FBLA 3UVEA 2EFJA 2OORA 4HRXA 2RG1A 1X42A 5LL6Y 2SKEA 4D25A 2D2CB 1DAGA 1PLJA 1U28A 2M2IA 2ZYWX 5F7ZA 1Y1TA 1AB3A 3H5WA 3VSCA 2QRGA 4GKAA 3CJRA 4KX5A 4RO2A 2O1EA 5EE1A 3EPJA 1CZNA 4D0GA 3DCIA 5CX1B 3IUEA 1E79D 4N1AA 1J8YF 3SIXA 1VECA 3MBKA 3P5BA 2Z8YA 4EPWA 1RA4A 4CTMA 5JBQA 2JRIA 4HYOA 1NWHA 1ENYA 3DE6X 4F6LA 5I7RA 1E2EA 3N2NA 1N2EA 3UMMA 1D5CA 3OOJA 4MS3A 1SCAA 3BTUA 1D09A 3GNSA 2L18A 1LI5A 4R0NA 4PVDA 5EVCA 2EGUA 4IDAA 1JR9A 4JI0B 1QIMA 3U37A 4B7CA 2GF2A 4CLEA 2QSZA 3R40A 2IQ5A 3QHQA 4DMUB 3IL2A 1QLEC 1C9DB 4TQ9A 4YAFA 4C8EA 1BXKA 2QUZA 1Y74A 2JEXA 1QH1B 3GZ4A 3LUDA 3OEHD 5AHKA 4B85A 4JZGA 1NLFA 4CFYA 1GL6A 2Q21A 4Q20A 1JQEA 4MXDA 1RRGA 5CM8B 3L7IA 1BFUA 3AX6A 4EFNA 4KR7A 4B5LA 4F92B 2NLJC 4KVZA 4RWZA 1EHYA 3G59A 3WA6A 4MUJA 3RTCA 3GLRA 2JIBA 4AMUA 4CU2A 2JHGA 4B6OA 4PYJA 1G1AA 1WMDA 3H97A 3KSRA 4YJ2A 1Z36A 3AR4A 1K88A 3DKKA 4JI2O 3QKIA 3MTJA 4BKOA 3QX7A 4WOJA 1MNQA 4TMTA 5GM1A 2XNHA 4DLBA 3H5NA 3U19A 3ND5A 4CODB 1SVNA 2IKSA 1Y4UA 2DFTA 3BPSA 3ECCA 3IP6A 1KGSA 1NVPB 1X7YA 2G06A 3PHJA 3SC4A 3IXMA 4JJ4A 2ZUWA 3PYLA 4EKIA 1Q0UA 4B0OA 2HS4A 2BRUA 1C29B 3ODGA 4F4IA 2C29D 3DV0B 5HSGA 1GTG1 1NU8A 2OMKA 5TQ0B 4PD4F 1HX7A 1TGVA 4ZQCB 1BXRB 4XGQA 2OZLB 4EJ6A 5B7QA 1BROA 1YB1A 2AUNA 5JISA 3W7WA 3K35A 4QBHA 1H48A 2ZSEA 2WMYA 3AFHA 4W8GA 3VMMA 2VBFA 3KL4A 4UHKA 3ABOB 1YRAA 2RJZA 4PZYA 3EVCA 4XD7A 1JNYA 2GF0A 4C21A 1IUNA 2WHXA 1BS2A 2JLUA 2UZ4A 3AB7A 2O8BB 1DADA 1CERA 1NV8A 4YPVA 3I83A 4HB3A 4ZT6A 4F4FA 4ZOLB 5B1AC 2D5BA 3PFCA 4XX1A 5K8CA 4BAGA 4BXOA 2O2ZA 3UK1A 1KEEB 1F2DA 4ZHQA 1M1NA 1W2HA 1ZH2A 2YIJA 2ZITA 1TB4A 3CT6A 3KKQA 3PRJA 5CIWA 3IX7A 2A06H 1DKRA 1GSIA 1X9IA 3FSEA 4AJKA 4CFZA 1QF7A 1VQ1A 3CCFA 3QXHA 4O2AF 2CLCX 2GJKA 2I4TA 3FTCA 5AOBA 4Q66C 4IWXA 4NFSA 4NPHA 5FA5A 3BWEA 3VOTA 1OFUA 5KC9A 2X5NA 3IAFA 4JL5A 1ZUQA 2F62A 2CVFA 4NDZA 4QLAA 4Y2XA 4TPKA 2G07A 2AFHA 3TETA 3G0BA 2QZJA 3A6GA 3IEKA 3RHTA 4RUEA 3EFEA 4DCMA 2CCKA 4H1WA 2XNDG 2ZOSA 3ZX5A 4RHYA 4HGNA 3WAJA 1T0JB 2CV2A 3EGIA 3PJDA 5ALRA 5A7FA 4RDCA 3K58A 2EW1A 3HEAA 4LXGA 3VC7A 4ZCIA 4KMMA 1KOFA 1P1RA 3I9FA 3SMQA 4YFYA 4D46A 1EUYA 3WMXA 3DVAA 3T7IA 1YULA 1KI1A 2FZLA 3CKYA 3LDHA 5J2UF 5JSQA 3O3NB 5KUKA 1DT9A 3OPQA 1VFPA 2JLAA 4ETIA 1VL1A 5D8DA 3QMWA 1A32A 4ALLA 4O5OA 1ZVJA 2W2LD 4K0KB 3BL6A 1WKCA 5IJ9A 2O8NA 2HQBA 3SBOA 1PLLA 2RGNA 2VQSA 4F3CA 3GRKA 3BXFA 2HJRA 3TLCA 4U3JB 2E4ZA 4DCPA 2ID8A 4ITUA 1XDUA 3LH5A 4LI3X 3ABMB 4QHSA 4M6WA 3NAZA 5LMZA 4U2FA 2HPVA 1NN3A 1GO0A 3EIWA 2G77B 3RWRD 3EQ7A 3IOCA 3OPYB 4CG1A 2QL7A 3WB1A 4WKPA 4GGMX 2IYEA 3UFXB 1N9KA 3NANA 5FI5A 2QD4A 1V9CA 1N4AA 3JS5A 1QCEA 4C4SA 5GIPE 1G8GA 3H6GA 3ZR4B 3VO1A 4BY9E 2O57A 3HZZA 1OWOA 1FA9A 2OUIA 4Z3DA 4MAAA 3ZUPA 3P2EA 4L72A 5AKEA 3WNZA 4XVRA 2CVZA 4D9KA 2C7RA 4AKHA 2QIOA 4JZKA 2WIFA 3KRTA 1CQZA 4L2IA 2DBQA 4NZPA 5HA5A 2FK7A 1MLDA 5JO9A 3OJLA 5TIIA 1SHTX 1RXEA 4G4JA 2P06A 4DRXB 5LMUO 1Q8RA 1S1CA 2GN0A 2I54A 2YHAA 3MWKA 5AKGA 2OESA 3DTVD 3Q15C 4HATA 1R6KA 3R0QA 1ZMBA 5HJEA 4OHXA 5DIZA 3HXKA 1L7RA 2C4MA 4LF6B 4JXZA 4PGGA 4L7QA 5JMOA 3O7WA 4URUR 5A5GA 3TPZA 4G0UA 1PN3A 2WWVD 3P9CA 4GRAA 2ZIMA 1X52A 3IERA 2CDCA 4AHCA 1O6CA 1L9XA 3E81A 4RPCA 3B52X 4XB1A 1YDEA 3RE1A 3TQTA 3LQQA 4FZ5A 5CT8A 3O21A 3P9NA 3TDMA 1L8OA 5H0IA 5B30A 5LQRA 4F3YA 3FVWA 4RHCA 1FNSA 3W90A 2FLKA 4Q47A 4V0OA 1IEQA 4KUHA 1KB9F 1ANKA 1I7NA 2CBGA 2REQB 4QXOA 2HX0A 4IUCS 5DTRA 2HBYA 1CYEA 5E8RA 1GQYA 4PIPA 5EHQA 4PDLA 3ZMTA 2GHIA 3TKLA 3A2LA 2RIRA 1W25A 2BGRA 1E3WA 5HFLA 2Z4RA 4GP7A 2QM7A 4BFTA 5JUWA 1SU8A 3EHBB 4UOEA 1Z62A 4OFWA 5BXZA 1A82A 3I56V 2MJLA 5T4HA 2QTVA 3FLMA 4HZIA 1VSUA 4EJ2A 5JS7A 5LQAA 3RAFC 1H2YA 4RQBA 3H2JA 3K0CC 5HKBA 3VTIC 3KKKA 4E0BA 3THOA 3CBQA 2OT5A 1YTFB 1GNSA 1PFWA 4QVKA 4BFSA 4MQLA 3RRFA 1HLFA 3ZNQA 1KRHA 1JDNA 4EG3A 3MD9A 3NATA 2E4VA 2WYVA 4G28B 1DDIA 2XRYA 3NP9A 5EGSA 4CMEC 1XXLA 3UPTA 3OTOB 2PMDA 3KQLA 3JWJA 3ZGXA 1JEOA 2HCRA 4WCFB 4ZK6A 3TOVA 4K3VA 3BQMB 3CCVV 4AQDA 1H0HA 1L5WA 3LPDA 1QONA 3OT5A 1JX9A 2PPVA 4ZHSA 2VHJA 1M67A 3C3XA 5CVEA 5GOTA 1A7AA 2X3YA 4WDQA 2X5KO 1NQXA 1F38A 1MJGM 1AVTA 4WINA 3ESJA 2E5LB 2LCAA 1U5AA 4AX4A 4FFLA 1QG6A 4FFBA 1DJNA 1F8FA 2D54A 4LHSA 3PI6A 4YMTA 4MQ6A 5BOSB 3U1TA 8ATCA 2X77A 4YRJA 3O6VA 5LQUA 4B3RB 1PL6A 2HLHA 2PO5A 1U6KA 3R5HA 1DPFA 3LQ2A 4PG5A 1T36B 3RADC 2RCNA 3CINA 3U49A 1PK8A 4C03A 1ZM7A 2O1WA 4GYWA 3LWPC 1GGMA 2ZBEA 1TAQA 1N2HA 3QE4A 3IAUA 4NCNA 3A9UA 2GTHA 3A1DA 4YB8A 1GO3F 1O95C 2YOHA 3ENZA 1AKWA 2IUSA 4XARA 2IZ0A 4D6TH 1JHQA 4Q5IA 3T3MB 4WJLA 1SQBH 1G41A 5BRAA 3BOSA 1GGEA 1L8XA 3FTNA 3GNQA 1G8FA 1LCIA 4FK8A 3UUEA 3ACCA 1WZEA 3QKUA 4NXNO 3BSYA 5CFMA 2OP1A 3AF0A 3RREA 3GUCA 4WXRA 2GKOA 4M88A 4S35A 3TRDA 4EZIA 3LPAA 2GLXA 3CIOA 5JAOA 1JSRA 1J8MF 4AS1A 1CJUC 1XLTC 2COUA 2NZJA 1HEIA 1NE2A 3L75H 1C0IA 1R15A 1NTZH 4DR4O 1G42A 5MN5A 1PSZA 1WSDA 2X5XA 1RFGE 1K8ZB 2OTCA 2IU6A 2ODAA 1O97D 4HWSA 4NEQA 4QXMA 4XWWA 4RY2A 5DN6G 3R75A 1ILWA 1A8QA 3ZVNA 1YZLA 5BMOA 4GKVA 4TYYA 2OPHA 5EOVA 4U39A 2CHEA 1ZH6A 2CKDA 5HQ3A 5K4GA 4TTRA 1A8HA 4M1ZA 5I6DA 1TA4A 2XUIA 3IV7A 3EZLA 3HN7A 2PKRA 2UXNA 1UBGA 1PNQA 3JVIA 4YI5A 4PWZA 3RF7A 3QOWA 4DIUA 4MQFA 3VH3A 3HNRA 5JYDA 4J80A 3SIVA 3T1YO 3H8WA 2ZUBA 1G3RA 3MPUA 4UJ5A 3TUIC 3RH0A 4B32A 3QENA 3A9CA 3IVMA 3KFVA 2QPLA 4GRIA 5JOQA 4KK3A 1DKMA 1YIDA 1Q5OA 4CF7A 2C88A 3CM0A 3AJRA 1A8IA 4HYYA 5JJKA 3RHZA 1O4WA 1NU1H 4HB0A 4WH0A 4EEKA 5G1NA 1V54B 4I5DA 2RAVA 2UYOA 4MR9B 5KCMA 3EX7C 3AERB 3I0MA 1FTWA 1JTEA 1OLSB 3VV3A 1DMRA 3L7OA 4S2UA 2ZREA 5EO3A 1VP7A 1J33A 3B6MA 3WP0A 3OHPA 3A9RA 3CY6A 4N8SA 4WERA 4C1NA 2VQ3A 1KRXA 2OK7A 3VKWA 2PL5A 4QECA 5KKNB 2PHZA 1DF5A 1JG6A 2OBMA 3CZ9A 4UHBA 1V0JA 3S5JA 3CF2A 4D2IA 4QHTA 4DA0A 3KB1A 2I76A 1ONSA 1RWWA 3NTQA 4PN7A 5HKAA 3Q0IA 2ZR2A 3COVA 2GXSA 3ZX6A 4LFCB 3CR7A 1CNEA 1RAHA 4O4IB 3E5NA 3OLWA 3N5KA 4HF7A 4L8WB 4XGIA 3IR9A 3TQRA 1GSHA 3LUBA 1AUQA 4JV5O 3ESZA 4BNIA 3PNOA 4BQFA 3DYIA 4JX9A 3C3CA 2AFIE 1IATA 1P6QA 4JH0A 4ZOEA 2G83A 1LV7A 1PDWA 3G9XA 4KRFA 1H9CA 1DLJA 1PZEA 4BVGA 4JKIA 4UW9A 5INTA 3D31A 2VH1A 3BC1A 1EWYA 1I3KA 5SYAA 4ETNA 3FFXA 2EVWX 5C35A 4DR3B 1RQNA 2C9CA 5L3RA 7MDHA 2JHAA 3LKDA 5CTAA 4C4YA 3SQWA 2V6BA 4C04A 1X59A 4B8YA 1JSXA 1Q6IA 1YQUA 2ADFA 3CR3C 3CJHB 1VRVA 1FRQA 3FB1A 2JJ1G 2ZINA 1DAMA 2FYUH 3P9PA 2XKAA 2LGWA 2N42A 3G2HA 2IW1A 4LHZA 1WTCA 4PAWA 1MAVA 5AJYA 1N2IA 3NHPA 1JQDA 4MIEA 3QF7A 4ASUG 2F3SA 1VQ9F 1YKGA 4OMCA 3TTYA 1TZBA 4OP3A 1XRQA 4P1ZA 4H33A 1LRLA 2VDLB 1H3NA 2VKQA 3RU9A 2Z9DA 3G2LA 1FXKC 2AW9A 4NF2A 4W5RA 2JLZA 2AZ0A 2G5TA 1CY7A 1XMXA 2NZVG 2HEGA 3O5AA 4KG7A 4DLYA 5ALEA 1EVKA 4TQFA 2ADPA 4Z7JA 1CQXA 4EKWA 1WCV1 4CKEA 2J3JA 1RKVA 2A78A 1UAGA 2W6JD 3EH1A 4LOKA 2WLHA 4UHCA 4EENA 3AM4A 3EZFA 1EVIA 3DTVB 1YL7A 1MIHA 3E7FA 4UMVA 1NW9B 2QZ4A 4WX2B 1A71A 1C8BA 4FTWA 1G8AA 4MRVA 5AM2A 5AW8A 1GZHB 2C5SA 1D04A 4I4CA 1GRJA 4UUQA 1I14A 5AH0A 1FVHA 1KMCA 4RXUA 1NT4A 3KKLA 3VYVA 3AFOA 2Z30A 2EKPA 1Q21A 1SC9A 3AR2A 4G65A 3H0KA 4AUNA 3A1SA 4KV7A 1VYUA 2NVUB 4DYHA 4XDGA 2NSLA 1NW8A 3RSSA 2X6QA 4NZMA 2B7LA 4I6GA 4JUAA 1TVKB 5DYGA 1MB3A 1QKIA 5DECA 4BGDA 2NV0A 4CQMB 5I4BA 3AK2A 3L0SA 3V97A 2H6LA 3FCOA 4NOJA 1RZRA 1PTKA 2LGJA 1ODIA 5LKAA 4YRQA 5JSKA 3AHJA 1PL4A 1AILA 1WN7A 4R84A 4Y9TA 2REOA 5I48A 5IHPA 1PYGA 2O4UX 4H6XA 3SAJA 1J09A 1KJYA 3UCEA 4H1VA 1ABFA 4L0DA 2DHDA 3OY2A 3BJMA 5I7OA 4TRNA 4UNSA 1OX4A 1FY2A 3WJ7A 4R6XA 3FAZA 4MUMA 2BBWA 5AM5A 3VBBA 1NMUB 2IUEA 3CCUV 1XRNA 2W6NA 2X86A 1XEWY 2RGAA 3K9QO 4NOKA 5E8JA 2DUJA 2XOKG 1IURA 3OPYI 1UBUS 1L8LA 4LH6A 4FLWA 1XMOB 1DQYA 4PNPA 1SXJA 1X7ZB 1XCPA 2TECE 4LW8A 2FMUA 5CX4A 5CDUA 3N27A 4JLKA 1WCWA 1JT9A 1LK0A 1V3TA 1CP3A 3C7KA 3LX4A 4A8TA 5HM8A 1W36D 2H16A 4MRAA 1YHNA 4KDCA 2ATXA 3B3GA 2VHYA 3KU4A 1OJHA 2AOWA 2G0NA 4P0PB 3CPJB 3SZ3A 5EKDA 1QPZA 2P69A 1IY8A 1Z0UA 2I2WA 3IDQA 3MWYW 3H2IA 1H2BA 2I2FA 1NDHA 4BO9A 4BIMA 2PZBA 1M66A 2DQYA 3C97A 2XB8A 1J0EA 3JYOA 4Q7KA 4YRAA 1KOGA 4KHPB 4UREA 1HZZC 4O2BA 3QEJA 2RGBA 5D87A 2PX6A 2Z6QA 4Z4GA 4TV8B 1P81A 3RA5A 1LDMA 3LZCA 1F7UA 1SVWA 1GNTA 1W34A 1ZKDA 2C9MA 2XMZA 5E3JA 2OAEA 3QWIA 3DAYA 3W0LB 3KCYA 5EQFA 1S7CA 1B8OA 3UAZA 1TIKA 1RADA 2DKNA 4RAIA 3CX8A 3HCBA 1ORQC 2B36A 4J1TC 4QXAA 1JWLA 3AY0A 1EX1A 3C4QA 3NBAA 1PG2A 2FZEA 3MMXA 1FYXA 1BVYF 3P45A 3RGWS 2X14A 3NV7A 4IVRA 5CDHA 1QV6A 4QZVA 1AKTA 5A0FA 3H8JA 4BU1A 1JYEA 4B7XA 2OFFA 3P0EA 1P5ZB 2H5EA 2QLJA 3DOEA 3W9YA 2Q5CA 1I33A 2C58A 2VJMA 1ULBA 1OZ0A 3BEDA 3OZIA 1SFRA 2WSYB 4YUVA 5KAFZ 4B43A 5AVUA 1G21A 1H2WA 1OI7A 4PA3A 2DECA 1GN9A 2DULA 4IPTA 4EPTA 1SCDA 3LBAA 3G2IA 1FYVA 2F48A 3I8OA 2KJQA 1KU0A 5IAOA 1GARA 2L17A 3KHKA 1DC5A 1KYVA 1NU6A 3GG2A 1Z38A 5FBQB 5TARA 4DXDA 5DW0A 4P81A 3I2YX 3SM9A 2C5EA 5J9FA 2IPNA 4R50A 4J3FA 2BMJA 3U0OA 4JLJA 1R8QA 3RKSA 1XPRA 1BCCH 1AR1B 2GFQA 5I01A 1QPGA 1RYYA 2FMFA 2XMQA 3FOBA 4L07A 1XP5A 1QP8A 4LTNA 1IAQA 4LF5O 2OHXA 4RDIA 1W96A 2I2AA 3H4TA 4D9EA 2H2GA 1N33O 3IUNA 3HDGA 5B53A 1JJVA 3FWKA 1K4DC 3QTLA 3LCJA 1HMPA 3NLLA 4INJA 4JENA 2COKA 3ZK7A 4CF4A 3OKAA 2OIEA 4P22A 1XZAA 4JK3A 5FWYB 1VMGA 1IXKA 4EKNB 4EG1A 3JATB 4M9CA 2QSYA 1G6HA 4PELA 1GKIA 1PJ2A 2Y99A 2NUAB 3PE3A 2P2LA 4MP8A 4E13A 3MIZA 3PNBA 4FD3A 1CQIB 1XTBA 4MVSA 1E7QA 1EAMA 3PPXA 2P67A 1WXWA 3HVHA 1NF3A 3QYJA 4KWEA 1KC8W 3KT6A 1K8XB 3CCVF 3C9UA 1G4HA 3M9LA 4JMPA 4EBBA 3QNWA 3S3XA 3W5CA 2ONJA 2FKAA 2XZOA 1KI2A 1CVLA 3IR5A 1L5ZA 2BBOA 3PS9A 4RF2A 4WK0B 5AYVA 1G2IA 4L5YA 3CCUF 4RKFA 1V2HE 4N03A 3PQ2A 2GAJA 4W1SA 1L2TA 5DBOA 1SCKA 2FE1A 3SYTA 3TNJA 3BB1A 3O90A 4MWGA 3FAVA 2QY6A 4EVQA 1S4MA 1PVDA 4LJ4A 2G1JA 1BMFD 4F04A 1KDVA 4L3VA 4P7GA 4F6CA 4IHJB 1Y4SA 1T4BA 2GJAA 2ZIXB 2FB9A 5ECWA 4LJ6A 1YZHA 3CSSA 5T4BA 3SEQA 1PCXA 5CFOA 3LPNA 4BWAA 4OCZA 621PA 4BNLA 4ZT3A 1ESMA 2VYQA 3NAQA 2JLXA 5AIAA 1MMFB 1N8SA 4GBGA 1YDWA 4XUDA 4EVIA 2XYVA 3EUAA 4RS4A 3Q3CA 3BXEA 3SS9X 3UMFA 3HGTA 5B6JA 1S8FA 1WL8A 2FUKA 2P35A 4U7WA 2BFCA 2JCGA 1P1BA 5JJCA 1DK1A 1UBMS 4PZ9A 4MCJA 3RTAA 5C46F 3B36A 3UJCA 4YCAA 4TLBA 2DMXA 4DV3B 2OVBA 1L4LA 1WEKA 4DGQA 3X1XA 4Y9DA 5C8YF 2P2SA 3Q9SA 2Q5QA 3Q8MA 3ELYA 2FQ1A 1QJ4A 2ZRPA 3L1IA 4IF6A 4JJ6A 4PO1A 5FFNA 1GZDA 3ASYA 1GCOA 3BE4A 4CG0A 1C80A 2VDWA 4BL5A 2PGDA 2JGNA 5CDFA 4ZYLA 1WDKA 5DBHX 5AVQA 4LFBB 5E9QA 4Q7JB 4HAYA 2UYNA 5HP8A 5ALUA 1RC8A 4INAA 1NURA 1XELA 5LGNA 4C2TA 3RG2A 1V37A 4DLZA 3GD7A 3MRTA 4L5CA 4XZ3A 3MZ0A 4PCVA 2Q9LA 2ATEA 4F4DA 2H18A 1KDOA 5U9CA 2HSWA 4LF9B 2Q1TA 3WQRA 1QNFA 1RLUA 4B82A 3QELB 1BA3A 5DX1A 4CF3A 3O8LA 3TLZA 1E2BA 2YXNA 4PONA 5E0OA 5BUZA 1P2BA 4GF5A 5JNUA 2VHXA 1MXHA 2Q7OE 5C4IA 3B6NA 1EINA 1FS0G 1LS1A 1LDBA 2XYPA 4FI3C 5FWDA 4RIFA 5DNUA 1JEQA 4ZU6X 1L7QA 1TFUA 3FI9A 3T6KA 4EHAA 2WJGA 3D54D 4NB5A 5JS8A 5EWMA 2KQXA 4WFFA 4TTQA 4UHFA 4J7UA 2OEPA 3AZPA 4I9FA 2F4VB 4RPKA 2ZRGA 2QW8A 4LHWA 1IPAA 4ANFA 1YR6A 1XA0A 4BVFA 1CJSA 2ZRLA 3KB6A 2CXUA 3KJXA 4NWOB 3QW2A 1UUFA 2IVZA 4L75A 5ECYA 1L5LA 4IHJA 2RGGA 2ZIXA 3K2BA 1QR2A 4E6PA 1KBQA 3L01A 1AQLA 4JBLA 1ML4A 2ZS9A 3FCEA 2WHRA 3EIOA 1FNCA 4UV8A 2B2CA 4FX2A 4L7VA 3K59A 5CVDA 4XCVA 1GGVA 1P77A 4MVJF 2GSDA 5IKXA 2O0HA 5C1BA 2GZ1A 1HLDA 2HUNA 4DLPA 4RV9A 2WOOA 2VT6A 1R9GA 4JCCA 4CMGA 4U9UA 3CRMA 1XDSA 3DLPX 2KBFA 4F6RA 1M1XB 3CX4A 1N3IA 4IEFB 4PINA 4IDOA 4YRCA 4ZQFA 2WF8A 3TXYA 1GO2A 1Q1ZA 3EDQA 4HSEA 4OGLA 4P4UA 1J2TA 1MOZA 2VLIA 2JG3A 4UAVA 3RIHA 1KFJB 2LBWA 1M2OB 3FFAA 3GGCA 3OE5A 3P8ZA 4CQJA 2ETXA 5A02A 3K70B 2P4SA 5TQVA 4DAEA 3TF5A 3IAHA 2ONKA 3JQEA 4F2WA 3BFPA 2NO4A 2XDQA 2HP3A 3D8TA 1SU4A 1H2XA 3GZNA 1C9JA 1OLXA 3E8MA 4XM1A 2RGWA 4GSYA 4R7ZA 5DCLA 4C3ZA 1GTL1 3FPCA 3L0OA 2Q5LA 1TPYA 3NEPX 3OMIB 3C5CA 1EN6A 2R47A 4KLRA 4Y1RA 3KP1A 3V8EA 2VAMA 1KFCB 1KI4A 3ETHA 5EXSA 2GM9A 3K73O 3JAKB 4J91A 3PBKA 4FI3F 1HE3A 3X2EA 4DDHA 1AJQA 3K71B 1BO6A 2Y4NA 1DX4A 2AN3A 5BPFA 4HOYA 4GT1A 3A9TA 1JIUA 3W5UA 2FOLA 3A27A 1EBUA 1NKDA 4M38A 2WKRA 4TL8A 3T9AA 4C7OB 4D4IA 2BCEA 2Z1FA 2AFIB 3AY3A 4O4IF 2OTJV 1USKA 2N47A 2YQZA 3VPSA 4IXMA 4F1KA 1K6EA 1UZNA 4MJLA 1U2PA 4ZI3A 1UM9B 2Q3JA 2HP0B 4GLJA 4OHZA 4EX6A 1RJ9B 2HQ1A 3FYCA 4IGFA 2G71A 4DCCA 2PNJA 1BXZA 1SXJC 4HTAA 4JNCA 5TDHA 3RIXA 3TZLA 4AMZA 4CGZA 3GUVA 4TL9A 5A2QM 1FFXB 2JH9A 2D7CA 3FKSA 3HS3A 3ZMSA 1L6RA 3UJHA 2ZSFA 4JYMA 2H85A 4Q3BA 1Q0QA 1T6YA 4FHZA 3Q11A 2IX3A 5KNLA 1CEEA 5B1NA 1W93A 3C8UA 2PG3A 5A0TA 4DWWA 5K9ZA 4OBEA 4D3SA 5FTMA 3C45A 3I42A 4RY9A 4ZCSA 3OKPA 3UUWA 4ADSG 4BP8A 4L57A 3MUNA 4PLCA 2Q69A 5IKPA 1HE2A 2NUPB 3QJGA 3NV9A 4OHBA 1HZZA 3VHXB 2AG8A 2GZMA 4J4HA 5ALMA 1COWA 3E7XA 1CRQA 1REQA 1SHLA 4KZPA 1L8AA 1BJKA 1E1MA 1K66A 3B5IA 1RRMA 2Q4PA 1AGXA 4IQGA 4UMFA 1NVVR 5G53C 5JS6A 5D5QA 2VPPA 3EGWA 1ZIXA 1AHHA 3ZV3A 3CMAV 4OTZA 4QNNA 3BH7A 3GYQA 5KHIA 2GN4A 1WR8A 3NM6B 3N6RA 5E2AA 3JQAD 2DQKA 3ZWBA 3HRIA 4UU1A 2ZVQX 2QJRA 2YS6A 3PDWA 4M8LA 1G4YB 1I1OA 1I3OA 2ATCA 3IULA 3W9BA 2XUHA 4YUZA 4IM7A 5H6RA 1IY2A 3K1JA 2R4UA 5KWEA 3FOZA 3DV9A 1URFA 3WG7B 4D4KA 1ODEA 4B5CA 1JCHA 1XQ8A 4HZ3A 3SR3A 2JC3A 4HEA1 2P6JA 3ESDA 1U7UA 3SIPA 1TAUA 4K6MA 3AOEA 4B17A 4XBFA 3UF0A 3AJDA 1CUIA 5KSZA 1HRKA 3DWEX 1Z39A 2C99A 1YS7A 1Q1QA 2ZZKA 3JASA 4YMWA 2XSZD 1H3FA 4D9GA 1TZJA 1SQ0A 4P4NA 3CCSF 3T4XA 2YKGA 4EZBA 4MV0A 5EP4A 1ECCA 4NTXA 1EFPA 2FPGB 4ITRC 1FSPA 2HK6A 1GFZA 4X62O 2HKOA 1KFBB 2J45A 2W11A 4EKEA 5IT9N 4F85A 3GWZA 5A5DA 1EZVH 2HTEA 3FSJX 3SEAA 3P20A 1MAAA 5BR8B 3T7CA 3LZ6A 3ZHCA 5B3JA 2QD2A 2SECE 2X40A 4DSUA 1WXDA 3CVWA 3VX3A 3NEYA 1MGOA 1XD2A 1VL0A 3OU6A 2XTAA 1NFRA 5CNIA 4LCKA 5ER9A 1XEWX 4O2AA 1L4BA 1USIA 2GAFA 1GPJA 3D9QX 5AMXA 4DJFC 3PXXA 1SQPH 3WJRA 2QR3A 2EDAA 2OSVA 3DQQA 1C30B 1VI6A 5AI9A 3V4RA 5IVHA 2HT1A 1RXUA 3N3AC 4O4HB 4FPXA 2C3YA 1Q17A 3WLKX 3JSAA 2HW8A 4UNNA 1X8XA 5HP7A 4QRIA 3VVLA 3WK4A 5JXJA 4JITA 1Y89A 1AVMA 4OQXA 4RH3A 4IUDS 3K96A 4R2JA 2WABA 1JJ2U 2RMKB 1M72A 4OXRA 1T2EA 2AQ8A 2EZTA 1ZX3A 2BEVA 3VBEA 4EARA 4U3FH 1EDOA 3CR8A 4KAJA 1BZKA 4K9NA 5HCNA 4MZXA 3C98A 5LQKA 2OLKA 3C3BA 4N7JA 4C89A 2QAJA 4IYIA 1IQRA 1E1KA 1R2QA 1QRRA 4NS1A 4UTZA 4ZEWA 3ZDQA 2W48A 2JFYA 4D3XA 1NMQA 4BZZA 5KQMA 2LZ0A 3G2JA 3CGWA 4A2PA 2PQ6A 4KR2A 2O19A 1NBIA 3DAOA 1Q44A 3JQAA 4JSRA 3UWDA 3VZDA 1VF6C 2HO5A 1XTZA 1T29A 4WXMA 4DA7A 5K03A 5EUCA 3OFJA 5JXWA 1SCNE 3KQMA 4KVFA 1W88A 1Q82H 4LJYA 5TPZD 5B3KA 5CVUA 3ZDFA 1KNXA 2XTZA 3NMUC 3D1LA 1IBKB 1Q0SA 1ZK0A 4FBGA 3ZU5A 4LCUC 1C7FA 2BGMA 4YLEA 3W5HA 3U44A 4ZYVA 4LPKA 2UYNB 1JLKA 1DQPA 2MYUA 4QPJC 2I9PA 4XDYA 1JZSA 1PJBA 2MOKA 3F5SA 4Q9AA 3EPHA 1KHTA 2G6BA 1ZJZA 2B8NA 4HNSA 1U6JA 1J0BA 4IMPA 1UMCB 2VWJA 1OW3B 1SPBS 3QVNA 1E3QA 1IBCA 2YIBD 1G60A 1NXPA 1P91A 4V0ME 5CH8A 4Q9JA 5T4EA 4UCSA 1FJGB 4FKZA 4MW7A 1D2CA 4AICA 4EAQA 1RYBA 2AJ8A 2IC5A 2ZRIA 1L1FA 1OA1A 1YASA 5LA6B 2GZDA 3L49A 4Y2SA 1Z5VA 2GGSA 2H7XA 3TFOA 1BCSA 1CUZA 3H99A 1A4XA 1JB1A 3ANYB 4BRWA 4G88A 4O59O 1KGDA 1OH6A 1Q6ZA 5GJCA 1FX0B 2IHBA 4KRYA 1EB9A 4L3WA 4O4JA 4XLTA 5ES3A 3SXUA 3V55A 3NHSA 1EFCA 4NENB 1QG4A 4YALA 1AXGA 2CFTA 4GE0A 5DWDA 2OV4A 3WMWA 1M0WA 1WCXA 3M4YA 5CJ2A 4UCQA 1AHPA 1LI4A 1CDZA 4G56A 1ZWZA 5I45A 2HCFA 2DJVA 2QRHA 2VQDA 5BY2A 1DVRA 4L4YA 4PC1A 3T7DA 2AJLI 1VF6A 3L4EA 1NDQA 2RARA 4XDHA 3BMQA 1GVHA 2VXBA 3E8BA 1KEWA 1MVLA 1ZL0A 2ZFUA 2FN4A 3IYLW 5IS2A 3KQSA 4D56A 4OB6A 1JKXA 4R1TA 2FPPA 4P53A 5G02A 1RP3B 2KSQA