5LASA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c/r396t) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-3)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
b'PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADETAAAKVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 61
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lasA00
4IW3A 4NHMA 4MHUA 4Y5SA 4NHYA 3W20A 5L9RA 5DAPA 4XC9A 4NHXA 5LBEA 5C5UA 4NHKA 2RDRA 2RDNA 3OBZA 2RDSA 4ZONA 3DKQA 3NNFA 5DAQA 2A1XA 2JIJA 4XCBA 4Y5TA 5A3UA 3EMRA 5DAWA 3BVCA 3HQRA 5HV0A 4NAOA 5LATA 3PL0A 2JIGA 2OPWA 5EPAA 4NHLA 5M0TA 2Y34A 2HBUA 5LBBA 3GJBA 2Y33A 4JZRA 5LBFA 4Q5OA 3OUIA 4XAAA 5LBCA 3KT7A 5DAVA 4ZPIA 5IAVA 5L9VA 2G1MA 3NNMA 3MGUA 3W21A 5LA9A 5EP9A 4XABA 4BQYA 4MHRA 5IAXA 5L9BA 5IATA 5EQUA 4UWDA 3NNJA 2G19A 4BQXA 2HBTA 4XCAA 4NMIA 2FCTA 4BQWA 3KT4A 3GJAA 5C5TA 3ITQA 4XACA 2RG4A 5LASA 5ERLA 3GZEA 2FCVA 3OUHA 5LB6A 4J25A 2FCUA 2RDQA 3NNLA 3OUJA 3HQUA 4KBZA 3KT1A 2V4AA 5DAXA 5HV4A
chains in the Genus database with same CATH superfamily
5H9RA 2A3XA 3BGAA 3C3VA 3SXWA 2R30A 3H1YA 1U12A 1HQWA 4WBBA 5D8AB 3MUY1 1GZ9A 4ZS3A 3WZ1A 3E6CC 2IXLA 2QE3A 3T4VA 3ZFFA 1TMF3 1UZ0A 2QBXA 2W94A 4OMDA 5DAPA 5FDBA 1JYCA 2P6CA 1DQ6A 2DFBA 3VBHA 4UFKA 3N9NA 2RDRA 2ERFA 2QQWA 3BN6A 4IE5A 3B9CA 1WWYA 3SEPA 5FPZA 3AKQA 1NCQC 4QPWA 4CCOA 1QJU2 3FWEA 2IWGB 1CWPA 3LE0A 3LA3A 3RZKA 4DY5A 1MEC1 4K7JA 4OMCA 5A1AA 3NNFA 5C3OA 4XFBA 2WAOA 4FT8A 4KGQA 5JXJA 4MXVA 1JZ6A 1YUDA 4YM0A 1WLWA 5JZGC 1IS4A 1MS8A 2RM22 5L7OA 1Y7BA 1V0AA 3J7MA 3VD7A 5J37A 4JKMA 1EP0A 4BXFA 1JU3A 3I3DA 4OVEA 1GWMA 5E1RA 1NAEA 5LATA 2LRPA 3ZXDA 3IM0A 1VBA1 2QZ2A 4AVCA 4UF0B 2P5BA 4V2VA 3QD6A 5LW9A 2HBUA 5FYVA 4MGKE 1UXXX 2LW8A 2ZHMA 1OH3A 5BPXA 1HB4A 2VMGA 2ZX3A 2DCYA 2BFUL 3CDZB 3LSDA 5IW0A 5T52A 4LKDA 4Q5OA 1MR5A 3BI3A 1JMUB 3ES1A 4YM1A 1CZSA 4QKNA 1AL0G 3GALA 1RXFA 5HPOA 3TBDA 2NMNA 5FZFA 3SISA 4TTGA 2WWJA 1F4HA 3FMGA 3T3YA 3VD4A 4XYXA 3I7DA 1EV11 3AK0A 1YI7A 1AL21 3LZZA 2XKPA 1F15A 3HVDA 2ZKNA 2OXBA 3MGUA 4JHZA 4LPLA 1XYNA 1W9SA 3ILRA 3H50A 2BJSA 4CDXC 5CFDB 2HWB1 3Q8AA 4YSFA 4V2WA 1CAUB 3NL1A 5FZOB 5EP9A 1RUI3 2JDYA 1TME3 5JSPA 1UWWA 2X5IC 2BW8A 5LEJA 3I3MA 2RR11 3ECQA 3I3BA 3L2YA 1F5FA 4Q0UA 4XQWA 2WS93 1H4HA 4AFMA 5GZGA 3DYMA 4XJUA 5A6ZA 4D7TA 1PIV1 1REFA 5GZEA 4GB32 4XDOA 5HCFA 3NWKA 4JGZC 4M4PA 3NNJA 4QPGA 4D94A 1LOFA 5FMBA 2TBVA 4NMIA 4QPYA 1H30A 3E5UA 4BPZA 1G6NA 1WW6A 2ORXA 4D7YA 5E88A 3VKMA 1JYVA 3GJAA 3U10A 4QB6A 2HWC2 4N43B 1OUXA 4CEWB 5KBFA 2V5YA 1KD7A 3T30A 3GZTB 5FZ3A 1OFNA 2D7FA 2OUJA 4CYDA 5LRSA 2VU9A 2WT1A 1ZYBA 1LRHA 3M8LA 4MOAA 4HSJA 4ZZ8A 4DOUA 1OURA 1AX2A 2UU8A 4DZGA 5J96B 1E5RA 2B42B 1VBE1 1BBT2 1WBLA 3J7LA 3LPGA 2R16A 4X6RB 5EV7A 2YMZA 4JC1A 3FBYA 5FP8A 2ZGOA 1JZ7A 4MZUA 1JS9A 1ZBA1 2A6ZA 4A6OA 1D4M3 4FFHA 4IEPA 2HWD1 1VB4A 5FXVA 5BXXA 1F35A 2VNRA 3KV4A 1FOD3 1W6MA 3KVBA 2VMEA 4FOWA 1O91A 4LBJA 1GZWA 1DU3D 1YI9A 4DUVA 1W6OA 1MS3A 3PDQA 1FMD2 4IQPA 5HBAA 1N3PA 1ZA4A 1LOAA 4Z2AA 3AXEA 3IIIA 4QT6A 4EJRA 4PIZA 4XC9A 2Q5TA 3SCHA 2VOXA 1FPN1 2HWE2 2GH8A 4EN7B 3OPTA 4PIXA 1F5JA 1PGSA 4I0WB 3GCXA 1OKOA 5A7WA 5F7UA 1V9U2 1MPXA 1W04A 3ACIA 2NN8A 4PI2A 5F2WA 3RI9A 2VUJA 2VZ3A 4AGRA 3MHZA 3V56A 2CGPA 3I2JA 4B4PA 1HXS1 1RUJ3 2E26A 2O1QA 4PDWB 5C3RA 2P1BA 2RJ2A 3I59B 3ETPA 1FYUA 1NYWA 3H3UA 1AR73 4KWUA 4LUKA 1YQCA 3O0XA 5GLWA 2QQOA 3HJRA 4ISRA 4N7UA 5FZLA 5JMOA 2GZWA 4Q8KA 1D0GA 4QX7A 4A42A 3U11A 1V6NA 2J1VA 2EXHA 4IEWA 3BALA 3S7IA 1TMF1 1OVSA 5G04L 4UYBA 1O8SA 3B94A 1VIWB 5A7QA 3U4SA 2PHTA 3AMHA 4HPKB 2IXIA 5AVAA 1ULPA 4N90A 5FKCA 4MGZE 2Q8CA 5A7SA 1LCLA 5BNOC 2TUNA 4WM8C 2R073 5KHHA 5F1RA 1G86A 2Y64A 2O8QA 4JTNA 4YRDA 2J1TA 2W3JA 4NRQA 5FMOS 4MVTA 5JOWA 4WVVA 3GXUA 1JHJA 2J22A 1AR83 1RUG2 2ET1A 2XH6A 4IE0A 2XBO2 3ZFGC 3CO2A 1X36A 1ZRRA 4CDUB 3FHIB 3IIAA 5FPBA 4YW4A 3ZFEB 3L9JT 2Q30A 4FSJA 4LKSA 2VMIA 4B7KA 2VZRA 2VPVA 3I2FA 3AB0A 1LOBA 3CJIB 1X7NA 4LUMA 4XFHA 2B7YA 2YGMA 4XPVA 3HWJA 5DZEA 5E8AA 4PLMA 4AVSA 4XBQA 1O3SA 3THPA 4GA9A 4UW6A 3ILNA 4Y24A 5AFBA 4GMP3 4P5YA 2BNMA 4XZPA 2D97A 4KGGA 3PVNA 3VBSB 1FXZA 2VCBA 3H1WA 3KQ4B 4RFRB 5BNNB 2A3WA 3UV9A 2PN5A 4UF0A 1ST8A 2DURA 3KD4A 5EZWA 1LULA 2GC0A 1SBEA 3W9AA 3WNNA 1XYOA 3ZIWA 3H7JA 4E27A 1G9AA 5FJKA 1RUI1 5D1IA 1TME1 1GV9A 2LALA 4BA6A 4QAWA 3N9MA 3OUHA 1UOGA 3M70A 1K5JA 5DG2A 2WS91 4OQ8A 4LBQD 3MICA 1B35C 1OD3A 4AAXA 4FOYA 4S2DA 2RM23 3WY6A 3C8XA 1O3RA 2QQJA 4QU1A 5CFDA 1UYXA 4AOCA 3WUDA 5FY1A 1CAUA 5FZOA 3LAGA 4QDRA 5JAXA 4GULA 5LK7B 4CCKA 4KU8A 5FZ4A 1LR5A 2QDRA 3UKNA 1JOPA 5LA0A 3O7OA 1VBD2 4IW3A 3PMEA 1E5IA 2DUQA 4XMIA 4LKEA 1N1VA 3KGLA 1RUD2 3D5OA 3J26N 3K4DA 5JMCA 2OZ6A 4CP9B 2LROA 4B4RA 4NRMA 2YU2A 2NQYA 5H9PA 1TE1B 4HK8A 5FO8B 1MZ6A 2RS32 4QU2A 2YBSA 3MFAA 4FVVA 3HQXA 1HRV1 1SLLA 1G9CA 2VQAA 5C8WA 1VBC1 5FZ6A 3WW4A 4N43A 4CEWA 1DYPA 1D4M1 1ND2C 1H0BA 5C8CC 3MBWA 2Y0OA 2Y6KA 1FOD1 1GP6A 2Y6GA 3J8F2 3N9QA 1OOPA 4AWDA 4HKOA 5FKBA 4OUSA 4JKKA 5FZGA 4AI3A 3POFA 1EAH2 4D6RA 1JYIA 1C8M2 5GLTA 3I54A 5HCAA 1KFXL 2GDFA 1BZWA 2WJSA 4GB33 4UFHA 3U14A 4BQ2A 4AI1A 2DU1A 2WWSA 4XBNA 1VAVA 4N8MA 2CU5A 3EJKA 4LULA 4HK9A 3Q8FA 3VZLA 3ZM8A 1UIKA 1TVGA 4JVAA 3KV6A 4LBOA 4LK7A 1I1EA 4BOWA 1BMV2 2C6SA 3DV8A 1DCSA 5KHGA 1JZ2A 5JZGB 1DIWA 2HWC3 3LIGA 1O7FA 2Z5WA 3MO4A 2W08A 4FFIA 1J3PA 4HMZA 4O9EA 3W5MA 2XGXA 1LOFC 3ZPOA 1MS9A 1YQ6A 4A4AA 3RWNA 3CL1A 3CIHA 2ARXA 4C1XA 2D6MA 1HN0A 1RHI2 3MIGA 1YJKA 5I0UA 3RZGA 1GUIA 1BBT3 1PNFA 4PDWA 4JRLA 4QGMA 2I74A 3I59A 3WUCA 4HSLA 1NXMA 2R071 1C8NA 5FPLA 4E9KA 2UYAA 1RB8G 4AHWA 1NA1C 1U5IA 3MZHA 3WF2A 3RZMA 3FJSA 4UFLA 1W03A 1HB1A 2GNBA 1FMD3 2R32A 3JQXA 2W95A 2GNTA 3NSTA 3B93A 1AR81 3POWA 4WVZA 4HPKA 5CVRA 3M3IA 3TRSB 5A1LA 3H3LA 5EYXA 4CDXB 2J1UA 2OQ7A 2OZJA 2XWJB 4PI0A 2VCMA 4XCAA 5A7PA 5T5PA 4FOQA 2HWE3 3TEXA 2IVIB 4FP2A 3B5LB 4RHV2 4DUXA 2VUAA 2X5IB 1MQTC 1S0IA 3VKOA 1V6MA 3OCPA 3VD9A 1BXHA 1Q56A 1A78A 2A3YA 1PGW1 3RNSA 3NKGA 2RMU2 1YWKA 2LUWA 3GBGA 4JGZB 2NP0A 5LB6A 2ZBJA 2J1SA 4CDUA 3HPNA 1UNBA 5CA6A 5G05L 1US2A 3AM2A 3NNLA 4CP2A 2JDMA 3OUJA 2B39A 1NY72 2R49A 2EICA 4LXLA 3UJQA 1PVC2 4BQ4A 3G7DA 2W91A 2FD8A 3CKHA 3KCYA 2Q4SA 5KC5A 3CLPA 4NPLA 2EAKA 4FTEA 4P9WA 5AVPA 3VHPA 3AL6A 3NV4A 5FQ0B 2VZUA 4IGOA 5FBJA 5C9AC 2BZDA 1H2LA 1FATA 3B3QE 1DZTA 3VBSA 5BNNA 1LGCA 1W8TA 4EQVA 2VD7A 1IHMA 2DVGA 2BGOA 4R9CA 2XJTA 1W6NB 3WF4A 1M06G 4RGKA 5C33A 1LNSA 1RUG3 3Q8EA 4AI0A 2XBO3 1RVF1 1LHUA 1UKRA 2RS52 4B8EA 2C9KA 4ZY9A 3GHMA 4LHSA 5FYCA 3PVOA 3LQCA 3LDKA 3VDBA 1X9PA 3R05A 3V0BA 4LHKA 1JU4A 4CCCA 1MS0A 1ULOA 2IUWA 2SBAA 1G8WA 5C3QA 3FZ3A 4IDZA 5LA1A 4MGYE 1YLLA 4OZXA 2GSYA 2HEWF 4FPYA 4CDQA 3VHNA 1SFPA 3ZDVA 3Q9OA 2C26A 3PTYA 1Y9MA 2ARAA 3D4KA 4WV8A 2QTWB 1LHVA 4XURA 3SQOA 2QQIA 4COVA 2V4VA 4FAHA 4INDA 3PL0A 3D0SA 4JGYC 5FRAA 3GF6A 2XUEA 1AR92 3PUSA 5FY7A 2HJIA 1DQ2A 1WLCA 1VE0A 3OOXA 3GYDA 1RJ8A 2JG8A 5FJHA 3ZXAC 3VZNA 1AX1A 2DTWA 3PIJA 4FPFA 2VY0A 1XNBA 3VDAA 1F2NA 4I30A 3WEZA 3OUIA 1RC6A 5C70A 1PO21 2P17A 3KT7A 4Q0SA 2OPKA 3ZYRA 2F6BA 2IXKA 4ZPIA 1OMIA 2JDAA 4XUNA 2RVAA 4GH4A 2VOVA 4AQ2A 5BNOB 3W5NA 2QZ3A 5GLVA 1PX4A 3GNEA 3VHOA 4ARXA 1CVNA 2GNDA 4U36A 2Q8DA 5F9TA 4QQLA 1LGBA 3V65A 3BB6A 4XABA 1PZ9A 1GNHA 1AR62 3GZUC 3RWKX 3ZFGB 2E9QA 1VBD3 1QXRA 1YFWA 2MHFA 1R081 5IAXA 4OQ9A 5IATA 4XFGA 5AC92 3POBA 1TNFA 2IXCA 1RUD3 3SKJE 3UETA 4BLIA 1NCQA 4LBNA 5FO9B 2VJXA 2Q1MA 2RS33 4NVPA 5IK8A 4CUAA 4D6SA 3VKLA 1SMVA 2D3PA 3SC7X 2OX0A 1BBT1 3TEWA 5C5TA 3QLQA 4Y26A 1UQXA 4C90A 5CKMA 3NAPA 3DN7A 4XIOA 1B09A 1UCXA 2J42A 3BTAA 3ZSKA 3LA7A 4X8NA 4AEDC 3IKWA 5FCCA 1YRZA 1Q8VA 3MIEA 5GZDA 3AVSA 3J8F3 4O7XA 5FLJA 1YYNA 5IYYA 4Z8BA 4UBGA 4OFGA 2GMPA 1FMD1 2VNVA 5FFOC 1EAH3 5CYYA 4AVBA 4E8DA 3AJYA 1HKDA 3OJBA 1JHNA 1LENA 2BVBA 3HQUA 1W2OA 3AMPA 4QQOA 4AVVA 2EXJA 3ELNA 5A70A 4M0HA 3OB8A 2HWE1 3RRDA 4WVMA 3SCGA 1OOPC 1TEIA 3EO6A 2A6WA 4S2HA 1I3HA 2BWCA 3PU3A 1FV2A 4TSVA 4MHUA 2EXKA 5DDJ3 1QKQA 3AYCA 5JXGA 2VZPA 2WSUA 4BLJA 2JJ6A 3VZOA 3VD5A 1B35B 1KXGA 4M4RA 4CPBD 2RE9A 3BCWA 1S0DA 2X10A 2XVKA 4PIYA 1RYYA 3HBKA 3O0VA 4DEQA 4ZU4A 5LBEA 5C5UA 4R9AA 2ZX1A 3O1TA 1J83A 2VR4A 3O1OA 2GN7A 5F3IA 2DVAA 5A3OA 1HB3A 3ZMOA 5JXHA 3MLLA 4IEYA 3APBA 4CXXA 4ZONA 4C91A 1Z78A 1OKQA 1RHI3 4DIQA 3FUQA 1Z7S2 1JYWA 1CGPA 5EFUA 3B00A 1VBB2 1IQDC 5A6YA 4DEVA 4JGZA 4OLLA 2IVJA 1K5MA 2WZPP 1URXA 2YY1A 5EXOA 2WO1A 4Y5TA 1JH5A 2OQ6A 4XXAA 1G9BA 4RYDA 4PJYA 2E7TA 4XXPA 2BFUS 4LA3A 3AYEA 1N1SA 3WD5A 4CCLA 1JZ4A 4IE6A 5K7PA 3IDEA 5HCHA 5FPVA 2WN3A 1ND2B 2XJPA 4A3ZA 5C8CB 1DGWX 3LWCA 5FZ0A 2ADEA 1XOYA 2NYYA 1NUKA 3ROUA 4KG8A 1QJY1 5FQ0A 2ZTNA 3WNXA 4RHV3 2ZAHA 3T4HB 4BB3A 3FBMA 5LBFA 3AC0A 4IEUA 1T2XA 5A6QA 2YV8A 4QM8A 1UOBA 2WO7A 4A45A 1W6NA 2PHUA 1PO12 4Q1PA 1FX5A 2W1SA 4QQ2A 4FXGB 1LOCA 3NJZA 4Q4Y2 3IAPA 2YUEA 4ASMB 4DMIA 5BNPA 3H9AA 2JDHA 4FQ4A 3TN91 1PVC3 3NV1A 4KU7A 2D93A 2O14A 5FZBA 5J3UA 1VB2A 2P3JA 3GBWA 3WF1A 2R063 2FQPA 1ZZ6A 2Y26A 4PCRA 4FTBA 3AKTA 3H42B 5F6LB 1LOGA 4LQRA 2CYFA 4BQ3A 4YW6A 3URFA 5FOBB 1YEWA 4IEVA 4L0PA 3CJXA 4LITA 1J1TA 1XE0A 4GMP0 5FUIA 4A44A 2YB7A 4S2GA 3K77A 3INAA 3DECA 2Y6FA 4OCTA 4Y1VA 1NE4A 1IKPA 3JCIA 1UX6A 5IVJA 2RS53 1NA1B 2CAUA 1A3KA 1O5UA 1XYPA 4YG6A 3WP3A 1NXD1 1UY1A 2D5HA 3AP5A 3H8XA 3DCQA 3WCSA 3FHAA 4MO3M 2FDKA 4EROA 1SFNA 1OLME 5CIRA 1VBD1 1OA3A 2BWAA 2XHNA 2ZEZA 4YGCA 3WXPA 5BNOA 1NCRA 2VBPA 3AKRA 4WM8A 1JOJA 2ZX2A 3TAYA 5A3PA 2QQMA 4M3CE 1W6OB 1MQTB 3FE5A 1W3XA 4BXSV 2B4KA 3ILFA 2OW4A 4BE3A 3POIA 3LPFA 1EYBA 1QHDA 2DBNA 2P37A 2W1QA 3OGRA 3AP4A 1AR93 3R6SA 2WNUA 1RUF2 2I2SA 2O0OA 4Q4W2 3RVHA 4CDQC 4RGAA 3ZN5A 1CPNA 2Z4FA 5CFCC 1COV1 1Y43B 2E7QA 3WDXA 1W39A 5F37A 2NPIA 1XRUA 3J8F1 5SV5A 4I0BA 3JZVA 3KLSA 2GC1A 2VVFA 3UGGA 3I49A 1EAH1 4L99A 3VD3A 2E51A 2Y0IA 4UAPA 4EWEA 3KHCA 2JG8C 3UL2A 3PUQA 3H3ZA 2DFCA 4YW3A 5FP4A 4Q4X3 5C9AB 4C8DA 1ZVFA 2JKXA 1DQ0A 3T0BA 3RGBA 1WUVA 4WM7A 3ZOIA 4Y1ZA 2D6KA 4R52A 3HAGA 5EJZB 3VBUC 5DDJ1 2A75A 3KF5A 4IERA 1OQEA 4XFFA 1AR63 3IDAA 3ZR6A 1G9FA 2ZKLA 4CE8A 2D6PA 4H7MA 5LA2A 2DDUA 3AFGA 1RUE2 3IT8A 5AC93 1CAVA 5FMDA 3PJYA 3WNMA 1NX9A 2UY8A 4FBFA 1HW5A 2PQSA 3ACHA 1UU4A 2XLFA 1T6GC 2H6BA 1IOAA 4M3CF 4LO8A 2PA7A 2VBDA 3ACGA 4K8RB 1JYXA 4C0HA 1B35A 1QJX2 3MV11 3N9PA 5FZ8A 3J4UH 4EWAA 3WDYA 3WX5A 5IVVA 1O3QA 3UK9A 5LEKA 2E63A 1MS1A 3UYJA 2WZ8A 4I3PA 2JKBA 4JGYB 4QXHA 2F17A 2FDFA 2BTVC 4AFAA 1SQ4A 3I2HA 4IEOA 3DUIA 4O61A 3SMHA 1KJLA 3ZO0B 5BV6A 3K3NA 1JODA 3NAPC 4RFT0 1R092 1STMA 2UY9A 5KXCA 1LHWA 1S0EA 2JE7A 3EQEA 2R0HA 1H8TC 2QUOA 2RS12 1MVQA 3MIBA 4D8MA 2ZZQA 1TQ5A 5IVYA 1GICA 2VMDA 2FDGA 2KM2A 4KI5M 5I91A 4Y3OA 2UWAA 4XTPA 1UL9A 1XNKA 2J1EA 3POSA 5FAXA 4CEYA 4FAGA 5JPNB 3S0MA 1YFUA 4UWDA 1ND2A 2VL4A 2ZCWA 5C8CA 2X8KA 2YFUA 2Z2SB 1CJPA 1XNCA 4RA0A 4ZS2A 3OYWA 3WF0A 1W8WA 5DXDA 1S2BA 2FCTA 4MX3A 3LF7A 1HRI2 1NY71 4DXSA 3ITQA 4XACA 5IFTA 2CV6A 4W50A 5CU1A 2A73B 1EUTA 1Z7S3 5K4LA 1VAMA 1VBB3 2R061 2Y8KA 4DPNA 3VGIA 1BEV2 2PLV1 3N7LA 1KS4A 2VZQA 1N3OA 1Q8PA 4IV3C 1J59A 4YZ2A 4OHWA 4EN0A 1UMHA 3KSCA 4J25A 3LOBA 1W0PA 2XL7A 1IKQA 2VXJA 1D2QA 1IS3A 1ENXA 1PMIA 5T3NA 5KR7A 1RMU1 1QOTA 3M3QA 1Q8SA 4AI8A 5IHRA 4KWLA 2LM3A 3BTZA 3I2IA 1IPJA 3SNMA 1WGPA 4MSVA 5DAXA 4AEDB 1K5MC 2ARCA 3M7AA 2DVFA 2XWBB 2R042 5GKAC 4RGGA 1HB2A 3BU7A 2WR9A 3POEA 1QGLA 4FO9A 1OFSA 4OI2A 3W59A 4DRVA 4Z1VA 5C71A 5C4WC 1SLAA 2Q1ZB 1JBCA 1FV3A 2ZGKA 2D43A 3EBRA 2DBIA 4K8FA 5FYTA 1PO13 5A80A 1OOPB 4JTOA 4QQHA 3RZZA 5I0RA 1NA1A 3MEPA 3UKTA 1LHOA 2QDNA 1JYTA 5KHIA 2PXJA 1BJQA 3O1MA 2HYKA 4YLZA 1ZBE1 4UFIA 2PHFA 3ZKUA 4XUQA 2R7EB 4ONUA 1UO9A 1VJ2A 1NLQA 3MIHA 3ZVXA 4B29A 2B9UA 5BNQA 2C9AA 5BNPC 4BQ5A 2H6CA 3KCXA 1MQTA 2WFF1 4QHZA 3WVJA 4K3UA 4META 2PAMA 5BYNA 5EPAA 2PHLA 4NHLA 4AAPA 4AQTA 4HLTA 2XDVA 3SKVA 3MW3A 2OS2A 5H9SA 2QQLA 2BNOA 4D7SA 5LZ6A 4XBLA 1LJ7A 1RUH3 3DGTA 3ZYFA 1X82A 4Q4X1 1BCXA 4P14A 5EJ1B 2AEYA 3K48A 3RMYA 5A3LA 3S5AA 3VZJA 5DQ0A 5IK5A 3ETQA 2C1FA 3QH7A 4YZ3A 3WOGA 1SEFA 4A41A 1UZWA 2GMMA 4E4ZA 2GH2A 3R0RA 3U1XA 1DYOA 1O5LA 1OLRA 1YFYA 3UKVA 1DZRA 4LE4A 2G9FA 4NIIA 3FFQA 5T5JA 3WHUA 2OT7A 1ULCA 5DUWA 2JG9C 2H0VA 5C9AA 4XMAA 3LCPA 3POYA 4HL0A 2Y60A 4B7EA 4MYEA 2VZVA 2ZPXA 2VZ1A 4YYOA 2IFRA 1X33A 4DQAA 3TEYA 4X8PA 1RUF3 1NCRC 4Q4W3 4IGPA 4NIDA 4YFWA 3IZOA 2CTVA 4CCJA 1DGRA 1L7QA 5FYMA 1CN1A 1UU5A 2JDNA 3OG2A 1W6QB 1ZZCA 2GALA 2WAAA 3WW3A 1SCRA 2XMLA 4BM8A 1GR3A 1S55A 1CIWA 4P9GA 4ZZ5A 2R0FA 3JUUA 2XQRA 4YWAA 3DPRC 2WUHA 2WNUC 3U07A 1CX1A 3NO8A 2VVDA 1VALA 3MLJA 3V64A 1GQPA 3KT4A 2E7AA 1S4CA 3ZSJA 4KQ7A 1DZQA 1LU2A 1J58A 1NLSA 4W6WA 5IK7A 4JGYA 3ZMNA 2ZABA 1K3IA 1VLNA 1ZNPA 2GNMA 3S57A 1CZVA 4HFSA 3Q8CA 4QX1A 4LOSA 4YW1A 4ISQA 4MXWB 5GALA 4IUGA 1RUE3 2AACA 3WG2A 4WM7C 1CZTA 1H9PA 5K0UC 1BHGA 4ASLA 1N1TA 3WV6A 3SEEA 2DCTA 2E6VA 1DF0A 2VNOA 3GCWA 4CUBA 1Y3TA 5C3PA 3FLRA 3E1F1 3KCCA 3BOPA 2XJQA 3J9SA 3TWIA 3MIDA 3LEGA 1WMDA 1QJX3 3DYPA 4ATFA 1XNDA 1U0AA 3CHXA 4KL1A 4AL9A 2DCKA 3ZLIA 3V0BB 1QJU3 1NOVA 4P00B 1YNAA 1H9WA 4CA9A 4NHKA 3ES4A 3PU8A 3W58A 2J1AA 2X53S 4LEJA 3ZYHA 3OBZA 3AVRA 2EVXA 1KEXA 4QM9A 4CDQB 3RMXA 1UZYA 4K9SA 2CDOA 2QVSB 5F5QA 5CFCB 2B5HA 1R093 1D0HA 3OY8B 1XE8A 1MZ5A 5HCBA 2Q8OA 1F31A 4D3WA 1DBNA 2RS13 5FYZA 1ULFA 1GQGA 4L8QA 4UW5A 1UZVA 3HNMA 3JD72 4NIHA 1KFUL 3ZYIB 3ZKYA 1GQHA 4QGNA 1GFF2 3QH6A 2JG8B 3RS6A 1A34A 4J1WA 5F5AA 3O0WA 2DU0A 1E5HA 3JBG2 4AEDA 1NE6A 4CCNA 5J7MA 1UY0A 3WW1A 5HXMA 1QNWA 2J1RA 3FX3A 1AYN2 3VBUB 1Q8QA 3OBRA 4GH4B 1KITA 2A71A 4JZRA 4LLFA 1HRI3 5CBLA 2ZS6B 5DN2A 4CEYC 1CJDA 1D7PM 3I3QA 5FZEA 4LJHA 3TYJA 3WQ1A 4W6YA 2VZTA 2CAVA 5CEHA 5DAVA 1NZIA 5JOXA 1UZZA 2YC2A 5DUUA 1BEV3 3MIFA 4I3GA 3KB5A 4XF3A 5I0TA 3NJVA 1S0GA 1G9DA 5ABJA 1WBFA 4QKFA 3VL8A 2HWF2 1ENQA 3DYOA 4AXOA 4BMBA 2I45A 5LY2A 2DV9A 4HG6B 4Q26A 1CD3G 4OULA 3HMYA 1NCQB 4MLOA 3I3EA 4I09A 3T0AA 3ZYPA 1RUH1 2ARBA 1PM7A 2K0GA 3ME2A 4UW3A 3PUAA 1TG7A 1O4ZA 1VPHA 2R043 3O5SA 5A3MA 1R1A2 1RUJ1 3I97A 4DO0A 4AHYA 3NRUA 1JOBA 4TZDA 2YROA 4KH9A 3NAPB 3VBOC 3O1RA 1AR71 3FL7A 4Y22A 2XR4A 1UMIA 1H8TB 3MF6A 4B3NA 5C3SA 3BU0A 1F8VA 3O1SA 1WCKA 3LFMA 1CONA 5KWRA 5GZCA 4UXAA 3AZVA 5ERLA 4OHZA 1YHFA 2FCVA 3KF3A 1W8ZA 2C5DA 1RUF1 2W5FA 4Q4W1 4WVMB 4QWNA 4C0BA 4JKLA 4HT1T 1GNZA 1SLCA 4LBQA 2CDPA 1UYPA 4YM3A 4ZHNA 1WMXA 3G6JB 1W6PA 2WNVC 2XPJA 4OHVA 1WW5A 3VKFC 2WT0A 4XW3A 3BTXA 3KT1A 2RJLA 2AEZA 1HN1A 1S0CA 2WNEA 3CU7A 3LEMA 1MVEA 1I5ZA 2JXAA 1CR7A 3P6BA 5IJRA 2VBBA 3OGVA 4JAAA 4FPCA 4IV3B 1SCSA 2A7AA 4D69A 1VRH2 2Y6HA 5CNAA 4LLOA 3EXUA 1V9U3 4NPMA 1W6QA 4QKDA 3KZ4C 1BKZA 3I2OA 4I01A 2DYCA 2NLRA 4FPOB 4EV0A 1IPKA 1WCQA 3N35A 2P34A 1ZZ8A 1ZRCA 4NIAA 1SHWB 5A7NA 4GMP1 3A22A 1K5MB 5JOZA 1MZEA 4LK6A 4HZFA 2ZMLA 5F8PA 5JR7B 2FBEA 3N36A 1OD5A 1W9WA 2UWCA 5T55A 2VECA 4AFBA 1SFYA 5C4WB 1MS5A 2PFWA 2YDEA 1QH7A 1VBA2 4GALA 3VV1A 3ZX7A 5JXIA 1DFQA 3IBMA 4CCMA 4MXWA 2AUYA 5A3UA 4LTAA 3B7MA 4RL7A 1BLZA 1XB9A 1JTZX 3HQRA 4EZHA 1JZ3A 1OF3A 1QJU1 1WKYA 1YQ2A 2X29A 3ZXLA 5IVEA 4LT5A 5IVBA 1S0JA 1XSQA 5M0TA 1PNGA 3CZJA 4MADA 1OVPA 3GJBA 2R1DA 4P02B 5FPUA 3MV01 5F5CA 4YGBA 2VC9A 3O1VA 2RM21 1W06A 4EN6B 3CF6E 1R091 1H2NA 1E5SA 2YXSA 3BIWE 5FZMA 3RSJA 1IQAA 5BNPB 4GIQA 3ZXJA 3AP9A 4JCKA 4PLNA 2CWMA 3K51A 5LY1A 2C4XA 2HWB2 2JB4A 1DGWA 1PMJX 4DINB 3IWZA 1ZZ7A 3VZMA 2P2KA 2BYVE 3AMQA 1US3A 2RR12 4ET7A 4QX3A 1W2UA 3MYXA 4LIUA 4QXBA 5FP7A 4B1MA 4QDQA 5LCWL 5FP3A 1ND3C 5CFCA 1PIV2 3MLKA 4NOTA 2W87A 3M1HA 3OY8A 2PAEA 4RR3C 3S7EA 5C7GA 2YYOA 4CP1A 5IVCA 2WABA 5JPMB 1GLHA 3RJ2X 4C1WA 4E2SA 4FPEA 1V6JA 2N7GA 1HRI1 5HI0A 4ASKA 1WMEA 3WQBA 1BK1A 4JQTA 4BU2A 2VQUA 3LEKA 1W9YA 2Z79A 3EHKA 5T50A 3F2ZA 2JG9B 3J7HA 4LHLA 3FLTA 4YVSC 3ZPYA 5KHKA 1AXYA 5FZAA 1LU1A 3VBUA 1O8PA 2W52A 4BIOA 2SLIA 1REDA 4K20A 2BGPA 1VBE2 1NCRB 1GNYA 1XNTA 4WM8B 4GB31 1FNYA 4XE9A 5EYYA 1CX4A 4NO4A 5FWJA 3AX4A 3WP6A 2MEV2 1J1LA 5DZGA 1NQJA 1AX0A 1V6IA 2WNOA 3H7YA 2HWD2 2LTNA 1IGOA 1ZZBA 5EJ3A 2VMHA 2CNAA 3DPRB 4DS0A 2WNUB 3JD73 2RDQA 4QB2A 2HWC1 5FK8A 2VTXJ 2XL9A 2VMFA 4LO7A 2EIBA 5KHJA 3WNOA 2XUMA 1DLCA 3OPWA 1UW8A 2IFWA 3JBG3 3LB9A 4N9IA 5FIXA 4BMEA 2VVEA 1ASJ2 2FDHA 1O4TA 2D40A 4UW4A 1W2AX 2XB6C 1HLCA 3ZSLA 1AYN3 1UOJA 4HETA 5CKNA 2JENA 3O1UA 1DG6A 1OPMA 3IPVB 3LDBA 4YGEA 1T6BX 4H2AA 3WNPA 1HXS2 3WW2A 3W20A 4CXYA 2WFPA 3V0AB 1HV0A 2ES3A 1NQDA 1H8TA 4AVTA 4WM7B 1LKNA 2ZEYA 3ABZA 5K0UB 2BPA2 1L3JA 2EA7A 1L7LA 5JI7A 4F8AA 2K2SA 3N7JA 2HWF3 3JQWA 4Y1XA 2VUCA 3B69A 4LE3A 5CISA 1H1MA 5A3NA 1C8M3 5FXZA 1OPOA 1CAVB 4RS5C 3WP4A 4FFGA 1W9TA 4QGLA 2EAAA 2HEYF 1JUHA 3WF3A 5DAQA 3S6PA 4XCBA 5FR3A 2WSVA 4EN9B 1V9U1 3VBRA 5ABJC 1DHKB 5B2GB 3EMRA 1R1A3 1PZ7A 3IDBB 3OBTA 4FPGA 4UFJA 5FUNA 1LECA 2VGDA 1O6UA 2WKKA 2BBVA 4EWDA 2VTXA 1VAKA 1WCDJ 4A7YA 3A0KA 2YPJA 2D5FA 3LA2A 5JI9A 5D21A 5FLIA 1RUOA 4GJYA 4IV3A 1ONAA 3QBQA 4DY3A 1UPIA 2Y33A 1UXZA 4CU8A 1QDCA 2DVBA 4L2NA 3K3OA 3AXDA 4DRRA 2P3IA 4Z07A 5A3TA 5J48A 2Q0AA 2WYFA 4JRAA 3TNPB 5FYUA 4IEQA 1OF4A 1JW6A 3OEBA 4ITCA 2BVVA 1CAWB 1UYZA 4UFMA 1ZRFA 1NG0A 4LMFA 5FWEA 4GQ7A 4Z2WA 3U78A 2ZEXA 2L9LA 4LO6B 3W21A 4CEYB 3OGJA 2X05A 4H55A 5C4WA 3WG1A 3WDVA 4ZKTB 3BKZA 4MG2A 1RUG1 2XBO1 2PHRA 3D8CA 2BQPA 1WLTA 3BPZA 5FUPA 2VULA 2A70A 4IETA 4SLIA 1VRH3 2DVDA 2EF6A 3OYWB 1ZA7A 1CIYA 2ZZJA 2GU9A 4R4XA 1P8JA 5APAA 2W47A 4YW5A 3A7QA 2XXZA 1HV1A 1TME2 4A7KA 1VMFA 2RMU3 3U75A 4V1PA 4FCAA 1LESA 1KRIA 2VW2A 4I2OA 1RITA 2WC2A 2WS92 2DUOA 4OZOA 4XJ9A 2VCCA 4K40A 5DMYA 5CKQA 4UI9L 4P9YA 2G9ZA 4BZ4A 4FOVA 4PQQA 1LEDA 5FZCA 3GZEA 1GYKA 1S2EA 4TLGA 2GC3A 4TN7A 4LA2A 3AL5A 3M3OA 2BRTA 1SPPA 2XHKA 3PUIA 4FPJA 4RN5A 4UT5A 4AFCA 4XF4A 2W9XA 1UKGA 5FXXA 2PELA 4YNIA 2IC1A 3ZSEA 1J3RA 2WLQA 2D44A 2WA3A 4HVOA 2GN3A 1VRBA 1DGRN 1HRV2 4IXLA 4URAA 1VBC2 1CPMA 2GP3A 3N3HA 4XHBA 1PVXA 3IDCB 2WNVB 4XAEA 1IG0A 2BNNA 2JG9A 1D4M2 4QMAA 4YZ4A 2VOWA 4Q0VA 2TEPA 1NT0A 1SDWA 1V70A 3MF9A 4BWOA 4QX5A 4NIGA 2HWB3 1WD4A 3LEIA 1FOD2 3IAQA 4QXCA 1Q8OA 3WG4A 3ZFEC 4AGGA 5F3CA 4OHYA 4E8CA 4COWA 3H1MA 1RUNA 4TYSA 1KQRA 3D6EA 2RR13 3T2TA 1BK0A 1POV0 1N3QA 1RXGA 3OEAA 1QU0A 3AKPA 1RUD1 2XQXA 3KV9A 3POJA 3JBG1 1PIV3 3FC0A 1MS4A 4XF1A 3LDRA 4Q4V2 2XG3A 2RS31 4NWVA 1Q43A 2CGNA 2FMYA 2VOTA 2A6XA 2JEMA 3VKNA 1JYNA 4AW7A 1LB2A 1AYN1 2A1XA 3DPRA 2QQVA 1RTVA 5BUVA 4CCEA 4QXKA 3MI8A 3PVEA 4OI4A 3BVCA 5F32A 2ZGTA 4XJZA 2E32A 1DP0A 3QOPA 5GZFA 5IK4A 1V6KA 1W2TA 5CG9A 3ENRA 3AYDA 1JN2P 2PHXA 3KV5A 5I0DA 2JECA 1QMJA 1W8OA 3IPVA 1S1AA 1C8M1 2G9GA 3NVCA 1VMJA 2BUKA 4RQPC 2BP6A 1POQA 2AZ5A 2ZX4A 3OBAA 5LBCA 4AHXA 4CU6A 3V0AA 1UMZA 2MEV3 4K21A 1AJOA 2R072 5K0UA 2ZGLA 4IGQA 2HWD3 4CDWC 5LWBA 2G4IA 4AEKA 1WD3A 4AFDA 1BMV1 2YU1A 1N1YA 2EXIA 1W90A 1O59A 3IMNA 2C24A 4AK3A 4XILA 3A23A 1M4WA 2ZA9A 4LKFA 1X8MA 3DEMA 4NRPA 4OUMA 5L19A 4P9XA 1BYHA 2ID4A 4XEZA 4A3XA 4CVUA 1VMHA 3NV2A 4KMQA 4BQ1A 1K45A 3VLBB 2BOJA 2JDPA 1CAXB 1ASJ3 4OUEA 5D2AA 5L36A 2OUHA 1RHI1 2V5DA 3JB8A 2JICA 2WO2A 1YJLA 4XHXA 1HIXA 1LHNA 1UF2C 3BYWA 4Q2FA 2EIGA 1HXS3 5DG1A 2O8OA 2ZGRA 1PGW2 2AR6A 4N7IA 4QX0A 4WZFA 4YVWC 4ZXKA 2FZ2A 4RR3B 2HBTA 2WZEA 1GKBA 2WLPA 3OGSA 4GKYA 3UT0A 4CU9A 3T1MA 2JD9A 2XOMA 5IT6A 5J1XA 2WQ8A 3JXSA 5LASA 3PNAA 1VR3A 2BDRA 3C7FA 4O9GA 4EN8B 4IE4A 3CNAA 1CAWA 4B1LA 1UU6A 3R4DB 2YPDA 3U37A 1VRH1 3A4UA 1APNA 4RHV1 1GZTA 5GLUA 2AH2A 2ZXQA 3MW4A 3PIGA 2FCUA 2ZACA 4YVSB 2I07B 1FAYA 4XZUG 5T5OA 3SITA 4AQ6A 3I8TA 2QCSB 3UGHA 3ON7A 1A8DA 2EIDA 4W6XA 2DF7A 4MV2A 1C4RA 5H9QA 3ZN4A 1ENSA 2RMU1 3WSOA 5KXBA 5FOJB 1XC6A 1GBGA 4O65A 3ST7A 1QF3A 1NLRA 1YQ5A 2YC4A 3VBRC 4NHMA 1RVF2 1KDKA 2QQNA 2VQTA 2WN2A 3AZYA 5I8TA 1OA2A 3CZUA 4MH0E 1U5YA 1KGYA 2P3KA 1U5ZA 3HT1A 5T54A 1PVC1 1W28A 3PLQA 3U0ZA 5L9RA 2WZR2 3VDDA 4XF0A 2VE1A 3RYPA 3T2OA 3PUHA 1UY3A 1UY2A 2RDNA 2DCJA 2TNFA 2PQQA 4QHBA 3C7EA 4OHXA 2X09A 1AUYA 4BDVB 4DUWA 4FXKB 4CUGA 4XDQA 4J6GA 4GXLA 3VBOA 1DDLA 1W8FA 4E4HA 3RZHA 2JE9A 1DGLA 1PK6A 2MPFA 2RS51 3WINE 4IEZA 5DAWA 2P4EA 3J7NA 5HV0A 1GOFA 1QXPA 4CXWA 1MZFA 1QEXA 3SH5A 4PHZA 1PO22 2A5ZA 1AVBA 3FUOA 3M3CA 4RS5B 1UOFA 2V72A 2OKXA 5FBZA 5LBBA 3VL9A 3T0DA 4GKXA 1LTEA 4COZA 3LIHA 4RD7A 3GZAA 4KNCA 4Q4Y3 5ABJB 1GSLA 4PF1A 2B8MA 2WNVA 4Q0PA 5K8SA 1AXKA 2MNGA 1UN1A 3LKJA 4AF9A 3DL3A 4ORFA 3AKSA 3AP7A 1W8UA 1W99A 1AR91 2QQPA 4IV1C 1SBFA 1W05A 5KXDA 5FPXA 3ATGA 5E16A 1AYM2 1JXNA 4HBNA 3NNGA 4PF5A 1W3VA 5E6HA 1AXZA 5HXVA 2G1MA 1R082 4AEJA 2JDZA 3BTYA 3UJOA 4AG4A 5JWPA 4GJZA 1PM4A 2XJSA 4OI0A 1TZOA 2WDBA 4HVRA 2VCAA 2B45X 4TXWA 1RUC2 4P9IA 4F3JA 2PHWA 3AZZA 1WA6X 4OI1A 4XUTA 4Y22B 5A6XA 1H1IA 1WMFA 3WHTA 4CU7A 2YHJA 4LR4A 3BUCA 3H8RA 1HRV3 1ALYA 1ZX5A 3PJQA 1VBC3 2AENA 1UPSA 4XQDA 4CTEA 3E6DA 5KC6A 4ATEA 1S2KA 2B9VA 4QPIC 3AMMA 1PGL2 3E6BA 2MEV1 3EYPA 3HN1A 4W65A 5EQUA 3SHRA 5FLHA 3HNBM 4NUBA 4JDMA 1H6YA 3H8OA 1ACCA 2EIEA 1AR61 4IESA 1K42A 2ZGQA 2VQ0A 5AFEA 1KS5A 4XTMA 3USUB 2W92A 4E4SA 4LBQB 4NN0A 5AC91 1AZDA 2YZ4A 3DXUA 1W6PB 2RG4A 4YFZA 4AI9A 4JDOA 3SCFA 2D6NA 1H4GA 4N53A 2VXRA 4G3YC 4Q4V3 4BJ0A 1ASJ1 2DWRA 1WLDA 2VMCA 5A32B 4Q0QA 4FP3A 1OHFA 4X6QB 1UAIA 2BBAA 4J1XA 1CESA 5JR2A 3RZJA 4H14A 1WW4A 4L9BA 5K9YA 4EZ4A 4G9SB 1ODNA 5A3WA 3K46A 2W46A 2YGLA 3GBFA 5JIAA 5T5LA 1CAXA 3ZN6B 4CCDA 4HN1A 3LFIA 2ZGMA 3KHBA 4Y20B 1OLMA 2ADDA 2ZHNA 2DCZA 4LO4B 4YG3A 5I0SA 1PZ8A 2R6QA 4YW2A 3T2QA 1Z0HA 1ND3A 2VH9A 1XQNA 3D82A 4IL7A 1WW7A 4M3CA 4PQ9A 1W0NA 4NHXA 4RR3A 4XF9A 2YBPA 1GWLA 3N7KA 4BH9A 2XJUA 3ZYGA 5D8AA 4L11A 4WZCA 4HVQA 5GJ6A 2ETEA 5J98B 3NJXA 4GWJA 1RJ7A 1QQP2 3KMHA 4ZU5A 3LSEA 5I8YA 4K1ZA 3OGGA 2ZOEB 2WYSA 2GP5A 1RIRA 5EWSA 2CGOA 4G4FA 3K4ZA 5IWFA 2YFZA 1QJY2 2WQZC 2AYHA 1WA4A 2VZOA 4XQ4A 4YVSA 2C0ZA 3NW4A 1ODMA 1BQPA 1Z7S1 5BY5A 1VBB1 1QDOA 3FHQA 3P3PA 2NZ9A 5DABA 2HEVF 1Y4WA 4GWMA 3PMSA 4LBKA 1POV3 3SLIA 5IFPA 2JDUA 5IVFA 2Y6LA 2ATFA 2FHRA 3I2KA 2WL1A 3KQRA 3VBFC 1C1LA 2JB8A 3WNKA 2VNGA 2ZGPA 4P9LA 2W0XA 1GOHA 1S0BA 3OD4A 5JIUA 3UNPA 5A1FA 2ZAAA 1LEMA 2OIIA 4XAAA 3TN92 3BOWA 5JLVA 4P9JA 2B46X 1XBFA 1OT5A 4Y1UA 1V00A 4PLOA 1ENRA 1YCIA 4P08A 1QY4A 4LBMA 3THDA 5J36A 3ZFFC 3OTFA 2CY6A 2NMOA 4QDSA 2JX9A 1K12A 4TLFA 1YIPA 4RQPB 3AZXA 3N4MA 4LNVA 3VBHC 3N9LA 1PO11 2WBKA 2PMWB 2FZ1A 4BQYA 4MGQA 2K46A 3NMBA 4Q4Y1 4CDWB 4XVHA 3JU9A 4Z82A 1RVF3 3MUZ1 1C3HA 1X8EA 4GWIA 1DQ4A 3MW2A 4XIKA 4Q29A 2G19A 2WZR3 2D6LX 4RS5A 3M3EA 1BVVA 4NJ4A 2QQUA 4AR2A 2ENRA 3OD0A 3RYKA 4XFIA 2PAKA 3AJZA 2OA2A 3WDTA 5L7OC 2QJVA 1I6XA 4E2QA 2RV9A 2LS6A 3IMMA 5I8SA 3VDDC 3WT3A 2EALA 4AZZA 4YVWB 4AVAA 1I5PA 2ZEWA 3THTA 4HONA 1H8VA 3IB3A 3P3NA 3T09A 3E97A 2Q1FA 1JZ5A 2Y38A 1COV2 4HOOA 4QX8A 4D6QA 4DNYA 3VB9A 1A8MA 1PO23 4D0QA 5ACA2 2V4AA 1U5XA 1D2SA 1PK6C 1H2MA 1Q5OA 5A33B 1EPWA 3UESA 2HH9A 4A7ZA 1O4YA 4Y5SA 4Q4V1 1JZ8A 2VO5A 3M4FA 3WR0A 1NZCA 3THCA 4LORA 4BHPA 3OPZA 1EPZA 3MPPG 5KXEA 5JSRA 4F7ZA 3HD8B 2AC1A 5DDJ2 5FTTC 1OH4A 3USUA 1AYM3 4GZ9A 4BISA 3VBRB 2KXLA 3Q8BA 1G7YA 5JSOA 1H1AA 1R083 4Q1RA 1KDMA 3DKQA 4QPGC 5EHDA 3ZSMA 3ZXKA 2W39A 5F3GA 2E33A 5L73A 3CQOA 2BOIA 2Y6JA 3C7GA 3AYAA 4M00A 4ES8A 1RUC3 1FT9A 4CP0A 1YIFA 5A32A 2VOKA 5I93A 2YC0A 3KS7A 4XETA 2JE8A 3PURA 4FPLA 3P5BA 3RDIA 5A7OA 3ZXEA 3O1PA 2PYTA 3SH3A 4NAMA 3WCRA 1R64A 1XU1A 1LOEA 2KA3A 4COUA 4DXRA 1Y9GA 4CUCA 2V73A 1TNRA 2ZGUA 3A0NA 2OPWA 4L97A 1MEC2 2Y34A 4NWWA 2CWSA 5FYIA 3SH4A 1PHMA 4Y5Z0 3ZN6A 1N47A 4BK4A 4Y20A 5JVVA 3HOBA 1IS6A 4NE9A 5FXWA 1W8NA 1RUE1 2XVGA 1H2KA 1IZ3A 3QCWA 1C28A 1AHSA 5DUVA 2XONA 3PVBB 5SV8A 4R9DA 1OQ1A 1PX3A 1DQ1A 4HKWA 2FMDA 4JQRA 5FZ1A 3ZXFA 1SLBA 5F39A 1SLTA 1H6XA 2ORZA 3WQ0A 2ZGSA 4A2UA 3RG0A 2W1WA 3K4AA 4H3WA 2Q8EA 4Q27A 5B4XA 1QJX1 5FMOL 2UYBA 4DFSA 2A6YA 1SACA 1QJZA 2W68A 5ANNA 1MACA 1UX7A 5FPAA 3USSA 3WQ7A 1POV1 5FZ7A 2A6VA 4N53C 5FYYA 1ZRDA 1EUUA 4K1YA 4MGSA 3POGA 2QFEA 4QD2A 4R8HA 1ZZ9A 4I0AA 4TWTA 3ZFEA 3RQ0A 2DTYA 5FMCA 4DXZA 4S2FA 4IV1B 4JHTA 4PT6A 1EV12 1RGSA 3KM5A 4H7LA 1AL22 3CJIA 3JB4C 4KBBA 1W2NA 3GM8A 4GAZA 5JDBA 5JCTA 1OSGA 2RS11 2R062 5LRRA 2PLV2 2W1UA 3HR9A 3ZIXA 2P6HA 4K6BA 3BIEA 2IXHA 2AREA 2QQKA 1A6CA 4LO5B 1SPPB 4XUOA 2IXJA 4Z92B 3HIFA 4COYA 1RMU2 3MPBA 2YG0A 2WRAA 3A21A 1QQP3 4QPIB 3BODA 3MDPA 1GOGA 1HQLA 3NV3A 4QB1A 4YG0A 1BVP1 1UIJA 2OVUA 3ZR5A 4YW7A 4LBLA 5CADA 3N9OA 3OF1A 1QJY3 3I2GA 4IEXA 3ZXGA 4W4ZA 5D8AC 1QOOA 1OQDA 5GLZA 2D3RA 2WZR1 4KBZA 2VG9A 4RQPA 3LD8A 1WCUA 4KG0A 4Q8LA 3WDWA 1XSRA 1BEV1 2VUDA 4LOTA 3F95A 4LIVA 1C1FA 1X9TA 5HV4A 2VM9A 4PBOA 4CDWA 5TSWA 2XKOA 1YFXA 5J09A 1AJKA 5F6KA 2Z42A 2ZGNA 3T2PA 1PMHX 4LHNA 1LGNA 3E5XA 4ZXEA 1OXCA 2VZSA 3ACFA 1J84A 1ZBE2 1ULDA 3TN93 4YPJA 1ULEA 1ZBA2 4QHOA 3M2MA 2PHDA 2FDJA 1IS5A 2CL2A 2R041 2UURA 3EB7A 3MFCA 3B9IA 3HBZA 1YC61 1RL3A 3GDBA 4CP9A 5FK7A 1C5HA 1QH6A 2JWPA 2WFF2 3CEWA 4GD4A 4XJ8A 1X50A 3RJRA 1YO8A 3RYRA 5ISLA 4DXTA 4YVWA 5F2SA 1OLQA 1DYKA 2J7MA 5FZ9A 1O3TA 1FPN2 4BIFA 5LK5A 1C57A 5JUVA 4AI2A 4GWNA 2VW0A 4ES9A 4Q4X2 1E57A 1QWRA 2BEOA 2XVLA 4SBVA 5E89A 3NQHA 5FZKA 3ZDSA 2WA4A 3GHNA 5F5IA 3VZKA 3PHMA 2ILMA 3BPSA 3LOIA 4U2AA 3LGRA 4I02A 1AYM1 1SBDA 2D98A 5FZIA 5A33A 2ZX0A 4ZU7A 4E2GA 4M0NA 2F4LA 3HN3A 1LAJA 2E31A 2ZHKA 2JDKA 2W2IA 3AZWA 5CFDC 3H8UA 1TMF2 4HN0A 1JUIA 1RUC1 3B02A 5ANQA 4YGDA 1L7RA 1S0FA 3B01A 2ZMNA 2WIIB 1QJEA 3TB0A 3K75B 5FYBA 4QKBA 2ET7A 5IAVA 5L9VA 1Y9QA 1RINA 3T08A 3D0JA 4MGIE 1GP5A 1UY4A 1FNZA 1REEA 2XLAA 5DPNA 3VBFB 4A6SA 5JZGA 1PGL1 1COV3 3O12A 5EIYB 1GANA 1FI2A 3E5QA 4XJAA 3ZYJB 2BGCA 5LA9A 3P1IA 3KVAA 4BCUA 1QIQA 3CMGA 1XNAA 2ZJCA 5ACA3 4B4QA 1QJFA 1ULGA 1CQ9A 3AFKA 4MHRA 3C2UA 4N43C 4CEWC 5L9BA 1SDDB 1VP6A 4FQZA 3C7OA 3ACLA 3ZFFB 1XXNA 4AEMA 4AE2A 3DF0A 3VBHB 1W9FA 4FFFA 3T1LA 4XOGA 4R9BA 4M01A 5FREA 3HNYM 1GP4A 4BYYA 4UOJA 3DKWA 5FY5A 5CB7A 4W8JA 4L92A 1R1ZA 1HJGA 4QQPA 3AMNA 4CDXA 1JI6A 3ORJA 1AF9A 4CRQA 1XPWA 3PTRB 2FDIA 1GMMA 1IPSA 2X5IA 1LODA 4KWJA 2HKXA 2KD7A 4XUPA 5L7OB 4XDPA 3O14A 5FYSA 4JX0A 1ZREA 3RZLA 1XU2A 3RPQA 3WP5A 1RUI2 2WWUA 2YBKA 4JV4A 4HKLA 3VDDB 5FZDA 4UBHA 1MEC3 4AYUA 4IE7A 3NJYA 4IV1A 4URTA 4PDWC 1QQP1 3L2HA 5CG8A 4NPRA 3HT2A 4NHYA 2NM1A 1Q3EA 1GWKA 5FY8A 1I9RA 3VUOA 4E4DX 3CBNA 3KGZA 3TEZA 3D3AA 3R4SA 4ARYA 2V09A 3VBOB 3I2DA 2PTMA 5FV3A 1WCSA 1VBA3 2QNKA 2IZWA 1PK6B 4YM2A 4DB5A 4Y4RA 2WO3A 2HLEA 2RDSA 2XLGA 2WT2A 3AP6A 4RSUA 2ZMKA 5B4NA 3H0OA 4QPIA 5F3EA 4BK5A 4MGTA 5DUXA 4FI9A 2VAUA 1F4AA 1SLIA 4FPKA 4NROA 2F4PA 3DXTA 4KWKA 4Y1YA 1OBNA 2JD4A 2AGSA 1V6LA 3GGLA 2WQ4A 5GM0A 2JIJA 1XE7A 1OI6A 2ZHLA 3FN9A 4FPHA 4CSWA 5DZFA 1W8HA 1EV13 4YZ1A 1AL23 5FY0A 3S5QA 1QNYA 4PBPA 2BERA 1D4VB 4NAOA 2K9ZA 4QPGB 4CPBA 1WZXA 1V6OA 2JIGA 4CDUC 4EYUA 4JDNA 2PLV3 5IUQA 3X29B 1HQNA 4EE2A 3ALQA 3JD71 5FO7B 4FTSA 1HX6A 3WDUA 1KJRA 2WINB 3CJIC 3HEIA 3FLPA 3OSDA 4XFCA 1W0OA 4CZSA 1RMU3 2GAUA 1J3QA 2UWBA 3QACA 2GMEA 1QXJA 1C5IA 1IG3A 2RHPA 3U4XA 4YARA 1HDKA 5CAZA 1RUH2 4MUVA 1ZM1A 3VHRA 2BU9A 1YXWA 3ZYBA 3NKTA 3VBSC 2P3YA 5BNNC 4WVWA 3K2OA 3NNMA 3VN4A 1RUJ2 4OYUA 2CHHA 3TOJA 3RFRA 4F83A 3N7MA 4HANA 2OYZA 5C6CA 2D3SA 3IN9A 1AR72 3S30A 2H0BA 1GZCA 3KWVA 3R4UA 1UD1A 2DUPA 2E53A 5FY4A 3WNLA 1QOSA 1W6MB 1DLLA 3FFZA 2QKDA 3C7HA 2HWF1 1GZWB 1ZRIA 5JOYA 4Y4YA 2BV4A 2RJKA 2KR2A 2VTFA 1VBE3 2D6OX 2R1BA 3WLUA 5CZKA 1ZBE3 4BQXA 1EY2A 4N53B 2CSGA 2VW1A 1ZBA3 4XFAA 4AHZA 2XJRA 5FZHA 3ZFGA 4YZ5A 1HJFA 5A7WB 4BQWA 1DQ5A 1R1A1 3ASIA 1F9KA 4XJWA 5FP9A 5FYHA 3WG3A 4AQSA 5FY9A 4QX2A 2WFF3 1XJAA 1AR82 5ACA1 2HYXA 2XJVA 4Y33A 1YQ8A 2Z69A 4R4ZA 1FPN3 1OUSA 3VBFA 1UYYA 3RI8A 4NR1A 2GC2A 3VDCA 1GU3A 4N9HA 3UGFA 1NKGA 4AGVA 1OC1A 1SG3A 4P5HA 3TNQA 3I4IA 1ND3B 1SZBA 4M3CB 4HXCA 4GH4C 1OA4A
chains in the Genus database with same CATH topology
4IW3A 4NHMA 4MHUA 4Y5SA 4NHYA 3W20A 5L9RA 5DAPA 4XC9A 4NHXA 5LBEA 5C5UA 4NHKA 2RDRA 2RDNA 3OBZA 2RDSA 4ZONA 3DKQA 3NNFA 5DAQA 2A1XA 2JIJA 4XCBA 4Y5TA 5A3UA 3EMRA 5DAWA 3BVCA 3HQRA 5HV0A 4NAOA 5LATA 3PL0A 2JIGA 2OPWA 5EPAA 4NHLA 5M0TA 2Y34A 2HBUA 5LBBA 3GJBA 2Y33A 4JZRA 5LBFA 4Q5OA 3OUIA 4XAAA 5LBCA 3KT7A 5DAVA 4ZPIA 5IAVA 5L9VA 2G1MA 3NNMA 3MGUA 3W21A 5LA9A 5EP9A 4XABA 4BQYA 4MHRA 5IAXA 5L9BA 5IATA 5EQUA 4UWDA 3NNJA 2G19A 4BQXA 2HBTA 4XCAA 4NMIA 2FCTA 4BQWA 3KT4A 3GJAA 5C5TA 3ITQA 4XACA 2RG4A 5LASA 5ERLA 3GZEA 2FCVA 3OUHA 5LB6A 4J25A 2FCUA 2RDQA 3NNLA 3OUJA 3HQUA 4KBZA 3KT1A 2V4AA 5DAXA 5HV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IW3 A;  4NHM A;  4MHU A;  4Y5S A;  4NHY A;  3W20 A;  5L9R A;  5DAP A;  4XC9 A;  4NHX A;  5LBE A;  5C5U A;  4NHK A;  2RDR A;  2RDN A;  3OBZ A;  2RDS A;  4ZON A;  3DKQ A;  3NNF A;  5DAQ A;  2A1X A;  2JIJ A;  4XCB A;  4Y5T A;  5A3U A;  3EMR A;  5DAW A;  3BVC A;  3HQR A;  5HV0 A;  4NAO A;  5LAT A;  3PL0 A;  2JIG A;  2OPW A;  5EPA A;  4NHL A;  5M0T A;  2Y34 A;  2HBU A;  5LBB A;  3GJB A;  2Y33 A;  4JZR A;  5LBF A;  4Q5O A;  3OUI A;  4XAA A;  5LBC A;  3KT7 A;  5DAV A;  4ZPI A;  5IAV A;  5L9V A;  2G1M A;  3NNM A;  3MGU A;  3W21 A;  5LA9 A;  5EP9 A;  4XAB A;  4BQY A;  4MHR A;  5IAX A;  5L9B A;  5IAT A;  5EQU A;  4UWD A;  3NNJ A;  2G19 A;  4BQX A;  2HBT A;  4XCA A;  4NMI A;  2FCT A;  4BQW A;  3KT4 A;  3GJA A;  5C5T A;  3ITQ A;  4XAC A;  2RG4 A;  5LAS A;  5ERL A;  3GZE A;  2FCV A;  3OUH A;  5LB6 A;  4J25 A;  2FCU A;  2RDQ A;  3NNL A;  3OUJ A;  3HQU A;  4KBZ A;  3KT1 A;  2V4A A;  5DAX A;  5HV4 A; 
#chains in the Genus database with same CATH topology
 5H9R A;  2A3X A;  3BGA A;  3C3V A;  3SXW A;  2R30 A;  3H1Y A;  1U12 A;  1HQW A;  4WBB A;  5D8A B;  3MUY 1;  1GZ9 A;  4ZS3 A;  3WZ1 A;  3E6C C;  2IXL A;  2QE3 A;  3T4V A;  3ZFF A;  1TMF 3;  1UZ0 A;  2QBX A;  2W94 A;  4OMD A;  5DAP A;  5FDB A;  1JYC A;  2P6C A;  1DQ6 A;  2DFB A;  3VBH A;  4UFK A;  3N9N A;  2RDR A;  2ERF A;  2QQW A;  3BN6 A;  4IE5 A;  3B9C A;  1WWY A;  3SEP A;  5FPZ A;  3AKQ A;  1NCQ C;  4QPW A;  4CCO A;  1QJU 2;  3FWE A;  2IWG B;  1CWP A;  3LE0 A;  3LA3 A;  3RZK A;  4DY5 A;  1MEC 1;  4K7J A;  4OMC A;  5A1A A;  3NNF A;  5C3O A;  4XFB A;  2WAO A;  4FT8 A;  4KGQ A;  5JXJ A;  4MXV A;  1JZ6 A;  1YUD A;  4YM0 A;  1WLW A;  5JZG C;  1IS4 A;  1MS8 A;  2RM2 2;  5L7O A;  1Y7B A;  1V0A A;  3J7M A;  3VD7 A;  5J37 A;  4JKM A;  1EP0 A;  4BXF A;  1JU3 A;  3I3D A;  4OVE A;  1GWM A;  5E1R A;  1NAE A;  5LAT A;  2LRP A;  3ZXD A;  3IM0 A;  1VBA 1;  2QZ2 A;  4AVC A;  4UF0 B;  2P5B A;  4V2V A;  3QD6 A;  5LW9 A;  2HBU A;  5FYV A;  4MGK E;  1UXX X;  2LW8 A;  2ZHM A;  1OH3 A;  5BPX A;  1HB4 A;  2VMG A;  2ZX3 A;  2DCY A;  2BFU L;  3CDZ B;  3LSD A;  5IW0 A;  5T52 A;  4LKD A;  4Q5O A;  1MR5 A;  3BI3 A;  1JMU B;  3ES1 A;  4YM1 A;  1CZS A;  4QKN A;  1AL0 G;  3GAL A;  1RXF A;  5HPO A;  3TBD A;  2NMN A;  5FZF A;  3SIS A;  4TTG A;  2WWJ A;  1F4H A;  3FMG A;  3T3Y A;  3VD4 A;  4XYX A;  3I7D A;  1EV1 1;  3AK0 A;  1YI7 A;  1AL2 1;  3LZZ A;  2XKP A;  1F15 A;  3HVD A;  2ZKN A;  2OXB A;  3MGU A;  4JHZ A;  4LPL A;  1XYN A;  1W9S A;  3ILR A;  3H50 A;  2BJS A;  4CDX C;  5CFD B;  2HWB 1;  3Q8A A;  4YSF A;  4V2W A;  1CAU B;  3NL1 A;  5FZO B;  5EP9 A;  1RUI 3;  2JDY A;  1TME 3;  5JSP A;  1UWW A;  2X5I C;  2BW8 A;  5LEJ A;  3I3M A;  2RR1 1;  3ECQ A;  3I3B A;  3L2Y A;  1F5F A;  4Q0U A;  4XQW A;  2WS9 3;  1H4H A;  4AFM A;  5GZG A;  3DYM A;  4XJU A;  5A6Z A;  4D7T A;  1PIV 1;  1REF A;  5GZE A;  4GB3 2;  4XDO A;  5HCF A;  3NWK A;  4JGZ C;  4M4P A;  3NNJ A;  4QPG A;  4D94 A;  1LOF A;  5FMB A;  2TBV A;  4NMI A;  4QPY A;  1H30 A;  3E5U A;  4BPZ A;  1G6N A;  1WW6 A;  2ORX A;  4D7Y A;  5E88 A;  3VKM A;  1JYV A;  3GJA A;  3U10 A;  4QB6 A;  2HWC 2;  4N43 B;  1OUX A;  4CEW B;  5KBF A;  2V5Y A;  1KD7 A;  3T30 A;  3GZT B;  5FZ3 A;  1OFN A;  2D7F A;  2OUJ A;  4CYD A;  5LRS A;  2VU9 A;  2WT1 A;  1ZYB A;  1LRH A;  3M8L A;  4MOA A;  4HSJ A;  4ZZ8 A;  4DOU A;  1OUR A;  1AX2 A;  2UU8 A;  4DZG A;  5J96 B;  1E5R A;  2B42 B;  1VBE 1;  1BBT 2;  1WBL A;  3J7L A;  3LPG A;  2R16 A;  4X6R B;  5EV7 A;  2YMZ A;  4JC1 A;  3FBY A;  5FP8 A;  2ZGO A;  1JZ7 A;  4MZU A;  1JS9 A;  1ZBA 1;  2A6Z A;  4A6O A;  1D4M 3;  4FFH A;  4IEP A;  2HWD 1;  1VB4 A;  5FXV A;  5BXX A;  1F35 A;  2VNR A;  3KV4 A;  1FOD 3;  1W6M A;  3KVB A;  2VME A;  4FOW A;  1O91 A;  4LBJ A;  1GZW A;  1DU3 D;  1YI9 A;  4DUV A;  1W6O A;  1MS3 A;  3PDQ A;  1FMD 2;  4IQP A;  5HBA A;  1N3P A;  1ZA4 A;  1LOA A;  4Z2A A;  3AXE A;  3III A;  4QT6 A;  4EJR A;  4PIZ A;  4XC9 A;  2Q5T A;  3SCH A;  2VOX A;  1FPN 1;  2HWE 2;  2GH8 A;  4EN7 B;  3OPT A;  4PIX A;  1F5J A;  1PGS A;  4I0W B;  3GCX A;  1OKO A;  5A7W A;  5F7U A;  1V9U 2;  1MPX A;  1W04 A;  3ACI A;  2NN8 A;  4PI2 A;  5F2W A;  3RI9 A;  2VUJ A;  2VZ3 A;  4AGR A;  3MHZ A;  3V56 A;  2CGP A;  3I2J A;  4B4P A;  1HXS 1;  1RUJ 3;  2E26 A;  2O1Q A;  4PDW B;  5C3R A;  2P1B A;  2RJ2 A;  3I59 B;  3ETP A;  1FYU A;  1NYW A;  3H3U A;  1AR7 3;  4KWU A;  4LUK A;  1YQC A;  3O0X A;  5GLW A;  2QQO A;  3HJR A;  4ISR A;  4N7U A;  5FZL A;  5JMO A;  2GZW A;  4Q8K A;  1D0G A;  4QX7 A;  4A42 A;  3U11 A;  1V6N A;  2J1V A;  2EXH A;  4IEW A;  3BAL A;  3S7I A;  1TMF 1;  1OVS A;  5G04 L;  4UYB A;  1O8S A;  3B94 A;  1VIW B;  5A7Q A;  3U4S A;  2PHT A;  3AMH A;  4HPK B;  2IXI A;  5AVA A;  1ULP A;  4N90 A;  5FKC A;  4MGZ E;  2Q8C A;  5A7S A;  1LCL A;  5BNO C;  2TUN A;  4WM8 C;  2R07 3;  5KHH A;  5F1R A;  1G86 A;  2Y64 A;  2O8Q A;  4JTN A;  4YRD A;  2J1T A;  2W3J A;  4NRQ A;  5FMO S;  4MVT A;  5JOW A;  4WVV A;  3GXU A;  1JHJ A;  2J22 A;  1AR8 3;  1RUG 2;  2ET1 A;  2XH6 A;  4IE0 A;  2XBO 2;  3ZFG C;  3CO2 A;  1X36 A;  1ZRR A;  4CDU B;  3FHI B;  3IIA A;  5FPB A;  4YW4 A;  3ZFE B;  3L9J T;  2Q30 A;  4FSJ A;  4LKS A;  2VMI A;  4B7K A;  2VZR A;  2VPV A;  3I2F A;  3AB0 A;  1LOB A;  3CJI B;  1X7N A;  4LUM A;  4XFH A;  2B7Y A;  2YGM A;  4XPV A;  3HWJ A;  5DZE A;  5E8A A;  4PLM A;  4AVS A;  4XBQ A;  1O3S A;  3THP A;  4GA9 A;  4UW6 A;  3ILN A;  4Y24 A;  5AFB A;  4GMP 3;  4P5Y A;  2BNM A;  4XZP A;  2D97 A;  4KGG A;  3PVN A;  3VBS B;  1FXZ A;  2VCB A;  3H1W A;  3KQ4 B;  4RFR B;  5BNN B;  2A3W A;  3UV9 A;  2PN5 A;  4UF0 A;  1ST8 A;  2DUR A;  3KD4 A;  5EZW A;  1LUL A;  2GC0 A;  1SBE A;  3W9A A;  3WNN A;  1XYO A;  3ZIW A;  3H7J A;  4E27 A;  1G9A A;  5FJK A;  1RUI 1;  5D1I A;  1TME 1;  1GV9 A;  2LAL A;  4BA6 A;  4QAW A;  3N9M A;  3OUH A;  1UOG A;  3M70 A;  1K5J A;  5DG2 A;  2WS9 1;  4OQ8 A;  4LBQ D;  3MIC A;  1B35 C;  1OD3 A;  4AAX A;  4FOY A;  4S2D A;  2RM2 3;  3WY6 A;  3C8X A;  1O3R A;  2QQJ A;  4QU1 A;  5CFD A;  1UYX A;  4AOC A;  3WUD A;  5FY1 A;  1CAU A;  5FZO A;  3LAG A;  4QDR A;  5JAX A;  4GUL A;  5LK7 B;  4CCK A;  4KU8 A;  5FZ4 A;  1LR5 A;  2QDR A;  3UKN A;  1JOP A;  5LA0 A;  3O7O A;  1VBD 2;  4IW3 A;  3PME A;  1E5I A;  2DUQ A;  4XMI A;  4LKE A;  1N1V A;  3KGL A;  1RUD 2;  3D5O A;  3J26 N;  3K4D A;  5JMC A;  2OZ6 A;  4CP9 B;  2LRO A;  4B4R A;  4NRM A;  2YU2 A;  2NQY A;  5H9P A;  1TE1 B;  4HK8 A;  5FO8 B;  1MZ6 A;  2RS3 2;  4QU2 A;  2YBS A;  3MFA A;  4FVV A;  3HQX A;  1HRV 1;  1SLL A;  1G9C A;  2VQA A;  5C8W A;  1VBC 1;  5FZ6 A;  3WW4 A;  4N43 A;  4CEW A;  1DYP A;  1D4M 1;  1ND2 C;  1H0B A;  5C8C C;  3MBW A;  2Y0O A;  2Y6K A;  1FOD 1;  1GP6 A;  2Y6G A;  3J8F 2;  3N9Q A;  1OOP A;  4AWD A;  4HKO A;  5FKB A;  4OUS A;  4JKK A;  5FZG A;  4AI3 A;  3POF A;  1EAH 2;  4D6R A;  1JYI A;  1C8M 2;  5GLT A;  3I54 A;  5HCA A;  1KFX L;  2GDF A;  1BZW A;  2WJS A;  4GB3 3;  4UFH A;  3U14 A;  4BQ2 A;  4AI1 A;  2DU1 A;  2WWS A;  4XBN A;  1VAV A;  4N8M A;  2CU5 A;  3EJK A;  4LUL A;  4HK9 A;  3Q8F A;  3VZL A;  3ZM8 A;  1UIK A;  1TVG A;  4JVA A;  3KV6 A;  4LBO A;  4LK7 A;  1I1E A;  4BOW A;  1BMV 2;  2C6S A;  3DV8 A;  1DCS A;  5KHG A;  1JZ2 A;  5JZG B;  1DIW A;  2HWC 3;  3LIG A;  1O7F A;  2Z5W A;  3MO4 A;  2W08 A;  4FFI A;  1J3P A;  4HMZ A;  4O9E A;  3W5M A;  2XGX A;  1LOF C;  3ZPO A;  1MS9 A;  1YQ6 A;  4A4A A;  3RWN A;  3CL1 A;  3CIH A;  2ARX A;  4C1X A;  2D6M A;  1HN0 A;  1RHI 2;  3MIG A;  1YJK A;  5I0U A;  3RZG A;  1GUI A;  1BBT 3;  1PNF A;  4PDW A;  4JRL A;  4QGM A;  2I74 A;  3I59 A;  3WUC A;  4HSL A;  1NXM A;  2R07 1;  1C8N A;  5FPL A;  4E9K A;  2UYA A;  1RB8 G;  4AHW A;  1NA1 C;  1U5I A;  3MZH A;  3WF2 A;  3RZM A;  3FJS A;  4UFL A;  1W03 A;  1HB1 A;  2GNB A;  1FMD 3;  2R32 A;  3JQX A;  2W95 A;  2GNT A;  3NST A;  3B93 A;  1AR8 1;  3POW A;  4WVZ A;  4HPK A;  5CVR A;  3M3I A;  3TRS B;  5A1L A;  3H3L A;  5EYX A;  4CDX B;  2J1U A;  2OQ7 A;  2OZJ A;  2XWJ B;  4PI0 A;  2VCM A;  4XCA A;  5A7P A;  5T5P A;  4FOQ A;  2HWE 3;  3TEX A;  2IVI B;  4FP2 A;  3B5L B;  4RHV 2;  4DUX A;  2VUA A;  2X5I B;  1MQT C;  1S0I A;  3VKO A;  1V6M A;  3OCP A;  3VD9 A;  1BXH A;  1Q56 A;  1A78 A;  2A3Y A;  1PGW 1;  3RNS A;  3NKG A;  2RMU 2;  1YWK A;  2LUW A;  3GBG A;  4JGZ B;  2NP0 A;  5LB6 A;  2ZBJ A;  2J1S A;  4CDU A;  3HPN A;  1UNB A;  5CA6 A;  5G05 L;  1US2 A;  3AM2 A;  3NNL A;  4CP2 A;  2JDM A;  3OUJ A;  2B39 A;  1NY7 2;  2R49 A;  2EIC A;  4LXL A;  3UJQ A;  1PVC 2;  4BQ4 A;  3G7D A;  2W91 A;  2FD8 A;  3CKH A;  3KCY A;  2Q4S A;  5KC5 A;  3CLP A;  4NPL A;  2EAK A;  4FTE A;  4P9W A;  5AVP A;  3VHP A;  3AL6 A;  3NV4 A;  5FQ0 B;  2VZU A;  4IGO A;  5FBJ A;  5C9A C;  2BZD A;  1H2L A;  1FAT A;  3B3Q E;  1DZT A;  3VBS A;  5BNN A;  1LGC A;  1W8T A;  4EQV A;  2VD7 A;  1IHM A;  2DVG A;  2BGO A;  4R9C A;  2XJT A;  1W6N B;  3WF4 A;  1M06 G;  4RGK A;  5C33 A;  1LNS A;  1RUG 3;  3Q8E A;  4AI0 A;  2XBO 3;  1RVF 1;  1LHU A;  1UKR A;  2RS5 2;  4B8E A;  2C9K A;  4ZY9 A;  3GHM A;  4LHS A;  5FYC A;  3PVO A;  3LQC A;  3LDK A;  3VDB A;  1X9P A;  3R05 A;  3V0B A;  4LHK A;  1JU4 A;  4CCC A;  1MS0 A;  1ULO A;  2IUW A;  2SBA A;  1G8W A;  5C3Q A;  3FZ3 A;  4IDZ A;  5LA1 A;  4MGY E;  1YLL A;  4OZX A;  2GSY A;  2HEW F;  4FPY A;  4CDQ A;  3VHN A;  1SFP A;  3ZDV A;  3Q9O A;  2C26 A;  3PTY A;  1Y9M A;  2ARA A;  3D4K A;  4WV8 A;  2QTW B;  1LHV A;  4XUR A;  3SQO A;  2QQI A;  4COV A;  2V4V A;  4FAH A;  4IND A;  3PL0 A;  3D0S A;  4JGY C;  5FRA A;  3GF6 A;  2XUE A;  1AR9 2;  3PUS A;  5FY7 A;  2HJI A;  1DQ2 A;  1WLC A;  1VE0 A;  3OOX A;  3GYD A;  1RJ8 A;  2JG8 A;  5FJH A;  3ZXA C;  3VZN A;  1AX1 A;  2DTW A;  3PIJ A;  4FPF A;  2VY0 A;  1XNB A;  3VDA A;  1F2N A;  4I30 A;  3WEZ A;  3OUI A;  1RC6 A;  5C70 A;  1PO2 1;  2P17 A;  3KT7 A;  4Q0S A;  2OPK A;  3ZYR A;  2F6B A;  2IXK A;  4ZPI A;  1OMI A;  2JDA A;  4XUN A;  2RVA A;  4GH4 A;  2VOV A;  4AQ2 A;  5BNO B;  3W5N A;  2QZ3 A;  5GLV A;  1PX4 A;  3GNE A;  3VHO A;  4ARX A;  1CVN A;  2GND A;  4U36 A;  2Q8D A;  5F9T A;  4QQL A;  1LGB A;  3V65 A;  3BB6 A;  4XAB A;  1PZ9 A;  1GNH A;  1AR6 2;  3GZU C;  3RWK X;  3ZFG B;  2E9Q A;  1VBD 3;  1QXR A;  1YFW A;  2MHF A;  1R08 1;  5IAX A;  4OQ9 A;  5IAT A;  4XFG A;  5AC9 2;  3POB A;  1TNF A;  2IXC A;  1RUD 3;  3SKJ E;  3UET A;  4BLI A;  1NCQ A;  4LBN A;  5FO9 B;  2VJX A;  2Q1M A;  2RS3 3;  4NVP A;  5IK8 A;  4CUA A;  4D6S A;  3VKL A;  1SMV A;  2D3P A;  3SC7 X;  2OX0 A;  1BBT 1;  3TEW A;  5C5T A;  3QLQ A;  4Y26 A;  1UQX A;  4C90 A;  5CKM A;  3NAP A;  3DN7 A;  4XIO A;  1B09 A;  1UCX A;  2J42 A;  3BTA A;  3ZSK A;  3LA7 A;  4X8N A;  4AED C;  3IKW A;  5FCC A;  1YRZ A;  1Q8V A;  3MIE A;  5GZD A;  3AVS A;  3J8F 3;  4O7X A;  5FLJ A;  1YYN A;  5IYY A;  4Z8B A;  4UBG A;  4OFG A;  2GMP A;  1FMD 1;  2VNV A;  5FFO C;  1EAH 3;  5CYY A;  4AVB A;  4E8D A;  3AJY A;  1HKD A;  3OJB A;  1JHN A;  1LEN A;  2BVB A;  3HQU A;  1W2O A;  3AMP A;  4QQO A;  4AVV A;  2EXJ A;  3ELN A;  5A70 A;  4M0H A;  3OB8 A;  2HWE 1;  3RRD A;  4WVM A;  3SCG A;  1OOP C;  1TEI A;  3EO6 A;  2A6W A;  4S2H A;  1I3H A;  2BWC A;  3PU3 A;  1FV2 A;  4TSV A;  4MHU A;  2EXK A;  5DDJ 3;  1QKQ A;  3AYC A;  5JXG A;  2VZP A;  2WSU A;  4BLJ A;  2JJ6 A;  3VZO A;  3VD5 A;  1B35 B;  1KXG A;  4M4R A;  4CPB D;  2RE9 A;  3BCW A;  1S0D A;  2X10 A;  2XVK A;  4PIY A;  1RYY A;  3HBK A;  3O0V A;  4DEQ A;  4ZU4 A;  5LBE A;  5C5U A;  4R9A A;  2ZX1 A;  3O1T A;  1J83 A;  2VR4 A;  3O1O A;  2GN7 A;  5F3I A;  2DVA A;  5A3O A;  1HB3 A;  3ZMO A;  5JXH A;  3MLL A;  4IEY A;  3APB A;  4CXX A;  4ZON A;  4C91 A;  1Z78 A;  1OKQ A;  1RHI 3;  4DIQ A;  3FUQ A;  1Z7S 2;  1JYW A;  1CGP A;  5EFU A;  3B00 A;  1VBB 2;  1IQD C;  5A6Y A;  4DEV A;  4JGZ A;  4OLL A;  2IVJ A;  1K5M A;  2WZP P;  1URX A;  2YY1 A;  5EXO A;  2WO1 A;  4Y5T A;  1JH5 A;  2OQ6 A;  4XXA A;  1G9B A;  4RYD A;  4PJY A;  2E7T A;  4XXP A;  2BFU S;  4LA3 A;  3AYE A;  1N1S A;  3WD5 A;  4CCL A;  1JZ4 A;  4IE6 A;  5K7P A;  3IDE A;  5HCH A;  5FPV A;  2WN3 A;  1ND2 B;  2XJP A;  4A3Z A;  5C8C B;  1DGW X;  3LWC A;  5FZ0 A;  2ADE A;  1XOY A;  2NYY A;  1NUK A;  3ROU A;  4KG8 A;  1QJY 1;  5FQ0 A;  2ZTN A;  3WNX A;  4RHV 3;  2ZAH A;  3T4H B;  4BB3 A;  3FBM A;  5LBF A;  3AC0 A;  4IEU A;  1T2X A;  5A6Q A;  2YV8 A;  4QM8 A;  1UOB A;  2WO7 A;  4A45 A;  1W6N A;  2PHU A;  1PO1 2;  4Q1P A;  1FX5 A;  2W1S A;  4QQ2 A;  4FXG B;  1LOC A;  3NJZ A;  4Q4Y 2;  3IAP A;  2YUE A;  4ASM B;  4DMI A;  5BNP A;  3H9A A;  2JDH A;  4FQ4 A;  3TN9 1;  1PVC 3;  3NV1 A;  4KU7 A;  2D93 A;  2O14 A;  5FZB A;  5J3U A;  1VB2 A;  2P3J A;  3GBW A;  3WF1 A;  2R06 3;  2FQP A;  1ZZ6 A;  2Y26 A;  4PCR A;  4FTB A;  3AKT A;  3H42 B;  5F6L B;  1LOG A;  4LQR A;  2CYF A;  4BQ3 A;  4YW6 A;  3URF A;  5FOB B;  1YEW A;  4IEV A;  4L0P A;  3CJX A;  4LIT A;  1J1T A;  1XE0 A;  4GMP 0;  5FUI A;  4A44 A;  2YB7 A;  4S2G A;  3K77 A;  3INA A;  3DEC A;  2Y6F A;  4OCT A;  4Y1V A;  1NE4 A;  1IKP A;  3JCI A;  1UX6 A;  5IVJ A;  2RS5 3;  1NA1 B;  2CAU A;  1A3K A;  1O5U A;  1XYP A;  4YG6 A;  3WP3 A;  1NXD 1;  1UY1 A;  2D5H A;  3AP5 A;  3H8X A;  3DCQ A;  3WCS A;  3FHA A;  4MO3 M;  2FDK A;  4ERO A;  1SFN A;  1OLM E;  5CIR A;  1VBD 1;  1OA3 A;  2BWA A;  2XHN A;  2ZEZ A;  4YGC A;  3WXP A;  5BNO A;  1NCR A;  2VBP A;  3AKR A;  4WM8 A;  1JOJ A;  2ZX2 A;  3TAY A;  5A3P A;  2QQM A;  4M3C E;  1W6O B;  1MQT B;  3FE5 A;  1W3X A;  4BXS V;  2B4K A;  3ILF A;  2OW4 A;  4BE3 A;  3POI A;  3LPF A;  1EYB A;  1QHD A;  2DBN A;  2P37 A;  2W1Q A;  3OGR A;  3AP4 A;  1AR9 3;  3R6S A;  2WNU A;  1RUF 2;  2I2S A;  2O0O A;  4Q4W 2;  3RVH A;  4CDQ C;  4RGA A;  3ZN5 A;  1CPN A;  2Z4F A;  5CFC C;  1COV 1;  1Y43 B;  2E7Q A;  3WDX A;  1W39 A;  5F37 A;  2NPI A;  1XRU A;  3J8F 1;  5SV5 A;  4I0B A;  3JZV A;  3KLS A;  2GC1 A;  2VVF A;  3UGG A;  3I49 A;  1EAH 1;  4L99 A;  3VD3 A;  2E51 A;  2Y0I A;  4UAP A;  4EWE A;  3KHC A;  2JG8 C;  3UL2 A;  3PUQ A;  3H3Z A;  2DFC A;  4YW3 A;  5FP4 A;  4Q4X 3;  5C9A B;  4C8D A;  1ZVF A;  2JKX A;  1DQ0 A;  3T0B A;  3RGB A;  1WUV A;  4WM7 A;  3ZOI A;  4Y1Z A;  2D6K A;  4R52 A;  3HAG A;  5EJZ B;  3VBU C;  5DDJ 1;  2A75 A;  3KF5 A;  4IER A;  1OQE A;  4XFF A;  1AR6 3;  3IDA A;  3ZR6 A;  1G9F A;  2ZKL A;  4CE8 A;  2D6P A;  4H7M A;  5LA2 A;  2DDU A;  3AFG A;  1RUE 2;  3IT8 A;  5AC9 3;  1CAV A;  5FMD A;  3PJY A;  3WNM A;  1NX9 A;  2UY8 A;  4FBF A;  1HW5 A;  2PQS A;  3ACH A;  1UU4 A;  2XLF A;  1T6G C;  2H6B A;  1IOA A;  4M3C F;  4LO8 A;  2PA7 A;  2VBD A;  3ACG A;  4K8R B;  1JYX A;  4C0H A;  1B35 A;  1QJX 2;  3MV1 1;  3N9P A;  5FZ8 A;  3J4U H;  4EWA A;  3WDY A;  3WX5 A;  5IVV A;  1O3Q A;  3UK9 A;  5LEK A;  2E63 A;  1MS1 A;  3UYJ A;  2WZ8 A;  4I3P A;  2JKB A;  4JGY B;  4QXH A;  2F17 A;  2FDF A;  2BTV C;  4AFA A;  1SQ4 A;  3I2H A;  4IEO A;  3DUI A;  4O61 A;  3SMH A;  1KJL A;  3ZO0 B;  5BV6 A;  3K3N A;  1JOD A;  3NAP C;  4RFT 0;  1R09 2;  1STM A;  2UY9 A;  5KXC A;  1LHW A;  1S0E A;  2JE7 A;  3EQE A;  2R0H A;  1H8T C;  2QUO A;  2RS1 2;  1MVQ A;  3MIB A;  4D8M A;  2ZZQ A;  1TQ5 A;  5IVY A;  1GIC A;  2VMD A;  2FDG A;  2KM2 A;  4KI5 M;  5I91 A;  4Y3O A;  2UWA A;  4XTP A;  1UL9 A;  1XNK A;  2J1E A;  3POS A;  5FAX A;  4CEY A;  4FAG A;  5JPN B;  3S0M A;  1YFU A;  4UWD A;  1ND2 A;  2VL4 A;  2ZCW A;  5C8C A;  2X8K A;  2YFU A;  2Z2S B;  1CJP A;  1XNC A;  4RA0 A;  4ZS2 A;  3OYW A;  3WF0 A;  1W8W A;  5DXD A;  1S2B A;  2FCT A;  4MX3 A;  3LF7 A;  1HRI 2;  1NY7 1;  4DXS A;  3ITQ A;  4XAC A;  5IFT A;  2CV6 A;  4W50 A;  5CU1 A;  2A73 B;  1EUT A;  1Z7S 3;  5K4L A;  1VAM A;  1VBB 3;  2R06 1;  2Y8K A;  4DPN A;  3VGI A;  1BEV 2;  2PLV 1;  3N7L A;  1KS4 A;  2VZQ A;  1N3O A;  1Q8P A;  4IV3 C;  1J59 A;  4YZ2 A;  4OHW A;  4EN0 A;  1UMH A;  3KSC A;  4J25 A;  3LOB A;  1W0P A;  2XL7 A;  1IKQ A;  2VXJ A;  1D2Q A;  1IS3 A;  1ENX A;  1PMI A;  5T3N A;  5KR7 A;  1RMU 1;  1QOT A;  3M3Q A;  1Q8S A;  4AI8 A;  5IHR A;  4KWL A;  2LM3 A;  3BTZ A;  3I2I A;  1IPJ A;  3SNM A;  1WGP A;  4MSV A;  5DAX A;  4AED B;  1K5M C;  2ARC A;  3M7A A;  2DVF A;  2XWB B;  2R04 2;  5GKA C;  4RGG A;  1HB2 A;  3BU7 A;  2WR9 A;  3POE A;  1QGL A;  4FO9 A;  1OFS A;  4OI2 A;  3W59 A;  4DRV A;  4Z1V A;  5C71 A;  5C4W C;  1SLA A;  2Q1Z B;  1JBC A;  1FV3 A;  2ZGK A;  2D43 A;  3EBR A;  2DBI A;  4K8F A;  5FYT A;  1PO1 3;  5A80 A;  1OOP B;  4JTO A;  4QQH A;  3RZZ A;  5I0R A;  1NA1 A;  3MEP A;  3UKT A;  1LHO A;  2QDN A;  1JYT A;  5KHI A;  2PXJ A;  1BJQ A;  3O1M A;  2HYK A;  4YLZ A;  1ZBE 1;  4UFI A;  2PHF A;  3ZKU A;  4XUQ A;  2R7E B;  4ONU A;  1UO9 A;  1VJ2 A;  1NLQ A;  3MIH A;  3ZVX A;  4B29 A;  2B9U A;  5BNQ A;  2C9A A;  5BNP C;  4BQ5 A;  2H6C A;  3KCX A;  1MQT A;  2WFF 1;  4QHZ A;  3WVJ A;  4K3U A;  4MET A;  2PAM A;  5BYN A;  5EPA A;  2PHL A;  4NHL A;  4AAP A;  4AQT A;  4HLT A;  2XDV A;  3SKV A;  3MW3 A;  2OS2 A;  5H9S A;  2QQL A;  2BNO A;  4D7S A;  5LZ6 A;  4XBL A;  1LJ7 A;  1RUH 3;  3DGT A;  3ZYF A;  1X82 A;  4Q4X 1;  1BCX A;  4P14 A;  5EJ1 B;  2AEY A;  3K48 A;  3RMY A;  5A3L A;  3S5A A;  3VZJ A;  5DQ0 A;  5IK5 A;  3ETQ A;  2C1F A;  3QH7 A;  4YZ3 A;  3WOG A;  1SEF A;  4A41 A;  1UZW A;  2GMM A;  4E4Z A;  2GH2 A;  3R0R A;  3U1X A;  1DYO A;  1O5L A;  1OLR A;  1YFY A;  3UKV A;  1DZR A;  4LE4 A;  2G9F A;  4NII A;  3FFQ A;  5T5J A;  3WHU A;  2OT7 A;  1ULC A;  5DUW A;  2JG9 C;  2H0V A;  5C9A A;  4XMA A;  3LCP A;  3POY A;  4HL0 A;  2Y60 A;  4B7E A;  4MYE A;  2VZV A;  2ZPX A;  2VZ1 A;  4YYO A;  2IFR A;  1X33 A;  4DQA A;  3TEY A;  4X8P A;  1RUF 3;  1NCR C;  4Q4W 3;  4IGP A;  4NID A;  4YFW A;  3IZO A;  2CTV A;  4CCJ A;  1DGR A;  1L7Q A;  5FYM A;  1CN1 A;  1UU5 A;  2JDN A;  3OG2 A;  1W6Q B;  1ZZC A;  2GAL A;  2WAA A;  3WW3 A;  1SCR A;  2XML A;  4BM8 A;  1GR3 A;  1S55 A;  1CIW A;  4P9G A;  4ZZ5 A;  2R0F A;  3JUU A;  2XQR A;  4YWA A;  3DPR C;  2WUH A;  2WNU C;  3U07 A;  1CX1 A;  3NO8 A;  2VVD A;  1VAL A;  3MLJ A;  3V64 A;  1GQP A;  3KT4 A;  2E7A A;  1S4C A;  3ZSJ A;  4KQ7 A;  1DZQ A;  1LU2 A;  1J58 A;  1NLS A;  4W6W A;  5IK7 A;  4JGY A;  3ZMN A;  2ZAB A;  1K3I A;  1VLN A;  1ZNP A;  2GNM A;  3S57 A;  1CZV A;  4HFS A;  3Q8C A;  4QX1 A;  4LOS A;  4YW1 A;  4ISQ A;  4MXW B;  5GAL A;  4IUG A;  1RUE 3;  2AAC A;  3WG2 A;  4WM7 C;  1CZT A;  1H9P A;  5K0U C;  1BHG A;  4ASL A;  1N1T A;  3WV6 A;  3SEE A;  2DCT A;  2E6V A;  1DF0 A;  2VNO A;  3GCW A;  4CUB A;  1Y3T A;  5C3P A;  3FLR A;  3E1F 1;  3KCC A;  3BOP A;  2XJQ A;  3J9S A;  3TWI A;  3MID A;  3LEG A;  1WMD A;  1QJX 3;  3DYP A;  4ATF A;  1XND A;  1U0A A;  3CHX A;  4KL1 A;  4AL9 A;  2DCK A;  3ZLI A;  3V0B B;  1QJU 3;  1NOV A;  4P00 B;  1YNA A;  1H9W A;  4CA9 A;  4NHK A;  3ES4 A;  3PU8 A;  3W58 A;  2J1A A;  2X53 S;  4LEJ A;  3ZYH A;  3OBZ A;  3AVR A;  2EVX A;  1KEX A;  4QM9 A;  4CDQ B;  3RMX A;  1UZY A;  4K9S A;  2CDO A;  2QVS B;  5F5Q A;  5CFC B;  2B5H A;  1R09 3;  1D0H A;  3OY8 B;  1XE8 A;  1MZ5 A;  5HCB A;  2Q8O A;  1F31 A;  4D3W A;  1DBN A;  2RS1 3;  5FYZ A;  1ULF A;  1GQG A;  4L8Q A;  4UW5 A;  1UZV A;  3HNM A;  3JD7 2;  4NIH A;  1KFU L;  3ZYI B;  3ZKY A;  1GQH A;  4QGN A;  1GFF 2;  3QH6 A;  2JG8 B;  3RS6 A;  1A34 A;  4J1W A;  5F5A A;  3O0W A;  2DU0 A;  1E5H A;  3JBG 2;  4AED A;  1NE6 A;  4CCN A;  5J7M A;  1UY0 A;  3WW1 A;  5HXM A;  1QNW A;  2J1R A;  3FX3 A;  1AYN 2;  3VBU B;  1Q8Q A;  3OBR A;  4GH4 B;  1KIT A;  2A71 A;  4JZR A;  4LLF A;  1HRI 3;  5CBL A;  2ZS6 B;  5DN2 A;  4CEY C;  1CJD A;  1D7P M;  3I3Q A;  5FZE A;  4LJH A;  3TYJ A;  3WQ1 A;  4W6Y A;  2VZT A;  2CAV A;  5CEH A;  5DAV A;  1NZI A;  5JOX A;  1UZZ A;  2YC2 A;  5DUU A;  1BEV 3;  3MIF A;  4I3G A;  3KB5 A;  4XF3 A;  5I0T A;  3NJV A;  1S0G A;  1G9D A;  5ABJ A;  1WBF A;  4QKF A;  3VL8 A;  2HWF 2;  1ENQ A;  3DYO A;  4AXO A;  4BMB A;  2I45 A;  5LY2 A;  2DV9 A;  4HG6 B;  4Q26 A;  1CD3 G;  4OUL A;  3HMY A;  1NCQ B;  4MLO A;  3I3E A;  4I09 A;  3T0A A;  3ZYP A;  1RUH 1;  2ARB A;  1PM7 A;  2K0G A;  3ME2 A;  4UW3 A;  3PUA A;  1TG7 A;  1O4Z A;  1VPH A;  2R04 3;  3O5S A;  5A3M A;  1R1A 2;  1RUJ 1;  3I97 A;  4DO0 A;  4AHY A;  3NRU A;  1JOB A;  4TZD A;  2YRO A;  4KH9 A;  3NAP B;  3VBO C;  3O1R A;  1AR7 1;  3FL7 A;  4Y22 A;  2XR4 A;  1UMI A;  1H8T B;  3MF6 A;  4B3N A;  5C3S A;  3BU0 A;  1F8V A;  3O1S A;  1WCK A;  3LFM A;  1CON A;  5KWR A;  5GZC A;  4UXA A;  3AZV A;  5ERL A;  4OHZ A;  1YHF A;  2FCV A;  3KF3 A;  1W8Z A;  2C5D A;  1RUF 1;  2W5F A;  4Q4W 1;  4WVM B;  4QWN A;  4C0B A;  4JKL A;  4HT1 T;  1GNZ A;  1SLC A;  4LBQ A;  2CDP A;  1UYP A;  4YM3 A;  4ZHN A;  1WMX A;  3G6J B;  1W6P A;  2WNV C;  2XPJ A;  4OHV A;  1WW5 A;  3VKF C;  2WT0 A;  4XW3 A;  3BTX A;  3KT1 A;  2RJL A;  2AEZ A;  1HN1 A;  1S0C A;  2WNE A;  3CU7 A;  3LEM A;  1MVE A;  1I5Z A;  2JXA A;  1CR7 A;  3P6B A;  5IJR A;  2VBB A;  3OGV A;  4JAA A;  4FPC A;  4IV3 B;  1SCS A;  2A7A A;  4D69 A;  1VRH 2;  2Y6H A;  5CNA A;  4LLO A;  3EXU A;  1V9U 3;  4NPM A;  1W6Q A;  4QKD A;  3KZ4 C;  1BKZ A;  3I2O A;  4I01 A;  2DYC A;  2NLR A;  4FPO B;  4EV0 A;  1IPK A;  1WCQ A;  3N35 A;  2P34 A;  1ZZ8 A;  1ZRC A;  4NIA A;  1SHW B;  5A7N A;  4GMP 1;  3A22 A;  1K5M B;  5JOZ A;  1MZE A;  4LK6 A;  4HZF A;  2ZML A;  5F8P A;  5JR7 B;  2FBE A;  3N36 A;  1OD5 A;  1W9W A;  2UWC A;  5T55 A;  2VEC A;  4AFB A;  1SFY A;  5C4W B;  1MS5 A;  2PFW A;  2YDE A;  1QH7 A;  1VBA 2;  4GAL A;  3VV1 A;  3ZX7 A;  5JXI A;  1DFQ A;  3IBM A;  4CCM A;  4MXW A;  2AUY A;  5A3U A;  4LTA A;  3B7M A;  4RL7 A;  1BLZ A;  1XB9 A;  1JTZ X;  3HQR A;  4EZH A;  1JZ3 A;  1OF3 A;  1QJU 1;  1WKY A;  1YQ2 A;  2X29 A;  3ZXL A;  5IVE A;  4LT5 A;  5IVB A;  1S0J A;  1XSQ A;  5M0T A;  1PNG A;  3CZJ A;  4MAD A;  1OVP A;  3GJB A;  2R1D A;  4P02 B;  5FPU A;  3MV0 1;  5F5C A;  4YGB A;  2VC9 A;  3O1V A;  2RM2 1;  1W06 A;  4EN6 B;  3CF6 E;  1R09 1;  1H2N A;  1E5S A;  2YXS A;  3BIW E;  5FZM A;  3RSJ A;  1IQA A;  5BNP B;  4GIQ A;  3ZXJ A;  3AP9 A;  4JCK A;  4PLN A;  2CWM A;  3K51 A;  5LY1 A;  2C4X A;  2HWB 2;  2JB4 A;  1DGW A;  1PMJ X;  4DIN B;  3IWZ A;  1ZZ7 A;  3VZM A;  2P2K A;  2BYV E;  3AMQ A;  1US3 A;  2RR1 2;  4ET7 A;  4QX3 A;  1W2U A;  3MYX A;  4LIU A;  4QXB A;  5FP7 A;  4B1M A;  4QDQ A;  5LCW L;  5FP3 A;  1ND3 C;  5CFC A;  1PIV 2;  3MLK A;  4NOT A;  2W87 A;  3M1H A;  3OY8 A;  2PAE A;  4RR3 C;  3S7E A;  5C7G A;  2YYO A;  4CP1 A;  5IVC A;  2WAB A;  5JPM B;  1GLH A;  3RJ2 X;  4C1W A;  4E2S A;  4FPE A;  1V6J A;  2N7G A;  1HRI 1;  5HI0 A;  4ASK A;  1WME A;  3WQB A;  1BK1 A;  4JQT A;  4BU2 A;  2VQU A;  3LEK A;  1W9Y A;  2Z79 A;  3EHK A;  5T50 A;  3F2Z A;  2JG9 B;  3J7H A;  4LHL A;  3FLT A;  4YVS C;  3ZPY A;  5KHK A;  1AXY A;  5FZA A;  1LU1 A;  3VBU A;  1O8P A;  2W52 A;  4BIO A;  2SLI A;  1RED A;  4K20 A;  2BGP A;  1VBE 2;  1NCR B;  1GNY A;  1XNT A;  4WM8 B;  4GB3 1;  1FNY A;  4XE9 A;  5EYY A;  1CX4 A;  4NO4 A;  5FWJ A;  3AX4 A;  3WP6 A;  2MEV 2;  1J1L A;  5DZG A;  1NQJ A;  1AX0 A;  1V6I A;  2WNO A;  3H7Y A;  2HWD 2;  2LTN A;  1IGO A;  1ZZB A;  5EJ3 A;  2VMH A;  2CNA A;  3DPR B;  4DS0 A;  2WNU B;  3JD7 3;  2RDQ A;  4QB2 A;  2HWC 1;  5FK8 A;  2VTX J;  2XL9 A;  2VMF A;  4LO7 A;  2EIB A;  5KHJ A;  3WNO A;  2XUM A;  1DLC A;  3OPW A;  1UW8 A;  2IFW A;  3JBG 3;  3LB9 A;  4N9I A;  5FIX A;  4BME A;  2VVE A;  1ASJ 2;  2FDH A;  1O4T A;  2D40 A;  4UW4 A;  1W2A X;  2XB6 C;  1HLC A;  3ZSL A;  1AYN 3;  1UOJ A;  4HET A;  5CKN A;  2JEN A;  3O1U A;  1DG6 A;  1OPM A;  3IPV B;  3LDB A;  4YGE A;  1T6B X;  4H2A A;  3WNP A;  1HXS 2;  3WW2 A;  3W20 A;  4CXY A;  2WFP A;  3V0A B;  1HV0 A;  2ES3 A;  1NQD A;  1H8T A;  4AVT A;  4WM7 B;  1LKN A;  2ZEY A;  3ABZ A;  5K0U B;  2BPA 2;  1L3J A;  2EA7 A;  1L7L A;  5JI7 A;  4F8A A;  2K2S A;  3N7J A;  2HWF 3;  3JQW A;  4Y1X A;  2VUC A;  3B69 A;  4LE3 A;  5CIS A;  1H1M A;  5A3N A;  1C8M 3;  5FXZ A;  1OPO A;  1CAV B;  4RS5 C;  3WP4 A;  4FFG A;  1W9T A;  4QGL A;  2EAA A;  2HEY F;  1JUH A;  3WF3 A;  5DAQ A;  3S6P A;  4XCB A;  5FR3 A;  2WSV A;  4EN9 B;  1V9U 1;  3VBR A;  5ABJ C;  1DHK B;  5B2G B;  3EMR A;  1R1A 3;  1PZ7 A;  3IDB B;  3OBT A;  4FPG A;  4UFJ A;  5FUN A;  1LEC A;  2VGD A;  1O6U A;  2WKK A;  2BBV A;  4EWD A;  2VTX A;  1VAK A;  1WCD J;  4A7Y A;  3A0K A;  2YPJ A;  2D5F A;  3LA2 A;  5JI9 A;  5D21 A;  5FLI A;  1RUO A;  4GJY A;  4IV3 A;  1ONA A;  3QBQ A;  4DY3 A;  1UPI A;  2Y33 A;  1UXZ A;  4CU8 A;  1QDC A;  2DVB A;  4L2N A;  3K3O A;  3AXD A;  4DRR A;  2P3I A;  4Z07 A;  5A3T A;  5J48 A;  2Q0A A;  2WYF A;  4JRA A;  3TNP B;  5FYU A;  4IEQ A;  1OF4 A;  1JW6 A;  3OEB A;  4ITC A;  2BVV A;  1CAW B;  1UYZ A;  4UFM A;  1ZRF A;  1NG0 A;  4LMF A;  5FWE A;  4GQ7 A;  4Z2W A;  3U78 A;  2ZEX A;  2L9L A;  4LO6 B;  3W21 A;  4CEY B;  3OGJ A;  2X05 A;  4H55 A;  5C4W A;  3WG1 A;  3WDV A;  4ZKT B;  3BKZ A;  4MG2 A;  1RUG 1;  2XBO 1;  2PHR A;  3D8C A;  2BQP A;  1WLT A;  3BPZ A;  5FUP A;  2VUL A;  2A70 A;  4IET A;  4SLI A;  1VRH 3;  2DVD A;  2EF6 A;  3OYW B;  1ZA7 A;  1CIY A;  2ZZJ A;  2GU9 A;  4R4X A;  1P8J A;  5APA A;  2W47 A;  4YW5 A;  3A7Q A;  2XXZ A;  1HV1 A;  1TME 2;  4A7K A;  1VMF A;  2RMU 3;  3U75 A;  4V1P A;  4FCA A;  1LES A;  1KRI A;  2VW2 A;  4I2O A;  1RIT A;  2WC2 A;  2WS9 2;  2DUO A;  4OZO A;  4XJ9 A;  2VCC A;  4K40 A;  5DMY A;  5CKQ A;  4UI9 L;  4P9Y A;  2G9Z A;  4BZ4 A;  4FOV A;  4PQQ A;  1LED A;  5FZC A;  3GZE A;  1GYK A;  1S2E A;  4TLG A;  2GC3 A;  4TN7 A;  4LA2 A;  3AL5 A;  3M3O A;  2BRT A;  1SPP A;  2XHK A;  3PUI A;  4FPJ A;  4RN5 A;  4UT5 A;  4AFC A;  4XF4 A;  2W9X A;  1UKG A;  5FXX A;  2PEL A;  4YNI A;  2IC1 A;  3ZSE A;  1J3R A;  2WLQ A;  2D44 A;  2WA3 A;  4HVO A;  2GN3 A;  1VRB A;  1DGR N;  1HRV 2;  4IXL A;  4URA A;  1VBC 2;  1CPM A;  2GP3 A;  3N3H A;  4XHB A;  1PVX A;  3IDC B;  2WNV B;  4XAE A;  1IG0 A;  2BNN A;  2JG9 A;  1D4M 2;  4QMA A;  4YZ4 A;  2VOW A;  4Q0V A;  2TEP A;  1NT0 A;  1SDW A;  1V70 A;  3MF9 A;  4BWO A;  4QX5 A;  4NIG A;  2HWB 3;  1WD4 A;  3LEI A;  1FOD 2;  3IAQ A;  4QXC A;  1Q8O A;  3WG4 A;  3ZFE C;  4AGG A;  5F3C A;  4OHY A;  4E8C A;  4COW A;  3H1M A;  1RUN A;  4TYS A;  1KQR A;  3D6E A;  2RR1 3;  3T2T A;  1BK0 A;  1POV 0;  1N3Q A;  1RXG A;  3OEA A;  1QU0 A;  3AKP A;  1RUD 1;  2XQX A;  3KV9 A;  3POJ A;  3JBG 1;  1PIV 3;  3FC0 A;  1MS4 A;  4XF1 A;  3LDR A;  4Q4V 2;  2XG3 A;  2RS3 1;  4NWV A;  1Q43 A;  2CGN A;  2FMY A;  2VOT A;  2A6X A;  2JEM A;  3VKN A;  1JYN A;  4AW7 A;  1LB2 A;  1AYN 1;  2A1X A;  3DPR A;  2QQV A;  1RTV A;  5BUV A;  4CCE A;  4QXK A;  3MI8 A;  3PVE A;  4OI4 A;  3BVC A;  5F32 A;  2ZGT A;  4XJZ A;  2E32 A;  1DP0 A;  3QOP A;  5GZF A;  5IK4 A;  1V6K A;  1W2T A;  5CG9 A;  3ENR A;  3AYD A;  1JN2 P;  2PHX A;  3KV5 A;  5I0D A;  2JEC A;  1QMJ A;  1W8O A;  3IPV A;  1S1A A;  1C8M 1;  2G9G A;  3NVC A;  1VMJ A;  2BUK A;  4RQP C;  2BP6 A;  1POQ A;  2AZ5 A;  2ZX4 A;  3OBA A;  5LBC A;  4AHX A;  4CU6 A;  3V0A A;  1UMZ A;  2MEV 3;  4K21 A;  1AJO A;  2R07 2;  5K0U A;  2ZGL A;  4IGQ A;  2HWD 3;  4CDW C;  5LWB A;  2G4I A;  4AEK A;  1WD3 A;  4AFD A;  1BMV 1;  2YU1 A;  1N1Y A;  2EXI A;  1W90 A;  1O59 A;  3IMN A;  2C24 A;  4AK3 A;  4XIL A;  3A23 A;  1M4W A;  2ZA9 A;  4LKF A;  1X8M A;  3DEM A;  4NRP A;  4OUM A;  5L19 A;  4P9X A;  1BYH A;  2ID4 A;  4XEZ A;  4A3X A;  4CVU A;  1VMH A;  3NV2 A;  4KMQ A;  4BQ1 A;  1K45 A;  3VLB B;  2BOJ A;  2JDP A;  1CAX B;  1ASJ 3;  4OUE A;  5D2A A;  5L36 A;  2OUH A;  1RHI 1;  2V5D A;  3JB8 A;  2JIC A;  2WO2 A;  1YJL A;  4XHX A;  1HIX A;  1LHN A;  1UF2 C;  3BYW A;  4Q2F A;  2EIG A;  1HXS 3;  5DG1 A;  2O8O A;  2ZGR A;  1PGW 2;  2AR6 A;  4N7I A;  4QX0 A;  4WZF A;  4YVW C;  4ZXK A;  2FZ2 A;  4RR3 B;  2HBT A;  2WZE A;  1GKB A;  2WLP A;  3OGS A;  4GKY A;  3UT0 A;  4CU9 A;  3T1M A;  2JD9 A;  2XOM A;  5IT6 A;  5J1X A;  2WQ8 A;  3JXS A;  5LAS A;  3PNA A;  1VR3 A;  2BDR A;  3C7F A;  4O9G A;  4EN8 B;  4IE4 A;  3CNA A;  1CAW A;  4B1L A;  1UU6 A;  3R4D B;  2YPD A;  3U37 A;  1VRH 1;  3A4U A;  1APN A;  4RHV 1;  1GZT A;  5GLU A;  2AH2 A;  2ZXQ A;  3MW4 A;  3PIG A;  2FCU A;  2ZAC A;  4YVS B;  2I07 B;  1FAY A;  4XZU G;  5T5O A;  3SIT A;  4AQ6 A;  3I8T A;  2QCS B;  3UGH A;  3ON7 A;  1A8D A;  2EID A;  4W6X A;  2DF7 A;  4MV2 A;  1C4R A;  5H9Q A;  3ZN4 A;  1ENS A;  2RMU 1;  3WSO A;  5KXB A;  5FOJ B;  1XC6 A;  1GBG A;  4O65 A;  3ST7 A;  1QF3 A;  1NLR A;  1YQ5 A;  2YC4 A;  3VBR C;  4NHM A;  1RVF 2;  1KDK A;  2QQN A;  2VQT A;  2WN2 A;  3AZY A;  5I8T A;  1OA2 A;  3CZU A;  4MH0 E;  1U5Y A;  1KGY A;  2P3K A;  1U5Z A;  3HT1 A;  5T54 A;  1PVC 1;  1W28 A;  3PLQ A;  3U0Z A;  5L9R A;  2WZR 2;  3VDD A;  4XF0 A;  2VE1 A;  3RYP A;  3T2O A;  3PUH A;  1UY3 A;  1UY2 A;  2RDN A;  2DCJ A;  2TNF A;  2PQQ A;  4QHB A;  3C7E A;  4OHX A;  2X09 A;  1AUY A;  4BDV B;  4DUW A;  4FXK B;  4CUG A;  4XDQ A;  4J6G A;  4GXL A;  3VBO A;  1DDL A;  1W8F A;  4E4H A;  3RZH A;  2JE9 A;  1DGL A;  1PK6 A;  2MPF A;  2RS5 1;  3WIN E;  4IEZ A;  5DAW A;  2P4E A;  3J7N A;  5HV0 A;  1GOF A;  1QXP A;  4CXW A;  1MZF A;  1QEX A;  3SH5 A;  4PHZ A;  1PO2 2;  2A5Z A;  1AVB A;  3FUO A;  3M3C A;  4RS5 B;  1UOF A;  2V72 A;  2OKX A;  5FBZ A;  5LBB A;  3VL9 A;  3T0D A;  4GKX A;  1LTE A;  4COZ A;  3LIH A;  4RD7 A;  3GZA A;  4KNC A;  4Q4Y 3;  5ABJ B;  1GSL A;  4PF1 A;  2B8M A;  2WNV A;  4Q0P A;  5K8S A;  1AXK A;  2MNG A;  1UN1 A;  3LKJ A;  4AF9 A;  3DL3 A;  4ORF A;  3AKS A;  3AP7 A;  1W8U A;  1W99 A;  1AR9 1;  2QQP A;  4IV1 C;  1SBF A;  1W05 A;  5KXD A;  5FPX A;  3ATG A;  5E16 A;  1AYM 2;  1JXN A;  4HBN A;  3NNG A;  4PF5 A;  1W3V A;  5E6H A;  1AXZ A;  5HXV A;  2G1M A;  1R08 2;  4AEJ A;  2JDZ A;  3BTY A;  3UJO A;  4AG4 A;  5JWP A;  4GJZ A;  1PM4 A;  2XJS A;  4OI0 A;  1TZO A;  2WDB A;  4HVR A;  2VCA A;  2B45 X;  4TXW A;  1RUC 2;  4P9I A;  4F3J A;  2PHW A;  3AZZ A;  1WA6 X;  4OI1 A;  4XUT A;  4Y22 B;  5A6X A;  1H1I A;  1WMF A;  3WHT A;  4CU7 A;  2YHJ A;  4LR4 A;  3BUC A;  3H8R A;  1HRV 3;  1ALY A;  1ZX5 A;  3PJQ A;  1VBC 3;  2AEN A;  1UPS A;  4XQD A;  4CTE A;  3E6D A;  5KC6 A;  4ATE A;  1S2K A;  2B9V A;  4QPI C;  3AMM A;  1PGL 2;  3E6B A;  2MEV 1;  3EYP A;  3HN1 A;  4W65 A;  5EQU A;  3SHR A;  5FLH A;  3HNB M;  4NUB A;  4JDM A;  1H6Y A;  3H8O A;  1ACC A;  2EIE A;  1AR6 1;  4IES A;  1K42 A;  2ZGQ A;  2VQ0 A;  5AFE A;  1KS5 A;  4XTM A;  3USU B;  2W92 A;  4E4S A;  4LBQ B;  4NN0 A;  5AC9 1;  1AZD A;  2YZ4 A;  3DXU A;  1W6P B;  2RG4 A;  4YFZ A;  4AI9 A;  4JDO A;  3SCF A;  2D6N A;  1H4G A;  4N53 A;  2VXR A;  4G3Y C;  4Q4V 3;  4BJ0 A;  1ASJ 1;  2DWR A;  1WLD A;  2VMC A;  5A32 B;  4Q0Q A;  4FP3 A;  1OHF A;  4X6Q B;  1UAI A;  2BBA A;  4J1X A;  1CES A;  5JR2 A;  3RZJ A;  4H14 A;  1WW4 A;  4L9B A;  5K9Y A;  4EZ4 A;  4G9S B;  1ODN A;  5A3W A;  3K46 A;  2W46 A;  2YGL A;  3GBF A;  5JIA A;  5T5L A;  1CAX A;  3ZN6 B;  4CCD A;  4HN1 A;  3LFI A;  2ZGM A;  3KHB A;  4Y20 B;  1OLM A;  2ADD A;  2ZHN A;  2DCZ A;  4LO4 B;  4YG3 A;  5I0S A;  1PZ8 A;  2R6Q A;  4YW2 A;  3T2Q A;  1Z0H A;  1ND3 A;  2VH9 A;  1XQN A;  3D82 A;  4IL7 A;  1WW7 A;  4M3C A;  4PQ9 A;  1W0N A;  4NHX A;  4RR3 A;  4XF9 A;  2YBP A;  1GWL A;  3N7K A;  4BH9 A;  2XJU A;  3ZYG A;  5D8A A;  4L11 A;  4WZC A;  4HVQ A;  5GJ6 A;  2ETE A;  5J98 B;  3NJX A;  4GWJ A;  1RJ7 A;  1QQP 2;  3KMH A;  4ZU5 A;  3LSE A;  5I8Y A;  4K1Z A;  3OGG A;  2ZOE B;  2WYS A;  2GP5 A;  1RIR A;  5EWS A;  2CGO A;  4G4F A;  3K4Z A;  5IWF A;  2YFZ A;  1QJY 2;  2WQZ C;  2AYH A;  1WA4 A;  2VZO A;  4XQ4 A;  4YVS A;  2C0Z A;  3NW4 A;  1ODM A;  1BQP A;  1Z7S 1;  5BY5 A;  1VBB 1;  1QDO A;  3FHQ A;  3P3P A;  2NZ9 A;  5DAB A;  2HEV F;  1Y4W A;  4GWM A;  3PMS A;  4LBK A;  1POV 3;  3SLI A;  5IFP A;  2JDU A;  5IVF A;  2Y6L A;  2ATF A;  2FHR A;  3I2K A;  2WL1 A;  3KQR A;  3VBF C;  1C1L A;  2JB8 A;  3WNK A;  2VNG A;  2ZGP A;  4P9L A;  2W0X A;  1GOH A;  1S0B A;  3OD4 A;  5JIU A;  3UNP A;  5A1F A;  2ZAA A;  1LEM A;  2OII A;  4XAA A;  3TN9 2;  3BOW A;  5JLV A;  4P9J A;  2B46 X;  1XBF A;  1OT5 A;  4Y1U A;  1V00 A;  4PLO A;  1ENR A;  1YCI A;  4P08 A;  1QY4 A;  4LBM A;  3THD A;  5J36 A;  3ZFF C;  3OTF A;  2CY6 A;  2NMO A;  4QDS A;  2JX9 A;  1K12 A;  4TLF A;  1YIP A;  4RQP B;  3AZX A;  3N4M A;  4LNV A;  3VBH C;  3N9L A;  1PO1 1;  2WBK A;  2PMW B;  2FZ1 A;  4BQY A;  4MGQ A;  2K46 A;  3NMB A;  4Q4Y 1;  4CDW B;  4XVH A;  3JU9 A;  4Z82 A;  1RVF 3;  3MUZ 1;  1C3H A;  1X8E A;  4GWI A;  1DQ4 A;  3MW2 A;  4XIK A;  4Q29 A;  2G19 A;  2WZR 3;  2D6L X;  4RS5 A;  3M3E A;  1BVV A;  4NJ4 A;  2QQU A;  4AR2 A;  2ENR A;  3OD0 A;  3RYK A;  4XFI A;  2PAK A;  3AJZ A;  2OA2 A;  3WDT A;  5L7O C;  2QJV A;  1I6X A;  4E2Q A;  2RV9 A;  2LS6 A;  3IMM A;  5I8S A;  3VDD C;  3WT3 A;  2EAL A;  4AZZ A;  4YVW B;  4AVA A;  1I5P A;  2ZEW A;  3THT A;  4HON A;  1H8V A;  3IB3 A;  3P3N A;  3T09 A;  3E97 A;  2Q1F A;  1JZ5 A;  2Y38 A;  1COV 2;  4HOO A;  4QX8 A;  4D6Q A;  4DNY A;  3VB9 A;  1A8M A;  1PO2 3;  4D0Q A;  5ACA 2;  2V4A A;  1U5X A;  1D2S A;  1PK6 C;  1H2M A;  1Q5O A;  5A33 B;  1EPW A;  3UES A;  2HH9 A;  4A7Z A;  1O4Y A;  4Y5S A;  4Q4V 1;  1JZ8 A;  2VO5 A;  3M4F A;  3WR0 A;  1NZC A;  3THC A;  4LOR A;  4BHP A;  3OPZ A;  1EPZ A;  3MPP G;  5KXE A;  5JSR A;  4F7Z A;  3HD8 B;  2AC1 A;  5DDJ 2;  5FTT C;  1OH4 A;  3USU A;  1AYM 3;  4GZ9 A;  4BIS A;  3VBR B;  2KXL A;  3Q8B A;  1G7Y A;  5JSO A;  1H1A A;  1R08 3;  4Q1R A;  1KDM A;  3DKQ A;  4QPG C;  5EHD A;  3ZSM A;  3ZXK A;  2W39 A;  5F3G A;  2E33 A;  5L73 A;  3CQO A;  2BOI A;  2Y6J A;  3C7G A;  3AYA A;  4M00 A;  4ES8 A;  1RUC 3;  1FT9 A;  4CP0 A;  1YIF A;  5A32 A;  2VOK A;  5I93 A;  2YC0 A;  3KS7 A;  4XET A;  2JE8 A;  3PUR A;  4FPL A;  3P5B A;  3RDI A;  5A7O A;  3ZXE A;  3O1P A;  2PYT A;  3SH3 A;  4NAM A;  3WCR A;  1R64 A;  1XU1 A;  1LOE A;  2KA3 A;  4COU A;  4DXR A;  1Y9G A;  4CUC A;  2V73 A;  1TNR A;  2ZGU A;  3A0N A;  2OPW A;  4L97 A;  1MEC 2;  2Y34 A;  4NWW A;  2CWS A;  5FYI A;  3SH4 A;  1PHM A;  4Y5Z 0;  3ZN6 A;  1N47 A;  4BK4 A;  4Y20 A;  5JVV A;  3HOB A;  1IS6 A;  4NE9 A;  5FXW A;  1W8N A;  1RUE 1;  2XVG A;  1H2K A;  1IZ3 A;  3QCW A;  1C28 A;  1AHS A;  5DUV A;  2XON A;  3PVB B;  5SV8 A;  4R9D A;  1OQ1 A;  1PX3 A;  1DQ1 A;  4HKW A;  2FMD A;  4JQR A;  5FZ1 A;  3ZXF A;  1SLB A;  5F39 A;  1SLT A;  1H6X A;  2ORZ A;  3WQ0 A;  2ZGS A;  4A2U A;  3RG0 A;  2W1W A;  3K4A A;  4H3W A;  2Q8E A;  4Q27 A;  5B4X A;  1QJX 1;  5FMO L;  2UYB A;  4DFS A;  2A6Y A;  1SAC A;  1QJZ A;  2W68 A;  5ANN A;  1MAC A;  1UX7 A;  5FPA A;  3USS A;  3WQ7 A;  1POV 1;  5FZ7 A;  2A6V A;  4N53 C;  5FYY A;  1ZRD A;  1EUU A;  4K1Y A;  4MGS A;  3POG A;  2QFE A;  4QD2 A;  4R8H A;  1ZZ9 A;  4I0A A;  4TWT A;  3ZFE A;  3RQ0 A;  2DTY A;  5FMC A;  4DXZ A;  4S2F A;  4IV1 B;  4JHT A;  4PT6 A;  1EV1 2;  1RGS A;  3KM5 A;  4H7L A;  1AL2 2;  3CJI A;  3JB4 C;  4KBB A;  1W2N A;  3GM8 A;  4GAZ A;  5JDB A;  5JCT A;  1OSG A;  2RS1 1;  2R06 2;  5LRR A;  2PLV 2;  2W1U A;  3HR9 A;  3ZIX A;  2P6H A;  4K6B A;  3BIE A;  2IXH A;  2ARE A;  2QQK A;  1A6C A;  4LO5 B;  1SPP B;  4XUO A;  2IXJ A;  4Z92 B;  3HIF A;  4COY A;  1RMU 2;  3MPB A;  2YG0 A;  2WRA A;  3A21 A;  1QQP 3;  4QPI B;  3BOD A;  3MDP A;  1GOG A;  1HQL A;  3NV3 A;  4QB1 A;  4YG0 A;  1BVP 1;  1UIJ A;  2OVU A;  3ZR5 A;  4YW7 A;  4LBL A;  5CAD A;  3N9O A;  3OF1 A;  1QJY 3;  3I2G A;  4IEX A;  3ZXG A;  4W4Z A;  5D8A C;  1QOO A;  1OQD A;  5GLZ A;  2D3R A;  2WZR 1;  4KBZ A;  2VG9 A;  4RQP A;  3LD8 A;  1WCU A;  4KG0 A;  4Q8L A;  3WDW A;  1XSR A;  1BEV 1;  2VUD A;  4LOT A;  3F95 A;  4LIV A;  1C1F A;  1X9T A;  5HV4 A;  2VM9 A;  4PBO A;  4CDW A;  5TSW A;  2XKO A;  1YFX A;  5J09 A;  1AJK A;  5F6K A;  2Z42 A;  2ZGN A;  3T2P A;  1PMH X;  4LHN A;  1LGN A;  3E5X A;  4ZXE A;  1OXC A;  2VZS A;  3ACF A;  1J84 A;  1ZBE 2;  1ULD A;  3TN9 3;  4YPJ A;  1ULE A;  1ZBA 2;  4QHO A;  3M2M A;  2PHD A;  2FDJ A;  1IS5 A;  2CL2 A;  2R04 1;  2UUR A;  3EB7 A;  3MFC A;  3B9I A;  3HBZ A;  1YC6 1;  1RL3 A;  3GDB A;  4CP9 A;  5FK7 A;  1C5H A;  1QH6 A;  2JWP A;  2WFF 2;  3CEW A;  4GD4 A;  4XJ8 A;  1X50 A;  3RJR A;  1YO8 A;  3RYR A;  5ISL A;  4DXT A;  4YVW A;  5F2S A;  1OLQ A;  1DYK A;  2J7M A;  5FZ9 A;  1O3T A;  1FPN 2;  4BIF A;  5LK5 A;  1C57 A;  5JUV A;  4AI2 A;  4GWN A;  2VW0 A;  4ES9 A;  4Q4X 2;  1E57 A;  1QWR A;  2BEO A;  2XVL A;  4SBV A;  5E89 A;  3NQH A;  5FZK A;  3ZDS A;  2WA4 A;  3GHN A;  5F5I A;  3VZK A;  3PHM A;  2ILM A;  3BPS A;  3LOI A;  4U2A A;  3LGR A;  4I02 A;  1AYM 1;  1SBD A;  2D98 A;  5FZI A;  5A33 A;  2ZX0 A;  4ZU7 A;  4E2G A;  4M0N A;  2F4L A;  3HN3 A;  1LAJ A;  2E31 A;  2ZHK A;  2JDK A;  2W2I A;  3AZW A;  5CFD C;  3H8U A;  1TMF 2;  4HN0 A;  1JUI A;  1RUC 1;  3B02 A;  5ANQ A;  4YGD A;  1L7R A;  1S0F A;  3B01 A;  2ZMN A;  2WII B;  1QJE A;  3TB0 A;  3K75 B;  5FYB A;  4QKB A;  2ET7 A;  5IAV A;  5L9V A;  1Y9Q A;  1RIN A;  3T08 A;  3D0J A;  4MGI E;  1GP5 A;  1UY4 A;  1FNZ A;  1REE A;  2XLA A;  5DPN A;  3VBF B;  4A6S A;  5JZG A;  1PGL 1;  1COV 3;  3O12 A;  5EIY B;  1GAN A;  1FI2 A;  3E5Q A;  4XJA A;  3ZYJ B;  2BGC A;  5LA9 A;  3P1I A;  3KVA A;  4BCU A;  1QIQ A;  3CMG A;  1XNA A;  2ZJC A;  5ACA 3;  4B4Q A;  1QJF A;  1ULG A;  1CQ9 A;  3AFK A;  4MHR A;  3C2U A;  4N43 C;  4CEW C;  5L9B A;  1SDD B;  1VP6 A;  4FQZ A;  3C7O A;  3ACL A;  3ZFF B;  1XXN A;  4AEM A;  4AE2 A;  3DF0 A;  3VBH B;  1W9F A;  4FFF A;  3T1L A;  4XOG A;  4R9B A;  4M01 A;  5FRE A;  3HNY M;  1GP4 A;  4BYY A;  4UOJ A;  3DKW A;  5FY5 A;  5CB7 A;  4W8J A;  4L92 A;  1R1Z A;  1HJG A;  4QQP A;  3AMN A;  4CDX A;  1JI6 A;  3ORJ A;  1AF9 A;  4CRQ A;  1XPW A;  3PTR B;  2FDI A;  1GMM A;  1IPS A;  2X5I A;  1LOD A;  4KWJ A;  2HKX A;  2KD7 A;  4XUP A;  5L7O B;  4XDP A;  3O14 A;  5FYS A;  4JX0 A;  1ZRE A;  3RZL A;  1XU2 A;  3RPQ A;  3WP5 A;  1RUI 2;  2WWU A;  2YBK A;  4JV4 A;  4HKL A;  3VDD B;  5FZD A;  4UBH A;  1MEC 3;  4AYU A;  4IE7 A;  3NJY A;  4IV1 A;  4URT A;  4PDW C;  1QQP 1;  3L2H A;  5CG8 A;  4NPR A;  3HT2 A;  4NHY A;  2NM1 A;  1Q3E A;  1GWK A;  5FY8 A;  1I9R A;  3VUO A;  4E4D X;  3CBN A;  3KGZ A;  3TEZ A;  3D3A A;  3R4S A;  4ARY A;  2V09 A;  3VBO B;  3I2D A;  2PTM A;  5FV3 A;  1WCS A;  1VBA 3;  2QNK A;  2IZW A;  1PK6 B;  4YM2 A;  4DB5 A;  4Y4R A;  2WO3 A;  2HLE A;  2RDS A;  2XLG A;  2WT2 A;  3AP6 A;  4RSU A;  2ZMK A;  5B4N A;  3H0O A;  4QPI A;  5F3E A;  4BK5 A;  4MGT A;  5DUX A;  4FI9 A;  2VAU A;  1F4A A;  1SLI A;  4FPK A;  4NRO A;  2F4P A;  3DXT A;  4KWK A;  4Y1Y A;  1OBN A;  2JD4 A;  2AGS A;  1V6L A;  3GGL A;  2WQ4 A;  5GM0 A;  2JIJ A;  1XE7 A;  1OI6 A;  2ZHL A;  3FN9 A;  4FPH A;  4CSW A;  5DZF A;  1W8H A;  1EV1 3;  4YZ1 A;  1AL2 3;  5FY0 A;  3S5Q A;  1QNY A;  4PBP A;  2BER A;  1D4V B;  4NAO A;  2K9Z A;  4QPG B;  4CPB A;  1WZX A;  1V6O A;  2JIG A;  4CDU C;  4EYU A;  4JDN A;  2PLV 3;  5IUQ A;  3X29 B;  1HQN A;  4EE2 A;  3ALQ A;  3JD7 1;  5FO7 B;  4FTS A;  1HX6 A;  3WDU A;  1KJR A;  2WIN B;  3CJI C;  3HEI A;  3FLP A;  3OSD A;  4XFC A;  1W0O A;  4CZS A;  1RMU 3;  2GAU A;  1J3Q A;  2UWB A;  3QAC A;  2GME A;  1QXJ A;  1C5I A;  1IG3 A;  2RHP A;  3U4X A;  4YAR A;  1HDK A;  5CAZ A;  1RUH 2;  4MUV A;  1ZM1 A;  3VHR A;  2BU9 A;  1YXW A;  3ZYB A;  3NKT A;  3VBS C;  2P3Y A;  5BNN C;  4WVW A;  3K2O A;  3NNM A;  3VN4 A;  1RUJ 2;  4OYU A;  2CHH A;  3TOJ A;  3RFR A;  4F83 A;  3N7M A;  4HAN A;  2OYZ A;  5C6C A;  2D3S A;  3IN9 A;  1AR7 2;  3S30 A;  2H0B A;  1GZC A;  3KWV A;  3R4U A;  1UD1 A;  2DUP A;  2E53 A;  5FY4 A;  3WNL A;  1QOS A;  1W6M B;  1DLL A;  3FFZ A;  2QKD A;  3C7H A;  2HWF 1;  1GZW B;  1ZRI A;  5JOY A;  4Y4Y A;  2BV4 A;  2RJK A;  2KR2 A;  2VTF A;  1VBE 3;  2D6O X;  2R1B A;  3WLU A;  5CZK A;  1ZBE 3;  4BQX A;  1EY2 A;  4N53 B;  2CSG A;  2VW1 A;  1ZBA 3;  4XFA A;  4AHZ A;  2XJR A;  5FZH A;  3ZFG A;  4YZ5 A;  1HJF A;  5A7W B;  4BQW A;  1DQ5 A;  1R1A 1;  3ASI A;  1F9K A;  4XJW A;  5FP9 A;  5FYH A;  3WG3 A;  4AQS A;  5FY9 A;  4QX2 A;  2WFF 3;  1XJA A;  1AR8 2;  5ACA 1;  2HYX A;  2XJV A;  4Y33 A;  1YQ8 A;  2Z69 A;  4R4Z A;  1FPN 3;  1OUS A;  3VBF A;  1UYY A;  3RI8 A;  4NR1 A;  2GC2 A;  3VDC A;  1GU3 A;  4N9H A;  3UGF A;  1NKG A;  4AGV A;  1OC1 A;  1SG3 A;  4P5H A;  3TNQ A;  3I4I A;  1ND3 B;  1SZB A;  4M3C B;  4HXC A;  4GH4 C;  1OA4 A; 
#chains in the Genus database with same CATH homology
 4IW3 A;  4NHM A;  4MHU A;  4Y5S A;  4NHY A;  3W20 A;  5L9R A;  5DAP A;  4XC9 A;  4NHX A;  5LBE A;  5C5U A;  4NHK A;  2RDR A;  2RDN A;  3OBZ A;  2RDS A;  4ZON A;  3DKQ A;  3NNF A;  5DAQ A;  2A1X A;  2JIJ A;  4XCB A;  4Y5T A;  5A3U A;  3EMR A;  5DAW A;  3BVC A;  3HQR A;  5HV0 A;  4NAO A;  5LAT A;  3PL0 A;  2JIG A;  2OPW A;  5EPA A;  4NHL A;  5M0T A;  2Y34 A;  2HBU A;  5LBB A;  3GJB A;  2Y33 A;  4JZR A;  5LBF A;  4Q5O A;  3OUI A;  4XAA A;  5LBC A;  3KT7 A;  5DAV A;  4ZPI A;  5IAV A;  5L9V A;  2G1M A;  3NNM A;  3MGU A;  3W21 A;  5LA9 A;  5EP9 A;  4XAB A;  4BQY A;  4MHR A;  5IAX A;  5L9B A;  5IAT A;  5EQU A;  4UWD A;  3NNJ A;  2G19 A;  4BQX A;  2HBT A;  4XCA A;  4NMI A;  2FCT A;  4BQW A;  3KT4 A;  3GJA A;  5C5T A;  3ITQ A;  4XAC A;  2RG4 A;  5LAS A;  5ERL A;  3GZE A;  2FCV A;  3OUH A;  5LB6 A;  4J25 A;  2FCU A;  2RDQ A;  3NNL A;  3OUJ A;  3HQU A;  4KBZ A;  3KT1 A;  2V4A A;  5DAX A;  5HV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...