5LB6A

Hif prolyl hydroxylase 2 (phd2/egln1) r371h variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
224
structure length
221
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRHNPHEVQPAYATRYAITVWYFDADERARAKVKYLKGVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 62
structure length 221
sequence length 224
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lb6A00
4XCBA 4ZONA 5DAPA 5L9RA 5C5TA 5DAWA 2FCTA 3KT1A 3OBZA 4JZRA 4KBZA 3HQRA 5L9BA 5LBCA 2G1MA 5IAXA 3PL0A 4J25A 4BQWA 2HBUA 5LBFA 5L9VA 4IW3A 3BVCA 5HV0A 2FCVA 2RG4A 4NMIA 2V4AA 3ITQA 2FCUA 2HBTA 4XABA 3EMRA 4UWDA 5A3UA 2OPWA 5DAQA 3GJAA 2JIGA 3GZEA 5DAVA 4ZPIA 5ERLA 2G19A 4MHUA 2RDQA 5M0TA 5EP9A 3GJBA 5LBBA 5EPAA 4BQYA 4XCAA 2Y34A 2RDRA 4XC9A 4NHXA 3OUIA 3NNLA 4Q5OA 3NNMA 4XAAA 3KT7A 3KT4A 5LATA 4XACA 5C5UA 3OUHA 5DAXA 3HQUA 4NAOA 5EQUA 5LASA 5LB6A 3NNJA 4NHLA 3NNFA 2JIJA 3OUJA 4NHKA 5LBEA 2RDNA 5IATA 4NHYA 2Y33A 3W20A 4MHRA 2A1XA 2RDSA 4NHMA 3W21A 5LA9A 5IAVA 5HV4A 3MGUA 4Y5TA 4BQXA 4Y5SA 3DKQA
chains in the Genus database with same CATH superfamily
5IFPA 1K5MB 4RA0A 1AYM3 1YQ5A 4OI1A 1GQPA 1J1TA 3WG4A 1MS4A 2ZAHA 1NX9A 1DZQA 2VPVA 2BTVC 2ZGSA 4MSVA 3D8CA 4IEQA 2VXRA 2HWF1 3KT1A 5JSOA 3ZSMA 4GB32 2P2KA 4YGCA 5FWEA 2VG9A 3KV4A 1QNYA 1XNAA 3HD8B 5JZGC 3JZVA 3RZHA 2AENA 1RJ8A 1R1A2 1SLLA 4LO4B 4QDRA 2JECA 5CZKA 2VCBA 3ACFA 5FXXA 4URAA 5ACA2 2BUKA 4LBLA 3AZZA 3LAGA 4OQ8A 2QDNA 4LJHA 5F1RA 1DCSA 1AR71 1FNYA 3HT2A 1QKQA 3MDPA 2ZOEB 3V0AA 4H55A 5B2GB 1RUG1 5FZ8A 1QGLA 4CDQB 2A6XA 3FZ3A 3WCSA 1UPSA 2CYFA 4DRRA 3POGA 1EP0A 2ZGTA 1RUH3 3BVCA 1UYPA 2XLFA 4JKLA 4DOUA 1VBD2 5I0TA 5A7WA 4Q26A 5J09A 3CQOA 3MLJA 1L7QA 3OPWA 4HONA 4AGGA 5IK8A 4NWVA 2WIIB 2RS52 4C0HA 2HBTA 1LOEA 1ST8A 2YB7A 1NT0A 3LEGA 2Q0AA 5FDBA 4OFGA 3WF0A 2PQQA 3POFA 2GC2A 3ZYIB 3M3QA 1MEC1 3KCXA 5JR2A 1HB2A 2DCZA 2VW2A 5KR7A 2CHHA 5GALA 2PHLA 2XQXA 1ACCA 4META 1JU3A 3RZKA 4AEMA 5CADA 3IM0A 5F5QA 5FBZA 5FMBA 3OYWB 3BGAA 5FLHA 5F6LB 1HRV2 4BQ1A 1H8TC 4XQ4A 2RS11 2XHNA 5D8AC 1UY3A 3ZMNA 4NHXA 1NLRA 2ZACA 1IQDC 4LIVA 3I49A 1N47A 4ZXEA 3P1IA 1V9U1 2Y26A 1UCXA 2ZMNA 1ENSA 3O12A 5LATA 1AJKA 4X8PA 5EZWA 4NIHA 4GKXA 5A3PA 4IE6A 2NYYA 4L8QA 3THDA 3OYWA 2AYHA 3CKHA 1TMF2 4BQ4A 4ZU4A 2PA7A 3OJBA 4C8DA 2VL4A 4IESA 1RUC3 3O14A 2P3YA 2OT7A 2XR4A 5KHGA 1DZTA 3JXSA 3POSA 4PF5A 5D21A 2WUHA 3FHAA 1CJDA 1C5IA 2RM21 4P5HA 5C9AC 2HWC3 1AL21 2ZCWA 4RFT0 4LIUA 1PGW1 4TSVA 2P3KA 1W6QA 1S0BA 3CHXA 5DPNA 3OGJA 4ZY9A 4JTOA 1C5HA 2YROA 1RUJ2 2QBXA 4LBMA 4D69A 5JXGA 3O1OA 1AR82 2GDFA 3MFCA 1LHUA 1HLCA 4XFIA 1KRIA 4GH4B 1AL22 1IPSA 4CDQC 2CWSA 5KXCA 1F35A 4M4PA 5A7NA 2RDSA 1V6JA 3NV1A 4L92A 4CRQA 4NUBA 2BWAA 3U10A 4NWWA 4IV3B 1W8HA 3OY8B 1JOJA 1W05A 3T0AA 4BQXA 4AYUA 2XL7A 5E89A 2JXAA 1ZBE1 4P08A 1IQAA 2A70A 1WW4A 1NXD1 5A32B 4Z8BA 1MS8A 4R9DA 3U4XA 4MG2A 4ZZ8A 1EY2A 4PHZA 2D6PA 3VZJA 3E5UA 5F2SA 3M3CA 4GWNA 1OOPB 4FPGA 4IV3C 2Y6HA 4RR3C 5BNPB 1VPHA 5FPVA 1VBE3 1UMIA 5FOJB 1JYIA 2WQ8A 3A21A 2EAKA 4BIOA 5GKAC 4IEOA 2ZX1A 3I3QA 3DYPA 2I74A 3H8OA 4XTMA 1H9WA 4WVVA 1RITA 4U36A 5F5CA 5FZCA 3TEWA 4JGYC 5IHRA 4LTAA 3KMHA 1NQJA 3AMPA 2B46X 4KWJA 1HJFA 4Q27A 1ULGA 5F6KA 1GMMA 4INDA 1A3KA 1UY0A 3GBFA 3I2IA 4JHTA 4FQZA 3SXWA 5GZCA 4DFSA 1PGSA 2EXJA 3P6BA 2VE1A 3LOIA 4JRLA 4QXCA 4CXXA 3PUAA 5KC5A 1DQ2A 4G4FA 4PLMA 5JMOA 3SH3A 1OA4A 1RUD1 5DABA 1A78A 1AZDA 3K4ZA 3EB7A 3KF3A 4YPJA 3DGTA 2PAEA 3U75A 3LGRA 4M3CE 2RG4A 4UF0B 3LE0A 4XDOA 1V6MA 3R4UA 2RV9A 3ES4A 1MR5A 2VZQA 2WT2A 4XBLA 4UXAA 2BNNA 4W6YA 5JSRA 4DXSA 4FTSA 1W6QB 4CEWC 3RI9A 1DGWX 1RUI1 3OSDA 2XJTA 4JGZA 3AYEA 3TNPB 1O6UA 4AF9A 3T2OA 2FBEA 2C26A 2JIGA 4Q1RA 3VV1A 1YXWA 1NCQB 3UGHA 2CGPA 1S0FA 3ACIA 5KHHA 4N7UA 1RMU2 2RS13 1RYYA 2TEPA 3AP4A 3KHBA 4QB1A 4CPBA 5L7OC 5LW9A 4UW4A 1W04A 5LBBA 3IN9A 2PYTA 2LM3A 2VZRA 3WP5A 4XCAA 3RZGA 4QX5A 2QQOA 3M3IA 3OY8A 1IOAA 2DBNA 3ZPYA 1N1YA 4W6XA 4NROA 5FZ4A 3UESA 5JOZA 1ALYA 2D6OX 3AKRA 3NNLA 3SCHA 4K1ZA 3H1MA 3NJYA 2QNKA 2W1QA 2D5FA 4MGQA 3ZXJA 5A70A 2BPA2 4NPRA 3U07A 5FLIA 1J3PA 1YI7A 4KG8A 2JJ6A 5DZEA 3HQXA 4LKEA 4YZ2A 3O1UA 3T4HB 5I93A 1YC61 5GLTA 1H4HA 2A6YA 4LA2A 1Y4WA 3TRSB 4GQ7A 3QOPA 4N8MA 3ZYPA 3ACGA 1RTVA 2GSYA 1W9SA 4HN0A 3O1MA 3VLBB 2P4EA 3HBKA 3J7NA 2BFUS 3FHIB 3OTFA 4XFAA 3RMXA 4CDWC 2ZHKA 2WWSA 5CFDC 3KB5A 1DLCA 2A75A 2VMFA 3J7MA 1PK6A 4GH4C 4F83A 1US2A 2ZHNA 3ZXFA 2WAOA 4WM7B 2D3SA 4L0PA 4MHRA 3TN93 5C4WA 3THTA 3VDDA 1BQPA 1W06A 1WWYA 4COWA 2IXIA 5FZBA 3W21A 4LO5B 4XFHA 5J1XA 1OD5A 1MS9A 2NMOA 2UY8A 3I59B 2WO7A 1VBB1 2OQ6A 4GH4A 3URFA 2P6HA 3KV5A 3ZDVA 1PMIA 4Y1ZA 4MZUA 3DPRB 2F4PA 3LZZA 3N9PA 4QGNA 1PO23 4CU8A 2E6VA 3IAPA 4LE3A 2XDVA 3L2HA 2V09A 1DFQA 1KQRA 5J98B 2FCTA 2XBO1 3KCCA 4R4XA 3AJZA 1GOGA 5FRAA 3PLQA 1DYKA 1WCUA 2E33A 2B39A 3WCRA 2X10A 5C3RA 1CWPA 1N3OA 1J3QA 1HXS1 3OBTA 3DUIA 4MVTA 2R062 2B9UA 3OF1A 5HBAA 1PVXA 4XJAA 4PIYA 3MI8A 4BMBA 4DUXA 2JG8C 3V65A 4E8CA 3ZFEA 5C8WA 5EJ3A 1PM4A 4K1YA 4LBJA 4MH0E 5FO7B 1EPWA 5CAZA 1ND3A 3F95A 2R043 4NAMA 3PUIA 3H7YA 4CCMA 3IWZA 4NIDA 1D7PM 3TEYA 4IE0A 1CAXB 2IZWA 2ZXQA 3CO2A 4TWTA 3I3DA 3KS7A 2MEV3 3NO8A 1NZCA 2K2SA 1R093 2XOMA 2FCUA 5HXMA 2C6SA 3ECQA 1H9PA 1MZEA 3UKVA 5DUVA 2AEYA 5DUWA 1SDDB 3OCPA 2QQLA 5K0UC 3LWCA 4ZU5A 4GZ9A 1ZM1A 2RM22 3ZYHA 2XVGA 2AH2A 3FBMA 5GLZA 4Q8LA 2NQYA 2QCSB 3PMEA 4HSLA 3VDBA 1F4AA 2HWC1 2IXKA 3GJAA 5IW0A 1JYXA 1WMDA 3T1LA 2VD7A 5GLVA 3VZLA 5JZGA 1O8SA 4AQSA 4FFGA 5JOWA 3EHKA 4Q4Y1 1QJX1 2Y38A 2WA4A 3SCGA 4RGGA 1RUNA 3KHCA 3QLQA 1OKQA 2V4VA 5EPAA 4RQPC 1WCQA 4COZA 3IDBB 3PMSA 5CKNA 3AC0A 5BPXA 3WDWA 1RUOA 4QXHA 5JXJA 1POQA 2CAVA 1HQNA 5FXVA 1RB8G 4IV1C 4FAHA 2JENA 4IDZA 4L11A 2WZPP 1RC6A 2NN8A 2VUDA 3KT7A 4YM2A 2E9QA 3MPPG 2QQIA 2BERA 4BXFA 2W47A 1H8VA 3VHRA 4AQ2A 3NAPC 1UMZA 4RS5A 5C5UA 4KL1A 2TNFA 1S0DA 1NG0A 4KNCA 4QGMA 3FHQA 3HQUA 4NAOA 5DAXA 5KXDA 5LASA 2GC3A 3MIFA 1E5HA 4OHZA 1O4TA 1MEC3 2WLPA 4NHKA 3B01A 2JWPA 2BOJA 2ZHMA 2XB6C 1W3VA 2PHUA 1DYOA 2BP6A 2BGOA 3PU8A 4JGZB 4QGLA 1QNWA 5FMCA 3ZR5A 4BHPA 1G9DA 2QQPA 4HN1A 4QM9A 1BBT3 4AEJA 3UKNA 2AUYA 1YLLA 3I3EA 2OKXA 1CR7A 2G9GA 5T50A 1RUG2 1D4VB 1OURA 4XILA 4ZKTB 2XKPA 1SDWA 2VC9A 4E2SA 2W46A 5FPUA 2XHKA 1T6GC 3H8UA 3LPFA 1DQ4A 4AFMA 4BISA 3R0RA 5KHIA 5FXZA 2D6MA 2WBKA 2DVGA 2YPDA 4XFGA 1O5UA 4IEUA 5C5TA 1H6XA 1PO13 1QQP3 4OCTA 1OXCA 4IE5A 5FY9A 1JHNA 5H9PA 2RR11 3WDVA 4D7YA 3VDCA 3DKWA 3WVJA 4EZ4A 4PDWA 1DQ6A 1RVF3 2ZABA 2GMPA 2VOXA 5BNNC 3K46A 5L9BA 1LB2A 2D6KA 2Q8CA 1CAVA 2WZR3 1W9TA 4IEZA 3SLIA 4ASMB 3V0AB 5FQ0B 2HKXA 4GA9A 4LR4A 4DS0A 2BW8A 2P5BA 2GP3A 2QZ3A 4OHXA 4K7JA 5AC91 1APNA 5D2AA 4QQ2A 4YVSC 4I0BA 2OA2A 3WNPA 4XDQA 3HNYM 4HL0A 1OSGA 5FKBA 2GC0A 4M0NA 1CJPA 1US3A 2VW1A 3SITA 4XUTA 3EO6A 5CA6A 5HCHA 2PHXA 5ISLA 1IKQA 2JB8A 2CGOA 4H7LA 2ZGUA 1VAKA 3G7DA 4AHYA 1K3IA 5A7SA 1EUTA 5FPBA 4FFIA 3CDZB 2DUPA 3FUQA 1ZZBA 1SLCA 1JN2P 4XABA 2Y6LA 4HETA 1F4HA 2WT1A 5ACA1 5DN2A 4QQPA 1NYWA 4CDXB 4BQ5A 2NLRA 4HKLA 4ES8A 2VCAA 3EYPA 5K8SA 3MV11 1DGWA 2FDJA 4Q4V1 4GMP1 3C7HA 3NAPA 3LCPA 4WZCA 3E1F1 2Z4FA 4WM8C 1PMJX 3UGFA 2EF6A 1GWMA 1ODNA 2EXHA 4YRDA 3MUY1 4LK6A 3SISA 3VBUC 2AC1A 3LDRA 3SCFA 4M01A 4PQQA 1C1LA 4HLTA 1S0IA 1S2KA 4XF3A 1L7RA 1GP6A 3C7FA 4DXZA 5D8AB 4XJWA 3U0ZA 2RHPA 2WZR2 4LKSA 4YW7A 1LGCA 1MVEA 4KU7A 1XJAA 1OH3A 3ZYFA 3ZYGA 4C0BA 1KS4A 2WNUB 3H7JA 2EIEA 4K6BA 3T0BA 4C90A 2D6NA 1YJKA 4GJZA 1UXZA 3GF6A 4GULA 2MEV1 2W1WA 1UMHA 2DUOA 1LENA 1UOGA 4CCDA 2FMDA 4AEDB 4CSWA 5J3UA 2W1UA 1WBFA 4B8EA 1D2QA 1PK6C 1UOBA 1W6MA 2RE9A 3PVOA 3TAYA 4JAAA 2VR4A 1OLME 2WC2A 4XPVA 5JIAA 4AFDA 2FDGA 4M00A 2VJXA 4XQDA 5AVAA 1SBFA 3MPBA 4AAPA 5CFCA 4XJZA 1BHGA 1OBNA 3LFIA 1DYPA 4NRPA 2RR13 4ES9A 4C1WA 1PIV2 4UW5A 4P5YA 3THCA 1IG0A 5EV7A 3K77A 5EHDA 2ZX3A 1XYPA 4WM8A 4BIFA 4CCEA 1WBLA 4XCBA 5E88A 4QWNA 3USUB 1O4YA 3NL1A 2C5DA 3ZYJB 1FOD1 1Q8PA 5I8YA 4ITCA 4Q4W3 3AZWA 3M8LA 5LZ6A 3PNAA 4JQTA 3NRUA 4W4ZA 3VZNA 1HXS2 5EFUA 3VBRB 3QACA 4BM8A 2PELA 4XURA 3AJYA 2A3XA 1C3HA 3T2QA 3EQEA 1YHFA 1DZRA 1YQ6A 2WKKA 4TLGA 2X09A 4CEYC 5C3SA 5FYMA 4CDQA 2C24A 3ZFFA 3CBNA 2ZEYA 1VBB3 1NXMA 3MLKA 3ZSEA 4BJ0A 5A3LA 5FYBA 1RMU1 4XF0A 1W9YA 4YM1A 4HSJA 3PL0A 4V2VA 5F3CA 5LK5A 3J8F1 5GM0A 4YARA 1UZZA 5H9RA 2EIBA 5LBFA 2VMCA 3RSJA 3C2UA 4PCRA 3AXDA 2QQUA 3WNLA 4WVZA 4Y22A 4JCKA 3ILRA 3WQ1A 3VKNA 4IW3A 4LKFA 1GNYA 2CDPA 1JMUB 3FLRA 5BNOC 2EALA 2QJVA 5KHJA 1QOTA 4XDPA 2PQSA 1IHMA 2UU8A 1ZYBA 3H1YA 1XB9A 5A6XA 2F17A 3ZXDA 2PHFA 2ZZQA 5J7MA 1RUD3 3A0NA 1B35B 5F5AA 3KGZA 4OLLA 3K3NA 1YIFA 5EYYA 3U1XA 2MEV2 3A23A 2J1UA 3OB8A 5LA1A 2QQKA 3PTYA 4Y1XA 1FMD2 5T3NA 1BMV1 2W92A 4ZPIA 2JDUA 1TME3 2RJKA 5DG2A 5ERLA 3VHPA 3MLLA 4Y5Z0 2ILMA 4O9GA 5C4WB 4ONUA 1DGRA 2P17A 4CUGA 3TEXA 1QU0A 3RZZA 2RDRA 5A6YA 1OT5A 5E1RA 4E8DA 1AVBA 2E53A 3JBG1 4XQWA 1Q8OA 3NJZA 5F3GA 3U37A 2H6CA 2V72A 4L97A 1D2SA 4IXLA 1REFA 2C0ZA 2UWBA 4QKNA 4A45A 2VUCA 2VTFA 1JZ4A 5CVRA 3GDBA 4YNIA 4QPIC 3EJKA 1JYNA 4QDSA 3WINE 3B00A 4Y3OA 4AGVA 2QFEA 2WFF2 2AACA 4YFWA 2WR9A 1YYNA 4LPLA 1P8JA 1D4M3 2HWB3 4RQPB 4WBBA 4LKDA 5CFDB 4CA9A 4IE7A 1YQ2A 1DQ0A 4OYUA 4OQ9A 3M3OA 1J3RA 2P37A 5JCTA 4XF9A 2VNRA 4AVAA 4WV8A 4HVRA 2VAUA 4FPHA 2QQWA 3VL9A 2A3YA 3ZXAC 4Q0UA 4UT5A 1QDCA 4QQOA 1SFPA 1URXA 5FZOA 4BE3A 3ES1A 1AL0G 1PX4A 1E5IA 2JE9A 2DU0A 3FL7A 1DHKB 4GWMA 1IG3A 1YO8A 2ZGNA 2XJUA 4XBQA 1AL23 5IAVA 3ZIWA 1LHOA 1HB4A 1PK6B 2DU1A 3JD73 4YVSB 1GNZA 4GXLA 4PQ9A 4AR2A 4A7ZA 4FFHA 4J1XA 5FY8A 1YEWA 4IE4A 3GHMA 3I7DA 4JTNA 5FUIA 4CDUC 4ET7A 5I8TA 1IS6A 4LHKA 2J1VA 3LD8A 4LQRA 3ZKUA 5JPMB 2IFRA 2JD9A 2DFBA 2VZSA 4K21A 4MOAA 5FZ3A 5IVVA 4RYDA 2XJRA 2CV6A 4IEXA 4XFBA 3VL8A 5IJRA 4DY5A 3HQRA 1GLHA 2Y60A 5FP9A 4I09A 3DXTA 5FK7A 1X36A 2JDYA 1G9FA 4MGYE 3ZX7A 1GKBA 3X29B 3U14A 4LOTA 2JDHA 3HNBM 2QQJA 1VBB2 1O59A 4AFAA 1LU2A 1PVC1 4LULA 2RJLA 5DG1A 4AVCA 4NR1A 2TUNA 2AEZA 3OEBA 1S1AA 3P3PA 1HV0A 1V6LA 1SCSA 3POIA 1LOBA 5IVBA 3W5MA 2Q1FA 1J83A 3H3ZA 1IZ3A 4CU6A 2BNOA 3WHUA 2X29A 3LA7A 4WZFA 2PMWB 4DNYA 4HKWA 3U4SA 5T5OA 2LUWA 4XFCA 3J4UH 1VE0A 5BY5A 4CDXC 5HV0A 3S0MA 3T0DA 1GP4A 3J26N 2NP0A 1YCIA 4COVA 1YQCA 3GCWA 3I2OA 4MGIE 1RUH1 4DB5A 2W1SA 4JV4A 2UURA 4D94A 1GZ9A 5IWFA 4XJ9A 3PVBB 1QHDA 2JG8A 5BNOB 2ETEA 5A6ZA 1R1A1 3WUCA 4NRMA 1BYHA 3MZHA 3VBHA 3CU7A 2D6LX 4X6QB 3K75B 5FZ9A 5M0TA 5BUVA 2NM1A 4IUGA 4M4RA 1IGOA 4YM3A 1HIXA 4JQRA 2OYZA 3IIAA 3DYMA 1OUXA 3NKTA 1RUI3 1WD4A 1ONAA 2XJSA 2HH9A 1OUSA 5DZFA 3T2TA 5DMYA 5A3OA 5I91A 3WDYA 5T54A 2W08A 3ZXKA 3N4MA 4CP9A 2BWCA 1NLQA 1O5LA 3ZKYA 3KT4A 3T08A 1C57A 1NUKA 3ALQA 4Q4W1 4MXVA 2ZA9A 5FZGA 2ARBA 1PX3A 4PF1A 1RXFA 1XRUA 1LOFA 3OGVA 2BGCA 2OW4A 3E6DA 5JVVA 3JBG3 4AK3A 3RGBA 1GFF2 2DDUA 4EE2A 1F9KA 5T55A 1RUF3 1UPIA 1PZ9A 4N53C 2WNVC 1DQ5A 1ND3C 5FZ1A 3WNNA 1U0AA 5I8SA 5K0UB 2A73B 4CUAA 3D4KA 4KGGA 4LXLA 4NE9A 1RGSA 1BZWA 3OBRA 3T4VA 1QH6A 1RUG3 4YGEA 5L36A 2XPJA 3O7OA 5IATA 1AR81 1SLBA 3QD6A 1HRI1 1PNFA 5FY4A 1PIV3 3VBFA 3OBAA 5J48A 3IMMA 1VALA 4XAEA 4UBGA 3PTRB 2ARXA 3HT1A 1X50A 1GZCA 5C3OA 4ZHNA 5BYNA 1B35C 1H2MA 4EYUA 2GN7A 2LTNA 2XVKA 3HJRA 1F5FA 1W2UA 3N36A 4QX1A 4Y5TA 4Y1UA 5I0DA 1CAWA 3QH6A 1TMF1 1CGPA 3NV4A 1QJU1 3IT8A 4KQ7A 4HK8A 4Z1VA 3DV8A 3AKPA 4Y4RA 1SPPB 4NIIA 1ZBE3 4HBNA 3E6CC 3UK9A 4NN0A 2DTWA 3LA3A 5FZKA 3RDIA 5HCFA 1NCRA 2VZ1A 4FBFA 4CXYA 1Q43A 2PFWA 3NNGA 4R9CA 4W65A 3IPVA 1W6PA 2E26A 3J8F3 5F7UA 3AMQA 1RHI1 1QXJA 2KM2A 2G1MA 4BWOA 4LNVA 4PIXA 1RL3A 3S57A 4X6RB 5GJ6A 1DLLA 2ZJCA 5CKMA 3WNKA 1NCRC 2ZAAA 3MBWA 1VBA3 1F2NA 5EIYB 2VECA 3RJRA 3O1PA 5C33A 5A1AA 4R9BA 1I6XA 3AMHA 4AI9A 2ZTNA 3ME2A 4B4RA 3MW4A 1RUC1 2RS51 1W6OB 2LALA 4BZ4A 3VHNA 1OHFA 4LBQB 3IMNA 4RL7A 1F5JA 2EICA 4A6OA 5IVJA 1SLTA 2JE7A 4YVWB 1DG6A 1HQWA 2A6WA 2R072 1ZA4A 2W39A 3OPZA 4KWUA 2YGMA 1LCLA 3HEIA 4Q0PA 4XJ8A 4XJUA 4ZS2A 1J1LA 3M2MA 3ZN5A 4NJ4A 2YU1A 1AXYA 4GKYA 3CIHA 3AP7A 2MPFA 1W8TA 3AYAA 3PIGA 3EMRA 3SKJE 4AI8A 1JHJA 5GZDA 4PLNA 3BTYA 3N9NA 1VJ2A 3WP3A 1VBC2 3J8F2 3M7AA 3VBFB 1HN0A 3EXUA 4QKBA 5DAVA 2PN5A 1OQEA 4ATEA 4FPLA 1VMJA 3ZFGA 1ENQA 1X9PA 3MYXA 5DDJ2 1CX1A 2AR6A 2IVIB 2W94A 2YUEA 4QB2A 3SH5A 4CDWA 2KD7A 2WO1A 5TSWA 1SPPA 3ZFEC 4QU2A 2WS92 3JD71 4XACA 4COYA 1COV3 2ZS6B 2VQAA 4KI5M 1MS1A 2WYSA 5ABJB 1LHWA 4Y26A 4AQTA 1C8NA 4BYYA 2WN3A 5FYYA 4CYDA 1UNBA 3POEA 1MQTB 1W9WA 2R32A 1XSQA 1UD1A 2HYKA 3ILNA 1OQDA 4SLIA 4A6SA 4D6SA 3D82A 3NNFA 3C7EA 2VMHA 5JXHA 2VW0A 4RGKA 3OUJA 1YJLA 3THPA 4CPBD 2YMZA 4YW2A 4R4ZA 4X8NA 1MVQA 3WV6A 2RDNA 4JC1A 1XE0A 2G9FA 2RVAA 1D4M1 2HWB1 4KGQA 1AR91 3LEMA 5A3WA 4P00B 1AYN1 1TE1B 1U5XA 3BPSA 3MICA 1TG7A 4NHMA 3VBSA 2DUQA 1BVP1 2VU9A 4BH9A 5CFDA 1BBT2 2WA3A 3CZUA 3CZJA 1FOD3 2DCKA 4M3CF 2IFWA 1U5IA 4AFCA 3U11A 4IEWA 2WJSA 1QJY3 4ZONA 1NLSA 1YQ8A 5DAPA 3JD72 1FX5A 3INAA 4QPIA 1YNAA 4ARYA 3GHNA 4CE8A 4DO0A 4FTEA 5A6QA 3WXPA 2B9VA 5SV8A 1K5MA 4ZXKA 2Q8OA 1VR3A 1HRV1 3BTAA 4CEWB 4D6RA 2XUEA 5LBCA 4NOTA 1G9AA 3WR0A 4LE4A 1NKGA 3DCQA 1QJU2 1ASJ3 3I3BA 4K20A 1S0GA 3AYCA 3OEAA 2XLGA 4J25A 1WMFA 2PAMA 3O1RA 5LA0A 4ZS3A 2G9ZA 4R9AA 4WVMB 4A42A 1W9FA 1JTZX 3ON7A 1NE6A 1RINA 3ZSLA 5FY1A 3N7MA 4QX8A 4RHV2 1RXGA 1WMEA 5FLJA 4YZ3A 4LUMA 4CP2A 3RZMA 1O3RA 1PHMA 1X9TA 4QX3A 1LEDA 2VZTA 4AXOA 2TBVA 1O4ZA 1GOHA 1NZIA 2D43A 2JG9C 2B5HA 2YPJA 2WSVA 3K2OA 4QPYA 2D5HA 4OZXA 1JUIA 1JUHA 3KCYA 4DMIA 1NA1A 1XSRA 2WZ8A 4XEZA 4FOVA 1WZXA 3JQXA 3EBRA 2VOKA 2ZHLA 5G05L 5AFEA 2DVBA 5FFOC 3MIDA 2GAUA 1WLCA 4HPKA 4AHWA 2JEMA 2BGPA 3T30A 2I2SA 1RVF1 1FMD3 3R05A 3WQ0A 4I3PA 5HI0A 5EP9A 2WS91 4P9GA 3LF7A 4LBOA 2KXLA 2WZR1 3AKTA 2Y34A 3C8XA 3KD4A 1BK0A 2B7YA 3H3UA 3K3OA 2Q30A 2VMDA 1TNRA 4H7MA 1MZ5A 4YW4A 3ZXGA 2AGSA 4LBQD 2P3JA 2ZBJA 3K51A 1JOPA 4Q5OA 1PGL2 4CEYA 1W6OA 2GMMA 2ZGLA 4RD7A 4XAAA 4CTEA 5FKCA 5FO9B 5A33B 2BRTA 5IVYA 2X05A 2EIGA 4B4PA 1UX6A 1MS0A 4CCCA 3POYA 2CTVA 4LHLA 1FMD1 3OUHA 1A8MA 1H1MA 3N9OA 3MUZ1 1W2NA 4EJRA 1CAVB 3WW2A 5LWBA 1JODA 5HCAA 4Y1VA 1VRH2 1LRHA 5D1IA 3KQ4B 5CBLA 1AR93 1OH4A 1UL9A 4MGSA 5AC93 2X53S 3N9QA 1D4M2 2HWB2 1OVSA 4V1PA 5DQ0A 5LA2A 1I5PA 4B3NA 5A1LA 2HWD1 1AYN2 3ETPA 5FJHA 5CFCB 3O1SA 4MUVA 1XXNA 4UW6A 5EWSA 4P9XA 4BQ3A 2ZKLA 2ET1A 3TYJA 5JPNB 3W58A 4BB3A 1CQ9A 2ZX0A 2ZGRA 1W8OA 3AKQA 1OOPA 2G4IA 1HX6A 2DTYA 4Y5SA 2JX9A 2YXSA 4FOQA 3RMYA 5FK8A 2B45X 2VVDA 1PGL1 3LDBA 3ZXEA 4GD4A 1SCRA 1ASJ1 5HCBA 1LOFC 2LROA 3NJVA 4CZSA 2RR12 2Y6GA 3K4AA 2ZX4A 1RUE2 2DYCA 1WA4A 2IVJA 3AP9A 2ZGKA 4YGDA 1UY1A 2QDRA 4Q4V3 4TZDA 2W87A 2Y64A 4Z2AA 4HK9A 2DFCA 3AXEA 1L7LA 2X5IB 2UWAA 1LU1A 5IVFA 3BTXA 1TVGA 5FTTC 4LUKA 1EV11 2ZZJA 3WY6A 1RHI3 2R073 1BMV2 1VRH3 1VAMA 3CF6E 4UFHA 2HBUA 5FPXA 1LR5A 3AZXA 3TOJA 3MF6A 3ZYRA 4CUBA 1BCXA 4CDUA 4P14A 5FR3A 2Y6KA 1AX0A 5KHKA 1WLWA 2RMU1 4CP9B 1YFWA 3AYDA 1EAH2 4FPEA 2L9LA 3RG0A 3T3YA 4RR3A 3WG2A 5FYVA 1QJU3 2WNUA 4DQAA 5JIUA 2RS53 4HT1T 4K8FA 4QKFA 1ZRCA 1W3XA 2VXJA 5C8CB 2R041 2PAKA 3ZFGB 3OOXA 2CWMA 1OVPA 2XQRA 2PLV1 4FQ4A 2D98A 3QCWA 3WG1A 4N90A 2ATFA 4IETA 3JB4C 4QPIB 4A7YA 2DBIA 4Q29A 3TN91 4Q8KA 2ZEXA 4EWDA 4CVUA 5T5PA 4MLOA 1GUIA 1ZA7A 1AR83 4AVSA 1ZRDA 3KM5A 1HXS3 3AZVA 1F31A 5I0SA 2OQ7A 1WLDA 5FP3A 4GB31 1I3HA 4UOJA 4AFBA 1SMVA 3VD4A 5F39A 1NAEA 3ZFFC 3GZAA 4OUSA 1UAIA 3SH4A 3MIHA 4P9YA 3LOBA 3ORJA 4URTA 1QJY1 1MQTA 2UY9A 3B93A 3LIHA 3H3LA 4Q4Y2 3V64A 5FY7A 1O91A 1TMF3 2ES3A 1DU3D 1C8M3 1KFUL 3I2FA 2FD8A 3N35A 4AQ6A 1KFXL 4IEPA 3ZPOA 4RS5C 3I4IA 5JR7B 2ADEA 1GWLA 4M3CB 4AW7A 4RHV3 1HW5A 4KWKA 2VMIA 3D6EA 2HEYF 4GWJA 1VBC1 4NRQA 5F8PA 1CZVA 1CAUA 4QXKA 1PIV1 1AYN3 2DWRA 2KA3A 3NW4A 3PUSA 5FZMA 1HRI3 2JD4A 1AXKA 1V00A 2W2IA 5GLWA 5LBEA 1S4CA 1AR92 1KJRA 4HZFA 4F8AA 2HLEA 5A3NA 4QPGC 1KEXA 2J1SA 3S7IA 2BEOA 2ZPXA 1OLMA 5ANQA 3WF3A 2VVFA 1KGYA 4UFMA 2J1EA 3GALA 4OMCA 4CDXA 3ABZA 4FVVA 4Y24A 1LGBA 1RUF1 3E5XA 5F5IA 1FPN3 4MO3M 2QE3A 2OZ6A 1DIWA 3WEZA 4OI2A 1XE7A 4B7KA 5FAXA 4SBVA 2VZPA 2JDKA 1PO12 4NPLA 1KDKA 2WFF1 4B7EA 3IZOA 3BALA 4CCNA 1TZOA 4AI0A 4MX3A 5FXWA 5D8AA 2RJ2A 1V6IA 3ACLA 3AP6A 1JS9A 2YU2A 3CJIB 3UJQA 1VBA1 1OA3A 1A6CA 3LPGA 4CP0A 1LAJA 2ARCA 4XIKA 1ZZCA 4FPJA 1S0EA 3ASIA 5DAWA 3VBRC 3O1TA 1QJX3 3VBOA 3KVAA 3GBGA 1V0AA 4NVPA 3LFMA 5GZFA 5E8AA 4PI0A 2Y6FA 2V73A 4P9JA 4PJYA 3JB8A 3HVDA 4AAXA 1XE8A 4B4QA 1R1A3 5DZGA 3JCIA 4LLOA 1PZ7A 4AVBA 3CJIA 1K12A 3Q8BA 4CDWB 1D0HA 5FJKA 2C9AA 1I9RA 1JI6A 4FP3A 5FYZA 4N43B 4DUWA 4Q0QA 3GYDA 4YM0A 2W91A 4JDMA 3ROUA 4F7ZA 3ENRA 4D0QA 1ODMA 3TB0A 1VAVA 2R042 1HJGA 3CL1A 1AUYA 4FPOB 3O1VA 1H30A 2A6ZA 3WSOA 3DECA 4K40A 4RS5B 3I8TA 1GBGA 3KZ4C 1V6KA 2A7AA 2IC1A 1G7YA 1LOAA 2KR2A 2W52A 1EUUA 1XNCA 2WRAA 2MHFA 4JKMA 4BK5A 4OZOA 3E6BA 5IT6A 3I97A 2GN3A 2VQTA 4EV0A 1BVVA 1KITA 1X8MA 3BB6A 5EJ1B 1W99A 5FP4A 1DP0A 4MXWB 1FT9A 2A3WA 1XOYA 4XBNA 5G04L 2H6BA 3HNMA 4ISQA 1NCRB 3ZIXA 2Z5WA 4E2QA 2D93A 2YHJA 2XVLA 3T2PA 4EN9B 2OPWA 1CONA 1OFNA 1GU3A 1V6NA 2V5DA 2WAAA 3CEWA 3Q8EA 3J7LA 5FREA 3ZSJA 5JUVA 4DY3A 3D3AA 4EZHA 4CCLA 3UYJA 4YW1A 3RJ2X 3C7GA 4MHUA 2RDQA 3N3HA 4L9BA 4PT6A 2JDMA 2WO3A 3BTZA 3D0SA 3GJBA 2XJQA 3KGLA 4P9IA 3FWEA 2VY0A 4BQYA 5K7PA 5FYIA 1QEXA 2FDHA 3OPTA 1Q8VA 3OUIA 4LBKA 1FOD2 1OF3A 3AP5A 4QKDA 4W6WA 4AG4A 4D3WA 3LEIA 3NNMA 3VD3A 1UYXA 3KWVA 3BIEA 3LSDA 1H2NA 3I2DA 2HWF3 1C28A 4TYSA 3HAGA 3UETA 3ZN6A 4Z82A 1XPWA 5BNPA 3RYPA 4AVTA 3BUCA 1CN1A 1H8TA 2DCYA 2CY6A 1JU4A 1S2BA 3RFRA 1CAXA 5CNAA 3DEMA 3WQBA 3NV2A 1LTEA 5FUPA 1Y9GA 2Q8DA 3NNJA 2XH6A 2P1BA 2WQ4A 1WCDJ 1RUF2 1CD3G 1SHWB 4FPKA 5FMOL 5JAXA 1SFYA 1IPJA 3BN6A 1HRI2 2J22A 4AVVA 5J36A 1E5RA 3IKWA 1JZ7A 1ZREA 4MGTA 5I0UA 4JGYB 3SEPA 3WX5A 4C91A 2OPKA 3FMGA 1H2LA 1ZBA2 2Y33A 1W39A 1VMFA 1UW8A 2X8KA 1FPN2 2OUHA 4IV1A 5FZLA 1EV13 5KBFA 3CNAA 4FSJA 2P3IA 2RS32 2VOTA 1Z7S3 4L99A 5F3IA 4IERA 1OOPC 3DXUA 4LBNA 1K45A 2OZJA 2VMEA 2JKXA 3QH7A 2FZ1A 2VZ3A 3MEPA 1UOFA 2GMEA 4GALA 4OUMA 3VBSB 3VKFC 1U12A 5L9RA 3IIIA 4K8RB 1Q5OA 1UZYA 3TEZA 4MYEA 5F2WA 1EYBA 1UZVA 2WYFA 3NAPB 3OBZA 4JZRA 5EXOA 5FY0A 2ZGOA 1C8M2 2E31A 3ZLIA 5IVCA 3CMGA 4PI2A 4RQPA 4CP1A 1GSLA 5IAXA 3W9AA 2VCCA 4LORA 5CB7A 2IUWA 3VBSC 2WNOA 5LRRA 2OVUA 3SQOA 3RZLA 5APAA 5FZ6A 2Y0OA 2HJIA 2WFPA 2XL9A 3HN1A 4DINB 1OA2A 4WVWA 1J59A 4P02B 1Q3EA 2XWJB 2CL2A 3B69A 5A33A 4CUCA 2D97A 2YV8A 1ZVFA 2WNUC 4UW3A 4D7SA 1Y3TA 4BXSV 3UGGA 4TXWA 2CGNA 2P6CA 1UY4A 2JG8B 3LSEA 3ZO0B 3NWKA 3GGLA 4DEQA 1ZZ6A 1PVC3 1E5SA 1K42A 4OHWA 4HANA 4YG3A 4KMQA 5A80A 1I1EA 1CZSA 2JKBA 5ABJC 3WLUA 3ZXLA 2O8OA 3A4UA 1W0NA 4RR3B 3ZSKA 5BNPC 1JZ2A 4OULA 2VQ0A 4Q4X1 5LY2A 4Z92B 1NA1B 3AFKA 4IV1B 3HWJA 4LLFA 1Q8QA 4KG0A 4JKKA 1SBEA 3AVRA 3MFAA 5ABJA 2VCMA 2YFUA 5LEKA 1UXXX 3VZKA 5IVEA 1ENRA 4EROA 2ZEWA 3VB9A 2N7GA 4XC9A 1UYZA 4G3YC 1AR62 2FZ2A 2CNAA 1YI9A 1XBFA 2YGLA 4DUVA 1DQ1A 3MW3A 3PJQA 4XVHA 1QJFA 2PHWA 1L3JA 1QH7A 4WVMA 2D3RA 1FNZA 2P34A 2VOVA 2GC1A 3GZTB 1RUE3 1ULCA 1W8NA 4C1XA 1JXNA 1GYKA 1RUJ3 3D0JA 5L73A 2E51A 3V0BA 2I45A 3IAQA 1IS4A 4E4HA 2B4KA 3HIFA 3RPQA 3MW2A 4OVEA 1WCSA 1W0OA 5LB6A 4NPMA 3WT3A 4WM7A 2EAAA 3VDDB 4YFZA 2JIJA 3N7LA 5DXDA 3ZFFB 1QMJA 2LS6A 2R6QA 3N9MA 4I30A 5FZAA 3TNQA 1SZBA 1OKOA 4CU9A 4Q0VA 5F32A 2YYOA 4AHZA 1GZWB 3OGGA 1W03A 2PHTA 1UN1A 5FUNA 4OHYA 4QQLA 2WNVA 5FPLA 2WLQA 1QOSA 3WNOA 4HPKB 2IWGB 4S2GA 4XMAA 5HXVA 3HOBA 4IGOA 2JDPA 4EN7B 2NPIA 4B29A 1IPKA 1AR72 4W50A 2RMU3 4LBQA 2HWE1 1HRV3 4N43C 2W5FA 4QM8A 4FP2A 4YG6A 3MIEA 2O8QA 2XONA 2R16A 5C4WC 1ULFA 3LA2A 4AOCA 1GQGA 1TME2 2EXIA 3LIGA 3AZYA 4LT5A 4YZ4A 1ULDA 1WLTA 1RUE1 4YWAA 2AREA 1V9U2 2ZGMA 1RMU3 2RS12 1N1TA 1GNHA 4IV3A 2OIIA 4UI9L 3ZFEB 4K3UA 2H0VA 4BMEA 2XJVA 4XZUG 4Q2FA 1TME1 3C7OA 2Q1MA 1KS5A 5BXXA 3N7KA 5FCCA 2X5IC 4AEKA 4I0WB 4PIZA 1X33A 3MIBA 4ASKA 5C3PA 5FYSA 5LCWL 2LRPA 4DZGA 1OF4A 4XXPA 3MIGA 2UYBA 4A7KA 3AL6A 2A5ZA 2FDIA 1EPZA 3J7HA 2JE8A 1SACA 3PUHA 4EN0A 5L7OB 1LESA 1PMHX 4XUPA 5JI9A 4FI9A 5KXBA 3TBDA 3BODA 3RI8A 1H0BA 4XETA 4HKOA 5C70A 1JW6A 3O0WA 4ORFA 2VBBA 1ZRIA 2I07B 5F37A 2O14A 4NMIA 2HWD2 2Q5TA 4XE9A 1CAUB 5JZGB 3VHOA 3R4SA 2HWD3 4ISRA 4I02A 3O5SA 4YYOA 3VBRA 4MGKE 1UOJA 1R64A 3N9LA 1W6NA 4UWDA 3VGIA 1EV12 4ASLA 1CESA 2WDBA 4DRVA 5CG9A 3UNPA 4GWIA 4Q4W2 3NMBA 4H2AA 4UFJA 4CEYB 2DVAA 1FXZA 2E7AA 1QQP2 2G19A 2ORXA 5FBJA 2BJSA 1BEV1 2Z42A 1K5MC 4YSFA 1QJY2 3GZUC 4HG6B 1LJ7A 1LODA 1OI6A 1WA6X 3Q8FA 2ZGPA 5E6HA 2ZX2A 1IS3A 5FOBB 5IFTA 4I2OA 5IUQA 1AYM1 4IGPA 1G8WA 4JX0A 1BEV2 1WGPA 2W0XA 1WD3A 1OPMA 4J1WA 3ZYBA 1UX7A 3ETQA 4HXCA 1H1IA 3POBA 1QJX2 3KLSA 3LEKA 2Y6JA 4E27A 5AFBA 1Y7BA 4Q4X2 4A41A 1LNSA 1XU1A 5C8CA 1FV3A 2ENRA 3Q8CA 2YZ4A 3BOWA 1FAYA 3P5BA 4FOWA 1ND2C 2J1TA 3JUUA 1LGNA 5C9AB 1LOGA 4A44A 4AI1A 4E4SA 3H50A 4YW3A 1JYTA 5ACA3 1Z7S1 1ZBA1 2GH8A 1X7NA 1VBD1 5C6CA 4HVOA 1LOCA 4KBBA 3AVSA 5EJZB 5JI7A 4NHYA 5KXEA 1RUC2 4QMAA 3DPRA 4JRAA 3CJXA 3GCXA 1Z7S2 3RWNA 4XUNA 2RS33 3BYWA 4GAZA 1GOFA 1REDA 3PDQA 2H0BA 3MO4A 4AWDA 4LHNA 4UYBA 2YBSA 2W9XA 1GR3A 4TN7A 2JDAA 1R1ZA 1R091 1X82A 2B42B 2O0OA 4XYXA 2JG9B 5A1FA 1Q8SA 1Y43B 2R7EB 1CPMA 3G6JB 5KWRA 4M0HA 2VZUA 4UBHA 4FTBA 1Q56A 4JDNA 5DUXA 2VTXA 4EWAA 4H14A 2QTWB 4ARXA 1C4RA 1DGLA 2DURA 2WABA 4V2WA 5JSPA 2GP5A 4CXWA 1LULA 1J84A 5FZFA 4GMP3 3FJSA 3RVHA 3V56A 3FBYA 5DDJ1 1NCQA 4BK4A 4B1LA 2QQNA 5FYCA 4AI3A 1UO9A 2ET7A 1ZZ7A 1U5YA 1QQP1 2WWUA 1PO11 4RN5A 4YVWA 2E32A 3BOPA 4RFRB 4BLJA 4N9IA 3B9IA 3OGRA 1N3PA 1DDLA 2BOIA 1O3QA 1UZ0A 2WNVB 5T52A 2K9ZA 3Q8AA 1YRZA 1XU2A 2IXHA 2PXJA 1WKYA 2XBO3 4FO9A 1QXPA 3RQ0A 4HOOA 1PM7A 2FQPA 1NQDA 2E7TA 1RUJ1 3B94A 3POWA 4I01A 3O0XA 1AX1A 1OQ1A 2BQPA 2VVEA 2XGXA 3C3VA 3A0KA 3LB9A 4MV2A 3DL3A 1GICA 4KH9A 4EN8B 5CFCC 3VBOC 1H4GA 2YC4A 4XZPA 4QT6A 2V4AA 3BU7A 3S6PA 4DPNA 4E4ZA 1N1SA 1AHSA 5ANNA 5FZ7A 2ZMKA 1AJOA 3WQ7A 5B4NA 5FZ0A 4XF1A 3ZVXA 2DVDA 1ND2B 1QY4A 2O1QA 5FZDA 5K0UA 1N1VA 3ATGA 3WHTA 4XIOA 1EAH3 3VBOB 5DAQA 1D0GA 1TQ5A 2ADDA 4G9SB 4DXRA 4A3XA 4MADA 2SBAA 5FPZA 3M3EA 1PNGA 1QXRA 3VKLA 1AR61 1HQLA 2R061 3Q9OA 1ND2A 1CAWB 3HR9A 2VNVA 2VGDA 3SEEA 4NO4A 2VOWA 2XMLA 1CZTA 1JZ6A 4GIQA 4N43A 1F8VA 4AI2A 2BYVE 3D5OA 3NKGA 4CCKA 3H8XA 1OPOA 3WDXA 2ARAA 4WM8B 4HFSA 4UFKA 5FYUA 5F9TA 2GALA 5T5LA 1HDKA 2HYXA 4PBOA 3TN92 4A2UA 3VUOA 4QDQA 4W8JA 1GZTA 4OHVA 4Q4Y3 1W6PB 4LMFA 5DUUA 4XFFA 3WW1A 1ZRRA 5JDBA 1MEC2 1BBT1 5F3EA 3A7QA 2BVBA 3SC7X 2R30A 1O7FA 4BDVB 4FOYA 2PHRA 1H1AA 4IL7A 3E97A 4QD2A 4CCJA 3FLPA 4EWEA 5CEHA 4H3WA 3B9CA 3RZJA 4JDOA 4Y20A 4TTGA 2A6VA 3KV9A 2GZWA 4M3CA 1XNKA 1PGW2 2DV9A 2VH9A 4LEJA 3VBHC 4AHXA 4OUEA 5A3MA 1H2KA 4YW6A 4ATFA 1SFNA 2UYAA 3WW4A 3ZN4A 1JZ8A 2W3JA 5I0RA 1W2OA 1QDOA 2DCJA 1YWKA 3AX4A 3FC0A 3GBWA 3FE5A 4QHOA 2C1FA 3U78A 3WW3A 1JYVA 2W68A 1FI2A 5LK7B 4IEVA 5EYXA 2XKOA 2R49A 3NSTA 4CEWA 3USSA 3KQRA 1KDMA 3I2KA 3IB3A 4UAPA 5CIRA 4YVWC 2VM9A 3IPVB 4QHBA 1S55A 3GNEA 2C4XA 2WQZC 1S0JA 1YFXA 3PJYA 1C8M1 2BFUL 2XBO2 1JYWA 5IK5A 2QUOA 4LO6B 4S2HA 1AF9A 2VZVA 1NE4A 3UT0A 3VZOA 3DN7A 1HN1A 4WM7C 2HWF2 3UL2A 4DEVA 3VBFC 5LY1A 3S5AA 4AEDA 1TEIA 3L9JT 3PIJA 1ZZ9A 1MZ6A 1XNDA 2XG3A 2OXBA 4FXGB 2VO5A 2CAUA 4S2DA 4YW5A 5A7OA 3I54A 3SKVA 3H8RA 4I0AA 4Q4V2 4CCOA 3HN3A 3LDKA 2ZKNA 4BQWA 4O61A 3GM8A 1TNFA 2Z69A 1VBE1 4XF4A 5T5JA 4BPZA 1O3TA 2Z2SB 1MS3A 1C1FA 1XNTA 3UV9A 2DVFA 3M4FA 3OG2A 3B02A 1POV1 4I3GA 3SHRA 4BU2A 5L9VA 2PLV3 4BA6A 5FV3A 2D44A 1V6OA 2VBPA 4JGZC 2JG9A 3UKTA 4LHSA 1DBNA 3V0BB 4Z2WA 3PURA 2WNEA 2CSGA 4UFLA 1QJZA 5C8CC 4JHZA 1Y9MA 1JZ3A 3WOGA 4RHV1 5BNQA 1QOOA 1MQTC 4IGQA 3M70A 3ZFGC 1POV3 1UQXA 5L7OA 4QHZA 1CIWA 3WDTA 3O0VA 1UU6A 1ULPA 5A3UA 3S5QA 1OC1A 1G9BA 1KD7A 2IXLA 3GZEA 3VBHB 3FX3A 1VRBA 4XTPA 1B35A 1CPNA 3ZOIA 3DPRC 2EA7A 2FMYA 2XXZA 1Z78A 4YLZA 3VN4A 4D7TA 3TWIA 2WN2A 2VMGA 3I2HA 1U5ZA 2RM23 4E9KA 1ULOA 2HEVF 4AZZA 4LO7A 1O3SA 1W6NB 1PO21 2MNGA 1W28A 4XW3A 1FATA 1LEMA 1KJLA 1CVNA 1YFYA 2Q4SA 3J9SA 1R081 1W8ZA 3OD0A 4Y22B 5JOYA 3FFZA 5KC6A 2K0GA 5AVPA 2VQUA 5JMCA 2Y0IA 1POV0 1NOVA 1M4WA 1Z0HA 4Y33A 2NMNA 1V9U3 5FO8B 3VKMA 3WF2A 2BZDA 2EIDA 2XWBB 3W5NA 2LW8A 2VBDA 4O7XA 1RJ7A 3RWKX 3DYOA 1W2TA 4FXKB 4ZU7A 2ZMLA 3WF1A 2XLAA 3VDDC 5FQ0A 3HPNA 3WUDA 4QPGB 4O9EA 3S7EA 3L2YA 1W8UA 3MHZA 3ST7A 5FWJA 3NJXA 3BKZA 3WP6A 1FPN1 3FN9A 1UKRA 1CIYA 4N53B 5JLVA 1KXGA 3ZDSA 2GH2A 1VRH1 1XYNA 3ZR6A 1LHNA 1LHVA 1EAH1 1NY72 2A1XA 4LK7A 5FYHA 4YGBA 3AL5A 3K4DA 5LA9A 3WNXA 4BOWA 3VDAA 1Y9QA 1SBDA 3H9AA 4QPGA 4FT8A 1XYOA 4AEDC 2VTXJ 1SEFA 4AGRA 1FV2A 1WMXA 1UU5A 1OLRA 2HEWF 3AM2A 1R083 3DKQA 2YBPA 3QBQA 1WCKA 3K48A 5K4LA 4AL9A 4UF0A 2OS2A 1H6YA 4D8MA 1DF0A 2WWJA 1OFSA 1R082 5K9YA 3AMNA 2D3PA 1VIWB 1B09A 3HMYA 2WFF3 1YUDA 2YY1A 2J1AA 4MXWA 3H0OA 4XHBA 3ZMOA 4A3ZA 3ILFA 3LKJA 1M06G 2R0FA 5FZEA 1GP5A 3KV6A 4QB6A 3I2JA 5FYTA 2B8MA 3OD4A 1NCQC 4QX7A 3AMMA 3BIWE 1UKGA 1W2AX 1ASJ2 2J42A 1STMA 3PU3A 3ZM8A 3WD5A 1AR63 3P3NA 4KU8A 4FPYA 2WSUA 1VP6A 4U2AA 4YG0A 2K46A 2VZOA 3OGSA 1BEV3 1UZWA 2A71A 5DDJ3 1T6BX 2GNDA 3RRDA 3RYRA 1SLIA 4Y20B 1XNBA 1R092 4J6GA 4NIGA 3B5LB 1OMIA 2OUJA 2UWCA 4Y1YA 3RYKA 1RUH2 2R1DA 2YG0A 2BBAA 1UIKA 1VBC3 3WDUA 1JOBA 1NA1C 4LA3A 4PDWC 1RIRA 1S2EA 4FCAA 4BCUA 1ZX5A 1UY2A 1BLZA 3VD5A 2CU5A 1QWRA 2FCVA 4HMZA 3T1MA 5SV5A 5A32A 2YFZA 2AZ5A 4ZZ5A 5BNOA 5JWPA 1AX2A 1RUD2 3ITQA 2QZ2A 3PHMA 4LOSA 3RNSA 1GV9A 1AR73 4P9LA 1ND3B 1HKDA 1J58A 5LEJA 1MPXA 3HBZA 2Y8KA 1VBE2 4DXTA 2R063 5BV6A 4GB33 4QAWA 5IYYA 3LQCA 4CU7A 1A8DA 1YFUA 3DF0A 5FMOS 4F3JA 4N53A 1YIPA 2FDFA 1T2XA 3VD7A 2VNOA 3BCWA 4LO8A 5CISA 1AYM2 4XXAA 3PVNA 2DF7A 1PO22 2OX0A 4AE2A 1JZ5A 1RHI2 2J1RA 2WINB 4FAGA 4YZ1A 1O8PA 3N7JA 4PLOA 1WUVA 1K5JA 4KWLA 2BBVA 1PZ8A 2VULA 3IDCB 3S30A 5A3TA 5GLUA 5GZEA 5LRSA 1BJQA 3B7MA 1ENXA 4XOGA 2XUMA 2R1BA 1OD3A 1GANA 5CYYA 5FIXA 1ZRFA 3ACHA 1FYUA 4XHXA 1VLNA 2BV4A 1UF2C 1XQNA 1ZBE2 2RS31 2QQVA 3WZ1A 1QF3A 5FPAA 3MF9A 5J37A 3FUOA 3NVCA 2PHDA 3VZMA 3AKSA 5JXIA 2R071 5FZIA 1HV1A 1G86A 2WL1A 1VB2A 3FFQA 3VKOA 5GZGA 1W8FA 2ZEZA 4LITA 4OI0A 4QX2A 3VD9A 2F6BA 3WG3A 3W20A 4DIQA 2RMU2 4UFIA 2FHRA 2E63A 4QU1A 5BNNB 3POJA 3BU0A 3IBMA 2YC0A 3BPZA 4QXBA 1ZBA3 4IEYA 3E5QA 5H9SA 1PVC2 1UYYA 4PBPA 5HV4A 2VNGA 4A4AA 1ZNPA 2IXJA 3AB0A 5AC92 4TLFA 4IQPA 1MZFA 4QX0A 5BNNA 2XJPA 3JBG2 1H8TB 2E7QA 1COV1 2EXKA 1GQHA 5CU1A 1QIQA 3ZN6B 1WW5A 1A34A 3W59A 1E57A 1MACA 2YC2A 2WZEA 2VUAA 1W0PA 1WW6A 4KBZA 3NQHA 4YVSA 2FDKA 5C9AA 4FFFA 4XUQA 3VBUA 4EQVA 5HPOA 3NV3A 1COV2 2JICA 5E16A 1AXZA 3CJIC 4CDUB 5C3QA 4P9WA 2WS93 2YDEA 1VMHA 5A7PA 2HWE2 4MGZE 1VBD3 1OLQA 2F4LA 2W95A 3BI3A 4JGYA 5A7QA 1BKZA 2GNMA 1ZZ8A 1JBCA 2HWC2 2JDZA 4N7IA 1SQ4A 4O65A 4Y4YA 1NY71 2PTMA 2Z79A 3WF4A 4XMIA 2X5IA 2PLV2 2Q1ZB 4BQ2A 1CX4A 5C7GA 1WW7A 4E4DX 3MV01 4FPFA 3I59A 5H9QA 2WT0A 1W8WA 3WP4A 5C71A 5IK4A 1X8EA 4Q0SA 2ID4A 4XUOA 3KF5A 4QQHA 5CKQA 2HWE3 3KSCA 3M1HA 4Z07A 3B3QE 1G6NA 1N3QA 4YZ5A 3GXUA 3AK0A 1HB3A 5FP7A 3USUA 2BU9A 4OMDA 2VUJA 3H42B 5A7WB 1LKNA 1GZWA 3WNMA 1JH5A 2QQMA 4K9SA 1V70A 4GMP0 5FZHA 3UJOA 4COUA 4RGAA 4D6QA 5FZOB 3R6SA 1GWKA 4N9HA 5J96B 1I5ZA 2R0HA 1UWWA 1JYCA 2YBKA 2QVSB 3PUQA 5B4XA 2Q8EA 4BLIA 2BDRA 2DCTA 2ZGQA 3T09A 3I3MA 2V5YA 2JB4A 1VBA2 3IDEA 3IDAA 5FP8A 2C9KA 4RSUA 1G9CA 1S0CA 1XC6A 5IK7A 1IS5A 3RS6A 5CG8A 3KVBA 4NIAA 2GNBA 1RVF2 1BK1A 2WO2A 4Q1PA 2J7MA 3R4DB 4EN6B 4PDWB 2GNTA 4HVQA 1HB1A 2ORZA 4S2FA 2ERFA 5EQUA 2NZ9A 1RUI2 4NHLA 4QPWA 1SG3A 2GU9A 3SNMA 3VBUB 3ELNA 1F15A 1VB4A 1UIJA 1IKPA 1SLAA 3I2GA 4E2GA 4R8HA 2BVVA 1MS5A 2SLIA 3SMHA 5FY5A 4Q4X3 1REEA 3F2ZA 5L19A 4GJYA 3PVEA 4B1MA 2BNMA 1ULEA 1W90A 1LECA 5FMDA 2EVXA 2IXCA 2D40A 1QJEA 2JDNA 4FPCA 4JVAA 2D7FA 3CLPA 1BXHA 3JQWA 4OI4A 3JU9A 2CDOA 3FLTA 4R52A 3MGUA 5JOXA 2QKDA 3A22A 1DGRN 3AFGA 1UU4A 3H1WA 1W6MB 4L2NA 3APBA
chains in the Genus database with same CATH topology
4XCBA 4ZONA 5DAPA 5L9RA 5C5TA 5DAWA 2FCTA 3KT1A 3OBZA 4JZRA 4KBZA 3HQRA 5L9BA 5LBCA 2G1MA 5IAXA 3PL0A 4J25A 4BQWA 2HBUA 5LBFA 5L9VA 4IW3A 3BVCA 5HV0A 2FCVA 2RG4A 4NMIA 2V4AA 3ITQA 2FCUA 2HBTA 4XABA 3EMRA 4UWDA 5A3UA 2OPWA 5DAQA 3GJAA 2JIGA 3GZEA 5DAVA 4ZPIA 5ERLA 2G19A 4MHUA 2RDQA 5M0TA 5EP9A 3GJBA 5LBBA 5EPAA 4BQYA 4XCAA 2Y34A 2RDRA 4XC9A 4NHXA 3OUIA 3NNLA 4Q5OA 3NNMA 4XAAA 3KT7A 3KT4A 5LATA 4XACA 5C5UA 3OUHA 5DAXA 3HQUA 4NAOA 5EQUA 5LASA 5LB6A 3NNJA 4NHLA 3NNFA 2JIJA 3OUJA 4NHKA 5LBEA 2RDNA 5IATA 4NHYA 2Y33A 3W20A 4MHRA 2A1XA 2RDSA 4NHMA 3W21A 5LA9A 5IAVA 5HV4A 3MGUA 4Y5TA 4BQXA 4Y5SA 3DKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XCB A;  4ZON A;  5DAP A;  5L9R A;  5C5T A;  5DAW A;  2FCT A;  3KT1 A;  3OBZ A;  4JZR A;  4KBZ A;  3HQR A;  5L9B A;  5LBC A;  2G1M A;  5IAX A;  3PL0 A;  4J25 A;  4BQW A;  2HBU A;  5LBF A;  5L9V A;  4IW3 A;  3BVC A;  5HV0 A;  2FCV A;  2RG4 A;  4NMI A;  2V4A A;  3ITQ A;  2FCU A;  2HBT A;  4XAB A;  3EMR A;  4UWD A;  5A3U A;  2OPW A;  5DAQ A;  3GJA A;  2JIG A;  3GZE A;  5DAV A;  4ZPI A;  5ERL A;  2G19 A;  4MHU A;  2RDQ A;  5M0T A;  5EP9 A;  3GJB A;  5LBB A;  5EPA A;  4BQY A;  4XCA A;  2Y34 A;  2RDR A;  4XC9 A;  4NHX A;  3OUI A;  3NNL A;  4Q5O A;  3NNM A;  4XAA A;  3KT7 A;  3KT4 A;  5LAT A;  4XAC A;  5C5U A;  3OUH A;  5DAX A;  3HQU A;  4NAO A;  5EQU A;  5LAS A;  5LB6 A;  3NNJ A;  4NHL A;  3NNF A;  2JIJ A;  3OUJ A;  4NHK A;  5LBE A;  2RDN A;  5IAT A;  4NHY A;  2Y33 A;  3W20 A;  4MHR A;  2A1X A;  2RDS A;  4NHM A;  3W21 A;  5LA9 A;  5IAV A;  5HV4 A;  3MGU A;  4Y5T A;  4BQX A;  4Y5S A;  3DKQ A; 
#chains in the Genus database with same CATH topology
 5IFP A;  1K5M B;  4RA0 A;  1AYM 3;  1YQ5 A;  4OI1 A;  1GQP A;  1J1T A;  3WG4 A;  1MS4 A;  2ZAH A;  1NX9 A;  1DZQ A;  2VPV A;  2BTV C;  2ZGS A;  4MSV A;  3D8C A;  4IEQ A;  2VXR A;  2HWF 1;  3KT1 A;  5JSO A;  3ZSM A;  4GB3 2;  2P2K A;  4YGC A;  5FWE A;  2VG9 A;  3KV4 A;  1QNY A;  1XNA A;  3HD8 B;  5JZG C;  3JZV A;  3RZH A;  2AEN A;  1RJ8 A;  1R1A 2;  1SLL A;  4LO4 B;  4QDR A;  2JEC A;  5CZK A;  2VCB A;  3ACF A;  5FXX A;  4URA A;  5ACA 2;  2BUK A;  4LBL A;  3AZZ A;  3LAG A;  4OQ8 A;  2QDN A;  4LJH A;  5F1R A;  1DCS A;  1AR7 1;  1FNY A;  3HT2 A;  1QKQ A;  3MDP A;  2ZOE B;  3V0A A;  4H55 A;  5B2G B;  1RUG 1;  5FZ8 A;  1QGL A;  4CDQ B;  2A6X A;  3FZ3 A;  3WCS A;  1UPS A;  2CYF A;  4DRR A;  3POG A;  1EP0 A;  2ZGT A;  1RUH 3;  3BVC A;  1UYP A;  2XLF A;  4JKL A;  4DOU A;  1VBD 2;  5I0T A;  5A7W A;  4Q26 A;  5J09 A;  3CQO A;  3MLJ A;  1L7Q A;  3OPW A;  4HON A;  4AGG A;  5IK8 A;  4NWV A;  2WII B;  2RS5 2;  4C0H A;  2HBT A;  1LOE A;  1ST8 A;  2YB7 A;  1NT0 A;  3LEG A;  2Q0A A;  5FDB A;  4OFG A;  3WF0 A;  2PQQ A;  3POF A;  2GC2 A;  3ZYI B;  3M3Q A;  1MEC 1;  3KCX A;  5JR2 A;  1HB2 A;  2DCZ A;  2VW2 A;  5KR7 A;  2CHH A;  5GAL A;  2PHL A;  2XQX A;  1ACC A;  4MET A;  1JU3 A;  3RZK A;  4AEM A;  5CAD A;  3IM0 A;  5F5Q A;  5FBZ A;  5FMB A;  3OYW B;  3BGA A;  5FLH A;  5F6L B;  1HRV 2;  4BQ1 A;  1H8T C;  4XQ4 A;  2RS1 1;  2XHN A;  5D8A C;  1UY3 A;  3ZMN A;  4NHX A;  1NLR A;  2ZAC A;  1IQD C;  4LIV A;  3I49 A;  1N47 A;  4ZXE A;  3P1I A;  1V9U 1;  2Y26 A;  1UCX A;  2ZMN A;  1ENS A;  3O12 A;  5LAT A;  1AJK A;  4X8P A;  5EZW A;  4NIH A;  4GKX A;  5A3P A;  4IE6 A;  2NYY A;  4L8Q A;  3THD A;  3OYW A;  2AYH A;  3CKH A;  1TMF 2;  4BQ4 A;  4ZU4 A;  2PA7 A;  3OJB A;  4C8D A;  2VL4 A;  4IES A;  1RUC 3;  3O14 A;  2P3Y A;  2OT7 A;  2XR4 A;  5KHG A;  1DZT A;  3JXS A;  3POS A;  4PF5 A;  5D21 A;  2WUH A;  3FHA A;  1CJD A;  1C5I A;  2RM2 1;  4P5H A;  5C9A C;  2HWC 3;  1AL2 1;  2ZCW A;  4RFT 0;  4LIU A;  1PGW 1;  4TSV A;  2P3K A;  1W6Q A;  1S0B A;  3CHX A;  5DPN A;  3OGJ A;  4ZY9 A;  4JTO A;  1C5H A;  2YRO A;  1RUJ 2;  2QBX A;  4LBM A;  4D69 A;  5JXG A;  3O1O A;  1AR8 2;  2GDF A;  3MFC A;  1LHU A;  1HLC A;  4XFI A;  1KRI A;  4GH4 B;  1AL2 2;  1IPS A;  4CDQ C;  2CWS A;  5KXC A;  1F35 A;  4M4P A;  5A7N A;  2RDS A;  1V6J A;  3NV1 A;  4L92 A;  4CRQ A;  4NUB A;  2BWA A;  3U10 A;  4NWW A;  4IV3 B;  1W8H A;  3OY8 B;  1JOJ A;  1W05 A;  3T0A A;  4BQX A;  4AYU A;  2XL7 A;  5E89 A;  2JXA A;  1ZBE 1;  4P08 A;  1IQA A;  2A70 A;  1WW4 A;  1NXD 1;  5A32 B;  4Z8B A;  1MS8 A;  4R9D A;  3U4X A;  4MG2 A;  4ZZ8 A;  1EY2 A;  4PHZ A;  2D6P A;  3VZJ A;  3E5U A;  5F2S A;  3M3C A;  4GWN A;  1OOP B;  4FPG A;  4IV3 C;  2Y6H A;  4RR3 C;  5BNP B;  1VPH A;  5FPV A;  1VBE 3;  1UMI A;  5FOJ B;  1JYI A;  2WQ8 A;  3A21 A;  2EAK A;  4BIO A;  5GKA C;  4IEO A;  2ZX1 A;  3I3Q A;  3DYP A;  2I74 A;  3H8O A;  4XTM A;  1H9W A;  4WVV A;  1RIT A;  4U36 A;  5F5C A;  5FZC A;  3TEW A;  4JGY C;  5IHR A;  4LTA A;  3KMH A;  1NQJ A;  3AMP A;  2B46 X;  4KWJ A;  1HJF A;  4Q27 A;  1ULG A;  5F6K A;  1GMM A;  4IND A;  1A3K A;  1UY0 A;  3GBF A;  3I2I A;  4JHT A;  4FQZ A;  3SXW A;  5GZC A;  4DFS A;  1PGS A;  2EXJ A;  3P6B A;  2VE1 A;  3LOI A;  4JRL A;  4QXC A;  4CXX A;  3PUA A;  5KC5 A;  1DQ2 A;  4G4F A;  4PLM A;  5JMO A;  3SH3 A;  1OA4 A;  1RUD 1;  5DAB A;  1A78 A;  1AZD A;  3K4Z A;  3EB7 A;  3KF3 A;  4YPJ A;  3DGT A;  2PAE A;  3U75 A;  3LGR A;  4M3C E;  2RG4 A;  4UF0 B;  3LE0 A;  4XDO A;  1V6M A;  3R4U A;  2RV9 A;  3ES4 A;  1MR5 A;  2VZQ A;  2WT2 A;  4XBL A;  4UXA A;  2BNN A;  4W6Y A;  5JSR A;  4DXS A;  4FTS A;  1W6Q B;  4CEW C;  3RI9 A;  1DGW X;  1RUI 1;  3OSD A;  2XJT A;  4JGZ A;  3AYE A;  3TNP B;  1O6U A;  4AF9 A;  3T2O A;  2FBE A;  2C26 A;  2JIG A;  4Q1R A;  3VV1 A;  1YXW A;  1NCQ B;  3UGH A;  2CGP A;  1S0F A;  3ACI A;  5KHH A;  4N7U A;  1RMU 2;  2RS1 3;  1RYY A;  2TEP A;  3AP4 A;  3KHB A;  4QB1 A;  4CPB A;  5L7O C;  5LW9 A;  4UW4 A;  1W04 A;  5LBB A;  3IN9 A;  2PYT A;  2LM3 A;  2VZR A;  3WP5 A;  4XCA A;  3RZG A;  4QX5 A;  2QQO A;  3M3I A;  3OY8 A;  1IOA A;  2DBN A;  3ZPY A;  1N1Y A;  4W6X A;  4NRO A;  5FZ4 A;  3UES A;  5JOZ A;  1ALY A;  2D6O X;  3AKR A;  3NNL A;  3SCH A;  4K1Z A;  3H1M A;  3NJY A;  2QNK A;  2W1Q A;  2D5F A;  4MGQ A;  3ZXJ A;  5A70 A;  2BPA 2;  4NPR A;  3U07 A;  5FLI A;  1J3P A;  1YI7 A;  4KG8 A;  2JJ6 A;  5DZE A;  3HQX A;  4LKE A;  4YZ2 A;  3O1U A;  3T4H B;  5I93 A;  1YC6 1;  5GLT A;  1H4H A;  2A6Y A;  4LA2 A;  1Y4W A;  3TRS B;  4GQ7 A;  3QOP A;  4N8M A;  3ZYP A;  3ACG A;  1RTV A;  2GSY A;  1W9S A;  4HN0 A;  3O1M A;  3VLB B;  2P4E A;  3HBK A;  3J7N A;  2BFU S;  3FHI B;  3OTF A;  4XFA A;  3RMX A;  4CDW C;  2ZHK A;  2WWS A;  5CFD C;  3KB5 A;  1DLC A;  2A75 A;  2VMF A;  3J7M A;  1PK6 A;  4GH4 C;  4F83 A;  1US2 A;  2ZHN A;  3ZXF A;  2WAO A;  4WM7 B;  2D3S A;  4L0P A;  4MHR A;  3TN9 3;  5C4W A;  3THT A;  3VDD A;  1BQP A;  1W06 A;  1WWY A;  4COW A;  2IXI A;  5FZB A;  3W21 A;  4LO5 B;  4XFH A;  5J1X A;  1OD5 A;  1MS9 A;  2NMO A;  2UY8 A;  3I59 B;  2WO7 A;  1VBB 1;  2OQ6 A;  4GH4 A;  3URF A;  2P6H A;  3KV5 A;  3ZDV A;  1PMI A;  4Y1Z A;  4MZU A;  3DPR B;  2F4P A;  3LZZ A;  3N9P A;  4QGN A;  1PO2 3;  4CU8 A;  2E6V A;  3IAP A;  4LE3 A;  2XDV A;  3L2H A;  2V09 A;  1DFQ A;  1KQR A;  5J98 B;  2FCT A;  2XBO 1;  3KCC A;  4R4X A;  3AJZ A;  1GOG A;  5FRA A;  3PLQ A;  1DYK A;  1WCU A;  2E33 A;  2B39 A;  3WCR A;  2X10 A;  5C3R A;  1CWP A;  1N3O A;  1J3Q A;  1HXS 1;  3OBT A;  3DUI A;  4MVT A;  2R06 2;  2B9U A;  3OF1 A;  5HBA A;  1PVX A;  4XJA A;  4PIY A;  3MI8 A;  4BMB A;  4DUX A;  2JG8 C;  3V65 A;  4E8C A;  3ZFE A;  5C8W A;  5EJ3 A;  1PM4 A;  4K1Y A;  4LBJ A;  4MH0 E;  5FO7 B;  1EPW A;  5CAZ A;  1ND3 A;  3F95 A;  2R04 3;  4NAM A;  3PUI A;  3H7Y A;  4CCM A;  3IWZ A;  4NID A;  1D7P M;  3TEY A;  4IE0 A;  1CAX B;  2IZW A;  2ZXQ A;  3CO2 A;  4TWT A;  3I3D A;  3KS7 A;  2MEV 3;  3NO8 A;  1NZC A;  2K2S A;  1R09 3;  2XOM A;  2FCU A;  5HXM A;  2C6S A;  3ECQ A;  1H9P A;  1MZE A;  3UKV A;  5DUV A;  2AEY A;  5DUW A;  1SDD B;  3OCP A;  2QQL A;  5K0U C;  3LWC A;  4ZU5 A;  4GZ9 A;  1ZM1 A;  2RM2 2;  3ZYH A;  2XVG A;  2AH2 A;  3FBM A;  5GLZ A;  4Q8L A;  2NQY A;  2QCS B;  3PME A;  4HSL A;  3VDB A;  1F4A A;  2HWC 1;  2IXK A;  3GJA A;  5IW0 A;  1JYX A;  1WMD A;  3T1L A;  2VD7 A;  5GLV A;  3VZL A;  5JZG A;  1O8S A;  4AQS A;  4FFG A;  5JOW A;  3EHK A;  4Q4Y 1;  1QJX 1;  2Y38 A;  2WA4 A;  3SCG A;  4RGG A;  1RUN A;  3KHC A;  3QLQ A;  1OKQ A;  2V4V A;  5EPA A;  4RQP C;  1WCQ A;  4COZ A;  3IDB B;  3PMS A;  5CKN A;  3AC0 A;  5BPX A;  3WDW A;  1RUO A;  4QXH A;  5JXJ A;  1POQ A;  2CAV A;  1HQN A;  5FXV A;  1RB8 G;  4IV1 C;  4FAH A;  2JEN A;  4IDZ A;  4L11 A;  2WZP P;  1RC6 A;  2NN8 A;  2VUD A;  3KT7 A;  4YM2 A;  2E9Q A;  3MPP G;  2QQI A;  2BER A;  4BXF A;  2W47 A;  1H8V A;  3VHR A;  4AQ2 A;  3NAP C;  1UMZ A;  4RS5 A;  5C5U A;  4KL1 A;  2TNF A;  1S0D A;  1NG0 A;  4KNC A;  4QGM A;  3FHQ A;  3HQU A;  4NAO A;  5DAX A;  5KXD A;  5LAS A;  2GC3 A;  3MIF A;  1E5H A;  4OHZ A;  1O4T A;  1MEC 3;  2WLP A;  4NHK A;  3B01 A;  2JWP A;  2BOJ A;  2ZHM A;  2XB6 C;  1W3V A;  2PHU A;  1DYO A;  2BP6 A;  2BGO A;  3PU8 A;  4JGZ B;  4QGL A;  1QNW A;  5FMC A;  3ZR5 A;  4BHP A;  1G9D A;  2QQP A;  4HN1 A;  4QM9 A;  1BBT 3;  4AEJ A;  3UKN A;  2AUY A;  1YLL A;  3I3E A;  2OKX A;  1CR7 A;  2G9G A;  5T50 A;  1RUG 2;  1D4V B;  1OUR A;  4XIL A;  4ZKT B;  2XKP A;  1SDW A;  2VC9 A;  4E2S A;  2W46 A;  5FPU A;  2XHK A;  1T6G C;  3H8U A;  3LPF A;  1DQ4 A;  4AFM A;  4BIS A;  3R0R A;  5KHI A;  5FXZ A;  2D6M A;  2WBK A;  2DVG A;  2YPD A;  4XFG A;  1O5U A;  4IEU A;  5C5T A;  1H6X A;  1PO1 3;  1QQP 3;  4OCT A;  1OXC A;  4IE5 A;  5FY9 A;  1JHN A;  5H9P A;  2RR1 1;  3WDV A;  4D7Y A;  3VDC A;  3DKW A;  3WVJ A;  4EZ4 A;  4PDW A;  1DQ6 A;  1RVF 3;  2ZAB A;  2GMP A;  2VOX A;  5BNN C;  3K46 A;  5L9B A;  1LB2 A;  2D6K A;  2Q8C A;  1CAV A;  2WZR 3;  1W9T A;  4IEZ A;  3SLI A;  4ASM B;  3V0A B;  5FQ0 B;  2HKX A;  4GA9 A;  4LR4 A;  4DS0 A;  2BW8 A;  2P5B A;  2GP3 A;  2QZ3 A;  4OHX A;  4K7J A;  5AC9 1;  1APN A;  5D2A A;  4QQ2 A;  4YVS C;  4I0B A;  2OA2 A;  3WNP A;  4XDQ A;  3HNY M;  4HL0 A;  1OSG A;  5FKB A;  2GC0 A;  4M0N A;  1CJP A;  1US3 A;  2VW1 A;  3SIT A;  4XUT A;  3EO6 A;  5CA6 A;  5HCH A;  2PHX A;  5ISL A;  1IKQ A;  2JB8 A;  2CGO A;  4H7L A;  2ZGU A;  1VAK A;  3G7D A;  4AHY A;  1K3I A;  5A7S A;  1EUT A;  5FPB A;  4FFI A;  3CDZ B;  2DUP A;  3FUQ A;  1ZZB A;  1SLC A;  1JN2 P;  4XAB A;  2Y6L A;  4HET A;  1F4H A;  2WT1 A;  5ACA 1;  5DN2 A;  4QQP A;  1NYW A;  4CDX B;  4BQ5 A;  2NLR A;  4HKL A;  4ES8 A;  2VCA A;  3EYP A;  5K8S A;  3MV1 1;  1DGW A;  2FDJ A;  4Q4V 1;  4GMP 1;  3C7H A;  3NAP A;  3LCP A;  4WZC A;  3E1F 1;  2Z4F A;  4WM8 C;  1PMJ X;  3UGF A;  2EF6 A;  1GWM A;  1ODN A;  2EXH A;  4YRD A;  3MUY 1;  4LK6 A;  3SIS A;  3VBU C;  2AC1 A;  3LDR A;  3SCF A;  4M01 A;  4PQQ A;  1C1L A;  4HLT A;  1S0I A;  1S2K A;  4XF3 A;  1L7R A;  1GP6 A;  3C7F A;  4DXZ A;  5D8A B;  4XJW A;  3U0Z A;  2RHP A;  2WZR 2;  4LKS A;  4YW7 A;  1LGC A;  1MVE A;  4KU7 A;  1XJA A;  1OH3 A;  3ZYF A;  3ZYG A;  4C0B A;  1KS4 A;  2WNU B;  3H7J A;  2EIE A;  4K6B A;  3T0B A;  4C90 A;  2D6N A;  1YJK A;  4GJZ A;  1UXZ A;  3GF6 A;  4GUL A;  2MEV 1;  2W1W A;  1UMH A;  2DUO A;  1LEN A;  1UOG A;  4CCD A;  2FMD A;  4AED B;  4CSW A;  5J3U A;  2W1U A;  1WBF A;  4B8E A;  1D2Q A;  1PK6 C;  1UOB A;  1W6M A;  2RE9 A;  3PVO A;  3TAY A;  4JAA A;  2VR4 A;  1OLM E;  2WC2 A;  4XPV A;  5JIA A;  4AFD A;  2FDG A;  4M00 A;  2VJX A;  4XQD A;  5AVA A;  1SBF A;  3MPB A;  4AAP A;  5CFC A;  4XJZ A;  1BHG A;  1OBN A;  3LFI A;  1DYP A;  4NRP A;  2RR1 3;  4ES9 A;  4C1W A;  1PIV 2;  4UW5 A;  4P5Y A;  3THC A;  1IG0 A;  5EV7 A;  3K77 A;  5EHD A;  2ZX3 A;  1XYP A;  4WM8 A;  4BIF A;  4CCE A;  1WBL A;  4XCB A;  5E88 A;  4QWN A;  3USU B;  1O4Y A;  3NL1 A;  2C5D A;  3ZYJ B;  1FOD 1;  1Q8P A;  5I8Y A;  4ITC A;  4Q4W 3;  3AZW A;  3M8L A;  5LZ6 A;  3PNA A;  4JQT A;  3NRU A;  4W4Z A;  3VZN A;  1HXS 2;  5EFU A;  3VBR B;  3QAC A;  4BM8 A;  2PEL A;  4XUR A;  3AJY A;  2A3X A;  1C3H A;  3T2Q A;  3EQE A;  1YHF A;  1DZR A;  1YQ6 A;  2WKK A;  4TLG A;  2X09 A;  4CEY C;  5C3S A;  5FYM A;  4CDQ A;  2C24 A;  3ZFF A;  3CBN A;  2ZEY A;  1VBB 3;  1NXM A;  3MLK A;  3ZSE A;  4BJ0 A;  5A3L A;  5FYB A;  1RMU 1;  4XF0 A;  1W9Y A;  4YM1 A;  4HSJ A;  3PL0 A;  4V2V A;  5F3C A;  5LK5 A;  3J8F 1;  5GM0 A;  4YAR A;  1UZZ A;  5H9R A;  2EIB A;  5LBF A;  2VMC A;  3RSJ A;  3C2U A;  4PCR A;  3AXD A;  2QQU A;  3WNL A;  4WVZ A;  4Y22 A;  4JCK A;  3ILR A;  3WQ1 A;  3VKN A;  4IW3 A;  4LKF A;  1GNY A;  2CDP A;  1JMU B;  3FLR A;  5BNO C;  2EAL A;  2QJV A;  5KHJ A;  1QOT A;  4XDP A;  2PQS A;  1IHM A;  2UU8 A;  1ZYB A;  3H1Y A;  1XB9 A;  5A6X A;  2F17 A;  3ZXD A;  2PHF A;  2ZZQ A;  5J7M A;  1RUD 3;  3A0N A;  1B35 B;  5F5A A;  3KGZ A;  4OLL A;  3K3N A;  1YIF A;  5EYY A;  3U1X A;  2MEV 2;  3A23 A;  2J1U A;  3OB8 A;  5LA1 A;  2QQK A;  3PTY A;  4Y1X A;  1FMD 2;  5T3N A;  1BMV 1;  2W92 A;  4ZPI A;  2JDU A;  1TME 3;  2RJK A;  5DG2 A;  5ERL A;  3VHP A;  3MLL A;  4Y5Z 0;  2ILM A;  4O9G A;  5C4W B;  4ONU A;  1DGR A;  2P17 A;  4CUG A;  3TEX A;  1QU0 A;  3RZZ A;  2RDR A;  5A6Y A;  1OT5 A;  5E1R A;  4E8D A;  1AVB A;  2E53 A;  3JBG 1;  4XQW A;  1Q8O A;  3NJZ A;  5F3G A;  3U37 A;  2H6C A;  2V72 A;  4L97 A;  1D2S A;  4IXL A;  1REF A;  2C0Z A;  2UWB A;  4QKN A;  4A45 A;  2VUC A;  2VTF A;  1JZ4 A;  5CVR A;  3GDB A;  4YNI A;  4QPI C;  3EJK A;  1JYN A;  4QDS A;  3WIN E;  3B00 A;  4Y3O A;  4AGV A;  2QFE A;  2WFF 2;  2AAC A;  4YFW A;  2WR9 A;  1YYN A;  4LPL A;  1P8J A;  1D4M 3;  2HWB 3;  4RQP B;  4WBB A;  4LKD A;  5CFD B;  4CA9 A;  4IE7 A;  1YQ2 A;  1DQ0 A;  4OYU A;  4OQ9 A;  3M3O A;  1J3R A;  2P37 A;  5JCT A;  4XF9 A;  2VNR A;  4AVA A;  4WV8 A;  4HVR A;  2VAU A;  4FPH A;  2QQW A;  3VL9 A;  2A3Y A;  3ZXA C;  4Q0U A;  4UT5 A;  1QDC A;  4QQO A;  1SFP A;  1URX A;  5FZO A;  4BE3 A;  3ES1 A;  1AL0 G;  1PX4 A;  1E5I A;  2JE9 A;  2DU0 A;  3FL7 A;  1DHK B;  4GWM A;  1IG3 A;  1YO8 A;  2ZGN A;  2XJU A;  4XBQ A;  1AL2 3;  5IAV A;  3ZIW A;  1LHO A;  1HB4 A;  1PK6 B;  2DU1 A;  3JD7 3;  4YVS B;  1GNZ A;  4GXL A;  4PQ9 A;  4AR2 A;  4A7Z A;  4FFH A;  4J1X A;  5FY8 A;  1YEW A;  4IE4 A;  3GHM A;  3I7D A;  4JTN A;  5FUI A;  4CDU C;  4ET7 A;  5I8T A;  1IS6 A;  4LHK A;  2J1V A;  3LD8 A;  4LQR A;  3ZKU A;  5JPM B;  2IFR A;  2JD9 A;  2DFB A;  2VZS A;  4K21 A;  4MOA A;  5FZ3 A;  5IVV A;  4RYD A;  2XJR A;  2CV6 A;  4IEX A;  4XFB A;  3VL8 A;  5IJR A;  4DY5 A;  3HQR A;  1GLH A;  2Y60 A;  5FP9 A;  4I09 A;  3DXT A;  5FK7 A;  1X36 A;  2JDY A;  1G9F A;  4MGY E;  3ZX7 A;  1GKB A;  3X29 B;  3U14 A;  4LOT A;  2JDH A;  3HNB M;  2QQJ A;  1VBB 2;  1O59 A;  4AFA A;  1LU2 A;  1PVC 1;  4LUL A;  2RJL A;  5DG1 A;  4AVC A;  4NR1 A;  2TUN A;  2AEZ A;  3OEB A;  1S1A A;  3P3P A;  1HV0 A;  1V6L A;  1SCS A;  3POI A;  1LOB A;  5IVB A;  3W5M A;  2Q1F A;  1J83 A;  3H3Z A;  1IZ3 A;  4CU6 A;  2BNO A;  3WHU A;  2X29 A;  3LA7 A;  4WZF A;  2PMW B;  4DNY A;  4HKW A;  3U4S A;  5T5O A;  2LUW A;  4XFC A;  3J4U H;  1VE0 A;  5BY5 A;  4CDX C;  5HV0 A;  3S0M A;  3T0D A;  1GP4 A;  3J26 N;  2NP0 A;  1YCI A;  4COV A;  1YQC A;  3GCW A;  3I2O A;  4MGI E;  1RUH 1;  4DB5 A;  2W1S A;  4JV4 A;  2UUR A;  4D94 A;  1GZ9 A;  5IWF A;  4XJ9 A;  3PVB B;  1QHD A;  2JG8 A;  5BNO B;  2ETE A;  5A6Z A;  1R1A 1;  3WUC A;  4NRM A;  1BYH A;  3MZH A;  3VBH A;  3CU7 A;  2D6L X;  4X6Q B;  3K75 B;  5FZ9 A;  5M0T A;  5BUV A;  2NM1 A;  4IUG A;  4M4R A;  1IGO A;  4YM3 A;  1HIX A;  4JQR A;  2OYZ A;  3IIA A;  3DYM A;  1OUX A;  3NKT A;  1RUI 3;  1WD4 A;  1ONA A;  2XJS A;  2HH9 A;  1OUS A;  5DZF A;  3T2T A;  5DMY A;  5A3O A;  5I91 A;  3WDY A;  5T54 A;  2W08 A;  3ZXK A;  3N4M A;  4CP9 A;  2BWC A;  1NLQ A;  1O5L A;  3ZKY A;  3KT4 A;  3T08 A;  1C57 A;  1NUK A;  3ALQ A;  4Q4W 1;  4MXV A;  2ZA9 A;  5FZG A;  2ARB A;  1PX3 A;  4PF1 A;  1RXF A;  1XRU A;  1LOF A;  3OGV A;  2BGC A;  2OW4 A;  3E6D A;  5JVV A;  3JBG 3;  4AK3 A;  3RGB A;  1GFF 2;  2DDU A;  4EE2 A;  1F9K A;  5T55 A;  1RUF 3;  1UPI A;  1PZ9 A;  4N53 C;  2WNV C;  1DQ5 A;  1ND3 C;  5FZ1 A;  3WNN A;  1U0A A;  5I8S A;  5K0U B;  2A73 B;  4CUA A;  3D4K A;  4KGG A;  4LXL A;  4NE9 A;  1RGS A;  1BZW A;  3OBR A;  3T4V A;  1QH6 A;  1RUG 3;  4YGE A;  5L36 A;  2XPJ A;  3O7O A;  5IAT A;  1AR8 1;  1SLB A;  3QD6 A;  1HRI 1;  1PNF A;  5FY4 A;  1PIV 3;  3VBF A;  3OBA A;  5J48 A;  3IMM A;  1VAL A;  4XAE A;  4UBG A;  3PTR B;  2ARX A;  3HT1 A;  1X50 A;  1GZC A;  5C3O A;  4ZHN A;  5BYN A;  1B35 C;  1H2M A;  4EYU A;  2GN7 A;  2LTN A;  2XVK A;  3HJR A;  1F5F A;  1W2U A;  3N36 A;  4QX1 A;  4Y5T A;  4Y1U A;  5I0D A;  1CAW A;  3QH6 A;  1TMF 1;  1CGP A;  3NV4 A;  1QJU 1;  3IT8 A;  4KQ7 A;  4HK8 A;  4Z1V A;  3DV8 A;  3AKP A;  4Y4R A;  1SPP B;  4NII A;  1ZBE 3;  4HBN A;  3E6C C;  3UK9 A;  4NN0 A;  2DTW A;  3LA3 A;  5FZK A;  3RDI A;  5HCF A;  1NCR A;  2VZ1 A;  4FBF A;  4CXY A;  1Q43 A;  2PFW A;  3NNG A;  4R9C A;  4W65 A;  3IPV A;  1W6P A;  2E26 A;  3J8F 3;  5F7U A;  3AMQ A;  1RHI 1;  1QXJ A;  2KM2 A;  2G1M A;  4BWO A;  4LNV A;  4PIX A;  1RL3 A;  3S57 A;  4X6R B;  5GJ6 A;  1DLL A;  2ZJC A;  5CKM A;  3WNK A;  1NCR C;  2ZAA A;  3MBW A;  1VBA 3;  1F2N A;  5EIY B;  2VEC A;  3RJR A;  3O1P A;  5C33 A;  5A1A A;  4R9B A;  1I6X A;  3AMH A;  4AI9 A;  2ZTN A;  3ME2 A;  4B4R A;  3MW4 A;  1RUC 1;  2RS5 1;  1W6O B;  2LAL A;  4BZ4 A;  3VHN A;  1OHF A;  4LBQ B;  3IMN A;  4RL7 A;  1F5J A;  2EIC A;  4A6O A;  5IVJ A;  1SLT A;  2JE7 A;  4YVW B;  1DG6 A;  1HQW A;  2A6W A;  2R07 2;  1ZA4 A;  2W39 A;  3OPZ A;  4KWU A;  2YGM A;  1LCL A;  3HEI A;  4Q0P A;  4XJ8 A;  4XJU A;  4ZS2 A;  1J1L A;  3M2M A;  3ZN5 A;  4NJ4 A;  2YU1 A;  1AXY A;  4GKY A;  3CIH A;  3AP7 A;  2MPF A;  1W8T A;  3AYA A;  3PIG A;  3EMR A;  3SKJ E;  4AI8 A;  1JHJ A;  5GZD A;  4PLN A;  3BTY A;  3N9N A;  1VJ2 A;  3WP3 A;  1VBC 2;  3J8F 2;  3M7A A;  3VBF B;  1HN0 A;  3EXU A;  4QKB A;  5DAV A;  2PN5 A;  1OQE A;  4ATE A;  4FPL A;  1VMJ A;  3ZFG A;  1ENQ A;  1X9P A;  3MYX A;  5DDJ 2;  1CX1 A;  2AR6 A;  2IVI B;  2W94 A;  2YUE A;  4QB2 A;  3SH5 A;  4CDW A;  2KD7 A;  2WO1 A;  5TSW A;  1SPP A;  3ZFE C;  4QU2 A;  2WS9 2;  3JD7 1;  4XAC A;  4COY A;  1COV 3;  2ZS6 B;  2VQA A;  4KI5 M;  1MS1 A;  2WYS A;  5ABJ B;  1LHW A;  4Y26 A;  4AQT A;  1C8N A;  4BYY A;  2WN3 A;  5FYY A;  4CYD A;  1UNB A;  3POE A;  1MQT B;  1W9W A;  2R32 A;  1XSQ A;  1UD1 A;  2HYK A;  3ILN A;  1OQD A;  4SLI A;  4A6S A;  4D6S A;  3D82 A;  3NNF A;  3C7E A;  2VMH A;  5JXH A;  2VW0 A;  4RGK A;  3OUJ A;  1YJL A;  3THP A;  4CPB D;  2YMZ A;  4YW2 A;  4R4Z A;  4X8N A;  1MVQ A;  3WV6 A;  2RDN A;  4JC1 A;  1XE0 A;  2G9F A;  2RVA A;  1D4M 1;  2HWB 1;  4KGQ A;  1AR9 1;  3LEM A;  5A3W A;  4P00 B;  1AYN 1;  1TE1 B;  1U5X A;  3BPS A;  3MIC A;  1TG7 A;  4NHM A;  3VBS A;  2DUQ A;  1BVP 1;  2VU9 A;  4BH9 A;  5CFD A;  1BBT 2;  2WA3 A;  3CZU A;  3CZJ A;  1FOD 3;  2DCK A;  4M3C F;  2IFW A;  1U5I A;  4AFC A;  3U11 A;  4IEW A;  2WJS A;  1QJY 3;  4ZON A;  1NLS A;  1YQ8 A;  5DAP A;  3JD7 2;  1FX5 A;  3INA A;  4QPI A;  1YNA A;  4ARY A;  3GHN A;  4CE8 A;  4DO0 A;  4FTE A;  5A6Q A;  3WXP A;  2B9V A;  5SV8 A;  1K5M A;  4ZXK A;  2Q8O A;  1VR3 A;  1HRV 1;  3BTA A;  4CEW B;  4D6R A;  2XUE A;  5LBC A;  4NOT A;  1G9A A;  3WR0 A;  4LE4 A;  1NKG A;  3DCQ A;  1QJU 2;  1ASJ 3;  3I3B A;  4K20 A;  1S0G A;  3AYC A;  3OEA A;  2XLG A;  4J25 A;  1WMF A;  2PAM A;  3O1R A;  5LA0 A;  4ZS3 A;  2G9Z A;  4R9A A;  4WVM B;  4A42 A;  1W9F A;  1JTZ X;  3ON7 A;  1NE6 A;  1RIN A;  3ZSL A;  5FY1 A;  3N7M A;  4QX8 A;  4RHV 2;  1RXG A;  1WME A;  5FLJ A;  4YZ3 A;  4LUM A;  4CP2 A;  3RZM A;  1O3R A;  1PHM A;  1X9T A;  4QX3 A;  1LED A;  2VZT A;  4AXO A;  2TBV A;  1O4Z A;  1GOH A;  1NZI A;  2D43 A;  2JG9 C;  2B5H A;  2YPJ A;  2WSV A;  3K2O A;  4QPY A;  2D5H A;  4OZX A;  1JUI A;  1JUH A;  3KCY A;  4DMI A;  1NA1 A;  1XSR A;  2WZ8 A;  4XEZ A;  4FOV A;  1WZX A;  3JQX A;  3EBR A;  2VOK A;  2ZHL A;  5G05 L;  5AFE A;  2DVB A;  5FFO C;  3MID A;  2GAU A;  1WLC A;  4HPK A;  4AHW A;  2JEM A;  2BGP A;  3T30 A;  2I2S A;  1RVF 1;  1FMD 3;  3R05 A;  3WQ0 A;  4I3P A;  5HI0 A;  5EP9 A;  2WS9 1;  4P9G A;  3LF7 A;  4LBO A;  2KXL A;  2WZR 1;  3AKT A;  2Y34 A;  3C8X A;  3KD4 A;  1BK0 A;  2B7Y A;  3H3U A;  3K3O A;  2Q30 A;  2VMD A;  1TNR A;  4H7M A;  1MZ5 A;  4YW4 A;  3ZXG A;  2AGS A;  4LBQ D;  2P3J A;  2ZBJ A;  3K51 A;  1JOP A;  4Q5O A;  1PGL 2;  4CEY A;  1W6O A;  2GMM A;  2ZGL A;  4RD7 A;  4XAA A;  4CTE A;  5FKC A;  5FO9 B;  5A33 B;  2BRT A;  5IVY A;  2X05 A;  2EIG A;  4B4P A;  1UX6 A;  1MS0 A;  4CCC A;  3POY A;  2CTV A;  4LHL A;  1FMD 1;  3OUH A;  1A8M A;  1H1M A;  3N9O A;  3MUZ 1;  1W2N A;  4EJR A;  1CAV B;  3WW2 A;  5LWB A;  1JOD A;  5HCA A;  4Y1V A;  1VRH 2;  1LRH A;  5D1I A;  3KQ4 B;  5CBL A;  1AR9 3;  1OH4 A;  1UL9 A;  4MGS A;  5AC9 3;  2X53 S;  3N9Q A;  1D4M 2;  2HWB 2;  1OVS A;  4V1P A;  5DQ0 A;  5LA2 A;  1I5P A;  4B3N A;  5A1L A;  2HWD 1;  1AYN 2;  3ETP A;  5FJH A;  5CFC B;  3O1S A;  4MUV A;  1XXN A;  4UW6 A;  5EWS A;  4P9X A;  4BQ3 A;  2ZKL A;  2ET1 A;  3TYJ A;  5JPN B;  3W58 A;  4BB3 A;  1CQ9 A;  2ZX0 A;  2ZGR A;  1W8O A;  3AKQ A;  1OOP A;  2G4I A;  1HX6 A;  2DTY A;  4Y5S A;  2JX9 A;  2YXS A;  4FOQ A;  3RMY A;  5FK8 A;  2B45 X;  2VVD A;  1PGL 1;  3LDB A;  3ZXE A;  4GD4 A;  1SCR A;  1ASJ 1;  5HCB A;  1LOF C;  2LRO A;  3NJV A;  4CZS A;  2RR1 2;  2Y6G A;  3K4A A;  2ZX4 A;  1RUE 2;  2DYC A;  1WA4 A;  2IVJ A;  3AP9 A;  2ZGK A;  4YGD A;  1UY1 A;  2QDR A;  4Q4V 3;  4TZD A;  2W87 A;  2Y64 A;  4Z2A A;  4HK9 A;  2DFC A;  3AXE A;  1L7L A;  2X5I B;  2UWA A;  1LU1 A;  5IVF A;  3BTX A;  1TVG A;  5FTT C;  4LUK A;  1EV1 1;  2ZZJ A;  3WY6 A;  1RHI 3;  2R07 3;  1BMV 2;  1VRH 3;  1VAM A;  3CF6 E;  4UFH A;  2HBU A;  5FPX A;  1LR5 A;  3AZX A;  3TOJ A;  3MF6 A;  3ZYR A;  4CUB A;  1BCX A;  4CDU A;  4P14 A;  5FR3 A;  2Y6K A;  1AX0 A;  5KHK A;  1WLW A;  2RMU 1;  4CP9 B;  1YFW A;  3AYD A;  1EAH 2;  4FPE A;  2L9L A;  3RG0 A;  3T3Y A;  4RR3 A;  3WG2 A;  5FYV A;  1QJU 3;  2WNU A;  4DQA A;  5JIU A;  2RS5 3;  4HT1 T;  4K8F A;  4QKF A;  1ZRC A;  1W3X A;  2VXJ A;  5C8C B;  2R04 1;  2PAK A;  3ZFG B;  3OOX A;  2CWM A;  1OVP A;  2XQR A;  2PLV 1;  4FQ4 A;  2D98 A;  3QCW A;  3WG1 A;  4N90 A;  2ATF A;  4IET A;  3JB4 C;  4QPI B;  4A7Y A;  2DBI A;  4Q29 A;  3TN9 1;  4Q8K A;  2ZEX A;  4EWD A;  4CVU A;  5T5P A;  4MLO A;  1GUI A;  1ZA7 A;  1AR8 3;  4AVS A;  1ZRD A;  3KM5 A;  1HXS 3;  3AZV A;  1F31 A;  5I0S A;  2OQ7 A;  1WLD A;  5FP3 A;  4GB3 1;  1I3H A;  4UOJ A;  4AFB A;  1SMV A;  3VD4 A;  5F39 A;  1NAE A;  3ZFF C;  3GZA A;  4OUS A;  1UAI A;  3SH4 A;  3MIH A;  4P9Y A;  3LOB A;  3ORJ A;  4URT A;  1QJY 1;  1MQT A;  2UY9 A;  3B93 A;  3LIH A;  3H3L A;  4Q4Y 2;  3V64 A;  5FY7 A;  1O91 A;  1TMF 3;  2ES3 A;  1DU3 D;  1C8M 3;  1KFU L;  3I2F A;  2FD8 A;  3N35 A;  4AQ6 A;  1KFX L;  4IEP A;  3ZPO A;  4RS5 C;  3I4I A;  5JR7 B;  2ADE A;  1GWL A;  4M3C B;  4AW7 A;  4RHV 3;  1HW5 A;  4KWK A;  2VMI A;  3D6E A;  2HEY F;  4GWJ A;  1VBC 1;  4NRQ A;  5F8P A;  1CZV A;  1CAU A;  4QXK A;  1PIV 1;  1AYN 3;  2DWR A;  2KA3 A;  3NW4 A;  3PUS A;  5FZM A;  1HRI 3;  2JD4 A;  1AXK A;  1V00 A;  2W2I A;  5GLW A;  5LBE A;  1S4C A;  1AR9 2;  1KJR A;  4HZF A;  4F8A A;  2HLE A;  5A3N A;  4QPG C;  1KEX A;  2J1S A;  3S7I A;  2BEO A;  2ZPX A;  1OLM A;  5ANQ A;  3WF3 A;  2VVF A;  1KGY A;  4UFM A;  2J1E A;  3GAL A;  4OMC A;  4CDX A;  3ABZ A;  4FVV A;  4Y24 A;  1LGB A;  1RUF 1;  3E5X A;  5F5I A;  1FPN 3;  4MO3 M;  2QE3 A;  2OZ6 A;  1DIW A;  3WEZ A;  4OI2 A;  1XE7 A;  4B7K A;  5FAX A;  4SBV A;  2VZP A;  2JDK A;  1PO1 2;  4NPL A;  1KDK A;  2WFF 1;  4B7E A;  3IZO A;  3BAL A;  4CCN A;  1TZO A;  4AI0 A;  4MX3 A;  5FXW A;  5D8A A;  2RJ2 A;  1V6I A;  3ACL A;  3AP6 A;  1JS9 A;  2YU2 A;  3CJI B;  3UJQ A;  1VBA 1;  1OA3 A;  1A6C A;  3LPG A;  4CP0 A;  1LAJ A;  2ARC A;  4XIK A;  1ZZC A;  4FPJ A;  1S0E A;  3ASI A;  5DAW A;  3VBR C;  3O1T A;  1QJX 3;  3VBO A;  3KVA A;  3GBG A;  1V0A A;  4NVP A;  3LFM A;  5GZF A;  5E8A A;  4PI0 A;  2Y6F A;  2V73 A;  4P9J A;  4PJY A;  3JB8 A;  3HVD A;  4AAX A;  1XE8 A;  4B4Q A;  1R1A 3;  5DZG A;  3JCI A;  4LLO A;  1PZ7 A;  4AVB A;  3CJI A;  1K12 A;  3Q8B A;  4CDW B;  1D0H A;  5FJK A;  2C9A A;  1I9R A;  1JI6 A;  4FP3 A;  5FYZ A;  4N43 B;  4DUW A;  4Q0Q A;  3GYD A;  4YM0 A;  2W91 A;  4JDM A;  3ROU A;  4F7Z A;  3ENR A;  4D0Q A;  1ODM A;  3TB0 A;  1VAV A;  2R04 2;  1HJG A;  3CL1 A;  1AUY A;  4FPO B;  3O1V A;  1H30 A;  2A6Z A;  3WSO A;  3DEC A;  4K40 A;  4RS5 B;  3I8T A;  1GBG A;  3KZ4 C;  1V6K A;  2A7A A;  2IC1 A;  1G7Y A;  1LOA A;  2KR2 A;  2W52 A;  1EUU A;  1XNC A;  2WRA A;  2MHF A;  4JKM A;  4BK5 A;  4OZO A;  3E6B A;  5IT6 A;  3I97 A;  2GN3 A;  2VQT A;  4EV0 A;  1BVV A;  1KIT A;  1X8M A;  3BB6 A;  5EJ1 B;  1W99 A;  5FP4 A;  1DP0 A;  4MXW B;  1FT9 A;  2A3W A;  1XOY A;  4XBN A;  5G04 L;  2H6B A;  3HNM A;  4ISQ A;  1NCR B;  3ZIX A;  2Z5W A;  4E2Q A;  2D93 A;  2YHJ A;  2XVL A;  3T2P A;  4EN9 B;  2OPW A;  1CON A;  1OFN A;  1GU3 A;  1V6N A;  2V5D A;  2WAA A;  3CEW A;  3Q8E A;  3J7L A;  5FRE A;  3ZSJ A;  5JUV A;  4DY3 A;  3D3A A;  4EZH A;  4CCL A;  3UYJ A;  4YW1 A;  3RJ2 X;  3C7G A;  4MHU A;  2RDQ A;  3N3H A;  4L9B A;  4PT6 A;  2JDM A;  2WO3 A;  3BTZ A;  3D0S A;  3GJB A;  2XJQ A;  3KGL A;  4P9I A;  3FWE A;  2VY0 A;  4BQY A;  5K7P A;  5FYI A;  1QEX A;  2FDH A;  3OPT A;  1Q8V A;  3OUI A;  4LBK A;  1FOD 2;  1OF3 A;  3AP5 A;  4QKD A;  4W6W A;  4AG4 A;  4D3W A;  3LEI A;  3NNM A;  3VD3 A;  1UYX A;  3KWV A;  3BIE A;  3LSD A;  1H2N A;  3I2D A;  2HWF 3;  1C28 A;  4TYS A;  3HAG A;  3UET A;  3ZN6 A;  4Z82 A;  1XPW A;  5BNP A;  3RYP A;  4AVT A;  3BUC A;  1CN1 A;  1H8T A;  2DCY A;  2CY6 A;  1JU4 A;  1S2B A;  3RFR A;  1CAX A;  5CNA A;  3DEM A;  3WQB A;  3NV2 A;  1LTE A;  5FUP A;  1Y9G A;  2Q8D A;  3NNJ A;  2XH6 A;  2P1B A;  2WQ4 A;  1WCD J;  1RUF 2;  1CD3 G;  1SHW B;  4FPK A;  5FMO L;  5JAX A;  1SFY A;  1IPJ A;  3BN6 A;  1HRI 2;  2J22 A;  4AVV A;  5J36 A;  1E5R A;  3IKW A;  1JZ7 A;  1ZRE A;  4MGT A;  5I0U A;  4JGY B;  3SEP A;  3WX5 A;  4C91 A;  2OPK A;  3FMG A;  1H2L A;  1ZBA 2;  2Y33 A;  1W39 A;  1VMF A;  1UW8 A;  2X8K A;  1FPN 2;  2OUH A;  4IV1 A;  5FZL A;  1EV1 3;  5KBF A;  3CNA A;  4FSJ A;  2P3I A;  2RS3 2;  2VOT A;  1Z7S 3;  4L99 A;  5F3I A;  4IER A;  1OOP C;  3DXU A;  4LBN A;  1K45 A;  2OZJ A;  2VME A;  2JKX A;  3QH7 A;  2FZ1 A;  2VZ3 A;  3MEP A;  1UOF A;  2GME A;  4GAL A;  4OUM A;  3VBS B;  3VKF C;  1U12 A;  5L9R A;  3III A;  4K8R B;  1Q5O A;  1UZY A;  3TEZ A;  4MYE A;  5F2W A;  1EYB A;  1UZV A;  2WYF A;  3NAP B;  3OBZ A;  4JZR A;  5EXO A;  5FY0 A;  2ZGO A;  1C8M 2;  2E31 A;  3ZLI A;  5IVC A;  3CMG A;  4PI2 A;  4RQP A;  4CP1 A;  1GSL A;  5IAX A;  3W9A A;  2VCC A;  4LOR A;  5CB7 A;  2IUW A;  3VBS C;  2WNO A;  5LRR A;  2OVU A;  3SQO A;  3RZL A;  5APA A;  5FZ6 A;  2Y0O A;  2HJI A;  2WFP A;  2XL9 A;  3HN1 A;  4DIN B;  1OA2 A;  4WVW A;  1J59 A;  4P02 B;  1Q3E A;  2XWJ B;  2CL2 A;  3B69 A;  5A33 A;  4CUC A;  2D97 A;  2YV8 A;  1ZVF A;  2WNU C;  4UW3 A;  4D7S A;  1Y3T A;  4BXS V;  3UGG A;  4TXW A;  2CGN A;  2P6C A;  1UY4 A;  2JG8 B;  3LSE A;  3ZO0 B;  3NWK A;  3GGL A;  4DEQ A;  1ZZ6 A;  1PVC 3;  1E5S A;  1K42 A;  4OHW A;  4HAN A;  4YG3 A;  4KMQ A;  5A80 A;  1I1E A;  1CZS A;  2JKB A;  5ABJ C;  3WLU A;  3ZXL A;  2O8O A;  3A4U A;  1W0N A;  4RR3 B;  3ZSK A;  5BNP C;  1JZ2 A;  4OUL A;  2VQ0 A;  4Q4X 1;  5LY2 A;  4Z92 B;  1NA1 B;  3AFK A;  4IV1 B;  3HWJ A;  4LLF A;  1Q8Q A;  4KG0 A;  4JKK A;  1SBE A;  3AVR A;  3MFA A;  5ABJ A;  2VCM A;  2YFU A;  5LEK A;  1UXX X;  3VZK A;  5IVE A;  1ENR A;  4ERO A;  2ZEW A;  3VB9 A;  2N7G A;  4XC9 A;  1UYZ A;  4G3Y C;  1AR6 2;  2FZ2 A;  2CNA A;  1YI9 A;  1XBF A;  2YGL A;  4DUV A;  1DQ1 A;  3MW3 A;  3PJQ A;  4XVH A;  1QJF A;  2PHW A;  1L3J A;  1QH7 A;  4WVM A;  2D3R A;  1FNZ A;  2P34 A;  2VOV A;  2GC1 A;  3GZT B;  1RUE 3;  1ULC A;  1W8N A;  4C1X A;  1JXN A;  1GYK A;  1RUJ 3;  3D0J A;  5L73 A;  2E51 A;  3V0B A;  2I45 A;  3IAQ A;  1IS4 A;  4E4H A;  2B4K A;  3HIF A;  3RPQ A;  3MW2 A;  4OVE A;  1WCS A;  1W0O A;  5LB6 A;  4NPM A;  3WT3 A;  4WM7 A;  2EAA A;  3VDD B;  4YFZ A;  2JIJ A;  3N7L A;  5DXD A;  3ZFF B;  1QMJ A;  2LS6 A;  2R6Q A;  3N9M A;  4I30 A;  5FZA A;  3TNQ A;  1SZB A;  1OKO A;  4CU9 A;  4Q0V A;  5F32 A;  2YYO A;  4AHZ A;  1GZW B;  3OGG A;  1W03 A;  2PHT A;  1UN1 A;  5FUN A;  4OHY A;  4QQL A;  2WNV A;  5FPL A;  2WLQ A;  1QOS A;  3WNO A;  4HPK B;  2IWG B;  4S2G A;  4XMA A;  5HXV A;  3HOB A;  4IGO A;  2JDP A;  4EN7 B;  2NPI A;  4B29 A;  1IPK A;  1AR7 2;  4W50 A;  2RMU 3;  4LBQ A;  2HWE 1;  1HRV 3;  4N43 C;  2W5F A;  4QM8 A;  4FP2 A;  4YG6 A;  3MIE A;  2O8Q A;  2XON A;  2R16 A;  5C4W C;  1ULF A;  3LA2 A;  4AOC A;  1GQG A;  1TME 2;  2EXI A;  3LIG A;  3AZY A;  4LT5 A;  4YZ4 A;  1ULD A;  1WLT A;  1RUE 1;  4YWA A;  2ARE A;  1V9U 2;  2ZGM A;  1RMU 3;  2RS1 2;  1N1T A;  1GNH A;  4IV3 A;  2OII A;  4UI9 L;  3ZFE B;  4K3U A;  2H0V A;  4BME A;  2XJV A;  4XZU G;  4Q2F A;  1TME 1;  3C7O A;  2Q1M A;  1KS5 A;  5BXX A;  3N7K A;  5FCC A;  2X5I C;  4AEK A;  4I0W B;  4PIZ A;  1X33 A;  3MIB A;  4ASK A;  5C3P A;  5FYS A;  5LCW L;  2LRP A;  4DZG A;  1OF4 A;  4XXP A;  3MIG A;  2UYB A;  4A7K A;  3AL6 A;  2A5Z A;  2FDI A;  1EPZ A;  3J7H A;  2JE8 A;  1SAC A;  3PUH A;  4EN0 A;  5L7O B;  1LES A;  1PMH X;  4XUP A;  5JI9 A;  4FI9 A;  5KXB A;  3TBD A;  3BOD A;  3RI8 A;  1H0B A;  4XET A;  4HKO A;  5C70 A;  1JW6 A;  3O0W A;  4ORF A;  2VBB A;  1ZRI A;  2I07 B;  5F37 A;  2O14 A;  4NMI A;  2HWD 2;  2Q5T A;  4XE9 A;  1CAU B;  5JZG B;  3VHO A;  3R4S A;  2HWD 3;  4ISR A;  4I02 A;  3O5S A;  4YYO A;  3VBR A;  4MGK E;  1UOJ A;  1R64 A;  3N9L A;  1W6N A;  4UWD A;  3VGI A;  1EV1 2;  4ASL A;  1CES A;  2WDB A;  4DRV A;  5CG9 A;  3UNP A;  4GWI A;  4Q4W 2;  3NMB A;  4H2A A;  4UFJ A;  4CEY B;  2DVA A;  1FXZ A;  2E7A A;  1QQP 2;  2G19 A;  2ORX A;  5FBJ A;  2BJS A;  1BEV 1;  2Z42 A;  1K5M C;  4YSF A;  1QJY 2;  3GZU C;  4HG6 B;  1LJ7 A;  1LOD A;  1OI6 A;  1WA6 X;  3Q8F A;  2ZGP A;  5E6H A;  2ZX2 A;  1IS3 A;  5FOB B;  5IFT A;  4I2O A;  5IUQ A;  1AYM 1;  4IGP A;  1G8W A;  4JX0 A;  1BEV 2;  1WGP A;  2W0X A;  1WD3 A;  1OPM A;  4J1W A;  3ZYB A;  1UX7 A;  3ETQ A;  4HXC A;  1H1I A;  3POB A;  1QJX 2;  3KLS A;  3LEK A;  2Y6J A;  4E27 A;  5AFB A;  1Y7B A;  4Q4X 2;  4A41 A;  1LNS A;  1XU1 A;  5C8C A;  1FV3 A;  2ENR A;  3Q8C A;  2YZ4 A;  3BOW A;  1FAY A;  3P5B A;  4FOW A;  1ND2 C;  2J1T A;  3JUU A;  1LGN A;  5C9A B;  1LOG A;  4A44 A;  4AI1 A;  4E4S A;  3H50 A;  4YW3 A;  1JYT A;  5ACA 3;  1Z7S 1;  1ZBA 1;  2GH8 A;  1X7N A;  1VBD 1;  5C6C A;  4HVO A;  1LOC A;  4KBB A;  3AVS A;  5EJZ B;  5JI7 A;  4NHY A;  5KXE A;  1RUC 2;  4QMA A;  3DPR A;  4JRA A;  3CJX A;  3GCX A;  1Z7S 2;  3RWN A;  4XUN A;  2RS3 3;  3BYW A;  4GAZ A;  1GOF A;  1RED A;  3PDQ A;  2H0B A;  3MO4 A;  4AWD A;  4LHN A;  4UYB A;  2YBS A;  2W9X A;  1GR3 A;  4TN7 A;  2JDA A;  1R1Z A;  1R09 1;  1X82 A;  2B42 B;  2O0O A;  4XYX A;  2JG9 B;  5A1F A;  1Q8S A;  1Y43 B;  2R7E B;  1CPM A;  3G6J B;  5KWR A;  4M0H A;  2VZU A;  4UBH A;  4FTB A;  1Q56 A;  4JDN A;  5DUX A;  2VTX A;  4EWA A;  4H14 A;  2QTW B;  4ARX A;  1C4R A;  1DGL A;  2DUR A;  2WAB A;  4V2W A;  5JSP A;  2GP5 A;  4CXW A;  1LUL A;  1J84 A;  5FZF A;  4GMP 3;  3FJS A;  3RVH A;  3V56 A;  3FBY A;  5DDJ 1;  1NCQ A;  4BK4 A;  4B1L A;  2QQN A;  5FYC A;  4AI3 A;  1UO9 A;  2ET7 A;  1ZZ7 A;  1U5Y A;  1QQP 1;  2WWU A;  1PO1 1;  4RN5 A;  4YVW A;  2E32 A;  3BOP A;  4RFR B;  4BLJ A;  4N9I A;  3B9I A;  3OGR A;  1N3P A;  1DDL A;  2BOI A;  1O3Q A;  1UZ0 A;  2WNV B;  5T52 A;  2K9Z A;  3Q8A A;  1YRZ A;  1XU2 A;  2IXH A;  2PXJ A;  1WKY A;  2XBO 3;  4FO9 A;  1QXP A;  3RQ0 A;  4HOO A;  1PM7 A;  2FQP A;  1NQD A;  2E7T A;  1RUJ 1;  3B94 A;  3POW A;  4I01 A;  3O0X A;  1AX1 A;  1OQ1 A;  2BQP A;  2VVE A;  2XGX A;  3C3V A;  3A0K A;  3LB9 A;  4MV2 A;  3DL3 A;  1GIC A;  4KH9 A;  4EN8 B;  5CFC C;  3VBO C;  1H4G A;  2YC4 A;  4XZP A;  4QT6 A;  2V4A A;  3BU7 A;  3S6P A;  4DPN A;  4E4Z A;  1N1S A;  1AHS A;  5ANN A;  5FZ7 A;  2ZMK A;  1AJO A;  3WQ7 A;  5B4N A;  5FZ0 A;  4XF1 A;  3ZVX A;  2DVD A;  1ND2 B;  1QY4 A;  2O1Q A;  5FZD A;  5K0U A;  1N1V A;  3ATG A;  3WHT A;  4XIO A;  1EAH 3;  3VBO B;  5DAQ A;  1D0G A;  1TQ5 A;  2ADD A;  4G9S B;  4DXR A;  4A3X A;  4MAD A;  2SBA A;  5FPZ A;  3M3E A;  1PNG A;  1QXR A;  3VKL A;  1AR6 1;  1HQL A;  2R06 1;  3Q9O A;  1ND2 A;  1CAW B;  3HR9 A;  2VNV A;  2VGD A;  3SEE A;  4NO4 A;  2VOW A;  2XML A;  1CZT A;  1JZ6 A;  4GIQ A;  4N43 A;  1F8V A;  4AI2 A;  2BYV E;  3D5O A;  3NKG A;  4CCK A;  3H8X A;  1OPO A;  3WDX A;  2ARA A;  4WM8 B;  4HFS A;  4UFK A;  5FYU A;  5F9T A;  2GAL A;  5T5L A;  1HDK A;  2HYX A;  4PBO A;  3TN9 2;  4A2U A;  3VUO A;  4QDQ A;  4W8J A;  1GZT A;  4OHV A;  4Q4Y 3;  1W6P B;  4LMF A;  5DUU A;  4XFF A;  3WW1 A;  1ZRR A;  5JDB A;  1MEC 2;  1BBT 1;  5F3E A;  3A7Q A;  2BVB A;  3SC7 X;  2R30 A;  1O7F A;  4BDV B;  4FOY A;  2PHR A;  1H1A A;  4IL7 A;  3E97 A;  4QD2 A;  4CCJ A;  3FLP A;  4EWE A;  5CEH A;  4H3W A;  3B9C A;  3RZJ A;  4JDO A;  4Y20 A;  4TTG A;  2A6V A;  3KV9 A;  2GZW A;  4M3C A;  1XNK A;  1PGW 2;  2DV9 A;  2VH9 A;  4LEJ A;  3VBH C;  4AHX A;  4OUE A;  5A3M A;  1H2K A;  4YW6 A;  4ATF A;  1SFN A;  2UYA A;  3WW4 A;  3ZN4 A;  1JZ8 A;  2W3J A;  5I0R A;  1W2O A;  1QDO A;  2DCJ A;  1YWK A;  3AX4 A;  3FC0 A;  3GBW A;  3FE5 A;  4QHO A;  2C1F A;  3U78 A;  3WW3 A;  1JYV A;  2W68 A;  1FI2 A;  5LK7 B;  4IEV A;  5EYX A;  2XKO A;  2R49 A;  3NST A;  4CEW A;  3USS A;  3KQR A;  1KDM A;  3I2K A;  3IB3 A;  4UAP A;  5CIR A;  4YVW C;  2VM9 A;  3IPV B;  4QHB A;  1S55 A;  3GNE A;  2C4X A;  2WQZ C;  1S0J A;  1YFX A;  3PJY A;  1C8M 1;  2BFU L;  2XBO 2;  1JYW A;  5IK5 A;  2QUO A;  4LO6 B;  4S2H A;  1AF9 A;  2VZV A;  1NE4 A;  3UT0 A;  3VZO A;  3DN7 A;  1HN1 A;  4WM7 C;  2HWF 2;  3UL2 A;  4DEV A;  3VBF C;  5LY1 A;  3S5A A;  4AED A;  1TEI A;  3L9J T;  3PIJ A;  1ZZ9 A;  1MZ6 A;  1XND A;  2XG3 A;  2OXB A;  4FXG B;  2VO5 A;  2CAU A;  4S2D A;  4YW5 A;  5A7O A;  3I54 A;  3SKV A;  3H8R A;  4I0A A;  4Q4V 2;  4CCO A;  3HN3 A;  3LDK A;  2ZKN A;  4BQW A;  4O61 A;  3GM8 A;  1TNF A;  2Z69 A;  1VBE 1;  4XF4 A;  5T5J A;  4BPZ A;  1O3T A;  2Z2S B;  1MS3 A;  1C1F A;  1XNT A;  3UV9 A;  2DVF A;  3M4F A;  3OG2 A;  3B02 A;  1POV 1;  4I3G A;  3SHR A;  4BU2 A;  5L9V A;  2PLV 3;  4BA6 A;  5FV3 A;  2D44 A;  1V6O A;  2VBP A;  4JGZ C;  2JG9 A;  3UKT A;  4LHS A;  1DBN A;  3V0B B;  4Z2W A;  3PUR A;  2WNE A;  2CSG A;  4UFL A;  1QJZ A;  5C8C C;  4JHZ A;  1Y9M A;  1JZ3 A;  3WOG A;  4RHV 1;  5BNQ A;  1QOO A;  1MQT C;  4IGQ A;  3M70 A;  3ZFG C;  1POV 3;  1UQX A;  5L7O A;  4QHZ A;  1CIW A;  3WDT A;  3O0V A;  1UU6 A;  1ULP A;  5A3U A;  3S5Q A;  1OC1 A;  1G9B A;  1KD7 A;  2IXL A;  3GZE A;  3VBH B;  3FX3 A;  1VRB A;  4XTP A;  1B35 A;  1CPN A;  3ZOI A;  3DPR C;  2EA7 A;  2FMY A;  2XXZ A;  1Z78 A;  4YLZ A;  3VN4 A;  4D7T A;  3TWI A;  2WN2 A;  2VMG A;  3I2H A;  1U5Z A;  2RM2 3;  4E9K A;  1ULO A;  2HEV F;  4AZZ A;  4LO7 A;  1O3S A;  1W6N B;  1PO2 1;  2MNG A;  1W28 A;  4XW3 A;  1FAT A;  1LEM A;  1KJL A;  1CVN A;  1YFY A;  2Q4S A;  3J9S A;  1R08 1;  1W8Z A;  3OD0 A;  4Y22 B;  5JOY A;  3FFZ A;  5KC6 A;  2K0G A;  5AVP A;  2VQU A;  5JMC A;  2Y0I A;  1POV 0;  1NOV A;  1M4W A;  1Z0H A;  4Y33 A;  2NMN A;  1V9U 3;  5FO8 B;  3VKM A;  3WF2 A;  2BZD A;  2EID A;  2XWB B;  3W5N A;  2LW8 A;  2VBD A;  4O7X A;  1RJ7 A;  3RWK X;  3DYO A;  1W2T A;  4FXK B;  4ZU7 A;  2ZML A;  3WF1 A;  2XLA A;  3VDD C;  5FQ0 A;  3HPN A;  3WUD A;  4QPG B;  4O9E A;  3S7E A;  3L2Y A;  1W8U A;  3MHZ A;  3ST7 A;  5FWJ A;  3NJX A;  3BKZ A;  3WP6 A;  1FPN 1;  3FN9 A;  1UKR A;  1CIY A;  4N53 B;  5JLV A;  1KXG A;  3ZDS A;  2GH2 A;  1VRH 1;  1XYN A;  3ZR6 A;  1LHN A;  1LHV A;  1EAH 1;  1NY7 2;  2A1X A;  4LK7 A;  5FYH A;  4YGB A;  3AL5 A;  3K4D A;  5LA9 A;  3WNX A;  4BOW A;  3VDA A;  1Y9Q A;  1SBD A;  3H9A A;  4QPG A;  4FT8 A;  1XYO A;  4AED C;  2VTX J;  1SEF A;  4AGR A;  1FV2 A;  1WMX A;  1UU5 A;  1OLR A;  2HEW F;  3AM2 A;  1R08 3;  3DKQ A;  2YBP A;  3QBQ A;  1WCK A;  3K48 A;  5K4L A;  4AL9 A;  4UF0 A;  2OS2 A;  1H6Y A;  4D8M A;  1DF0 A;  2WWJ A;  1OFS A;  1R08 2;  5K9Y A;  3AMN A;  2D3P A;  1VIW B;  1B09 A;  3HMY A;  2WFF 3;  1YUD A;  2YY1 A;  2J1A A;  4MXW A;  3H0O A;  4XHB A;  3ZMO A;  4A3Z A;  3ILF A;  3LKJ A;  1M06 G;  2R0F A;  5FZE A;  1GP5 A;  3KV6 A;  4QB6 A;  3I2J A;  5FYT A;  2B8M A;  3OD4 A;  1NCQ C;  4QX7 A;  3AMM A;  3BIW E;  1UKG A;  1W2A X;  1ASJ 2;  2J42 A;  1STM A;  3PU3 A;  3ZM8 A;  3WD5 A;  1AR6 3;  3P3N A;  4KU8 A;  4FPY A;  2WSU A;  1VP6 A;  4U2A A;  4YG0 A;  2K46 A;  2VZO A;  3OGS A;  1BEV 3;  1UZW A;  2A71 A;  5DDJ 3;  1T6B X;  2GND A;  3RRD A;  3RYR A;  1SLI A;  4Y20 B;  1XNB A;  1R09 2;  4J6G A;  4NIG A;  3B5L B;  1OMI A;  2OUJ A;  2UWC A;  4Y1Y A;  3RYK A;  1RUH 2;  2R1D A;  2YG0 A;  2BBA A;  1UIK A;  1VBC 3;  3WDU A;  1JOB A;  1NA1 C;  4LA3 A;  4PDW C;  1RIR A;  1S2E A;  4FCA A;  4BCU A;  1ZX5 A;  1UY2 A;  1BLZ A;  3VD5 A;  2CU5 A;  1QWR A;  2FCV A;  4HMZ A;  3T1M A;  5SV5 A;  5A32 A;  2YFZ A;  2AZ5 A;  4ZZ5 A;  5BNO A;  5JWP A;  1AX2 A;  1RUD 2;  3ITQ A;  2QZ2 A;  3PHM A;  4LOS A;  3RNS A;  1GV9 A;  1AR7 3;  4P9L A;  1ND3 B;  1HKD A;  1J58 A;  5LEJ A;  1MPX A;  3HBZ A;  2Y8K A;  1VBE 2;  4DXT A;  2R06 3;  5BV6 A;  4GB3 3;  4QAW A;  5IYY A;  3LQC A;  4CU7 A;  1A8D A;  1YFU A;  3DF0 A;  5FMO S;  4F3J A;  4N53 A;  1YIP A;  2FDF A;  1T2X A;  3VD7 A;  2VNO A;  3BCW A;  4LO8 A;  5CIS A;  1AYM 2;  4XXA A;  3PVN A;  2DF7 A;  1PO2 2;  2OX0 A;  4AE2 A;  1JZ5 A;  1RHI 2;  2J1R A;  2WIN B;  4FAG A;  4YZ1 A;  1O8P A;  3N7J A;  4PLO A;  1WUV A;  1K5J A;  4KWL A;  2BBV A;  1PZ8 A;  2VUL A;  3IDC B;  3S30 A;  5A3T A;  5GLU A;  5GZE A;  5LRS A;  1BJQ A;  3B7M A;  1ENX A;  4XOG A;  2XUM A;  2R1B A;  1OD3 A;  1GAN A;  5CYY A;  5FIX A;  1ZRF A;  3ACH A;  1FYU A;  4XHX A;  1VLN A;  2BV4 A;  1UF2 C;  1XQN A;  1ZBE 2;  2RS3 1;  2QQV A;  3WZ1 A;  1QF3 A;  5FPA A;  3MF9 A;  5J37 A;  3FUO A;  3NVC A;  2PHD A;  3VZM A;  3AKS A;  5JXI A;  2R07 1;  5FZI A;  1HV1 A;  1G86 A;  2WL1 A;  1VB2 A;  3FFQ A;  3VKO A;  5GZG A;  1W8F A;  2ZEZ A;  4LIT A;  4OI0 A;  4QX2 A;  3VD9 A;  2F6B A;  3WG3 A;  3W20 A;  4DIQ A;  2RMU 2;  4UFI A;  2FHR A;  2E63 A;  4QU1 A;  5BNN B;  3POJ A;  3BU0 A;  3IBM A;  2YC0 A;  3BPZ A;  4QXB A;  1ZBA 3;  4IEY A;  3E5Q A;  5H9S A;  1PVC 2;  1UYY A;  4PBP A;  5HV4 A;  2VNG A;  4A4A A;  1ZNP A;  2IXJ A;  3AB0 A;  5AC9 2;  4TLF A;  4IQP A;  1MZF A;  4QX0 A;  5BNN A;  2XJP A;  3JBG 2;  1H8T B;  2E7Q A;  1COV 1;  2EXK A;  1GQH A;  5CU1 A;  1QIQ A;  3ZN6 B;  1WW5 A;  1A34 A;  3W59 A;  1E57 A;  1MAC A;  2YC2 A;  2WZE A;  2VUA A;  1W0P A;  1WW6 A;  4KBZ A;  3NQH A;  4YVS A;  2FDK A;  5C9A A;  4FFF A;  4XUQ A;  3VBU A;  4EQV A;  5HPO A;  3NV3 A;  1COV 2;  2JIC A;  5E16 A;  1AXZ A;  3CJI C;  4CDU B;  5C3Q A;  4P9W A;  2WS9 3;  2YDE A;  1VMH A;  5A7P A;  2HWE 2;  4MGZ E;  1VBD 3;  1OLQ A;  2F4L A;  2W95 A;  3BI3 A;  4JGY A;  5A7Q A;  1BKZ A;  2GNM A;  1ZZ8 A;  1JBC A;  2HWC 2;  2JDZ A;  4N7I A;  1SQ4 A;  4O65 A;  4Y4Y A;  1NY7 1;  2PTM A;  2Z79 A;  3WF4 A;  4XMI A;  2X5I A;  2PLV 2;  2Q1Z B;  4BQ2 A;  1CX4 A;  5C7G A;  1WW7 A;  4E4D X;  3MV0 1;  4FPF A;  3I59 A;  5H9Q A;  2WT0 A;  1W8W A;  3WP4 A;  5C71 A;  5IK4 A;  1X8E A;  4Q0S A;  2ID4 A;  4XUO A;  3KF5 A;  4QQH A;  5CKQ A;  2HWE 3;  3KSC A;  3M1H A;  4Z07 A;  3B3Q E;  1G6N A;  1N3Q A;  4YZ5 A;  3GXU A;  3AK0 A;  1HB3 A;  5FP7 A;  3USU A;  2BU9 A;  4OMD A;  2VUJ A;  3H42 B;  5A7W B;  1LKN A;  1GZW A;  3WNM A;  1JH5 A;  2QQM A;  4K9S A;  1V70 A;  4GMP 0;  5FZH A;  3UJO A;  4COU A;  4RGA A;  4D6Q A;  5FZO B;  3R6S A;  1GWK A;  4N9H A;  5J96 B;  1I5Z A;  2R0H A;  1UWW A;  1JYC A;  2YBK A;  2QVS B;  3PUQ A;  5B4X A;  2Q8E A;  4BLI A;  2BDR A;  2DCT A;  2ZGQ A;  3T09 A;  3I3M A;  2V5Y A;  2JB4 A;  1VBA 2;  3IDE A;  3IDA A;  5FP8 A;  2C9K A;  4RSU A;  1G9C A;  1S0C A;  1XC6 A;  5IK7 A;  1IS5 A;  3RS6 A;  5CG8 A;  3KVB A;  4NIA A;  2GNB A;  1RVF 2;  1BK1 A;  2WO2 A;  4Q1P A;  2J7M A;  3R4D B;  4EN6 B;  4PDW B;  2GNT A;  4HVQ A;  1HB1 A;  2ORZ A;  4S2F A;  2ERF A;  5EQU A;  2NZ9 A;  1RUI 2;  4NHL A;  4QPW A;  1SG3 A;  2GU9 A;  3SNM A;  3VBU B;  3ELN A;  1F15 A;  1VB4 A;  1UIJ A;  1IKP A;  1SLA A;  3I2G A;  4E2G A;  4R8H A;  2BVV A;  1MS5 A;  2SLI A;  3SMH A;  5FY5 A;  4Q4X 3;  1REE A;  3F2Z A;  5L19 A;  4GJY A;  3PVE A;  4B1M A;  2BNM A;  1ULE A;  1W90 A;  1LEC A;  5FMD A;  2EVX A;  2IXC A;  2D40 A;  1QJE A;  2JDN A;  4FPC A;  4JVA A;  2D7F A;  3CLP A;  1BXH A;  3JQW A;  4OI4 A;  3JU9 A;  2CDO A;  3FLT A;  4R52 A;  3MGU A;  5JOX A;  2QKD A;  3A22 A;  1DGR N;  3AFG A;  1UU4 A;  3H1W A;  1W6M B;  4L2N A;  3APB A; 
#chains in the Genus database with same CATH homology
 4XCB A;  4ZON A;  5DAP A;  5L9R A;  5C5T A;  5DAW A;  2FCT A;  3KT1 A;  3OBZ A;  4JZR A;  4KBZ A;  3HQR A;  5L9B A;  5LBC A;  2G1M A;  5IAX A;  3PL0 A;  4J25 A;  4BQW A;  2HBU A;  5LBF A;  5L9V A;  4IW3 A;  3BVC A;  5HV0 A;  2FCV A;  2RG4 A;  4NMI A;  2V4A A;  3ITQ A;  2FCU A;  2HBT A;  4XAB A;  3EMR A;  4UWD A;  5A3U A;  2OPW A;  5DAQ A;  3GJA A;  2JIG A;  3GZE A;  5DAV A;  4ZPI A;  5ERL A;  2G19 A;  4MHU A;  2RDQ A;  5M0T A;  5EP9 A;  3GJB A;  5LBB A;  5EPA A;  4BQY A;  4XCA A;  2Y34 A;  2RDR A;  4XC9 A;  4NHX A;  3OUI A;  3NNL A;  4Q5O A;  3NNM A;  4XAA A;  3KT7 A;  3KT4 A;  5LAT A;  4XAC A;  5C5U A;  3OUH A;  5DAX A;  3HQU A;  4NAO A;  5EQU A;  5LAS A;  5LB6 A;  3NNJ A;  4NHL A;  3NNF A;  2JIJ A;  3OUJ A;  4NHK A;  5LBE A;  2RDN A;  5IAT A;  4NHY A;  2Y33 A;  3W20 A;  4MHR A;  2A1X A;  2RDS A;  4NHM A;  3W21 A;  5LA9 A;  5IAV A;  5HV4 A;  3MGU A;  4Y5T A;  4BQX A;  4Y5S A;  3DKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...