5LASA

Hif prolyl hydroxylase 2 (phd2-r281c/p317c/r396t) cross-linked to hif-1alpha nodd-l397c/d412c and n-oxalylglycine (nog) (complex-3)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
215
structure length
215
Chain Sequence
PALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLICHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNCNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADETAAAKVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 61
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lasA00
3GZEA 3KT7A 4NHKA 5A3UA 4XCAA 2HBTA 2A1XA 3KT1A 3DKQA 4ZONA 4NHMA 2G19A 3OUIA 4J25A 5LASA 5HV0A 4NMIA 4XABA 3PL0A 4XAAA 4MHUA 5EPAA 5DAPA 4MHRA 3EMRA 3GJAA 5L9VA 3NNLA 2Y34A 5LBBA 2JIJA 5DAWA 5IAVA 5EP9A 5LBCA 4NHLA 3NNFA 5LBFA 2FCUA 3MGUA 2RDNA 3BVCA 4NHXA 4BQYA 5HV4A 5IAXA 3HQUA 4Y5TA 2RG4A 3W21A 3NNJA 3KT4A 5L9BA 4BQWA 2RDRA 5DAQA 3GJBA 5LBEA 5L9RA 4UWDA 3OUHA 4Y5SA 5IATA 2OPWA 2FCVA 2Y33A 4IW3A 2JIGA 4BQXA 4JZRA 3NNMA 5LA9A 2RDQA 4ZPIA 5ERLA 2G1MA 4XC9A 3OUJA 5DAVA 2V4AA 4XACA 4NAOA 5C5UA 2RDSA 4Q5OA 4KBZA 4XCBA 5C5TA 2FCTA 5LB6A 3W20A 3ITQA 5LATA 5M0TA 5EQUA 2HBUA 3OBZA 5DAXA 4NHYA 3HQRA
chains in the Genus database with same CATH superfamily
3GZEA 5FY7A 1MS8A 4FPOB 4RR3A 4AW7A 4PDWA 3WG2A 1L7RA 4E2QA 5J09A 4LA2A 3N9OA 4TN7A 5HCHA 1CAVB 2VL4A 1C8M3 3DV8A 1FPN1 1V9U1 5CFDB 1CJPA 1DQ4A 2ZZJA 2IXJA 4Q8KA 4KGQA 1S0FA 5KHHA 1LHWA 2QZ3A 4GWJA 4R9DA 2VZSA 1J59A 1DU3D 1UAIA 4JTNA 4PT6A 4N43B 4ZXKA 3VBFC 1QJY3 3PTYA 3POGA 4IGQA 5C3PA 4XABA 4CP9A 3FHIB 1Y9MA 2HWF1 1XNAA 4NE9A 3S57A 4NPLA 2XUMA 2Q5TA 2XHKA 1BK0A 1URXA 1OVPA 1S0GA 4OQ9A 1DG6A 4OMDA 3UGGA 3AKSA 2I2SA 1VBB1 3LDBA 1XE0A 4HPKB 5AFEA 4GH4B 5L7OB 2DVFA 3IDCB 1PMHX 3LPGA 1SLAA 1ND3A 2GMMA 4F83A 5JZGC 3ZXEA 1XOYA 5T5JA 1O3TA 1HRV3 1SLCA 4A4AA 2ZGKA 1H30A 1T6GC 3ZFGC 3FX3A 5FZAA 4HN1A 4WVMB 1O91A 1LECA 2RS12 4D69A 5FYTA 2JD9A 2JDMA 3D5OA 1GUIA 1OI6A 1QOSA 5A1AA 1V6LA 1WLTA 2XVGA 1UPSA 4Y5Z0 2W87A 1Q3EA 2WA4A 3ZR5A 4CXXA 1ZX5A 3R6SA 4Y3OA 3RZGA 1VMHA 2JKXA 3FL7A 3NAPB 3C7HA 2WNOA 4AVSA 5DPNA 1G9CA 2KA3A 4R9AA 4LBKA 1PM7A 1EAH2 1ULOA 1KJRA 1KQRA 1MS9A 3WF4A 4YVSC 1C5HA 3VLBB 1HN1A 4X8PA 3C7GA 5JOYA 2CY6A 4YYOA 4LE3A 3WQ1A 4QAWA 1R1A3 2VNVA 1F2NA 4XF3A 2WNVA 3O5SA 1ACCA 2PLV2 1PO22 3K4DA 4CCJA 1D4M3 2MPFA 2IC1A 3DN7A 3H8UA 4YW5A 4MO3M 5FKBA 3QH7A 1FOD3 3VHNA 3THPA 5A7SA 1U0AA 3PUIA 5GALA 2NN8A 4FPJA 2JG8B 3ILNA 5JR7B 2XWJB 4D3WA 1QJZA 5F1RA 1SFNA 3TYJA 3OYWA 3GBGA 3HEIA 5A80A 2QTWB 2UY9A 3ACLA 3PIGA 1GMMA 4XUNA 4DB5A 4RFT0 3C2UA 3WG3A 1UO9A 2XL9A 3GHMA 4O9GA 2W9XA 1GSLA 1SLLA 2G9GA 2GU9A 5CYYA 3LIGA 2XVKA 2DURA 2BJSA 3SEPA 4XFIA 1X50A 1GZCA 4SBVA 3UNPA 3FN9A 1LOFA 2NLRA 3JCIA 3KGLA 3OF1A 4QQHA 1GZ9A 4QD2A 1TEIA 3AP9A 5DQ0A 4QXHA 1FMD1 1AL21 5T55A 1LR5A 5GZFA 1CN1A 3SCFA 1HB3A 1LKNA 2BVVA 3NW4A 3OBTA 1W6MB 5J36A 4OHVA 5C4WA 2YGLA 5T54A 3RNSA 2RS33 2W0XA 1R082 2PN5A 4PJYA 4BIOA 2ZCWA 5JLVA 1JU3A 3KSCA 3M1HA 4KG0A 1OKQA 3CJIC 5JXGA 3IBMA 2PHWA 3KT7A 4HBNA 4HZFA 4QPGB 2JKBA 1JUHA 1ONAA 1H8TC 1C1FA 1VRH3 2YZ4A 2WLPA 4M00A 4TLFA 5DUUA 3ZXFA 2WWJA 4AG4A 4CU6A 4E8CA 2VZPA 2ZKLA 3JU9A 2VCBA 4KQ7A 5FO8B 5JOXA 3KZ4C 3MUY1 2YG0A 3LKJA 1OD5A 4META 2CWMA 2DBIA 2PQSA 4MZUA 2DU1A 2Q8DA 4BDVB 4I30A 5FXXA 4NIDA 4EZHA 2W1UA 4ZU4A 1NCRB 2WYFA 3PL0A 1UQXA 4MH0E 3URFA 4BQ1A 1QU0A 3H0OA 5FJKA 1LAJA 3AKPA 2LM3A 4A44A 3DYMA 2NYYA 3AZYA 1DGWX 3JXSA 4QHBA 4RQPA 3T2TA 4AF9A 1QJU2 1JXNA 3ZN6B 4Y22A 2VMDA 5D21A 5LW9A 4FPEA 1V6JA 5C3SA 5I0UA 1MQTB 4DY5A 2CV6A 5BNPA 1SHWB 4GA9A 4J1WA 5FZ3A 3P1IA 3M3CA 4V2VA 2ZPXA 2AGSA 2VCAA 3MHZA 1XU1A 5FY9A 2IXIA 3WW4A 1GP5A 2XWBB 4LBJA 4OHZA 2X09A 2N7GA 3PIJA 4I3GA 3VD9A 1W6PA 2DWRA 2C6SA 3H7JA 3HN3A 5F5IA 3RZJA 3VBHB 2JE8A 4XOGA 5FZ0A 3WP5A 4HOOA 2PHXA 2WL1A 2Z42A 3ON7A 4FFHA 4FQ4A 3TNPB 2RS11 4ES9A 4G4FA 1IS4A 5IAXA 4LEJA 2EXKA 4E27A 2I45A 4GJZA 2X10A 1YQ5A 1DYKA 3E5QA 3VBOC 4A42A 2X5IB 5FP8A 1ODMA 1DGRN 4MADA 4CUCA 4M0NA 5JCTA 2RJ2A 4IL7A 3OCPA 4Z92B 1E57A 1J3RA 5CNAA 4AYUA 4AFBA 2R062 3D3AA 1EAH1 1ZZCA 3RWKX 3VD3A 1ND2B 2DCJA 4QPIB 5AVAA 3VZJA 4PIXA 4Y5SA 5FZIA 1AX0A 3PU8A 4CEWB 3KHBA 1KD7A 1C5IA 1EV12 1NOVA 1U5ZA 2D6OX 1BEV2 2GH8A 3MI8A 3ZSEA 1H2LA 4HXCA 5FUIA 4TYSA 2PLV1 4EE2A 3VHPA 5BNOB 4XW3A 3BI3A 1X8MA 4N7UA 1AXZA 3HIFA 3T4VA 4KH9A 1APNA 1CVNA 1GWLA 2WBKA 2VZVA 4CCMA 1UZYA 2R073 4TXWA 3I3DA 1F35A 2XQXA 5KR7A 3TN93 2RR12 4XQWA 2HWB2 5GLWA 4KWJA 3HD8B 5GLZA 3SISA 4QDQA 3RPQA 3ZN5A 4LBOA 4OLLA 3S5AA 3J8F3 2GDFA 3N9PA 2WZPP 5FWJA 5KHJA 3N7JA 4RGKA 4QKNA 2LTNA 4P9JA 4RA0A 5CFCA 2P3KA 4K8FA 3BPZA 3GM8A 2KM2A 3CU7A 4L2NA 5F32A 2DF7A 3HWJA 1NKGA 3V0BB 1BZWA 4NIGA 4KL1A 1OSGA 1WMEA 2VBBA 2JEMA 1REEA 2P6HA 4JHZA 3ZKUA 2P37A 3POEA 5F9TA 5JOZA 2B7YA 1PZ9A 4PI2A 1XU2A 2JDAA 3BKZA 4X6QB 3NSTA 1V9U3 3ILFA 3OBZA 4IV1B 4L8QA 1N1TA 2ZGSA 3ZYJB 4LMFA 2V09A 4CE8A 3WSOA 1ZZ9A 5BPXA 2WN3A 3KCCA 1R081 4CCEA 2EF6A 1ULEA 2J1RA 4N7IA 1H9WA 3E6CC 2QQUA 1XE7A 2D7FA 4FAGA 2A73B 3TEZA 4LITA 4MG2A 3FZ3A 1YEWA 1LOEA 2LUWA 4QPWA 1VBE2 2HWF3 1XSQA 4RN5A 3JB4C 5KHGA 1NY72 2ZX4A 3WVJA 1TMF3 1G9BA 3BYWA 4KI5M 1ULCA 3U14A 1NUKA 1VBB3 2RM22 1W6NB 1AR72 1VMJA 1W6QA 2WFF3 1CAUB 5E6HA 2GNTA 3M3QA 1HQLA 5K0UB 2BOIA 3SMHA 4CCCA 2VXJA 2R49A 5FOJB 2ES3A 5I0SA 1FATA 5EPAA 4NAMA 3CBNA 5BNQA 1H8VA 2JB4A 3J7NA 1WD4A 1IGOA 2JG9B 1O3RA 1KFXL 4AGRA 4NO4A 1QJU1 1PX4A 3OTFA 2ZX1A 5GLVA 5EP9A 1N1SA 2E33A 4S2GA 2ETEA 3M3IA 1YWKA 3VBUB 1OUSA 1MZ5A 4JGYB 5EXOA 4N43C 5AC93 2FCUA 3I59A 4W8JA 1SDWA 3VBSA 1QJY2 1I1EA 2VPVA 3UK9A 4RR3B 1OXCA 4PDWB 3T1LA 5KXEA 3ZXGA 3MIBA 2FDKA 1EPWA 2WFPA 2A3YA 1ZA7A 5JSOA 4BU2A 1UYZA 2WQ8A 1OQEA 4GH4C 5L7OC 1AHSA 3KVAA 3I2OA 3FWEA 4LHKA 3IKWA 3K2OA 4YW4A 2VAUA 1MS5A 2VCCA 3VDBA 3ATGA 1CONA 2DVDA 3JUUA 5FREA 4LHSA 2ZKNA 1RTVA 1UIJA 1RHI3 5B4XA 4CP9B 2IFWA 1EUUA 4GB31 1NQJA 4LO4B 1JODA 3G6JB 1WUVA 4GD4A 1HX6A 2JX9A 2R061 3A0NA 1W3VA 3B02A 5KWRA 5I0TA 4AZZA 5C8WA 3POFA 4QT6A 4Q1RA 4YG0A 3NAPC 4A6OA 1ND3B 4IUGA 1EV11 3Q8AA 1BEV1 4NROA 2SBAA 1UKGA 2ZGPA 3JBG2 3VKNA 4CXWA 4TTGA 3UYJA 3VBRA 5CB7A 4AI3A 3MBWA 3CNAA 2O14A 1YHFA 4Y4YA 3ZDVA 1FMD3 3WCSA 2EXIA 5FZ7A 1R1A2 4YW7A 3EXUA 4B8EA 3ZIWA 3BTYA 4U2AA 1I9RA 4PLMA 4YM1A 2RR11 2JWPA 2HWB1 4Q0UA 2A5ZA 3BOPA 3HNMA 3MEPA 3UKVA 1PO12 1QH6A 2MNGA 4XJ8A 2H6BA 2YU2A 3VDCA 1FOD2 1GOFA 4LK7A 4XXPA 5T5OA 1VJ2A 2ZHLA 5C5TA 1H9PA 2JG8C 4OHYA 2VOXA 4RS5A 3I2IA 5IWFA 3OG2A 2QQJA 2VUJA 5I0RA 1OUXA 2A75A 3J7HA 1JW6A 4LOSA 1LTEA 2DTWA 3OEAA 2D6LX 1HLCA 1J1LA 3V0AA 5H9SA 1G8WA 1NCQC 2WNVB 3NNGA 2I74A 3HBKA 4NHKA 5GLUA 5LK5A 3H8OA 3WDUA 5D8AC 4DXZA 3UJOA 3ZMOA 1QEXA 1W90A 1CZVA 2XGXA 2D3SA 4B1MA 1NLSA 2AEZA 3I2GA 4LO8A 4Q4V2 4XPVA 2EIBA 2YYOA 5GM0A 3OYWB 5IVJA 5FY8A 5LASA 2ARCA 4HK8A 1GQGA 3LWCA 1W8NA 3A21A 4ARXA 1N3QA 1UF2C 2IFRA 3RI8A 2QCSB 2WO2A 1WGPA 2RS32 1VBE1 3UGFA 4YZ2A 1NZIA 3ELNA 3WW1A 1Y4WA 1GP4A 5FZGA 1EPZA 2CGPA 5GZEA 4B7EA 1AVBA 1QHDA 4NN0A 5ABJA 2RM21 3EMRA 3K51A 4BH9A 1AR71 2L9LA 1VRH2 1X9TA 2QFEA 3N7KA 3ST7A 2DDUA 3W5MA 1O3SA 3EQEA 4FOQA 2FDJA 2Q30A 5DZEA 4XYXA 2QUOA 5IK5A 1F5JA 5GZCA 2ZGTA 3AM2A 1YQCA 3H42B 5C4WB 2VY0A 1N1YA 1WD3A 5KXDA 5FBZA 2RS13 2OS2A 3KV9A 1TQ5A 1C8M1 1KGYA 1VBD3 1X33A 1NCRC 3IB3A 5A3MA 4Z82A 3S5QA 3MGUA 5J98B 4Z1VA 4Z8BA 4L99A 5HV4A 1D2SA 3T2PA 3BIEA 1BBT3 3RJRA 3I3EA 3CEWA 2HJIA 2D6KA 3LB9A 4JDNA 2RG4A 3O0XA 2ZXQA 4MYEA 1QJY1 1EAH3 5AVPA 4ZXEA 4DO0A 5ACA2 1MQTC 3I3QA 2BZDA 3J7MA 4EJRA 3RZLA 1LHNA 1POV1 1W0OA 4LKFA 5L9RA 1ENXA 4XUTA 2J1EA 2CYFA 2FDFA 4XFHA 3WNXA 1PMJX 1PO23 3AX4A 1DP0A 2Y33A 2XVLA 4XMAA 4IW3A 4RQPB 5LA2A 3VKFC 4BK4A 1K5MA 5FOBB 2IVIB 4CUGA 1Q8OA 1W0PA 4YPJA 2PHLA 1WMFA 2JB8A 2WAOA 3C7FA 3R0RA 5BNPB 4Y26A 3WUCA 2RDQA 3Q9OA 1YCIA 4DNYA 2D5HA 1DQ5A 4U36A 1NE4A 5FZ9A 3ZYRA 4PF1A 1UY4A 3THDA 4D6QA 1W6PB 2W1SA 3QCWA 2A71A 2XHNA 4JDOA 1ASJ2 4W50A 3LSEA 2XMLA 4ES8A 1RVF2 2PAEA 5C6CA 5T5LA 1ND2C 4CP0A 3JBG1 1UXXX 3D8CA 4ORFA 2ZMLA 4QPIC 4IGPA 3QOPA 3MDPA 5C5UA 5IK7A 1DQ1A 5FY4A 1X7NA 1XRUA 1WBFA 1OPOA 1YYNA 1R1A1 1V00A 2ZGRA 1VR3A 4H14A 4P9YA 1PNGA 3ACGA 4WM8C 5LB6A 3ITQA 5LATA 1PO11 1KS5A 4KG8A 4C91A 3NL1A 3H3ZA 5I8TA 2QZ2A 4ASKA 3OSDA 1R083 1ZRCA 1FOD1 3HT1A 4MGZE 2G4IA 4NHYA 2FMDA 4LIUA 4LHNA 4QX3A 1JYNA 2V5DA 3I2KA 5EYXA 4LOTA 2LW8A 4RGGA 3X29B 1ENSA 1GFF2 1IG0A 1RUJ2 3OGJA 1EP0A 1UMIA 5IK4A 1U5YA 3WHTA 1BJQA 4B29A 1L7LA 4WM7A 4CDUC 5LA1A 4Q4V1 3LSDA 1YQ2A 1O7FA 4K21A 4NMIA 1H4GA 1V0AA 4W6XA 4D7SA 3QLQA 2BNOA 1GNYA 3LE0A 1C4RA 4CU8A 4RFRB 4PCRA 3D0JA 1OHFA 3AZXA 4M4RA 4UOJA 4PLOA 4IV1C 1W2NA 1F15A 1FT9A 1GR3A 1RL3A 1W9TA 3CZUA 5CFCB 5IHRA 1QJU3 4CEYA 3GCWA 3GZTB 1K3IA 1PK6A 3A7QA 1QOTA 2RS31 1RC6A 2WA3A 2WQ4A 4COVA 1O4TA 3LA7A 2LS6A 2G9FA 1RJ8A 3UL2A 5JSRA 2W08A 2LRPA 4C0BA 1RUG2 1VRH1 5FMDA 3U4XA 4O7XA 5APAA 3NJVA 2BEOA 1O4ZA 3OOXA 2WZR3 5CEHA 2XR4A 1RYYA 2WO1A 4BM8A 1E5RA 1RUD2 3WR0A 2VW1A 4UW5A 1DDLA 3AJYA 4PQ9A 3ORJA 2WFF2 3W59A 4BQYA 1QH7A 1G9AA 1W9SA 4IEWA 4HN0A 4Y5TA 1JYVA 4IE7A 5FKCA 4UW4A 4IEYA 5LA0A 3CMGA 3ZVXA 4C1WA 3WP6A 2A7AA 5EV7A 2UY8A 2JG9C 3AP5A 3SLIA 4DINB 4IQPA 3OGVA 3VDAA 5T50A 2R063 1NT0A 3QD6A 1JS9A 1W6QB 4HK9A 4XQ4A 5ACA1 2BRTA 4IE0A 4JGYC 4JQTA 4NPRA 3RZMA 5AC92 1FNYA 1EV13 3K46A 4RGAA 1BEV3 1LOBA 4DY3A 2VMCA 4RR3C 3VKMA 5A3TA 5CA6A 1ZBA2 4URTA 4QKDA 2QQNA 4A6SA 2YC4A 4AEMA 3PTRB 2Y6HA 5F3CA 3H9AA 3GBWA 2PELA 2JDYA 1XPWA 4WBBA 2CGNA 1QXJA 1W0NA 4QXCA 2VE1A 2RR13 2HWB3 2P3JA 5ERLA 2A3XA 4XETA 3EYPA 1W9FA 2IXKA 4XTMA 4YG3A 3SITA 3I59B 4LHLA 3VBSB 4EWAA 1EUTA 1K5JA 1RHI2 3N9MA 2Z79A 2ET1A 4IEOA 3ZM8A 4CVUA 1ASJ1 4NWWA 5FIXA 2GSYA 1MS3A 5FYSA 1RVF1 1PX3A 4Y1UA 4N53A 2Q1ZB 1AXKA 5CKMA 1GWKA 2B9VA 1W28A 5F6LB 4FTSA 1SCSA 1ND3C 2XLAA 1W9WA 4HETA 4B4QA 3B69A 5C9AA 2VTXJ 5L19A 4PF5A 1OH3A 4XILA 1Z78A 1GNHA 1O6UA 2FBEA 4OVEA 1XYOA 1DQ2A 4CA9A 4CDWC 2QDNA 3POBA 3VZMA 1RUOA 1MACA 3CIHA 4JV4A 5FZ4A 1X8EA 2ZEWA 5CVRA 4YGDA 1VE0A 1PGL2 1TVGA 2E53A 3AFKA 1JOPA 2ZA9A 3SH4A 3VV1A 3W9AA 3AMHA 1IPJA 1VBE3 3J8F1 4BB3A 1RUJ1 1ULGA 2D5FA 4JCKA 3VBRB 3VHRA 5CAZA 3M3OA 1G6NA 2RM23 2BBVA 1AR73 2A6ZA 2A70A 2Y6JA 4MHUA 4Q0VA 5IFTA 3FBMA 3O0VA 1CZTA 1VP6A 2D6PA 2H0VA 3OB8A 5JDBA 4XF4A 4Q8LA 2A6VA 2WNVC 4CCOA 4BMEA 5KXCA 1WLCA 2J42A 4AR2A 3I2HA 4KBBA 4QKFA 5DUXA 2VD7A 4LPLA 1UOBA 2Q8CA 3MLLA 5CIRA 3HPNA 3PDQA 1WZXA 1DBNA 4QX2A 5IAVA 2YFUA 1WCUA 2ZX3A 4RS5B 3VL9A 2W95A 1W39A 2WT0A 2VGDA 1H6XA 4B4RA 4CP2A 3WDWA 3V0AB 1RUG1 1MPXA 5LCWL 1VLNA 3WDVA 2UWCA 4COWA 3CO2A 4EQVA 3OEBA 1C1LA 3EB7A 4MX3A 1TMF1 1UCXA 1RUD1 3H1YA 3UJQA 4DPNA 1SPPA 1ZRRA 1POV3 4MGYE 4MOAA 1DGWA 3LPFA 3MPPG 2WFF1 3ZYPA 4FSJA 4H55A 4EN8B 2VMEA 2ZHMA 1I5ZA 1LU2A 2Z4FA 3U10A 2BGOA 3GJBA 1YXWA 3AMQA 2BNMA 3F95A 3NV2A 5DAQA 2XL7A 5A7NA 1SACA 2XOMA 4QMAA 3WQBA 5C4WC 5CG9A 3U37A 2FZ2A 1MS4A 1OKOA 5F3EA 4QQLA 1RIRA 2YBKA 3DL3A 3KF3A 1VBD2 2I07B 2ZACA 4G9SB 4JZRA 3HT2A 2EALA 3RJ2X 5ABJB 5BXXA 2Y0IA 1UXZA 2G9ZA 3B9CA 1BBT2 2GAUA 5F6KA 1LHUA 4BQ2A 4H3WA 5AC91 1LULA 2P1BA 4AQTA 2PHRA 2GC2A 2VW2A 5FXWA 4BMBA 3JBG3 1LESA 4QHOA 1ZBA1 4JHTA 3I4IA 3PUAA 1SEFA 3W58A 1CESA 1PNFA 1PHMA 2XUEA 3PVOA 3ZX7A 3NJYA 3FFZA 4CU9A 4CYDA 2PQQA 1LGBA 5FK8A 4YNIA 1Y43B 4XXAA 1S0EA 2GNDA 3O1OA 1IS3A 2K0GA 2CDOA 3HNBM 3AL6A 5FZDA 2PFWA 1PO13 4Q5OA 4RQPC 1UYPA 2DCYA 2PTMA 3U78A 5F37A 1BVP1 4RD7A 1ZBE2 1RHI1 2FCTA 4H2AA 3FUOA 3IM0A 4NPMA 5JXJA 2YC2A 4XJZA 5BNPC 3PJYA 1RINA 4EV0A 4R9BA 5CZKA 3KHCA 1UIKA 2ATFA 3VZOA 1UW8A 2VVDA 2HWC2 4Y1YA 5DAXA 4UF0A 1DGLA 4OHXA 4PIZA 5A7PA 5G04L 1SBEA 5F3IA 5A3UA 1OF3A 2TEPA 4AOCA 1WA6X 1RXFA 1K5MB 2PHUA 3T3YA 4AHYA 3ES4A 5ANNA 1SDDB 2QQWA 4Q4V3 5FQ0A 5FMBA 3KV6A 5C8CA 4AQ6A 1ALYA 1FYUA 3WUDA 2YY1A 3KV4A 4HSLA 2PHFA 1SBDA 5HV0A 2VUAA 5EYYA 4XEZA 4ZZ8A 4ZY9A 1PGL1 4ASMB 1LB2A 3E6DA 3P5BA 4IEUA 4CDXC 1RUF2 3LA3A 4OI0A 3S6PA 3V56A 4EROA 4C0HA 3SEEA 3PUHA 2CAVA 2DUQA 1J3PA 2XJQA 2VVEA 3K3OA 4AQSA 3BU7A 1JHNA 1OLQA 2Y34A 4LK6A 4LLFA 1YFWA 3CHXA 3W5NA 2P17A 4JKMA 4ONUA 2Z2SB 3IAPA 4Q26A 1LEDA 4Q2FA 5GZDA 3TNQA 1RUC2 3IMMA 2YFZA 5H9QA 1TME3 1S0DA 1D7PM 4R8HA 1LOCA 2VZTA 3RZZA 3ZFGA 3KCXA 4I01A 3LGRA 1F4HA 2R1DA 3LDKA 4Q1PA 5FZCA 5FR3A 1CAXB 5F39A 3OGSA 2D3RA 3KS7A 5CFCC 2VQAA 1Q56A 3M8LA 3MIGA 3NNJA 4JRLA 5FYMA 4XF0A 3MV01 5EJ1B 3UGHA 4KGGA 2QQOA 4BXSV 3ETPA 2RDRA 5ACA3 2JDZA 1GNZA 5HXVA 3RYKA 5BV6A 4P5YA 4YVSA 1S0IA 3LOIA 4I0BA 2OXBA 4UWDA 4AFDA 2QQPA 4UW6A 4Y1VA 1JYIA 4ZU5A 4E4HA 5FP4A 2WZR2 1F4AA 1FX5A 1V70A 3UKNA 2VQ0A 1NQDA 4CCDA 4A3ZA 4P9WA 4CEYB 1WBLA 1QJEA 2ILMA 1PK6B 3N7LA 2B42B 3PVBB 5H9RA 3OY8A 5FUPA 1OVSA 2JJ6A 5FWEA 3T0AA 5A32A 3DPRA 3AMMA 3ES1A 1GZWA 1VBD1 4I02A 1SFYA 4LO6B 5LY2A 1V6NA 2CSGA 1AR82 2DFCA 1E5IA 5A3OA 2BWAA 3HN1A 2ZOEB 4OUMA 1KDKA 3TBDA 3DEMA 1BBT1 4Q27A 4CTEA 1ASJ3 2CL2A 3RFRA 5DUWA 1RVF3 4LIVA 4DXRA 2VM9A 4AVAA 2ZJCA 5JR2A 2B46X 4NAOA 3PMSA 2BQPA 1GWMA 5F3GA 2QQLA 2ARBA 1H4HA 3LEIA 5JWPA 1UZWA 3WDTA 2NQYA 5DG1A 1MR5A 3ACIA 1A6CA 4V1PA 1R1ZA 1J58A 3VDDA 1PO21 1X82A 1S55A 1DQ6A 4AWDA 1KFUL 1ZBE1 3IIIA 1HJGA 1BVVA 2KD7A 5JAXA 4Q0QA 2DVBA 3VL8A 4JGZA 2VOKA 5AFBA 3IN9A 4BHPA 5FMCA 3O1VA 1AXYA 1FNZA 4PQQA 1W2UA 1WA4A 5HXMA 3VBSC 1S0BA 3MFAA 2HWC1 2VOVA 4Y24A 1RUJ3 4XHXA 4MGTA 2QNKA 5JI9A 1OF4A 3D82A 2QQMA 5A7WA 2G19A 3OUIA 5FYYA 3DXUA 1NXMA 2V73A 4O65A 1IS6A 4CUBA 1NA1C 1QKQA 4OHWA 1XC6A 4Z2WA 3O1TA 5IVEA 4S2DA 4IE4A 1O8PA 2BYVE 3IPVA 2W5FA 5J96B 5FYHA 2OW4A 3AB0A 5DAPA 5FV3A 2Y38A 2ZHKA 4IV3C 3T09A 1HB4A 3MW2A 1R092 3USUA 4JRAA 2A6YA 4GIQA 4N53B 3WW2A 1YJLA 2D97A 5C70A 2GNMA 1XJAA 4ZS2A 1Z0HA 4IEXA 1RUG3 2E7AA 2B39A 3MIHA 4C8DA 1XSRA 1PGW2 2WJSA 4YZ3A 1KXGA 2F6BA 3ZLIA 4BLJA 4AI8A 3T0BA 3VBRC 2NM1A 2XJPA 3THTA 1RUD3 2HLEA 1RUC1 1U5IA 2P3YA 5JOWA 4KU7A 4QM9A 1TE1B 1ZVFA 3JB8A 4TZDA 5FYIA 4OI1A 3WINE 3W21A 2YC0A 3ZXAC 3WHUA 3WF2A 1SLTA 1REDA 2EICA 3BIWE 3GCXA 1UZZA 1YQ8A 1GLHA 3SHRA 4CCLA 1VIWB 4UW3A 3VBOA 3SH3A 5C7GA 5CFDC 5T3NA 3DCQA 3OBAA 1BCXA 1JUIA 4Q0PA 1RUNA 1OC1A 1OQDA 4XBQA 4QB2A 4YZ5A 2JDNA 2Q8EA 2VH9A 4P14A 4K20A 3ZDSA 4N9HA 5F2WA 1W8TA 4LBQD 3RQ0A 3KWVA 5FZFA 2VC9A 1ENQA 1UZ0A 1ZBA3 3E1F1 3AZVA 4XDQA 3APBA 3FLRA 2WZR1 2XJRA 3AVSA 3AMNA 4ZPIA 2AYHA 1T2XA 3LFMA 2P6CA 2OT7A 2DUPA 4LBQA 5FCCA 1N1VA 3AC0A 5FP3A 3I3BA 2JICA 2Y60A 3POSA 4Q4X2 1F5FA 3A0KA 5BUVA 2VOTA 4BXFA 1POV0 3Q8FA 4PLNA 4GZ9A 5IT6A 2ET7A 3B7MA 3GZUC 4DS0A 1AR81 2OPKA 4UFLA 4FBFA 2ZX0A 3ZPOA 2R6QA 2PAKA 3K4ZA 1UY2A 1I6XA 1B35A 2BP6A 5ABJC 2X53S 4BYYA 2WUHA 1ZA4A 4MXWA 4RSUA 1LRHA 4DRRA 3WQ0A 1L3JA 3S30A 1YUDA 4NOTA 2OQ6A 1HB1A 2C4XA 4V2WA 1IG3A 5HI0A 3I49A 1PVC2 4C1XA 1KS4A 3B93A 3WLUA 4QB6A 3ZIXA 2O8QA 2RJLA 3TEYA 2A1XA 3AL5A 2VTXA 2D3PA 1VALA 4UFIA 1CAWA 1YJKA 2ERFA 3M4FA 2QKDA 1CD3G 4Q0SA 5B4NA 3KQ4B 1G9FA 5FO7B 1G9DA 3OPZA 3C7OA 3FLPA 1SQ4A 1IOAA 1RUE2 4HVRA 4LO7A 4UFMA 4WVWA 2VNOA 4J25A 1Y9GA 1I3HA 2R7EB 1S1AA 2ZGUA 2VOWA 5CKNA 4AGVA 1Z7S3 4I0WB 2ZMNA 2AUYA 3WEZA 3RS6A 2J7MA 1SLBA 3HJRA 1GYKA 2EA7A 2PHDA 4HFSA 4YVWA 4O9EA 2B45X 4FOYA 4MHRA 4YGCA 4R4ZA 1F31A 1LCLA 4EZ4A 4AVCA 3TEWA 1QY4A 4UFKA 1QF3A 3KGZA 3NNLA 1K5MC 2BUKA 4FI9A 1YRZA 4AEDA 2FDIA 4BQ4A 4XFBA 1AYN2 3ZN4A 2Q8OA 1STMA 1W8WA 2J1TA 4ATFA 2FZ1A 1R091 2BU9A 1UU4A 2LALA 4UF0B 3ASIA 3FJSA 1YIFA 3M70A 2VULA 3BVCA 3B94A 5FK7A 3Q8BA 1DCSA 2VZOA 5BYNA 5H9PA 3U4SA 1PGW1 2E6VA 1Q8SA 3OD0A 1XYPA 1PGSA 1HQNA 4XDOA 5FQ0B 1NY71 5ISLA 5C8CB 4QPGC 3GZAA 3A4UA 4M3CF 3N36A 4D7YA 1JYCA 2DCKA 3H8RA 3KB5A 3LD8A 3HBZA 4OUSA 4WV8A 4W6WA 1LGCA 1JBCA 4AI9A 1DGRA 3CDZB 5T5PA 2XJTA 5FUNA 5KBFA 5FMOL 1GQHA 1TME2 1XE8A 3ROUA 1UPIA 2ZAAA 5DG2A 1OLME 5FDBA 3RRDA 3I3MA 3M2MA 1PM4A 2W68A 2DYCA 4AHXA 2VQTA 4DUVA 2WZEA 3N35A 4M0HA 4BISA 4K1ZA 2HYKA 4QKBA 3USSA 3NO8A 4MXVA 4YM2A 4CRQA 4A7ZA 1VB4A 3ETQA 4XFFA 1UOFA 3POIA 4J6GA 4ARYA 1GOHA 3L2HA 2AR6A 3ZFGB 3TB0A 2Z5WA 4W6YA 2W52A 4OZXA 3SC7X 3T30A 2VMHA 4JX0A 4Q4X1 4EWEA 2Q0AA 3UKTA 5JXIA 2RDSA 3RYRA 2BOJA 1YFYA 3DKWA 3VBHC 4ISRA 4CEYC 1S2KA 1NLRA 1ZBE3 4YW1A 4NIHA 1UYXA 4CCNA 1PK6C 4Y22B 5C71A 5K9YA 3VZKA 3RI9A 2GP3A 2WR9A 1W2OA 1DYPA 1W9YA 1WCSA 1ZZ6A 2W47A 2WNEA 3PNAA 3WG1A 3ZO0B 2EIGA 3ZYHA 4BPZA 5IVYA 1YFXA 2X5IC 2HWC3 2JG8A 3I2FA 4GWNA 3BCWA 2YBPA 4YM0A 4YVSB 4BIFA 1MS1A 1YLLA 2SLIA 1YC61 1OLMA 4FOVA 4IESA 4XDPA 1OMIA 4FCAA 2P2KA 3DECA 4FPCA 5J3UA 3LEMA 4CZSA 4PBPA 5A3LA 2RVAA 4NRQA 5FFOC 3O1UA 1PVC1 1G86A 1NCQA 2UYBA 5FZ6A 3BB6A 5KHIA 2KR2A 3D6EA 3WP4A 4E2GA 1DZTA 5D8AA 5A6QA 5I8YA 4GJYA 4CEWC 5A32B 2JECA 3DPRB 3MZHA 4AEJA 1GZWB 3K48A 4ZS3A 1MZEA 5FZOA 2YB7A 3VKOA 4A7YA 2QE3A 4JVAA 2XDVA 4D6RA 1LENA 2RE9A 1HDKA 1MS0A 3RDIA 5BNOC 3N9NA 1RUE1 1K12A 2E7QA 2O1QA 5A6ZA 1PIV2 1RUF3 3S7EA 3ZMNA 2DU0A 2ARAA 4MSVA 3GJAA 3VGIA 3E6BA 5FTTC 3FLTA 5T52A 3ZSMA 3WQ7A 2FD8A 1CJDA 1RITA 2BBAA 3DYPA 2QQIA 5DAWA 1D2QA 1OURA 4JC1A 2ZGOA 1SZBA 1TG7A 1ENRA 3VDDB 2R0HA 3ZSJA 4GALA 1WW5A 1RUC3 3NNFA 3NV3A 5LBFA 4YRDA 1WLWA 1XNCA 3NV1A 1W6OA 1HQWA 1AYN1 3N9QA 4Q4W2 4JGZB 5HCFA 4D94A 3R4SA 1QJX2 4XJUA 2VG9A 3KQRA 1NAEA 2ZAHA 5DZGA 1BXHA 4XBLA 1AUYA 3LF7A 1HXS2 4QX8A 5A7WB 1RMU2 1JMUB 3WNMA 4GKYA 5GJ6A 5A1FA 4GMP1 2W2IA 4N53C 1X9PA 4XUQA 5LBEA 4AFCA 4NUBA 4Y4RA 4L92A 3U75A 1DZQA 3CJXA 2OPWA 1MQTA 3PUQA 3IPVB 3LDRA 4ATEA 4BOWA 1H1AA 1QOOA 2W3JA 1NX9A 3O7OA 4P9GA 1ZRDA 1JOJA 4Q4Y3 5EJ3A 4OI4A 2E32A 2YU1A 5FPLA 5FLIA 3AKRA 4WVVA 2A6XA 4NRPA 1FPN2 3USUB 5K0UC 5A3WA 1TME1 3OPWA 1OOPA 2C5DA 2R32A 1O5UA 1AR83 2VBDA 1UY1A 3POJA 2PYTA 5LZ6A 5FPZA 1H1IA 1JU4A 5E8AA 2OVUA 3GF6A 4XUPA 3ZXKA 3WT3A 2B5HA 1IKPA 2UURA 3VBUC 3ZFFA 4Y1ZA 1S2EA 1FV2A 5IVVA 2WN2A 1RUI3 2WT1A 1YQ6A 1KRIA 4XE9A 3SQOA 1AR92 3B9IA 3RVHA 4GQ7A 4QPIA 4WZCA 1Q5OA 2W92A 2OX0A 2W1QA 3G7DA 4PDWC 1SCRA 5M0TA 3LOBA 4PIYA 2ZEZA 2C24A 2Y0OA 4L11A 5BNNA 2ZEXA 3ZKYA 4A2UA 2Y6LA 4WM8A 3WNNA 3HMYA 4OMCA 3NKTA 3AP7A 3VN4A 2KXLA 1O5LA 3VUOA 1JZ2A 3I2JA 2ADEA 4N9IA 1PZ8A 3NV4A 4CDQA 3ZXLA 2WS92 3FUQA 4FPKA 4QPYA 1IZ3A 4YSFA 2HYXA 1QWRA 1HW5A 1VBC2 4ISQA 1XQNA 3ZOIA 4J1XA 3LAGA 4LQRA 2WWSA 4LBQB 2XQRA 4IERA 4L0PA 1AYM2 2JDKA 4DIQA 1FXZA 5J48A 5JIUA 5J37A 3DXTA 3E5UA 1XNBA 1HB2A 4N90A 5JSPA 2VW0A 4XJWA 4CDUA 1UX7A 4UFJA 2CDPA 3ALQA 4LKDA 5IFPA 4OZOA 3QBQA 3JQXA 3N7MA 4YGEA 2VZ1A 5L9VA 4LUMA 4BK5A 3MO4A 2ZX2A 5JPNB 4INDA 1PIV1 5IK8A 1B35B 1R093 4D7TA 2D43A 2JIJA 1OA4A 4BQ5A 3IMNA 3ZFEA 3JZVA 4MXWB 5KC5A 5LBCA 1JZ6A 3LA2A 1TNRA 3MLKA 1US3A 5HPOA 4M4PA 4K6BA 5LRSA 2VO5A 4HG6B 4AFAA 5F5AA 4AXOA 4FPYA 2RDNA 3FC0A 1GQPA 1Z7S2 1RUH2 2W39A 1A3KA 3MIFA 5FAXA 2X05A 3RG0A 1Q8QA 2WC2A 1UY0A 1QMJA 1UZVA 1JTZX 5FZMA 1J1TA 2R1BA 3AXEA 1S0CA 3D4KA 4DOUA 4AQ2A 2WO3A 1B09A 3LEGA 4P9XA 5EIYB 1NG0A 4UYBA 5L9BA 1KJLA 3HOBA 1Q8PA 4Q4W1 4ET7A 2PMWB 1AL22 2ZGMA 3VD5A 3NKGA 5FMOS 3WDXA 4FTEA 2NP0A 1QJX1 3TEXA 5LEKA 4LTAA 4FP2A 4K9SA 3HNYM 4D8MA 5IVFA 2P34A 1HXS1 1N3PA 1QNWA 1W8HA 1RMU1 3N3HA 2JG9A 4FPHA 5JXHA 2E63A 2E31A 1US2A 1ZYBA 4YVWB 4I2OA 1LEMA 1C57A 4QX1A 5F5CA 1W05A 4LORA 4CUAA 4XFGA 1LU1A 5EZWA 1SLIA 5L73A 5LA9A 1ZNPA 3OGGA 3U11A 4LJHA 4JGYA 5IJRA 2FDGA 1UL9A 3JQWA 1K42A 4L9BA 4AEDB 2ZGLA 1LOFC 1V6MA 4IDZA 1HIXA 1H2KA 1XXNA 3B3QE 3ZSLA 4BZ4A 3EHKA 5C8CC 4OQ8A 1ULFA 1QQP2 2ORXA 3AK0A 3I2DA 4ZHNA 4YARA 4E9KA 1CR7A 2V4VA 1HN0A 2YGMA 4PI0A 4Q4X3 2G1MA 4COZA 3KMHA 2VCMA 1MZFA 4Y33A 1YI7A 2D6NA 5A1LA 2W1WA 1Y3TA 1VBA3 2HKXA 3IDBB 3ZXJA 4HL0A 2C0ZA 2P4EA 3U07A 2C1FA 3T4HB 4CCKA 4QQ2A 2DVGA 1XB9A 2XJSA 4MGKE 2WNUA 2ZGQA 1RJ7A 2ZTNA 4B3NA 2WT2A 4AVVA 4DRVA 5FYBA 2QDRA 3I54A 1AR91 3HQRA 5FY1A 5BY5A 2UYAA 4M3CA 4P08A 1PVC3 1Y7BA 2E51A 3HR9A 4FT8A 2D98A 4JKKA 4P02B 4XFCA 1JYTA 2WRAA 4TLGA 3KT1A 1WWYA 2IXCA 3WX5A 3OGRA 3H8XA 1HRI2 3MFCA 4JDMA 4E4ZA 3JD73 4R4XA 4SLIA 3P3PA 4ZONA 4NHMA 2GN3A 1RUE3 4AAPA 5LEJA 1C8NA 4CDWA 1CPNA 1UD1A 2DVAA 2WS91 3H1MA 4W4ZA 4B4PA 4X6RB 1BMV2 2A6WA 4I09A 1VBC1 1ULPA 1PVXA 3O14A 3Q8CA 5FZEA 4QGMA 4AVTA 3VD7A 2B4KA 3QH6A 2XKPA 3VKLA 4XIKA 1P8JA 1AYM1 2OUHA 1AZDA 2A3WA 1AJOA 1OLRA 4GWMA 4KU8A 4AFMA 2IUWA 2F17A 2XJUA 3T1MA 3UETA 2XBO2 1TNFA 5FP9A 2HWD2 5C33A 2NMNA 1COV2 3L9JT 2VVFA 1GICA 2VU9A 2O8OA 5FY0A 1AYN3 3BTXA 3GYDA 1X36A 3DPRC 3CQOA 1LNSA 3KM5A 1LOGA 2UU8A 3R4DB 2AC1A 2HWE3 3WZ1A 2FDHA 3O1PA 2VUCA 2XKOA 1WCDJ 2Y6FA 4QHZA 2DFBA 4QX0A 3HQXA 4XBNA 5CG8A 1OFNA 2FQPA 3UV9A 3AVRA 3HAGA 4GMP3 2EXHA 1NCQB 3PURA 2X29A 1M4WA 1Z7S1 1YI9A 1RUH1 4FPGA 2XB6C 3VBFA 3O1MA 5D8AB 3BPSA 4K40A 1DIWA 4BQWA 3C3VA 4RHV3 1D0HA 2K9ZA 5FYVA 1CPMA 2Q1FA 5FZOB 3MYXA 1BYHA 2BWCA 1GU3A 4QXBA 2TUNA 3VDDC 1E5SA 3SKJE 5LWBA 4HANA 3O12A 5FP7A 5JVVA 1U5XA 5EFUA 5CBLA 1ZRFA 4CSWA 3K75B 2BERA 5JZGA 5JMOA 2GH2A 2XG3A 2BDRA 5A6XA 3L2YA 3H3UA 3H1WA 4LXLA 3E5XA 1JYWA 2Q1MA 4JGZC 4GULA 2RS53 3WG4A 4EN7B 2AACA 3BGAA 5FPBA 1U12A 3AJZA 1S2BA 1UU6A 5HCAA 3POYA 3NJXA 2QQVA 4YLZA 1MVQA 1DYOA 4QGNA 1HKDA 4M01A 4TWTA 4BWOA 1UOJA 4QDRA 4JAAA 1OT5A 3U1XA 3NRUA 2RJKA 1QDOA 1MVEA 1WMDA 4XAEA 4Y20A 5GLTA 2XONA 4LBNA 4WM7B 4DQAA 1NXD1 1UOGA 2RV9A 3BALA 3K77A 4PHZA 2CWSA 1W6OB 2GC1A 3KVBA 2BVBA 2V4AA 4ZZ5A 3CKHA 1W2TA 1QQP1 2WABA 5K4LA 3RZKA 4UI9L 2OYZA 3ZPYA 2F4LA 3RMYA 1M06G 3OJBA 4Q4Y2 3PLQA 1OA2A 4HONA 4EN6B 3GXUA 3KLSA 3BOWA 3WDYA 2VMFA 3SCHA 2MEV2 4CXYA 2NZ9A 1MZ6A 2EIEA 4CU7A 1QIQA 4QQPA 2PAMA 3J26N 4ASLA 1ZRIA 2YDEA 1EYBA 3RSJA 3BTAA 4XZUG 3N4MA 5JMCA 4XF1A 5G05L 3FHQA 1DLCA 4QWNA 1W04A 1LODA 2PHTA 2DTYA 1HV0A 1KITA 1SBFA 2GZWA 1RUI2 2TNFA 4EYUA 4DXSA 4NJ4A 1OOPB 2YXSA 4Y1XA 5DDJ2 1VB2A 1HRI1 2AEYA 2OKXA 1W2AX 2GC3A 3VD4A 1DLLA 2JD4A 1PZ7A 1AR63 2WWUA 3AYCA 3ZYFA 4AHWA 4F8AA 5A6YA 1JZ8A 1ZZ8A 2EAKA 3LCPA 1W99A 2IXLA 2OZ6A 1PIV3 1WCQA 3V65A 1IKQA 1HV1A 4GB32 4AAXA 1BMV1 4A41A 1IS5A 1W8OA 2XLFA 4WZFA 4A45A 3ZFFB 4BQ3A 3RZHA 4CDXA 2E9QA 1GANA 2HEVF 3ABZA 2ZS6B 1C28A 3N9LA 4LBMA 4MVTA 2VTFA 3LIHA 1WMXA 3CJIA 2K2SA 4NHLA 5I93A 5EHDA 1H8TA 4DMIA 4HVOA 3P6BA 3FBYA 2XBO1 3H3LA 4QX5A 2HWD1 3C7EA 2DCZA 5BNNB 1MEC2 4WM8B 2D6MA 1GKBA 4K8RB 1COV1 5LRRA 3ZYGA 5D1IA 4DEVA 2R042 4Q4W3 4NRMA 1LOAA 3DYOA 4CDQB 1JI6A 1QJX3 4H7MA 2ZHNA 3T2QA 4BE3A 1G7YA 4S2HA 1UNBA 4E2SA 4LULA 5IVBA 1TZOA 1GZTA 1LHOA 1UMZA 2ZMKA 3E97A 4R9CA 1HXS3 4XF9A 2VNGA 1RMU3 3WOGA 4YGBA 1RUF1 1B35C 3AZZA 3T08A 1A78A 2BNNA 4X8NA 1LHVA 2QJVA 5CISA 1JYXA 5IATA 3MW3A 5C9AB 1PMIA 1ZZ7A 3FHAA 4CDUB 2ZGNA 1VRBA 3PVEA 4QU1A 4RL7A 1J83A 2R16A 2O0OA 1H0BA 2Y26A 3KD4A 5FZKA 5SV5A 1BQPA 3EO6A 1FPN3 1JHJA 4IEZA 1QNYA 4ITCA 3ZFEB 3ZYIB 4KWLA 2BPA2 1YNAA 3R4UA 2VZQA 2Y64A 2H0BA 2Y8KA 2RMU2 4AHZA 2VBPA 1FV3A 4KMQA 3ME2A 4RS5C 4XACA 3I7DA 1UN1A 1ZZBA 3NWKA 4YVWC 3CL1A 4RYDA 1H2MA 1GBGA 1GP6A 4KBZA 1GOGA 2QQKA 1AR93 5E16A 3W20A 3IWZA 1VPHA 3KCYA 3D0SA 4FO9A 4LLOA 4WVZA 4XURA 2J1VA 5ANQA 4AEDC 5A7OA 3QACA 1E5HA 2Y6KA 2EVXA 3GBFA 2VMIA 4Q4Y1 3WW3A 3AYDA 4F3JA 5SV8A 2GMPA 2XXZA 2HBTA 1VAVA 2MEV1 4E4DX 1C8M2 1UYYA 2EXJA 2WS93 4LKSA 1VBA2 2VQUA 3UT0A 4JQRA 2VECA 3VZNA 1RB8G 5FPAA 2YPDA 1Q8VA 4LUKA 1VBC3 2ARXA 5F2SA 4YW2A 2VNRA 4OULA 4R52A 1XYNA 2ZZQA 3M3EA 4E4SA 1SPPB 1AYM3 3WP3A 4AL9A 4UAPA 3AP6A 1ZM1A 4XAAA 4HLTA 4FAHA 4HT1T 5FPXA 1RUI1 2VR4A 3IDAA 3MICA 1WW6A 4FXGB 1QDCA 3DF0A 4IXLA 4LA3A 4LE4A 5DDJ1 5GKAC 3M7AA 3MW4A 5K8SA 4I0AA 1BHGA 1NA1A 1UY3A 3R05A 5FLJA 2R0FA 3IT8A 4YG6A 1K45A 1HRV2 4KNCA 5J7MA 2VMGA 2WKKA 2WNUB 5FYUA 3VB9A 2RHPA 3JD72 4IV3A 1W8UA 4L97A 1Q43A 5JUVA 1OA3A 5DN2A 1F8VA 2BGCA 3P3NA 3J4UH 4M3CB 4ZKTB 1N47A 2ID4A 1RUH3 3WNLA 2C26A 5A33A 5K7PA 4D0QA 4XVHA 3ECQA 4FOWA 4YWAA 5L36A 3ENRA 1MEC1 4B7KA 4CPBD 4G3YC 2BW8A 4UT5A 3K3NA 3KT4A 1O8SA 2WYSA 4QX7A 5A70A 2R041 1WW4A 2C9AA 3ACFA 1AL23 1BK1A 2IXHA 2Z69A 4BA6A 4CDWB 2IWGB 1DFQA 1SMVA 5JI7A 1KEXA 4CPBA 3J7LA 4YFZA 3FE5A 1D4M2 5TSWA 2DBNA 2W91A 1RGSA 4FPFA 4BJ0A 2GALA 1LJ7A 1QXRA 2CTVA 1CAVA 2JIGA 5CFDA 5FXVA 5EJZB 2HWE2 4COYA 1R64A 3K4AA 2AZ5A 4OUEA 5LK7B 2W94A 3GGLA 3OBRA 5FZ8A 3ZXDA 3H7YA 2JENA 2VUDA 3WF0A 2BFUL 4N43A 4NIAA 1SG3A 4GXLA 3LZZA 3AYAA 2R30A 5B2GB 4QM8A 2WZ8A 2GMEA 1IHMA 1QQP3 1LGNA 4O61A 5E1RA 4RHV2 4GMP0 5DMYA 4AI2A 3J9SA 4KWUA 4OYUA 3O1RA 2JDUA 4LT5A 4ZU7A 1DF0A 4XUOA 5JIAA 3OUJA 3ZYBA 3NVCA 4DZGA 4HPKA 4FVVA 4GH4A 4NVPA 5L7OA 2DV9A 1CWPA 5KC6A 3AFGA 2ORZA 3LEKA 2GP5A 4XTPA 2YUEA 2QVSB 1AL0G 4HKLA 4P9IA 3VZLA 2RMU1 3B00A 1NE6A 1WKYA 4XCBA 2WSUA 3PJQA 2E7TA 2B8MA 2HH9A 3VBFB 1A34A 3MLJA 2J1AA 2RS52 1YIPA 4LNVA 4WVMA 5KHKA 3EBRA 4DEQA 4NR1A 3VHOA 5E88A 2HBUA 5FLHA 1UU5A 2OZJA 3LQCA 4LO5B 1BLZA 5CU1A 4D6SA 4XCAA 4AK3A 3NAPA 1RXGA 5E89A 4XZPA 1H2NA 4WM7C 1D4VB 2EAAA 2NMOA 4IGOA 5D2AA 4EWDA 1NZCA 4UBHA 3V64A 2H6CA 5JZGB 1JZ3A 3WNKA 1HRI3 3POWA 3DKQA 3RMXA 1CGPA 1QXPA 4Z07A 4YW3A 2C9KA 1V6IA 1CX1A 4IEPA 4IEVA 4Z2AA 5A3PA 2DCTA 4Q29A 3PU3A 4HMZA 3C8XA 4EN0A 4K7JA 4QQOA 1VBA1 5FZBA 1DZRA 1ST8A 3MPBA 3IIAA 4Y20B 4GKXA 1NYWA 1W8FA 5FPVA 2XH6A 5C3OA 1IQDC 3MV11 4PBOA 3AZWA 5F8PA 3S0MA 2WAAA 4YFWA 2VZ3A 2IZWA 2YMZA 5IYYA 2XBO3 1ODNA 2HWD3 5KXBA 2B9UA 3T2OA 1COV3 5A7QA 1AX1A 2CU5A 2PLV3 3EJKA 3ILRA 2BGPA 3OY8B 4EN9B 4W65A 5CADA 1W03A 1HRV1 1OOPC 1QJFA 3MF9A 4P9LA 5FZ1A 1POQA 1UWWA 1OBNA 1F9KA 3DUIA 3JD71 1AR62 3A23A 4XHBA 2WIIB 4XFAA 5FY5A 5FRAA 5DZFA 3HQUA 4XJ9A 3TRSB 4XJAA 2CAUA 4AI0A 1EY2A 2ENRA 1BKZA 3THCA 1VMFA 2JDHA 2BTVC 3O0WA 4DUWA 5A3NA 3OD4A 2D93A 1W8ZA 2JDPA 1W6MA 3ZFFC 4YM3A 3TAYA 2JXAA 5DXDA 4F7ZA 1O3QA 3O1SA 3HVDA 2EIDA 4DFSA 4DUXA 1AF9A 1W3XA 4JKLA 3SKVA 4HSJA 3A22A 3PMEA 2P3IA 2AENA 2AREA 2P5BA 4QPGA 2V5YA 1O4YA 3GHNA 5BNNC 3ZR6A 4MGIE 3SNMA 3WNPA 1V6OA 4I3PA 1S0JA 2JE7A 3NNMA 1JZ7A 1D4M1 5I91A 4LKEA 3AKTA 2IVJA 3GNEA 4CDXB 4URAA 3IDEA 1I5PA 3S7IA 4CDQC 3FFQA 3NQHA 2R072 4YZ1A 3Q8EA 4IE5A 4C90A 2HWE1 1CQ9A 3RGBA 4AI1A 1NLQA 2WO7A 2W46A 3CJIB 3TN92 1NCRA 5FO9B 2WLQA 3BUCA 4FTBA 1H8TB 4B1LA 4AVBA 4QGLA 3J8F2 1CAXA 2K46A 4K3UA 2FHRA 4CP1A 1VAKA 1OD3A 4K1YA 1YO8A 4XC9A 3WXPA 5C3QA 2Q4SA 5FXZA 3ZN6A 2OIIA 4A3XA 5FPUA 3GDBA 4H7LA 4TSVA 3SXWA 3BU0A 5JPMB 5C9AC 5F7UA 2VZUA 4RHV1 2ADDA 4QDSA 3BN6A 3CZJA 4IEQA 3WCRA 4BCUA 1KDMA 3IAQA 4HKOA 2ZABA 2ZEYA 3INAA 2DUOA 4N8MA 1V6KA 1JN2P 3AMPA 2WDBA 1GV9A 1OFSA 2MEV3 2YBSA 3RYPA 1V9U2 4YZ4A 3ZFEC 1REFA 2CGOA 4QB1A 3UESA 1OPMA 2LROA 3VBHA 1WLDA 3I97A 3IZOA 2WQZC 2RS51 3CF6E 3F2ZA 1AX2A 4P00B 1S4CA 2J1SA 2WINB 1JZ5A 1XNDA 3KF5A 2GN7A 4UXAA 3RWNA 5DUVA 2X5IA 1SFPA 2YV8A 4QU2A 1XNTA 3AXDA 5HBAA 1OQ1A 2HWF2 2UWBA 3U0ZA 4HKWA 4S2FA 1FI2A 2YPJA 4MLOA 2WSVA 1TMF2 2D40A 2AH2A 1JZ4A 1JOBA 2GNBA 4DXTA 1VBB2 5FYCA 1ND2A 5DDJ3 2D44A 2MHFA 1UKRA 1H1MA 4XQDA 2V72A 3AKQA 4CEWA 5GZGA 2PA7A 5J1XA 2J1UA 4GWIA 4LR4A 5CKQA 3VBOB 5IVCA 4FFGA 3ACHA 2VJXA 4FP3A 4GB33 5HCBA 1UMHA 5BNOA 4UFHA 2XPJA 1VAMA 4XMIA 4MUVA 1IQAA 1DQ0A 2HEWF 2OA2A 5C3RA 5LBBA 1C3HA 2YHJA 5FJHA 2TBVA 3H50A 3MIEA 1Y9QA 1WW7A 2J22A 1CIWA 3NMBA 2JE9A 3MF6A 3TWIA 4XIOA 3FMGA 4QXKA 4UBGA 3SCGA 3BTZA 4AGGA 1MEC3 3AYEA 1OH4A 4IETA 1D0GA 1XNKA 4NHXA 4KWKA 5I0DA 2CHHA 4NWVA 3NJZA 3WY6A 2R043 2XJVA 1H6YA 4HVQA 3V0BA 2QBXA 1UX6A 2OUJA 2UWAA 2HEYF 2ZBJA 1YFUA 2BV4A 4FFFA 4COUA 1ZREA 2OQ7A 2Y6GA 3GALA 5FYZA 4AE2A 1ULDA 1AR61 3DGTA 2FMYA 4NIIA 1CX4A 5LY1A 2NPIA 2F4PA 4MGSA 5DABA 4E8DA 4FQZA 2WNUC 3B01A 4OCTA 3TOJA 4IV1A 2YROA 3OUHA 3WF3A 2FCVA 4A7KA 1O59A 2BFUS 5EWSA 1CIYA 5I8SA 5IW0A 3WV6A 2X8KA 3WD5A 5FBJA 3T0DA 3B5LB 1QGLA 4OFGA 1NA1B 4IE6A 4MV2A 1CZSA 2XLGA 4YW6A 3OPTA 2VXRA 1CAWB 3ZSKA 4FFIA 4IV3B 1L7QA 1FAYA 4FPLA 1W6NA 4JTOA 1AJKA 1N3OA 1WCKA 1J3QA 3PVNA 1CAUA 1FMD2 4FXKB 3WF1A 2GC0A 5K0UA 3KV5A 1A8DA 2R071 1HJFA 3LFIA 2VZRA 4BLIA 4LBLA 1T6BX 4AEKA 5IUQA 3TN91 2RMU3 3BODA 5DAVA 5FZHA 3WNOA 1J84A 1JH5A 3PUSA 2CNAA 3AP4A 3MUZ1 5A33B 1A8MA 4BQXA 1W06A 3I8TA 4OI2A 4M3CE 2PXJA 3CLPA 4P5HA 5FZLA 1XBFA 3SH5A 3VBUA 1DHKB 4GAZA 2E26A 3PHMA 4MGQA 5EQUA 1IPKA 1IPSA 3MIDA 5F5QA
chains in the Genus database with same CATH topology
3GZEA 3KT7A 4NHKA 5A3UA 4XCAA 2HBTA 2A1XA 3KT1A 3DKQA 4ZONA 4NHMA 2G19A 3OUIA 4J25A 5LASA 5HV0A 4NMIA 4XABA 3PL0A 4XAAA 4MHUA 5EPAA 5DAPA 4MHRA 3EMRA 3GJAA 5L9VA 3NNLA 2Y34A 5LBBA 2JIJA 5DAWA 5IAVA 5EP9A 5LBCA 4NHLA 3NNFA 5LBFA 2FCUA 3MGUA 2RDNA 3BVCA 4NHXA 4BQYA 5HV4A 5IAXA 3HQUA 4Y5TA 2RG4A 3W21A 3NNJA 3KT4A 5L9BA 4BQWA 2RDRA 5DAQA 3GJBA 5LBEA 5L9RA 4UWDA 3OUHA 4Y5SA 5IATA 2OPWA 2FCVA 2Y33A 4IW3A 2JIGA 4BQXA 4JZRA 3NNMA 5LA9A 2RDQA 4ZPIA 5ERLA 2G1MA 4XC9A 3OUJA 5DAVA 2V4AA 4XACA 4NAOA 5C5UA 2RDSA 4Q5OA 4KBZA 4XCBA 5C5TA 2FCTA 5LB6A 3W20A 3ITQA 5LATA 5M0TA 5EQUA 2HBUA 3OBZA 5DAXA 4NHYA 3HQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZE A;  3KT7 A;  4NHK A;  5A3U A;  4XCA A;  2HBT A;  2A1X A;  3KT1 A;  3DKQ A;  4ZON A;  4NHM A;  2G19 A;  3OUI A;  4J25 A;  5LAS A;  5HV0 A;  4NMI A;  4XAB A;  3PL0 A;  4XAA A;  4MHU A;  5EPA A;  5DAP A;  4MHR A;  3EMR A;  3GJA A;  5L9V A;  3NNL A;  2Y34 A;  5LBB A;  2JIJ A;  5DAW A;  5IAV A;  5EP9 A;  5LBC A;  4NHL A;  3NNF A;  5LBF A;  2FCU A;  3MGU A;  2RDN A;  3BVC A;  4NHX A;  4BQY A;  5HV4 A;  5IAX A;  3HQU A;  4Y5T A;  2RG4 A;  3W21 A;  3NNJ A;  3KT4 A;  5L9B A;  4BQW A;  2RDR A;  5DAQ A;  3GJB A;  5LBE A;  5L9R A;  4UWD A;  3OUH A;  4Y5S A;  5IAT A;  2OPW A;  2FCV A;  2Y33 A;  4IW3 A;  2JIG A;  4BQX A;  4JZR A;  3NNM A;  5LA9 A;  2RDQ A;  4ZPI A;  5ERL A;  2G1M A;  4XC9 A;  3OUJ A;  5DAV A;  2V4A A;  4XAC A;  4NAO A;  5C5U A;  2RDS A;  4Q5O A;  4KBZ A;  4XCB A;  5C5T A;  2FCT A;  5LB6 A;  3W20 A;  3ITQ A;  5LAT A;  5M0T A;  5EQU A;  2HBU A;  3OBZ A;  5DAX A;  4NHY A;  3HQR A; 
#chains in the Genus database with same CATH topology
 3GZE A;  5FY7 A;  1MS8 A;  4FPO B;  4RR3 A;  4AW7 A;  4PDW A;  3WG2 A;  1L7R A;  4E2Q A;  5J09 A;  4LA2 A;  3N9O A;  4TN7 A;  5HCH A;  1CAV B;  2VL4 A;  1C8M 3;  3DV8 A;  1FPN 1;  1V9U 1;  5CFD B;  1CJP A;  1DQ4 A;  2ZZJ A;  2IXJ A;  4Q8K A;  4KGQ A;  1S0F A;  5KHH A;  1LHW A;  2QZ3 A;  4GWJ A;  4R9D A;  2VZS A;  1J59 A;  1DU3 D;  1UAI A;  4JTN A;  4PT6 A;  4N43 B;  4ZXK A;  3VBF C;  1QJY 3;  3PTY A;  3POG A;  4IGQ A;  5C3P A;  4XAB A;  4CP9 A;  3FHI B;  1Y9M A;  2HWF 1;  1XNA A;  4NE9 A;  3S57 A;  4NPL A;  2XUM A;  2Q5T A;  2XHK A;  1BK0 A;  1URX A;  1OVP A;  1S0G A;  4OQ9 A;  1DG6 A;  4OMD A;  3UGG A;  3AKS A;  2I2S A;  1VBB 1;  3LDB A;  1XE0 A;  4HPK B;  5AFE A;  4GH4 B;  5L7O B;  2DVF A;  3IDC B;  1PMH X;  3LPG A;  1SLA A;  1ND3 A;  2GMM A;  4F83 A;  5JZG C;  3ZXE A;  1XOY A;  5T5J A;  1O3T A;  1HRV 3;  1SLC A;  4A4A A;  2ZGK A;  1H30 A;  1T6G C;  3ZFG C;  3FX3 A;  5FZA A;  4HN1 A;  4WVM B;  1O91 A;  1LEC A;  2RS1 2;  4D69 A;  5FYT A;  2JD9 A;  2JDM A;  3D5O A;  1GUI A;  1OI6 A;  1QOS A;  5A1A A;  1V6L A;  1WLT A;  2XVG A;  1UPS A;  4Y5Z 0;  2W87 A;  1Q3E A;  2WA4 A;  3ZR5 A;  4CXX A;  1ZX5 A;  3R6S A;  4Y3O A;  3RZG A;  1VMH A;  2JKX A;  3FL7 A;  3NAP B;  3C7H A;  2WNO A;  4AVS A;  5DPN A;  1G9C A;  2KA3 A;  4R9A A;  4LBK A;  1PM7 A;  1EAH 2;  1ULO A;  1KJR A;  1KQR A;  1MS9 A;  3WF4 A;  4YVS C;  1C5H A;  3VLB B;  1HN1 A;  4X8P A;  3C7G A;  5JOY A;  2CY6 A;  4YYO A;  4LE3 A;  3WQ1 A;  4QAW A;  1R1A 3;  2VNV A;  1F2N A;  4XF3 A;  2WNV A;  3O5S A;  1ACC A;  2PLV 2;  1PO2 2;  3K4D A;  4CCJ A;  1D4M 3;  2MPF A;  2IC1 A;  3DN7 A;  3H8U A;  4YW5 A;  4MO3 M;  5FKB A;  3QH7 A;  1FOD 3;  3VHN A;  3THP A;  5A7S A;  1U0A A;  3PUI A;  5GAL A;  2NN8 A;  4FPJ A;  2JG8 B;  3ILN A;  5JR7 B;  2XWJ B;  4D3W A;  1QJZ A;  5F1R A;  1SFN A;  3TYJ A;  3OYW A;  3GBG A;  3HEI A;  5A80 A;  2QTW B;  2UY9 A;  3ACL A;  3PIG A;  1GMM A;  4XUN A;  4DB5 A;  4RFT 0;  3C2U A;  3WG3 A;  1UO9 A;  2XL9 A;  3GHM A;  4O9G A;  2W9X A;  1GSL A;  1SLL A;  2G9G A;  2GU9 A;  5CYY A;  3LIG A;  2XVK A;  2DUR A;  2BJS A;  3SEP A;  4XFI A;  1X50 A;  1GZC A;  4SBV A;  3UNP A;  3FN9 A;  1LOF A;  2NLR A;  3JCI A;  3KGL A;  3OF1 A;  4QQH A;  1GZ9 A;  4QD2 A;  1TEI A;  3AP9 A;  5DQ0 A;  4QXH A;  1FMD 1;  1AL2 1;  5T55 A;  1LR5 A;  5GZF A;  1CN1 A;  3SCF A;  1HB3 A;  1LKN A;  2BVV A;  3NW4 A;  3OBT A;  1W6M B;  5J36 A;  4OHV A;  5C4W A;  2YGL A;  5T54 A;  3RNS A;  2RS3 3;  2W0X A;  1R08 2;  2PN5 A;  4PJY A;  4BIO A;  2ZCW A;  5JLV A;  1JU3 A;  3KSC A;  3M1H A;  4KG0 A;  1OKQ A;  3CJI C;  5JXG A;  3IBM A;  2PHW A;  3KT7 A;  4HBN A;  4HZF A;  4QPG B;  2JKB A;  1JUH A;  1ONA A;  1H8T C;  1C1F A;  1VRH 3;  2YZ4 A;  2WLP A;  4M00 A;  4TLF A;  5DUU A;  3ZXF A;  2WWJ A;  4AG4 A;  4CU6 A;  4E8C A;  2VZP A;  2ZKL A;  3JU9 A;  2VCB A;  4KQ7 A;  5FO8 B;  5JOX A;  3KZ4 C;  3MUY 1;  2YG0 A;  3LKJ A;  1OD5 A;  4MET A;  2CWM A;  2DBI A;  2PQS A;  4MZU A;  2DU1 A;  2Q8D A;  4BDV B;  4I30 A;  5FXX A;  4NID A;  4EZH A;  2W1U A;  4ZU4 A;  1NCR B;  2WYF A;  3PL0 A;  1UQX A;  4MH0 E;  3URF A;  4BQ1 A;  1QU0 A;  3H0O A;  5FJK A;  1LAJ A;  3AKP A;  2LM3 A;  4A44 A;  3DYM A;  2NYY A;  3AZY A;  1DGW X;  3JXS A;  4QHB A;  4RQP A;  3T2T A;  4AF9 A;  1QJU 2;  1JXN A;  3ZN6 B;  4Y22 A;  2VMD A;  5D21 A;  5LW9 A;  4FPE A;  1V6J A;  5C3S A;  5I0U A;  1MQT B;  4DY5 A;  2CV6 A;  5BNP A;  1SHW B;  4GA9 A;  4J1W A;  5FZ3 A;  3P1I A;  3M3C A;  4V2V A;  2ZPX A;  2AGS A;  2VCA A;  3MHZ A;  1XU1 A;  5FY9 A;  2IXI A;  3WW4 A;  1GP5 A;  2XWB B;  4LBJ A;  4OHZ A;  2X09 A;  2N7G A;  3PIJ A;  4I3G A;  3VD9 A;  1W6P A;  2DWR A;  2C6S A;  3H7J A;  3HN3 A;  5F5I A;  3RZJ A;  3VBH B;  2JE8 A;  4XOG A;  5FZ0 A;  3WP5 A;  4HOO A;  2PHX A;  2WL1 A;  2Z42 A;  3ON7 A;  4FFH A;  4FQ4 A;  3TNP B;  2RS1 1;  4ES9 A;  4G4F A;  1IS4 A;  5IAX A;  4LEJ A;  2EXK A;  4E27 A;  2I45 A;  4GJZ A;  2X10 A;  1YQ5 A;  1DYK A;  3E5Q A;  3VBO C;  4A42 A;  2X5I B;  5FP8 A;  1ODM A;  1DGR N;  4MAD A;  4CUC A;  4M0N A;  5JCT A;  2RJ2 A;  4IL7 A;  3OCP A;  4Z92 B;  1E57 A;  1J3R A;  5CNA A;  4AYU A;  4AFB A;  2R06 2;  3D3A A;  1EAH 1;  1ZZC A;  3RWK X;  3VD3 A;  1ND2 B;  2DCJ A;  4QPI B;  5AVA A;  3VZJ A;  4PIX A;  4Y5S A;  5FZI A;  1AX0 A;  3PU8 A;  4CEW B;  3KHB A;  1KD7 A;  1C5I A;  1EV1 2;  1NOV A;  1U5Z A;  2D6O X;  1BEV 2;  2GH8 A;  3MI8 A;  3ZSE A;  1H2L A;  4HXC A;  5FUI A;  4TYS A;  2PLV 1;  4EE2 A;  3VHP A;  5BNO B;  4XW3 A;  3BI3 A;  1X8M A;  4N7U A;  1AXZ A;  3HIF A;  3T4V A;  4KH9 A;  1APN A;  1CVN A;  1GWL A;  2WBK A;  2VZV A;  4CCM A;  1UZY A;  2R07 3;  4TXW A;  3I3D A;  1F35 A;  2XQX A;  5KR7 A;  3TN9 3;  2RR1 2;  4XQW A;  2HWB 2;  5GLW A;  4KWJ A;  3HD8 B;  5GLZ A;  3SIS A;  4QDQ A;  3RPQ A;  3ZN5 A;  4LBO A;  4OLL A;  3S5A A;  3J8F 3;  2GDF A;  3N9P A;  2WZP P;  5FWJ A;  5KHJ A;  3N7J A;  4RGK A;  4QKN A;  2LTN A;  4P9J A;  4RA0 A;  5CFC A;  2P3K A;  4K8F A;  3BPZ A;  3GM8 A;  2KM2 A;  3CU7 A;  4L2N A;  5F32 A;  2DF7 A;  3HWJ A;  1NKG A;  3V0B B;  1BZW A;  4NIG A;  4KL1 A;  1OSG A;  1WME A;  2VBB A;  2JEM A;  1REE A;  2P6H A;  4JHZ A;  3ZKU A;  2P37 A;  3POE A;  5F9T A;  5JOZ A;  2B7Y A;  1PZ9 A;  4PI2 A;  1XU2 A;  2JDA A;  3BKZ A;  4X6Q B;  3NST A;  1V9U 3;  3ILF A;  3OBZ A;  4IV1 B;  4L8Q A;  1N1T A;  2ZGS A;  3ZYJ B;  4LMF A;  2V09 A;  4CE8 A;  3WSO A;  1ZZ9 A;  5BPX A;  2WN3 A;  3KCC A;  1R08 1;  4CCE A;  2EF6 A;  1ULE A;  2J1R A;  4N7I A;  1H9W A;  3E6C C;  2QQU A;  1XE7 A;  2D7F A;  4FAG A;  2A73 B;  3TEZ A;  4LIT A;  4MG2 A;  3FZ3 A;  1YEW A;  1LOE A;  2LUW A;  4QPW A;  1VBE 2;  2HWF 3;  1XSQ A;  4RN5 A;  3JB4 C;  5KHG A;  1NY7 2;  2ZX4 A;  3WVJ A;  1TMF 3;  1G9B A;  3BYW A;  4KI5 M;  1ULC A;  3U14 A;  1NUK A;  1VBB 3;  2RM2 2;  1W6N B;  1AR7 2;  1VMJ A;  1W6Q A;  2WFF 3;  1CAU B;  5E6H A;  2GNT A;  3M3Q A;  1HQL A;  5K0U B;  2BOI A;  3SMH A;  4CCC A;  2VXJ A;  2R49 A;  5FOJ B;  2ES3 A;  5I0S A;  1FAT A;  5EPA A;  4NAM A;  3CBN A;  5BNQ A;  1H8V A;  2JB4 A;  3J7N A;  1WD4 A;  1IGO A;  2JG9 B;  1O3R A;  1KFX L;  4AGR A;  4NO4 A;  1QJU 1;  1PX4 A;  3OTF A;  2ZX1 A;  5GLV A;  5EP9 A;  1N1S A;  2E33 A;  4S2G A;  2ETE A;  3M3I A;  1YWK A;  3VBU B;  1OUS A;  1MZ5 A;  4JGY B;  5EXO A;  4N43 C;  5AC9 3;  2FCU A;  3I59 A;  4W8J A;  1SDW A;  3VBS A;  1QJY 2;  1I1E A;  2VPV A;  3UK9 A;  4RR3 B;  1OXC A;  4PDW B;  3T1L A;  5KXE A;  3ZXG A;  3MIB A;  2FDK A;  1EPW A;  2WFP A;  2A3Y A;  1ZA7 A;  5JSO A;  4BU2 A;  1UYZ A;  2WQ8 A;  1OQE A;  4GH4 C;  5L7O C;  1AHS A;  3KVA A;  3I2O A;  3FWE A;  4LHK A;  3IKW A;  3K2O A;  4YW4 A;  2VAU A;  1MS5 A;  2VCC A;  3VDB A;  3ATG A;  1CON A;  2DVD A;  3JUU A;  5FRE A;  4LHS A;  2ZKN A;  1RTV A;  1UIJ A;  1RHI 3;  5B4X A;  4CP9 B;  2IFW A;  1EUU A;  4GB3 1;  1NQJ A;  4LO4 B;  1JOD A;  3G6J B;  1WUV A;  4GD4 A;  1HX6 A;  2JX9 A;  2R06 1;  3A0N A;  1W3V A;  3B02 A;  5KWR A;  5I0T A;  4AZZ A;  5C8W A;  3POF A;  4QT6 A;  4Q1R A;  4YG0 A;  3NAP C;  4A6O A;  1ND3 B;  4IUG A;  1EV1 1;  3Q8A A;  1BEV 1;  4NRO A;  2SBA A;  1UKG A;  2ZGP A;  3JBG 2;  3VKN A;  4CXW A;  4TTG A;  3UYJ A;  3VBR A;  5CB7 A;  4AI3 A;  3MBW A;  3CNA A;  2O14 A;  1YHF A;  4Y4Y A;  3ZDV A;  1FMD 3;  3WCS A;  2EXI A;  5FZ7 A;  1R1A 2;  4YW7 A;  3EXU A;  4B8E A;  3ZIW A;  3BTY A;  4U2A A;  1I9R A;  4PLM A;  4YM1 A;  2RR1 1;  2JWP A;  2HWB 1;  4Q0U A;  2A5Z A;  3BOP A;  3HNM A;  3MEP A;  3UKV A;  1PO1 2;  1QH6 A;  2MNG A;  4XJ8 A;  2H6B A;  2YU2 A;  3VDC A;  1FOD 2;  1GOF A;  4LK7 A;  4XXP A;  5T5O A;  1VJ2 A;  2ZHL A;  5C5T A;  1H9P A;  2JG8 C;  4OHY A;  2VOX A;  4RS5 A;  3I2I A;  5IWF A;  3OG2 A;  2QQJ A;  2VUJ A;  5I0R A;  1OUX A;  2A75 A;  3J7H A;  1JW6 A;  4LOS A;  1LTE A;  2DTW A;  3OEA A;  2D6L X;  1HLC A;  1J1L A;  3V0A A;  5H9S A;  1G8W A;  1NCQ C;  2WNV B;  3NNG A;  2I74 A;  3HBK A;  4NHK A;  5GLU A;  5LK5 A;  3H8O A;  3WDU A;  5D8A C;  4DXZ A;  3UJO A;  3ZMO A;  1QEX A;  1W90 A;  1CZV A;  2XGX A;  2D3S A;  4B1M A;  1NLS A;  2AEZ A;  3I2G A;  4LO8 A;  4Q4V 2;  4XPV A;  2EIB A;  2YYO A;  5GM0 A;  3OYW B;  5IVJ A;  5FY8 A;  5LAS A;  2ARC A;  4HK8 A;  1GQG A;  3LWC A;  1W8N A;  3A21 A;  4ARX A;  1N3Q A;  1UF2 C;  2IFR A;  3RI8 A;  2QCS B;  2WO2 A;  1WGP A;  2RS3 2;  1VBE 1;  3UGF A;  4YZ2 A;  1NZI A;  3ELN A;  3WW1 A;  1Y4W A;  1GP4 A;  5FZG A;  1EPZ A;  2CGP A;  5GZE A;  4B7E A;  1AVB A;  1QHD A;  4NN0 A;  5ABJ A;  2RM2 1;  3EMR A;  3K51 A;  4BH9 A;  1AR7 1;  2L9L A;  1VRH 2;  1X9T A;  2QFE A;  3N7K A;  3ST7 A;  2DDU A;  3W5M A;  1O3S A;  3EQE A;  4FOQ A;  2FDJ A;  2Q30 A;  5DZE A;  4XYX A;  2QUO A;  5IK5 A;  1F5J A;  5GZC A;  2ZGT A;  3AM2 A;  1YQC A;  3H42 B;  5C4W B;  2VY0 A;  1N1Y A;  1WD3 A;  5KXD A;  5FBZ A;  2RS1 3;  2OS2 A;  3KV9 A;  1TQ5 A;  1C8M 1;  1KGY A;  1VBD 3;  1X33 A;  1NCR C;  3IB3 A;  5A3M A;  4Z82 A;  3S5Q A;  3MGU A;  5J98 B;  4Z1V A;  4Z8B A;  4L99 A;  5HV4 A;  1D2S A;  3T2P A;  3BIE A;  1BBT 3;  3RJR A;  3I3E A;  3CEW A;  2HJI A;  2D6K A;  3LB9 A;  4JDN A;  2RG4 A;  3O0X A;  2ZXQ A;  4MYE A;  1QJY 1;  1EAH 3;  5AVP A;  4ZXE A;  4DO0 A;  5ACA 2;  1MQT C;  3I3Q A;  2BZD A;  3J7M A;  4EJR A;  3RZL A;  1LHN A;  1POV 1;  1W0O A;  4LKF A;  5L9R A;  1ENX A;  4XUT A;  2J1E A;  2CYF A;  2FDF A;  4XFH A;  3WNX A;  1PMJ X;  1PO2 3;  3AX4 A;  1DP0 A;  2Y33 A;  2XVL A;  4XMA A;  4IW3 A;  4RQP B;  5LA2 A;  3VKF C;  4BK4 A;  1K5M A;  5FOB B;  2IVI B;  4CUG A;  1Q8O A;  1W0P A;  4YPJ A;  2PHL A;  1WMF A;  2JB8 A;  2WAO A;  3C7F A;  3R0R A;  5BNP B;  4Y26 A;  3WUC A;  2RDQ A;  3Q9O A;  1YCI A;  4DNY A;  2D5H A;  1DQ5 A;  4U36 A;  1NE4 A;  5FZ9 A;  3ZYR A;  4PF1 A;  1UY4 A;  3THD A;  4D6Q A;  1W6P B;  2W1S A;  3QCW A;  2A71 A;  2XHN A;  4JDO A;  1ASJ 2;  4W50 A;  3LSE A;  2XML A;  4ES8 A;  1RVF 2;  2PAE A;  5C6C A;  5T5L A;  1ND2 C;  4CP0 A;  3JBG 1;  1UXX X;  3D8C A;  4ORF A;  2ZML A;  4QPI C;  4IGP A;  3QOP A;  3MDP A;  5C5U A;  5IK7 A;  1DQ1 A;  5FY4 A;  1X7N A;  1XRU A;  1WBF A;  1OPO A;  1YYN A;  1R1A 1;  1V00 A;  2ZGR A;  1VR3 A;  4H14 A;  4P9Y A;  1PNG A;  3ACG A;  4WM8 C;  5LB6 A;  3ITQ A;  5LAT A;  1PO1 1;  1KS5 A;  4KG8 A;  4C91 A;  3NL1 A;  3H3Z A;  5I8T A;  2QZ2 A;  4ASK A;  3OSD A;  1R08 3;  1ZRC A;  1FOD 1;  3HT1 A;  4MGZ E;  2G4I A;  4NHY A;  2FMD A;  4LIU A;  4LHN A;  4QX3 A;  1JYN A;  2V5D A;  3I2K A;  5EYX A;  4LOT A;  2LW8 A;  4RGG A;  3X29 B;  1ENS A;  1GFF 2;  1IG0 A;  1RUJ 2;  3OGJ A;  1EP0 A;  1UMI A;  5IK4 A;  1U5Y A;  3WHT A;  1BJQ A;  4B29 A;  1L7L A;  4WM7 A;  4CDU C;  5LA1 A;  4Q4V 1;  3LSD A;  1YQ2 A;  1O7F A;  4K21 A;  4NMI A;  1H4G A;  1V0A A;  4W6X A;  4D7S A;  3QLQ A;  2BNO A;  1GNY A;  3LE0 A;  1C4R A;  4CU8 A;  4RFR B;  4PCR A;  3D0J A;  1OHF A;  3AZX A;  4M4R A;  4UOJ A;  4PLO A;  4IV1 C;  1W2N A;  1F15 A;  1FT9 A;  1GR3 A;  1RL3 A;  1W9T A;  3CZU A;  5CFC B;  5IHR A;  1QJU 3;  4CEY A;  3GCW A;  3GZT B;  1K3I A;  1PK6 A;  3A7Q A;  1QOT A;  2RS3 1;  1RC6 A;  2WA3 A;  2WQ4 A;  4COV A;  1O4T A;  3LA7 A;  2LS6 A;  2G9F A;  1RJ8 A;  3UL2 A;  5JSR A;  2W08 A;  2LRP A;  4C0B A;  1RUG 2;  1VRH 1;  5FMD A;  3U4X A;  4O7X A;  5APA A;  3NJV A;  2BEO A;  1O4Z A;  3OOX A;  2WZR 3;  5CEH A;  2XR4 A;  1RYY A;  2WO1 A;  4BM8 A;  1E5R A;  1RUD 2;  3WR0 A;  2VW1 A;  4UW5 A;  1DDL A;  3AJY A;  4PQ9 A;  3ORJ A;  2WFF 2;  3W59 A;  4BQY A;  1QH7 A;  1G9A A;  1W9S A;  4IEW A;  4HN0 A;  4Y5T A;  1JYV A;  4IE7 A;  5FKC A;  4UW4 A;  4IEY A;  5LA0 A;  3CMG A;  3ZVX A;  4C1W A;  3WP6 A;  2A7A A;  5EV7 A;  2UY8 A;  2JG9 C;  3AP5 A;  3SLI A;  4DIN B;  4IQP A;  3OGV A;  3VDA A;  5T50 A;  2R06 3;  1NT0 A;  3QD6 A;  1JS9 A;  1W6Q B;  4HK9 A;  4XQ4 A;  5ACA 1;  2BRT A;  4IE0 A;  4JGY C;  4JQT A;  4NPR A;  3RZM A;  5AC9 2;  1FNY A;  1EV1 3;  3K46 A;  4RGA A;  1BEV 3;  1LOB A;  4DY3 A;  2VMC A;  4RR3 C;  3VKM A;  5A3T A;  5CA6 A;  1ZBA 2;  4URT A;  4QKD A;  2QQN A;  4A6S A;  2YC4 A;  4AEM A;  3PTR B;  2Y6H A;  5F3C A;  3H9A A;  3GBW A;  2PEL A;  2JDY A;  1XPW A;  4WBB A;  2CGN A;  1QXJ A;  1W0N A;  4QXC A;  2VE1 A;  2RR1 3;  2HWB 3;  2P3J A;  5ERL A;  2A3X A;  4XET A;  3EYP A;  1W9F A;  2IXK A;  4XTM A;  4YG3 A;  3SIT A;  3I59 B;  4LHL A;  3VBS B;  4EWA A;  1EUT A;  1K5J A;  1RHI 2;  3N9M A;  2Z79 A;  2ET1 A;  4IEO A;  3ZM8 A;  4CVU A;  1ASJ 1;  4NWW A;  5FIX A;  2GSY A;  1MS3 A;  5FYS A;  1RVF 1;  1PX3 A;  4Y1U A;  4N53 A;  2Q1Z B;  1AXK A;  5CKM A;  1GWK A;  2B9V A;  1W28 A;  5F6L B;  4FTS A;  1SCS A;  1ND3 C;  2XLA A;  1W9W A;  4HET A;  4B4Q A;  3B69 A;  5C9A A;  2VTX J;  5L19 A;  4PF5 A;  1OH3 A;  4XIL A;  1Z78 A;  1GNH A;  1O6U A;  2FBE A;  4OVE A;  1XYO A;  1DQ2 A;  4CA9 A;  4CDW C;  2QDN A;  3POB A;  3VZM A;  1RUO A;  1MAC A;  3CIH A;  4JV4 A;  5FZ4 A;  1X8E A;  2ZEW A;  5CVR A;  4YGD A;  1VE0 A;  1PGL 2;  1TVG A;  2E53 A;  3AFK A;  1JOP A;  2ZA9 A;  3SH4 A;  3VV1 A;  3W9A A;  3AMH A;  1IPJ A;  1VBE 3;  3J8F 1;  4BB3 A;  1RUJ 1;  1ULG A;  2D5F A;  4JCK A;  3VBR B;  3VHR A;  5CAZ A;  3M3O A;  1G6N A;  2RM2 3;  2BBV A;  1AR7 3;  2A6Z A;  2A70 A;  2Y6J A;  4MHU A;  4Q0V A;  5IFT A;  3FBM A;  3O0V A;  1CZT A;  1VP6 A;  2D6P A;  2H0V A;  3OB8 A;  5JDB A;  4XF4 A;  4Q8L A;  2A6V A;  2WNV C;  4CCO A;  4BME A;  5KXC A;  1WLC A;  2J42 A;  4AR2 A;  3I2H A;  4KBB A;  4QKF A;  5DUX A;  2VD7 A;  4LPL A;  1UOB A;  2Q8C A;  3MLL A;  5CIR A;  3HPN A;  3PDQ A;  1WZX A;  1DBN A;  4QX2 A;  5IAV A;  2YFU A;  1WCU A;  2ZX3 A;  4RS5 B;  3VL9 A;  2W95 A;  1W39 A;  2WT0 A;  2VGD A;  1H6X A;  4B4R A;  4CP2 A;  3WDW A;  3V0A B;  1RUG 1;  1MPX A;  5LCW L;  1VLN A;  3WDV A;  2UWC A;  4COW A;  3CO2 A;  4EQV A;  3OEB A;  1C1L A;  3EB7 A;  4MX3 A;  1TMF 1;  1UCX A;  1RUD 1;  3H1Y A;  3UJQ A;  4DPN A;  1SPP A;  1ZRR A;  1POV 3;  4MGY E;  4MOA A;  1DGW A;  3LPF A;  3MPP G;  2WFF 1;  3ZYP A;  4FSJ A;  4H55 A;  4EN8 B;  2VME A;  2ZHM A;  1I5Z A;  1LU2 A;  2Z4F A;  3U10 A;  2BGO A;  3GJB A;  1YXW A;  3AMQ A;  2BNM A;  3F95 A;  3NV2 A;  5DAQ A;  2XL7 A;  5A7N A;  1SAC A;  2XOM A;  4QMA A;  3WQB A;  5C4W C;  5CG9 A;  3U37 A;  2FZ2 A;  1MS4 A;  1OKO A;  5F3E A;  4QQL A;  1RIR A;  2YBK A;  3DL3 A;  3KF3 A;  1VBD 2;  2I07 B;  2ZAC A;  4G9S B;  4JZR A;  3HT2 A;  2EAL A;  3RJ2 X;  5ABJ B;  5BXX A;  2Y0I A;  1UXZ A;  2G9Z A;  3B9C A;  1BBT 2;  2GAU A;  5F6K A;  1LHU A;  4BQ2 A;  4H3W A;  5AC9 1;  1LUL A;  2P1B A;  4AQT A;  2PHR A;  2GC2 A;  2VW2 A;  5FXW A;  4BMB A;  3JBG 3;  1LES A;  4QHO A;  1ZBA 1;  4JHT A;  3I4I A;  3PUA A;  1SEF A;  3W58 A;  1CES A;  1PNF A;  1PHM A;  2XUE A;  3PVO A;  3ZX7 A;  3NJY A;  3FFZ A;  4CU9 A;  4CYD A;  2PQQ A;  1LGB A;  5FK8 A;  4YNI A;  1Y43 B;  4XXA A;  1S0E A;  2GND A;  3O1O A;  1IS3 A;  2K0G A;  2CDO A;  3HNB M;  3AL6 A;  5FZD A;  2PFW A;  1PO1 3;  4Q5O A;  4RQP C;  1UYP A;  2DCY A;  2PTM A;  3U78 A;  5F37 A;  1BVP 1;  4RD7 A;  1ZBE 2;  1RHI 1;  2FCT A;  4H2A A;  3FUO A;  3IM0 A;  4NPM A;  5JXJ A;  2YC2 A;  4XJZ A;  5BNP C;  3PJY A;  1RIN A;  4EV0 A;  4R9B A;  5CZK A;  3KHC A;  1UIK A;  2ATF A;  3VZO A;  1UW8 A;  2VVD A;  2HWC 2;  4Y1Y A;  5DAX A;  4UF0 A;  1DGL A;  4OHX A;  4PIZ A;  5A7P A;  5G04 L;  1SBE A;  5F3I A;  5A3U A;  1OF3 A;  2TEP A;  4AOC A;  1WA6 X;  1RXF A;  1K5M B;  2PHU A;  3T3Y A;  4AHY A;  3ES4 A;  5ANN A;  1SDD B;  2QQW A;  4Q4V 3;  5FQ0 A;  5FMB A;  3KV6 A;  5C8C A;  4AQ6 A;  1ALY A;  1FYU A;  3WUD A;  2YY1 A;  3KV4 A;  4HSL A;  2PHF A;  1SBD A;  5HV0 A;  2VUA A;  5EYY A;  4XEZ A;  4ZZ8 A;  4ZY9 A;  1PGL 1;  4ASM B;  1LB2 A;  3E6D A;  3P5B A;  4IEU A;  4CDX C;  1RUF 2;  3LA3 A;  4OI0 A;  3S6P A;  3V56 A;  4ERO A;  4C0H A;  3SEE A;  3PUH A;  2CAV A;  2DUQ A;  1J3P A;  2XJQ A;  2VVE A;  3K3O A;  4AQS A;  3BU7 A;  1JHN A;  1OLQ A;  2Y34 A;  4LK6 A;  4LLF A;  1YFW A;  3CHX A;  3W5N A;  2P17 A;  4JKM A;  4ONU A;  2Z2S B;  3IAP A;  4Q26 A;  1LED A;  4Q2F A;  5GZD A;  3TNQ A;  1RUC 2;  3IMM A;  2YFZ A;  5H9Q A;  1TME 3;  1S0D A;  1D7P M;  4R8H A;  1LOC A;  2VZT A;  3RZZ A;  3ZFG A;  3KCX A;  4I01 A;  3LGR A;  1F4H A;  2R1D A;  3LDK A;  4Q1P A;  5FZC A;  5FR3 A;  1CAX B;  5F39 A;  3OGS A;  2D3R A;  3KS7 A;  5CFC C;  2VQA A;  1Q56 A;  3M8L A;  3MIG A;  3NNJ A;  4JRL A;  5FYM A;  4XF0 A;  3MV0 1;  5EJ1 B;  3UGH A;  4KGG A;  2QQO A;  4BXS V;  3ETP A;  2RDR A;  5ACA 3;  2JDZ A;  1GNZ A;  5HXV A;  3RYK A;  5BV6 A;  4P5Y A;  4YVS A;  1S0I A;  3LOI A;  4I0B A;  2OXB A;  4UWD A;  4AFD A;  2QQP A;  4UW6 A;  4Y1V A;  1JYI A;  4ZU5 A;  4E4H A;  5FP4 A;  2WZR 2;  1F4A A;  1FX5 A;  1V70 A;  3UKN A;  2VQ0 A;  1NQD A;  4CCD A;  4A3Z A;  4P9W A;  4CEY B;  1WBL A;  1QJE A;  2ILM A;  1PK6 B;  3N7L A;  2B42 B;  3PVB B;  5H9R A;  3OY8 A;  5FUP A;  1OVS A;  2JJ6 A;  5FWE A;  3T0A A;  5A32 A;  3DPR A;  3AMM A;  3ES1 A;  1GZW A;  1VBD 1;  4I02 A;  1SFY A;  4LO6 B;  5LY2 A;  1V6N A;  2CSG A;  1AR8 2;  2DFC A;  1E5I A;  5A3O A;  2BWA A;  3HN1 A;  2ZOE B;  4OUM A;  1KDK A;  3TBD A;  3DEM A;  1BBT 1;  4Q27 A;  4CTE A;  1ASJ 3;  2CL2 A;  3RFR A;  5DUW A;  1RVF 3;  4LIV A;  4DXR A;  2VM9 A;  4AVA A;  2ZJC A;  5JR2 A;  2B46 X;  4NAO A;  3PMS A;  2BQP A;  1GWM A;  5F3G A;  2QQL A;  2ARB A;  1H4H A;  3LEI A;  5JWP A;  1UZW A;  3WDT A;  2NQY A;  5DG1 A;  1MR5 A;  3ACI A;  1A6C A;  4V1P A;  1R1Z A;  1J58 A;  3VDD A;  1PO2 1;  1X82 A;  1S55 A;  1DQ6 A;  4AWD A;  1KFU L;  1ZBE 1;  3III A;  1HJG A;  1BVV A;  2KD7 A;  5JAX A;  4Q0Q A;  2DVB A;  3VL8 A;  4JGZ A;  2VOK A;  5AFB A;  3IN9 A;  4BHP A;  5FMC A;  3O1V A;  1AXY A;  1FNZ A;  4PQQ A;  1W2U A;  1WA4 A;  5HXM A;  3VBS C;  1S0B A;  3MFA A;  2HWC 1;  2VOV A;  4Y24 A;  1RUJ 3;  4XHX A;  4MGT A;  2QNK A;  5JI9 A;  1OF4 A;  3D82 A;  2QQM A;  5A7W A;  2G19 A;  3OUI A;  5FYY A;  3DXU A;  1NXM A;  2V73 A;  4O65 A;  1IS6 A;  4CUB A;  1NA1 C;  1QKQ A;  4OHW A;  1XC6 A;  4Z2W A;  3O1T A;  5IVE A;  4S2D A;  4IE4 A;  1O8P A;  2BYV E;  3IPV A;  2W5F A;  5J96 B;  5FYH A;  2OW4 A;  3AB0 A;  5DAP A;  5FV3 A;  2Y38 A;  2ZHK A;  4IV3 C;  3T09 A;  1HB4 A;  3MW2 A;  1R09 2;  3USU A;  4JRA A;  2A6Y A;  4GIQ A;  4N53 B;  3WW2 A;  1YJL A;  2D97 A;  5C70 A;  2GNM A;  1XJA A;  4ZS2 A;  1Z0H A;  4IEX A;  1RUG 3;  2E7A A;  2B39 A;  3MIH A;  4C8D A;  1XSR A;  1PGW 2;  2WJS A;  4YZ3 A;  1KXG A;  2F6B A;  3ZLI A;  4BLJ A;  4AI8 A;  3T0B A;  3VBR C;  2NM1 A;  2XJP A;  3THT A;  1RUD 3;  2HLE A;  1RUC 1;  1U5I A;  2P3Y A;  5JOW A;  4KU7 A;  4QM9 A;  1TE1 B;  1ZVF A;  3JB8 A;  4TZD A;  5FYI A;  4OI1 A;  3WIN E;  3W21 A;  2YC0 A;  3ZXA C;  3WHU A;  3WF2 A;  1SLT A;  1RED A;  2EIC A;  3BIW E;  3GCX A;  1UZZ A;  1YQ8 A;  1GLH A;  3SHR A;  4CCL A;  1VIW B;  4UW3 A;  3VBO A;  3SH3 A;  5C7G A;  5CFD C;  5T3N A;  3DCQ A;  3OBA A;  1BCX A;  1JUI A;  4Q0P A;  1RUN A;  1OC1 A;  1OQD A;  4XBQ A;  4QB2 A;  4YZ5 A;  2JDN A;  2Q8E A;  2VH9 A;  4P14 A;  4K20 A;  3ZDS A;  4N9H A;  5F2W A;  1W8T A;  4LBQ D;  3RQ0 A;  3KWV A;  5FZF A;  2VC9 A;  1ENQ A;  1UZ0 A;  1ZBA 3;  3E1F 1;  3AZV A;  4XDQ A;  3APB A;  3FLR A;  2WZR 1;  2XJR A;  3AVS A;  3AMN A;  4ZPI A;  2AYH A;  1T2X A;  3LFM A;  2P6C A;  2OT7 A;  2DUP A;  4LBQ A;  5FCC A;  1N1V A;  3AC0 A;  5FP3 A;  3I3B A;  2JIC A;  2Y60 A;  3POS A;  4Q4X 2;  1F5F A;  3A0K A;  5BUV A;  2VOT A;  4BXF A;  1POV 0;  3Q8F A;  4PLN A;  4GZ9 A;  5IT6 A;  2ET7 A;  3B7M A;  3GZU C;  4DS0 A;  1AR8 1;  2OPK A;  4UFL A;  4FBF A;  2ZX0 A;  3ZPO A;  2R6Q A;  2PAK A;  3K4Z A;  1UY2 A;  1I6X A;  1B35 A;  2BP6 A;  5ABJ C;  2X53 S;  4BYY A;  2WUH A;  1ZA4 A;  4MXW A;  4RSU A;  1LRH A;  4DRR A;  3WQ0 A;  1L3J A;  3S30 A;  1YUD A;  4NOT A;  2OQ6 A;  1HB1 A;  2C4X A;  4V2W A;  1IG3 A;  5HI0 A;  3I49 A;  1PVC 2;  4C1X A;  1KS4 A;  3B93 A;  3WLU A;  4QB6 A;  3ZIX A;  2O8Q A;  2RJL A;  3TEY A;  2A1X A;  3AL5 A;  2VTX A;  2D3P A;  1VAL A;  4UFI A;  1CAW A;  1YJK A;  2ERF A;  3M4F A;  2QKD A;  1CD3 G;  4Q0S A;  5B4N A;  3KQ4 B;  1G9F A;  5FO7 B;  1G9D A;  3OPZ A;  3C7O A;  3FLP A;  1SQ4 A;  1IOA A;  1RUE 2;  4HVR A;  4LO7 A;  4UFM A;  4WVW A;  2VNO A;  4J25 A;  1Y9G A;  1I3H A;  2R7E B;  1S1A A;  2ZGU A;  2VOW A;  5CKN A;  4AGV A;  1Z7S 3;  4I0W B;  2ZMN A;  2AUY A;  3WEZ A;  3RS6 A;  2J7M A;  1SLB A;  3HJR A;  1GYK A;  2EA7 A;  2PHD A;  4HFS A;  4YVW A;  4O9E A;  2B45 X;  4FOY A;  4MHR A;  4YGC A;  4R4Z A;  1F31 A;  1LCL A;  4EZ4 A;  4AVC A;  3TEW A;  1QY4 A;  4UFK A;  1QF3 A;  3KGZ A;  3NNL A;  1K5M C;  2BUK A;  4FI9 A;  1YRZ A;  4AED A;  2FDI A;  4BQ4 A;  4XFB A;  1AYN 2;  3ZN4 A;  2Q8O A;  1STM A;  1W8W A;  2J1T A;  4ATF A;  2FZ1 A;  1R09 1;  2BU9 A;  1UU4 A;  2LAL A;  4UF0 B;  3ASI A;  3FJS A;  1YIF A;  3M70 A;  2VUL A;  3BVC A;  3B94 A;  5FK7 A;  3Q8B A;  1DCS A;  2VZO A;  5BYN A;  5H9P A;  3U4S A;  1PGW 1;  2E6V A;  1Q8S A;  3OD0 A;  1XYP A;  1PGS A;  1HQN A;  4XDO A;  5FQ0 B;  1NY7 1;  5ISL A;  5C8C B;  4QPG C;  3GZA A;  3A4U A;  4M3C F;  3N36 A;  4D7Y A;  1JYC A;  2DCK A;  3H8R A;  3KB5 A;  3LD8 A;  3HBZ A;  4OUS A;  4WV8 A;  4W6W A;  1LGC A;  1JBC A;  4AI9 A;  1DGR A;  3CDZ B;  5T5P A;  2XJT A;  5FUN A;  5KBF A;  5FMO L;  1GQH A;  1TME 2;  1XE8 A;  3ROU A;  1UPI A;  2ZAA A;  5DG2 A;  1OLM E;  5FDB A;  3RRD A;  3I3M A;  3M2M A;  1PM4 A;  2W68 A;  2DYC A;  4AHX A;  2VQT A;  4DUV A;  2WZE A;  3N35 A;  4M0H A;  4BIS A;  4K1Z A;  2HYK A;  4QKB A;  3USS A;  3NO8 A;  4MXV A;  4YM2 A;  4CRQ A;  4A7Z A;  1VB4 A;  3ETQ A;  4XFF A;  1UOF A;  3POI A;  4J6G A;  4ARY A;  1GOH A;  3L2H A;  2AR6 A;  3ZFG B;  3TB0 A;  2Z5W A;  4W6Y A;  2W52 A;  4OZX A;  3SC7 X;  3T30 A;  2VMH A;  4JX0 A;  4Q4X 1;  4EWE A;  2Q0A A;  3UKT A;  5JXI A;  2RDS A;  3RYR A;  2BOJ A;  1YFY A;  3DKW A;  3VBH C;  4ISR A;  4CEY C;  1S2K A;  1NLR A;  1ZBE 3;  4YW1 A;  4NIH A;  1UYX A;  4CCN A;  1PK6 C;  4Y22 B;  5C71 A;  5K9Y A;  3VZK A;  3RI9 A;  2GP3 A;  2WR9 A;  1W2O A;  1DYP A;  1W9Y A;  1WCS A;  1ZZ6 A;  2W47 A;  2WNE A;  3PNA A;  3WG1 A;  3ZO0 B;  2EIG A;  3ZYH A;  4BPZ A;  5IVY A;  1YFX A;  2X5I C;  2HWC 3;  2JG8 A;  3I2F A;  4GWN A;  3BCW A;  2YBP A;  4YM0 A;  4YVS B;  4BIF A;  1MS1 A;  1YLL A;  2SLI A;  1YC6 1;  1OLM A;  4FOV A;  4IES A;  4XDP A;  1OMI A;  4FCA A;  2P2K A;  3DEC A;  4FPC A;  5J3U A;  3LEM A;  4CZS A;  4PBP A;  5A3L A;  2RVA A;  4NRQ A;  5FFO C;  3O1U A;  1PVC 1;  1G86 A;  1NCQ A;  2UYB A;  5FZ6 A;  3BB6 A;  5KHI A;  2KR2 A;  3D6E A;  3WP4 A;  4E2G A;  1DZT A;  5D8A A;  5A6Q A;  5I8Y A;  4GJY A;  4CEW C;  5A32 B;  2JEC A;  3DPR B;  3MZH A;  4AEJ A;  1GZW B;  3K48 A;  4ZS3 A;  1MZE A;  5FZO A;  2YB7 A;  3VKO A;  4A7Y A;  2QE3 A;  4JVA A;  2XDV A;  4D6R A;  1LEN A;  2RE9 A;  1HDK A;  1MS0 A;  3RDI A;  5BNO C;  3N9N A;  1RUE 1;  1K12 A;  2E7Q A;  2O1Q A;  5A6Z A;  1PIV 2;  1RUF 3;  3S7E A;  3ZMN A;  2DU0 A;  2ARA A;  4MSV A;  3GJA A;  3VGI A;  3E6B A;  5FTT C;  3FLT A;  5T52 A;  3ZSM A;  3WQ7 A;  2FD8 A;  1CJD A;  1RIT A;  2BBA A;  3DYP A;  2QQI A;  5DAW A;  1D2Q A;  1OUR A;  4JC1 A;  2ZGO A;  1SZB A;  1TG7 A;  1ENR A;  3VDD B;  2R0H A;  3ZSJ A;  4GAL A;  1WW5 A;  1RUC 3;  3NNF A;  3NV3 A;  5LBF A;  4YRD A;  1WLW A;  1XNC A;  3NV1 A;  1W6O A;  1HQW A;  1AYN 1;  3N9Q A;  4Q4W 2;  4JGZ B;  5HCF A;  4D94 A;  3R4S A;  1QJX 2;  4XJU A;  2VG9 A;  3KQR A;  1NAE A;  2ZAH A;  5DZG A;  1BXH A;  4XBL A;  1AUY A;  3LF7 A;  1HXS 2;  4QX8 A;  5A7W B;  1RMU 2;  1JMU B;  3WNM A;  4GKY A;  5GJ6 A;  5A1F A;  4GMP 1;  2W2I A;  4N53 C;  1X9P A;  4XUQ A;  5LBE A;  4AFC A;  4NUB A;  4Y4R A;  4L92 A;  3U75 A;  1DZQ A;  3CJX A;  2OPW A;  1MQT A;  3PUQ A;  3IPV B;  3LDR A;  4ATE A;  4BOW A;  1H1A A;  1QOO A;  2W3J A;  1NX9 A;  3O7O A;  4P9G A;  1ZRD A;  1JOJ A;  4Q4Y 3;  5EJ3 A;  4OI4 A;  2E32 A;  2YU1 A;  5FPL A;  5FLI A;  3AKR A;  4WVV A;  2A6X A;  4NRP A;  1FPN 2;  3USU B;  5K0U C;  5A3W A;  1TME 1;  3OPW A;  1OOP A;  2C5D A;  2R32 A;  1O5U A;  1AR8 3;  2VBD A;  1UY1 A;  3POJ A;  2PYT A;  5LZ6 A;  5FPZ A;  1H1I A;  1JU4 A;  5E8A A;  2OVU A;  3GF6 A;  4XUP A;  3ZXK A;  3WT3 A;  2B5H A;  1IKP A;  2UUR A;  3VBU C;  3ZFF A;  4Y1Z A;  1S2E A;  1FV2 A;  5IVV A;  2WN2 A;  1RUI 3;  2WT1 A;  1YQ6 A;  1KRI A;  4XE9 A;  3SQO A;  1AR9 2;  3B9I A;  3RVH A;  4GQ7 A;  4QPI A;  4WZC A;  1Q5O A;  2W92 A;  2OX0 A;  2W1Q A;  3G7D A;  4PDW C;  1SCR A;  5M0T A;  3LOB A;  4PIY A;  2ZEZ A;  2C24 A;  2Y0O A;  4L11 A;  5BNN A;  2ZEX A;  3ZKY A;  4A2U A;  2Y6L A;  4WM8 A;  3WNN A;  3HMY A;  4OMC A;  3NKT A;  3AP7 A;  3VN4 A;  2KXL A;  1O5L A;  3VUO A;  1JZ2 A;  3I2J A;  2ADE A;  4N9I A;  1PZ8 A;  3NV4 A;  4CDQ A;  3ZXL A;  2WS9 2;  3FUQ A;  4FPK A;  4QPY A;  1IZ3 A;  4YSF A;  2HYX A;  1QWR A;  1HW5 A;  1VBC 2;  4ISQ A;  1XQN A;  3ZOI A;  4J1X A;  3LAG A;  4LQR A;  2WWS A;  4LBQ B;  2XQR A;  4IER A;  4L0P A;  1AYM 2;  2JDK A;  4DIQ A;  1FXZ A;  5J48 A;  5JIU A;  5J37 A;  3DXT A;  3E5U A;  1XNB A;  1HB2 A;  4N90 A;  5JSP A;  2VW0 A;  4XJW A;  4CDU A;  1UX7 A;  4UFJ A;  2CDP A;  3ALQ A;  4LKD A;  5IFP A;  4OZO A;  3QBQ A;  3JQX A;  3N7M A;  4YGE A;  2VZ1 A;  5L9V A;  4LUM A;  4BK5 A;  3MO4 A;  2ZX2 A;  5JPN B;  4IND A;  1PIV 1;  5IK8 A;  1B35 B;  1R09 3;  4D7T A;  2D43 A;  2JIJ A;  1OA4 A;  4BQ5 A;  3IMN A;  3ZFE A;  3JZV A;  4MXW B;  5KC5 A;  5LBC A;  1JZ6 A;  3LA2 A;  1TNR A;  3MLK A;  1US3 A;  5HPO A;  4M4P A;  4K6B A;  5LRS A;  2VO5 A;  4HG6 B;  4AFA A;  5F5A A;  4AXO A;  4FPY A;  2RDN A;  3FC0 A;  1GQP A;  1Z7S 2;  1RUH 2;  2W39 A;  1A3K A;  3MIF A;  5FAX A;  2X05 A;  3RG0 A;  1Q8Q A;  2WC2 A;  1UY0 A;  1QMJ A;  1UZV A;  1JTZ X;  5FZM A;  1J1T A;  2R1B A;  3AXE A;  1S0C A;  3D4K A;  4DOU A;  4AQ2 A;  2WO3 A;  1B09 A;  3LEG A;  4P9X A;  5EIY B;  1NG0 A;  4UYB A;  5L9B A;  1KJL A;  3HOB A;  1Q8P A;  4Q4W 1;  4ET7 A;  2PMW B;  1AL2 2;  2ZGM A;  3VD5 A;  3NKG A;  5FMO S;  3WDX A;  4FTE A;  2NP0 A;  1QJX 1;  3TEX A;  5LEK A;  4LTA A;  4FP2 A;  4K9S A;  3HNY M;  4D8M A;  5IVF A;  2P34 A;  1HXS 1;  1N3P A;  1QNW A;  1W8H A;  1RMU 1;  3N3H A;  2JG9 A;  4FPH A;  5JXH A;  2E63 A;  2E31 A;  1US2 A;  1ZYB A;  4YVW B;  4I2O A;  1LEM A;  1C57 A;  4QX1 A;  5F5C A;  1W05 A;  4LOR A;  4CUA A;  4XFG A;  1LU1 A;  5EZW A;  1SLI A;  5L73 A;  5LA9 A;  1ZNP A;  3OGG A;  3U11 A;  4LJH A;  4JGY A;  5IJR A;  2FDG A;  1UL9 A;  3JQW A;  1K42 A;  4L9B A;  4AED B;  2ZGL A;  1LOF C;  1V6M A;  4IDZ A;  1HIX A;  1H2K A;  1XXN A;  3B3Q E;  3ZSL A;  4BZ4 A;  3EHK A;  5C8C C;  4OQ8 A;  1ULF A;  1QQP 2;  2ORX A;  3AK0 A;  3I2D A;  4ZHN A;  4YAR A;  4E9K A;  1CR7 A;  2V4V A;  1HN0 A;  2YGM A;  4PI0 A;  4Q4X 3;  2G1M A;  4COZ A;  3KMH A;  2VCM A;  1MZF A;  4Y33 A;  1YI7 A;  2D6N A;  5A1L A;  2W1W A;  1Y3T A;  1VBA 3;  2HKX A;  3IDB B;  3ZXJ A;  4HL0 A;  2C0Z A;  2P4E A;  3U07 A;  2C1F A;  3T4H B;  4CCK A;  4QQ2 A;  2DVG A;  1XB9 A;  2XJS A;  4MGK E;  2WNU A;  2ZGQ A;  1RJ7 A;  2ZTN A;  4B3N A;  2WT2 A;  4AVV A;  4DRV A;  5FYB A;  2QDR A;  3I54 A;  1AR9 1;  3HQR A;  5FY1 A;  5BY5 A;  2UYA A;  4M3C A;  4P08 A;  1PVC 3;  1Y7B A;  2E51 A;  3HR9 A;  4FT8 A;  2D98 A;  4JKK A;  4P02 B;  4XFC A;  1JYT A;  2WRA A;  4TLG A;  3KT1 A;  1WWY A;  2IXC A;  3WX5 A;  3OGR A;  3H8X A;  1HRI 2;  3MFC A;  4JDM A;  4E4Z A;  3JD7 3;  4R4X A;  4SLI A;  3P3P A;  4ZON A;  4NHM A;  2GN3 A;  1RUE 3;  4AAP A;  5LEJ A;  1C8N A;  4CDW A;  1CPN A;  1UD1 A;  2DVA A;  2WS9 1;  3H1M A;  4W4Z A;  4B4P A;  4X6R B;  1BMV 2;  2A6W A;  4I09 A;  1VBC 1;  1ULP A;  1PVX A;  3O14 A;  3Q8C A;  5FZE A;  4QGM A;  4AVT A;  3VD7 A;  2B4K A;  3QH6 A;  2XKP A;  3VKL A;  4XIK A;  1P8J A;  1AYM 1;  2OUH A;  1AZD A;  2A3W A;  1AJO A;  1OLR A;  4GWM A;  4KU8 A;  4AFM A;  2IUW A;  2F17 A;  2XJU A;  3T1M A;  3UET A;  2XBO 2;  1TNF A;  5FP9 A;  2HWD 2;  5C33 A;  2NMN A;  1COV 2;  3L9J T;  2VVF A;  1GIC A;  2VU9 A;  2O8O A;  5FY0 A;  1AYN 3;  3BTX A;  3GYD A;  1X36 A;  3DPR C;  3CQO A;  1LNS A;  3KM5 A;  1LOG A;  2UU8 A;  3R4D B;  2AC1 A;  2HWE 3;  3WZ1 A;  2FDH A;  3O1P A;  2VUC A;  2XKO A;  1WCD J;  2Y6F A;  4QHZ A;  2DFB A;  4QX0 A;  3HQX A;  4XBN A;  5CG8 A;  1OFN A;  2FQP A;  3UV9 A;  3AVR A;  3HAG A;  4GMP 3;  2EXH A;  1NCQ B;  3PUR A;  2X29 A;  1M4W A;  1Z7S 1;  1YI9 A;  1RUH 1;  4FPG A;  2XB6 C;  3VBF A;  3O1M A;  5D8A B;  3BPS A;  4K40 A;  1DIW A;  4BQW A;  3C3V A;  4RHV 3;  1D0H A;  2K9Z A;  5FYV A;  1CPM A;  2Q1F A;  5FZO B;  3MYX A;  1BYH A;  2BWC A;  1GU3 A;  4QXB A;  2TUN A;  3VDD C;  1E5S A;  3SKJ E;  5LWB A;  4HAN A;  3O12 A;  5FP7 A;  5JVV A;  1U5X A;  5EFU A;  5CBL A;  1ZRF A;  4CSW A;  3K75 B;  2BER A;  5JZG A;  5JMO A;  2GH2 A;  2XG3 A;  2BDR A;  5A6X A;  3L2Y A;  3H3U A;  3H1W A;  4LXL A;  3E5X A;  1JYW A;  2Q1M A;  4JGZ C;  4GUL A;  2RS5 3;  3WG4 A;  4EN7 B;  2AAC A;  3BGA A;  5FPB A;  1U12 A;  3AJZ A;  1S2B A;  1UU6 A;  5HCA A;  3POY A;  3NJX A;  2QQV A;  4YLZ A;  1MVQ A;  1DYO A;  4QGN A;  1HKD A;  4M01 A;  4TWT A;  4BWO A;  1UOJ A;  4QDR A;  4JAA A;  1OT5 A;  3U1X A;  3NRU A;  2RJK A;  1QDO A;  1MVE A;  1WMD A;  4XAE A;  4Y20 A;  5GLT A;  2XON A;  4LBN A;  4WM7 B;  4DQA A;  1NXD 1;  1UOG A;  2RV9 A;  3BAL A;  3K77 A;  4PHZ A;  2CWS A;  1W6O B;  2GC1 A;  3KVB A;  2BVB A;  2V4A A;  4ZZ5 A;  3CKH A;  1W2T A;  1QQP 1;  2WAB A;  5K4L A;  3RZK A;  4UI9 L;  2OYZ A;  3ZPY A;  2F4L A;  3RMY A;  1M06 G;  3OJB A;  4Q4Y 2;  3PLQ A;  1OA2 A;  4HON A;  4EN6 B;  3GXU A;  3KLS A;  3BOW A;  3WDY A;  2VMF A;  3SCH A;  2MEV 2;  4CXY A;  2NZ9 A;  1MZ6 A;  2EIE A;  4CU7 A;  1QIQ A;  4QQP A;  2PAM A;  3J26 N;  4ASL A;  1ZRI A;  2YDE A;  1EYB A;  3RSJ A;  3BTA A;  4XZU G;  3N4M A;  5JMC A;  4XF1 A;  5G05 L;  3FHQ A;  1DLC A;  4QWN A;  1W04 A;  1LOD A;  2PHT A;  2DTY A;  1HV0 A;  1KIT A;  1SBF A;  2GZW A;  1RUI 2;  2TNF A;  4EYU A;  4DXS A;  4NJ4 A;  1OOP B;  2YXS A;  4Y1X A;  5DDJ 2;  1VB2 A;  1HRI 1;  2AEY A;  2OKX A;  1W2A X;  2GC3 A;  3VD4 A;  1DLL A;  2JD4 A;  1PZ7 A;  1AR6 3;  2WWU A;  3AYC A;  3ZYF A;  4AHW A;  4F8A A;  5A6Y A;  1JZ8 A;  1ZZ8 A;  2EAK A;  3LCP A;  1W99 A;  2IXL A;  2OZ6 A;  1PIV 3;  1WCQ A;  3V65 A;  1IKQ A;  1HV1 A;  4GB3 2;  4AAX A;  1BMV 1;  4A41 A;  1IS5 A;  1W8O A;  2XLF A;  4WZF A;  4A45 A;  3ZFF B;  4BQ3 A;  3RZH A;  4CDX A;  2E9Q A;  1GAN A;  2HEV F;  3ABZ A;  2ZS6 B;  1C28 A;  3N9L A;  4LBM A;  4MVT A;  2VTF A;  3LIH A;  1WMX A;  3CJI A;  2K2S A;  4NHL A;  5I93 A;  5EHD A;  1H8T A;  4DMI A;  4HVO A;  3P6B A;  3FBY A;  2XBO 1;  3H3L A;  4QX5 A;  2HWD 1;  3C7E A;  2DCZ A;  5BNN B;  1MEC 2;  4WM8 B;  2D6M A;  1GKB A;  4K8R B;  1COV 1;  5LRR A;  3ZYG A;  5D1I A;  4DEV A;  2R04 2;  4Q4W 3;  4NRM A;  1LOA A;  3DYO A;  4CDQ B;  1JI6 A;  1QJX 3;  4H7M A;  2ZHN A;  3T2Q A;  4BE3 A;  1G7Y A;  4S2H A;  1UNB A;  4E2S A;  4LUL A;  5IVB A;  1TZO A;  1GZT A;  1LHO A;  1UMZ A;  2ZMK A;  3E97 A;  4R9C A;  1HXS 3;  4XF9 A;  2VNG A;  1RMU 3;  3WOG A;  4YGB A;  1RUF 1;  1B35 C;  3AZZ A;  3T08 A;  1A78 A;  2BNN A;  4X8N A;  1LHV A;  2QJV A;  5CIS A;  1JYX A;  5IAT A;  3MW3 A;  5C9A B;  1PMI A;  1ZZ7 A;  3FHA A;  4CDU B;  2ZGN A;  1VRB A;  3PVE A;  4QU1 A;  4RL7 A;  1J83 A;  2R16 A;  2O0O A;  1H0B A;  2Y26 A;  3KD4 A;  5FZK A;  5SV5 A;  1BQP A;  3EO6 A;  1FPN 3;  1JHJ A;  4IEZ A;  1QNY A;  4ITC A;  3ZFE B;  3ZYI B;  4KWL A;  2BPA 2;  1YNA A;  3R4U A;  2VZQ A;  2Y64 A;  2H0B A;  2Y8K A;  2RMU 2;  4AHZ A;  2VBP A;  1FV3 A;  4KMQ A;  3ME2 A;  4RS5 C;  4XAC A;  3I7D A;  1UN1 A;  1ZZB A;  3NWK A;  4YVW C;  3CL1 A;  4RYD A;  1H2M A;  1GBG A;  1GP6 A;  4KBZ A;  1GOG A;  2QQK A;  1AR9 3;  5E16 A;  3W20 A;  3IWZ A;  1VPH A;  3KCY A;  3D0S A;  4FO9 A;  4LLO A;  4WVZ A;  4XUR A;  2J1V A;  5ANQ A;  4AED C;  5A7O A;  3QAC A;  1E5H A;  2Y6K A;  2EVX A;  3GBF A;  2VMI A;  4Q4Y 1;  3WW3 A;  3AYD A;  4F3J A;  5SV8 A;  2GMP A;  2XXZ A;  2HBT A;  1VAV A;  2MEV 1;  4E4D X;  1C8M 2;  1UYY A;  2EXJ A;  2WS9 3;  4LKS A;  1VBA 2;  2VQU A;  3UT0 A;  4JQR A;  2VEC A;  3VZN A;  1RB8 G;  5FPA A;  2YPD A;  1Q8V A;  4LUK A;  1VBC 3;  2ARX A;  5F2S A;  4YW2 A;  2VNR A;  4OUL A;  4R52 A;  1XYN A;  2ZZQ A;  3M3E A;  4E4S A;  1SPP B;  1AYM 3;  3WP3 A;  4AL9 A;  4UAP A;  3AP6 A;  1ZM1 A;  4XAA A;  4HLT A;  4FAH A;  4HT1 T;  5FPX A;  1RUI 1;  2VR4 A;  3IDA A;  3MIC A;  1WW6 A;  4FXG B;  1QDC A;  3DF0 A;  4IXL A;  4LA3 A;  4LE4 A;  5DDJ 1;  5GKA C;  3M7A A;  3MW4 A;  5K8S A;  4I0A A;  1BHG A;  1NA1 A;  1UY3 A;  3R05 A;  5FLJ A;  2R0F A;  3IT8 A;  4YG6 A;  1K45 A;  1HRV 2;  4KNC A;  5J7M A;  2VMG A;  2WKK A;  2WNU B;  5FYU A;  3VB9 A;  2RHP A;  3JD7 2;  4IV3 A;  1W8U A;  4L97 A;  1Q43 A;  5JUV A;  1OA3 A;  5DN2 A;  1F8V A;  2BGC A;  3P3N A;  3J4U H;  4M3C B;  4ZKT B;  1N47 A;  2ID4 A;  1RUH 3;  3WNL A;  2C26 A;  5A33 A;  5K7P A;  4D0Q A;  4XVH A;  3ECQ A;  4FOW A;  4YWA A;  5L36 A;  3ENR A;  1MEC 1;  4B7K A;  4CPB D;  4G3Y C;  2BW8 A;  4UT5 A;  3K3N A;  3KT4 A;  1O8S A;  2WYS A;  4QX7 A;  5A70 A;  2R04 1;  1WW4 A;  2C9A A;  3ACF A;  1AL2 3;  1BK1 A;  2IXH A;  2Z69 A;  4BA6 A;  4CDW B;  2IWG B;  1DFQ A;  1SMV A;  5JI7 A;  1KEX A;  4CPB A;  3J7L A;  4YFZ A;  3FE5 A;  1D4M 2;  5TSW A;  2DBN A;  2W91 A;  1RGS A;  4FPF A;  4BJ0 A;  2GAL A;  1LJ7 A;  1QXR A;  2CTV A;  1CAV A;  2JIG A;  5CFD A;  5FXV A;  5EJZ B;  2HWE 2;  4COY A;  1R64 A;  3K4A A;  2AZ5 A;  4OUE A;  5LK7 B;  2W94 A;  3GGL A;  3OBR A;  5FZ8 A;  3ZXD A;  3H7Y A;  2JEN A;  2VUD A;  3WF0 A;  2BFU L;  4N43 A;  4NIA A;  1SG3 A;  4GXL A;  3LZZ A;  3AYA A;  2R30 A;  5B2G B;  4QM8 A;  2WZ8 A;  2GME A;  1IHM A;  1QQP 3;  1LGN A;  4O61 A;  5E1R A;  4RHV 2;  4GMP 0;  5DMY A;  4AI2 A;  3J9S A;  4KWU A;  4OYU A;  3O1R A;  2JDU A;  4LT5 A;  4ZU7 A;  1DF0 A;  4XUO A;  5JIA A;  3OUJ A;  3ZYB A;  3NVC A;  4DZG A;  4HPK A;  4FVV A;  4GH4 A;  4NVP A;  5L7O A;  2DV9 A;  1CWP A;  5KC6 A;  3AFG A;  2ORZ A;  3LEK A;  2GP5 A;  4XTP A;  2YUE A;  2QVS B;  1AL0 G;  4HKL A;  4P9I A;  3VZL A;  2RMU 1;  3B00 A;  1NE6 A;  1WKY A;  4XCB A;  2WSU A;  3PJQ A;  2E7T A;  2B8M A;  2HH9 A;  3VBF B;  1A34 A;  3MLJ A;  2J1A A;  2RS5 2;  1YIP A;  4LNV A;  4WVM A;  5KHK A;  3EBR A;  4DEQ A;  4NR1 A;  3VHO A;  5E88 A;  2HBU A;  5FLH A;  1UU5 A;  2OZJ A;  3LQC A;  4LO5 B;  1BLZ A;  5CU1 A;  4D6S A;  4XCA A;  4AK3 A;  3NAP A;  1RXG A;  5E89 A;  4XZP A;  1H2N A;  4WM7 C;  1D4V B;  2EAA A;  2NMO A;  4IGO A;  5D2A A;  4EWD A;  1NZC A;  4UBH A;  3V64 A;  2H6C A;  5JZG B;  1JZ3 A;  3WNK A;  1HRI 3;  3POW A;  3DKQ A;  3RMX A;  1CGP A;  1QXP A;  4Z07 A;  4YW3 A;  2C9K A;  1V6I A;  1CX1 A;  4IEP A;  4IEV A;  4Z2A A;  5A3P A;  2DCT A;  4Q29 A;  3PU3 A;  4HMZ A;  3C8X A;  4EN0 A;  4K7J A;  4QQO A;  1VBA 1;  5FZB A;  1DZR A;  1ST8 A;  3MPB A;  3IIA A;  4Y20 B;  4GKX A;  1NYW A;  1W8F A;  5FPV A;  2XH6 A;  5C3O A;  1IQD C;  3MV1 1;  4PBO A;  3AZW A;  5F8P A;  3S0M A;  2WAA A;  4YFW A;  2VZ3 A;  2IZW A;  2YMZ A;  5IYY A;  2XBO 3;  1ODN A;  2HWD 3;  5KXB A;  2B9U A;  3T2O A;  1COV 3;  5A7Q A;  1AX1 A;  2CU5 A;  2PLV 3;  3EJK A;  3ILR A;  2BGP A;  3OY8 B;  4EN9 B;  4W65 A;  5CAD A;  1W03 A;  1HRV 1;  1OOP C;  1QJF A;  3MF9 A;  4P9L A;  5FZ1 A;  1POQ A;  1UWW A;  1OBN A;  1F9K A;  3DUI A;  3JD7 1;  1AR6 2;  3A23 A;  4XHB A;  2WII B;  4XFA A;  5FY5 A;  5FRA A;  5DZF A;  3HQU A;  4XJ9 A;  3TRS B;  4XJA A;  2CAU A;  4AI0 A;  1EY2 A;  2ENR A;  1BKZ A;  3THC A;  1VMF A;  2JDH A;  2BTV C;  3O0W A;  4DUW A;  5A3N A;  3OD4 A;  2D93 A;  1W8Z A;  2JDP A;  1W6M A;  3ZFF C;  4YM3 A;  3TAY A;  2JXA A;  5DXD A;  4F7Z A;  1O3Q A;  3O1S A;  3HVD A;  2EID A;  4DFS A;  4DUX A;  1AF9 A;  1W3X A;  4JKL A;  3SKV A;  4HSJ A;  3A22 A;  3PME A;  2P3I A;  2AEN A;  2ARE A;  2P5B A;  4QPG A;  2V5Y A;  1O4Y A;  3GHN A;  5BNN C;  3ZR6 A;  4MGI E;  3SNM A;  3WNP A;  1V6O A;  4I3P A;  1S0J A;  2JE7 A;  3NNM A;  1JZ7 A;  1D4M 1;  5I91 A;  4LKE A;  3AKT A;  2IVJ A;  3GNE A;  4CDX B;  4URA A;  3IDE A;  1I5P A;  3S7I A;  4CDQ C;  3FFQ A;  3NQH A;  2R07 2;  4YZ1 A;  3Q8E A;  4IE5 A;  4C90 A;  2HWE 1;  1CQ9 A;  3RGB A;  4AI1 A;  1NLQ A;  2WO7 A;  2W46 A;  3CJI B;  3TN9 2;  1NCR A;  5FO9 B;  2WLQ A;  3BUC A;  4FTB A;  1H8T B;  4B1L A;  4AVB A;  4QGL A;  3J8F 2;  1CAX A;  2K46 A;  4K3U A;  2FHR A;  4CP1 A;  1VAK A;  1OD3 A;  4K1Y A;  1YO8 A;  4XC9 A;  3WXP A;  5C3Q A;  2Q4S A;  5FXZ A;  3ZN6 A;  2OII A;  4A3X A;  5FPU A;  3GDB A;  4H7L A;  4TSV A;  3SXW A;  3BU0 A;  5JPM B;  5C9A C;  5F7U A;  2VZU A;  4RHV 1;  2ADD A;  4QDS A;  3BN6 A;  3CZJ A;  4IEQ A;  3WCR A;  4BCU A;  1KDM A;  3IAQ A;  4HKO A;  2ZAB A;  2ZEY A;  3INA A;  2DUO A;  4N8M A;  1V6K A;  1JN2 P;  3AMP A;  2WDB A;  1GV9 A;  1OFS A;  2MEV 3;  2YBS A;  3RYP A;  1V9U 2;  4YZ4 A;  3ZFE C;  1REF A;  2CGO A;  4QB1 A;  3UES A;  1OPM A;  2LRO A;  3VBH A;  1WLD A;  3I97 A;  3IZO A;  2WQZ C;  2RS5 1;  3CF6 E;  3F2Z A;  1AX2 A;  4P00 B;  1S4C A;  2J1S A;  2WIN B;  1JZ5 A;  1XND A;  3KF5 A;  2GN7 A;  4UXA A;  3RWN A;  5DUV A;  2X5I A;  1SFP A;  2YV8 A;  4QU2 A;  1XNT A;  3AXD A;  5HBA A;  1OQ1 A;  2HWF 2;  2UWB A;  3U0Z A;  4HKW A;  4S2F A;  1FI2 A;  2YPJ A;  4MLO A;  2WSV A;  1TMF 2;  2D40 A;  2AH2 A;  1JZ4 A;  1JOB A;  2GNB A;  4DXT A;  1VBB 2;  5FYC A;  1ND2 A;  5DDJ 3;  2D44 A;  2MHF A;  1UKR A;  1H1M A;  4XQD A;  2V72 A;  3AKQ A;  4CEW A;  5GZG A;  2PA7 A;  5J1X A;  2J1U A;  4GWI A;  4LR4 A;  5CKQ A;  3VBO B;  5IVC A;  4FFG A;  3ACH A;  2VJX A;  4FP3 A;  4GB3 3;  5HCB A;  1UMH A;  5BNO A;  4UFH A;  2XPJ A;  1VAM A;  4XMI A;  4MUV A;  1IQA A;  1DQ0 A;  2HEW F;  2OA2 A;  5C3R A;  5LBB A;  1C3H A;  2YHJ A;  5FJH A;  2TBV A;  3H50 A;  3MIE A;  1Y9Q A;  1WW7 A;  2J22 A;  1CIW A;  3NMB A;  2JE9 A;  3MF6 A;  3TWI A;  4XIO A;  3FMG A;  4QXK A;  4UBG A;  3SCG A;  3BTZ A;  4AGG A;  1MEC 3;  3AYE A;  1OH4 A;  4IET A;  1D0G A;  1XNK A;  4NHX A;  4KWK A;  5I0D A;  2CHH A;  4NWV A;  3NJZ A;  3WY6 A;  2R04 3;  2XJV A;  1H6Y A;  4HVQ A;  3V0B A;  2QBX A;  1UX6 A;  2OUJ A;  2UWA A;  2HEY F;  2ZBJ A;  1YFU A;  2BV4 A;  4FFF A;  4COU A;  1ZRE A;  2OQ7 A;  2Y6G A;  3GAL A;  5FYZ A;  4AE2 A;  1ULD A;  1AR6 1;  3DGT A;  2FMY A;  4NII A;  1CX4 A;  5LY1 A;  2NPI A;  2F4P A;  4MGS A;  5DAB A;  4E8D A;  4FQZ A;  2WNU C;  3B01 A;  4OCT A;  3TOJ A;  4IV1 A;  2YRO A;  3OUH A;  3WF3 A;  2FCV A;  4A7K A;  1O59 A;  2BFU S;  5EWS A;  1CIY A;  5I8S A;  5IW0 A;  3WV6 A;  2X8K A;  3WD5 A;  5FBJ A;  3T0D A;  3B5L B;  1QGL A;  4OFG A;  1NA1 B;  4IE6 A;  4MV2 A;  1CZS A;  2XLG A;  4YW6 A;  3OPT A;  2VXR A;  1CAW B;  3ZSK A;  4FFI A;  4IV3 B;  1L7Q A;  1FAY A;  4FPL A;  1W6N A;  4JTO A;  1AJK A;  1N3O A;  1WCK A;  1J3Q A;  3PVN A;  1CAU A;  1FMD 2;  4FXK B;  3WF1 A;  2GC0 A;  5K0U A;  3KV5 A;  1A8D A;  2R07 1;  1HJF A;  3LFI A;  2VZR A;  4BLI A;  4LBL A;  1T6B X;  4AEK A;  5IUQ A;  3TN9 1;  2RMU 3;  3BOD A;  5DAV A;  5FZH A;  3WNO A;  1J84 A;  1JH5 A;  3PUS A;  2CNA A;  3AP4 A;  3MUZ 1;  5A33 B;  1A8M A;  4BQX A;  1W06 A;  3I8T A;  4OI2 A;  4M3C E;  2PXJ A;  3CLP A;  4P5H A;  5FZL A;  1XBF A;  3SH5 A;  3VBU A;  1DHK B;  4GAZ A;  2E26 A;  3PHM A;  4MGQ A;  5EQU A;  1IPK A;  1IPS A;  3MID A;  5F5Q A; 
#chains in the Genus database with same CATH homology
 3GZE A;  3KT7 A;  4NHK A;  5A3U A;  4XCA A;  2HBT A;  2A1X A;  3KT1 A;  3DKQ A;  4ZON A;  4NHM A;  2G19 A;  3OUI A;  4J25 A;  5LAS A;  5HV0 A;  4NMI A;  4XAB A;  3PL0 A;  4XAA A;  4MHU A;  5EPA A;  5DAP A;  4MHR A;  3EMR A;  3GJA A;  5L9V A;  3NNL A;  2Y34 A;  5LBB A;  2JIJ A;  5DAW A;  5IAV A;  5EP9 A;  5LBC A;  4NHL A;  3NNF A;  5LBF A;  2FCU A;  3MGU A;  2RDN A;  3BVC A;  4NHX A;  4BQY A;  5HV4 A;  5IAX A;  3HQU A;  4Y5T A;  2RG4 A;  3W21 A;  3NNJ A;  3KT4 A;  5L9B A;  4BQW A;  2RDR A;  5DAQ A;  3GJB A;  5LBE A;  5L9R A;  4UWD A;  3OUH A;  4Y5S A;  5IAT A;  2OPW A;  2FCV A;  2Y33 A;  4IW3 A;  2JIG A;  4BQX A;  4JZR A;  3NNM A;  5LA9 A;  2RDQ A;  4ZPI A;  5ERL A;  2G1M A;  4XC9 A;  3OUJ A;  5DAV A;  2V4A A;  4XAC A;  4NAO A;  5C5U A;  2RDS A;  4Q5O A;  4KBZ A;  4XCB A;  5C5T A;  2FCT A;  5LB6 A;  3W20 A;  3ITQ A;  5LAT A;  5M0T A;  5EQU A;  2HBU A;  3OBZ A;  5DAX A;  4NHY A;  3HQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...