5LBBA

Hif prolyl hydroxylase 2 (phd2/egln1) r396t variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
229
Chain Sequence
NGQTLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADETARAKVKYLTGGVRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 61
structure length 229
sequence length 233
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbbA00
4XCAA 4KBZA 5DAWA 3NNLA 4XC9A 2G1MA 5A3UA 5EPAA 2Y33A 4MHUA 3KT1A 4NHYA 5HV0A 3DKQA 4NHMA 3BVCA 4ZPIA 4XABA 4XACA 3HQRA 2Y34A 3GJAA 2FCTA 5DAPA 2FCVA 5DAQA 4BQYA 2JIJA 5LBFA 3W21A 5L9BA 5L9VA 2G19A 2HBUA 5EP9A 4Y5TA 3W20A 3GZEA 5LBEA 5LASA 2V4AA 5C5TA 5IATA 5HV4A 2A1XA 3OUIA 5EQUA 4MHRA 4BQWA 3PL0A 4UWDA 4NHKA 4J25A 5IAVA 2FCUA 2OPWA 4NHXA 5LA9A 2RDNA 3NNMA 4Q5OA 3OUJA 3EMRA 3ITQA 4BQXA 2RDRA 3OBZA 5C5UA 3NNJA 2RDQA 3MGUA 3GJBA 4IW3A 3NNFA 5L9RA 2JIGA 3KT4A 3KT7A 3OUHA 4NAOA 5IAXA 5LB6A 5LBCA 2RG4A 4ZONA 4JZRA 5DAXA 4Y5SA 5LATA 5M0TA 4NHLA 4XAAA 4XCBA 2RDSA 3HQUA 5DAVA 2HBTA 4NMIA 5LBBA 5ERLA
chains in the Genus database with same CATH superfamily
4MO3M 1YQCA 3PU3A 4Y4YA 4NIIA 1QOSA 3WSOA 2CL2A 2WZ8A 4KWJA 2CNAA 4LHSA 4N43A 4Q4Y1 2PLV3 5IT6A 3H0OA 3MIHA 3FLTA 4LMFA 5EPAA 2Z79A 2V5YA 4RS5B 1WKYA 2R0HA 3DYPA 3TEZA 1H1MA 1XU1A 4JDNA 4PJYA 4HKLA 4D7YA 2XJSA 3VD5A 3WCRA 3DKQA 3LA3A 2JDZA 2R062 4RFRB 2P17A 2HH9A 1RXFA 3FL7A 1JS9A 3C2UA 2YHJA 2C6SA 4MGYE 4D8MA 2NLRA 2HLEA 5FR3A 1W04A 1GP6A 4FFHA 2R061 1JOPA 3ZXAC 2VUJA 3JB4C 4XJ8A 3AYCA 3UGFA 4D7SA 1AX2A 1FV2A 4DO0A 2RE9A 1WZXA 3R6SA 2BTVC 2HWC2 1PMIA 1W3VA 2QQOA 5HXMA 5CISA 4L0PA 4CCOA 2BERA 5L9VA 2G19A 1YI9A 4Y5TA 2HWC1 1WW4A 4CDXB 2PHWA 1W8WA 3GBGA 3MV01 2WZR3 5G04L 3ZYFA 1WCKA 4Q29A 1Z7S2 1PX3A 2ET1A 2RS13 3URFA 2DDUA 2DVBA 1C8NA 2E31A 4NROA 3KVAA 1LHUA 2YMZA 5FZ7A 5FZDA 4RGGA 3O1RA 1CX1A 3ETQA 1UKRA 1N1SA 1EPZA 3N7LA 5I93A 4AE2A 1OURA 3U78A 2AEYA 4E4SA 3K48A 4ZHNA 4BQWA 1LOBA 4CCKA 4AQ6A 2DCZA 2WAOA 2IXIA 1VMHA 4FTEA 1T6GC 4GZ9A 5JR7B 5BNOC 3ZYPA 1W2OA 4LQRA 2P4EA 5FUNA 5FXXA 4I30A 4F8AA 2QKDA 1C1FA 4XETA 2P3YA 2WLPA 3OGRA 5F7UA 2YROA 1UX6A 3PHMA 4DRRA 3ZFFA 3O1VA 1W8HA 3EMRA 3ITQA 4KG8A 4Z82A 2GNTA 2ZHLA 3LFMA 4P5HA 3WDWA 1OQ1A 1VRH2 1X7NA 2VNVA 3HIFA 3NNJA 1KDMA 5JMOA 2NM1A 3A23A 3VD7A 3POIA 4XURA 4AEKA 1KJRA 2I45A 3LFIA 1BBT2 1XNTA 2OUJA 2HYXA 4MV2A 5FFOC 1VRH1 3ZN4A 3TBDA 3N4MA 5FP3A 3IPVA 3SKJE 1YRZA 1NCRA 5L7OA 4LLFA 1Y9GA 4L2NA 5JSRA 3UJQA 4KGQA 4RGAA 4G9SB 3DPRC 4FFIA 1JZ4A 4P9GA 2R49A 3AKQA 4OCTA 5LATA 3ZYHA 4CCJA 1YFWA 1ND2B 4GMP1 5A7WA 1J84A 2VO5A 5FRAA 3USSA 5T3NA 4AF9A 1PGSA 1KGYA 3VBSB 1EV13 1YFUA 5FY4A 3WLUA 1HIXA 5F3GA 2VZSA 3T1LA 5A1LA 1IS3A 2Y0OA 3I2GA 3IMNA 3D0JA 3VBHC 1RVF2 1OF3A 3VKOA 1LU1A 2IFWA 4P9YA 1GNZA 2BJSA 2X5IC 4YW6A 3PJYA 3VZLA 1YQ5A 1REDA 3AJYA 4OLLA 4Q0VA 3POWA 1CAVB 1PO13 2IXCA 1OD5A 5FZLA 3ACLA 5FQ0A 5I0SA 3ZXEA 5B2GB 4K20A 1LAJA 2WABA 1HJGA 1A3KA 5FZCA 5ABJA 4XACA 1GZ9A 4AFAA 1RUG2 4MXVA 5FP9A 5FREA 1ASJ3 1ONAA 4DXTA 3KHCA 4Q4V2 3MZHA 4MGKE 3OPTA 3ST7A 1XJAA 2JD9A 4YGBA 4CDQC 3ZM8A 3EXUA 3AMMA 2KA3A 2OZJA 2WO2A 3KV4A 4LUKA 3BTYA 3BIEA 3U1XA 4I2OA 2P6CA 2B7YA 1W9WA 2J42A 2UU8A 3O7OA 1AYN3 2HWE2 3OBRA 4PI2A 4IV1B 4Q4V1 5I91A 4CVUA 3PUHA 5BNPC 1DQ1A 5IK5A 4BQ2A 2PHLA 4YWAA 2LW8A 2V5DA 4IEQA 2QDRA 4WBBA 2HWE1 1ZX5A 4RR3A 5FLIA 4LT5A 1HXS2 5C8CC 1K3IA 3WUCA 4QX1A 5FXVA 3A0KA 5HV4A 2BFUL 1NA1B 3KGLA 1SHWB 1OH4A 2UYBA 3WY6A 1OHFA 2VZUA 2GMPA 2GSYA 1MPXA 3R0RA 2GH2A 1AL23 1VBB3 2UWCA 5FV3A 2BZDA 1O91A 3JCIA 2WKKA 2ZMKA 3PL0A 1V6JA 5JMCA 1R081 1IS6A 2FDFA 1K45A 1V6KA 3AP7A 4AAXA 1LGCA 1AR62 2ZABA 2OPWA 5A3LA 2H6BA 3LPFA 3THTA 3K2OA 2ZJCA 4N43C 2Q5TA 1VR3A 1RMU2 1WA4A 3V65A 5BY5A 1AR61 4CU8A 4K40A 2N7GA 5A1AA 3FZ3A 4HK8A 4CSWA 2JJ6A 2ZAHA 3CNAA 3D4KA 5IHRA 1RMU1 1X36A 4FOYA 4QGLA 2G9FA 5IUQA 2EICA 4OI1A 4DUXA 2DYCA 1UOBA 1A34A 2VTXA 1Q5OA 4L92A 5JSOA 5LBCA 3ABZA 1E5SA 2WINB 4OFGA 4WM8C 4AEJA 1WW5A 4CDXA 5LCWL 2WFF3 4E4DX 1OLME 1Z78A 2EAAA 2EIBA 2FMDA 2YB7A 2XPJA 1EAH2 2D6MA 3I2IA 2VG9A 5FYCA 3T4VA 1HRI2 2DBIA 3GCWA 5FMDA 4FPHA 3N36A 3CJIC 4MYEA 3DYMA 1W6PA 2PN5A 1FMD3 2W1SA 4TTGA 5E1RA 3SCGA 3JB8A 2H0BA 3GDBA 4XUOA 1QJFA 4DEQA 4DS0A 2F4PA 3JUUA 2QQLA 4K8FA 5KXEA 2JWPA 4EN6B 4A7YA 2WA4A 1ZZ6A 5DAWA 1YCIA 3VD3A 1D4VB 4BOWA 3JQXA 3PU8A 4CEWC 4YZ4A 2Y6JA 3B7MA 1I3HA 1CPMA 3NW4A 5KBFA 3A0NA 3F95A 3GM8A 4X8PA 4N53B 4NPLA 4N8MA 5EJ3A 5L36A 4M00A 3N9MA 1DZQA 4XDOA 5C71A 3J8F3 1RIRA 4ZPIA 1YJKA 1D2QA 4CCNA 1U5YA 1W8ZA 4MH0E 3ATGA 5T54A 1KD7A 2QQJA 3KV9A 1ENRA 1R1A2 3OGJA 4WZFA 4A44A 3CMGA 1BXHA 2VVEA 5LEKA 3FJSA 1AZDA 1D4M3 1RHI3 3ACHA 3RMXA 1TME2 3RZGA 1R091 5K9YA 1UOJA 4YRDA 1IQDC 1MS4A 4LHNA 4BK5A 2CY6A 2ZGQA 4XFBA 1OOPA 1S0FA 1OVPA 3T0AA 4DPNA 3POSA 3ZKUA 2VQUA 2AC1A 2UWAA 3WW2A 4AI3A 3T2PA 2OT7A 1V9U1 1ND2A 3PIJA 4PF5A 4EYUA 4BQ4A 3POJA 2JE7A 4BQ1A 5L7OC 2C1FA 3VBSA 5DXDA 1SACA 1WA6X 2BNNA 2VULA 3SEEA 2AYHA 2E7TA 2BDRA 2DVFA 2XBO3 4G4FA 1UOGA 3AMQA 3N9NA 3ZR5A 4EN9B 3E6BA 1JBCA 5FZIA 3AKSA 4Z2WA 1G9FA 4J1WA 3IM0A 3JD72 3O14A 2BFUS 1QOTA 2LRPA 1QJU3 1RUF3 2CGNA 3ACFA 3HAGA 3M70A 4E2QA 3KQ4B 3MI8A 5ACA2 5GLUA 3J7NA 1CAVA 1F15A 4KG0A 3RGBA 3O1OA 5LA2A 5T50A 4CDWB 1CAXB 1VBA3 1DU3D 2XL7A 4OZOA 3MF6A 4MVTA 3MBWA 3SH3A 1UZYA 1WCUA 2EF6A 2Q8CA 5ACA1 3ORJA 1FT9A 1DGRA 1RUI3 4B29A 2VTFA 2BBVA 3LF7A 5GZDA 1GKBA 1GMMA 2JDPA 2JXAA 3I2KA 3ZXJA 1CD3G 2TNFA 1OD3A 1GOGA 3P6BA 2VMDA 2X8KA 3MIBA 2AACA 1VB4A 4KWLA 2W46A 2YPJA 2NMNA 5F32A 2VR4A 1DQ2A 3O0VA 1WLWA 4RL7A 4AVSA 1OC1A 5CADA 4FP2A 4AVBA 2AUYA 3B9IA 3E5XA 4UOJA 4FAGA 1ZVFA 4GIQA 3UETA 1C28A 1K5JA 1OXCA 1Q56A 3H3LA 5FZAA 4W6XA 4RQPA 3LDBA 3PDQA 1ULFA 4FBFA 5F1RA 5AVAA 4JGYB 4IEOA 3TRSB 4I3GA 4OHWA 1QNWA 1WLDA 1NA1A 4Q1RA 3BCWA 1CAWB 3EB7A 4FPGA 1IG0A 1TMF2 4J1XA 3CL1A 1MZ6A 2Y8KA 5DAVA 5EIYB 2PHFA 5FY5A 5J36A 3KM5A 2J1RA 2LM3A 2A75A 1I6XA 1MVQA 2RMU2 5FZGA 3R4DB 3DGTA 4Y22B 5DUUA 4D7TA 3VZOA 5I0UA 2WSUA 2GP3A 1UY3A 4Y3OA 2IVJA 1TMF1 3ZPYA 1H9PA 3NNLA 3I97A 1ZBA3 4Q1PA 3OEBA 4XJ9A 1V6LA 2CAVA 2G1MA 3NMBA 5FPVA 3M3OA 1HB2A 3ZO0B 3ACIA 4BMEA 1L7LA 1CZSA 3DPRB 3T09A 2ENRA 2BNMA 5IVBA 2R16A 1COV1 2KXLA 3MYXA 5JDBA 3HMYA 4JHZA 4RS5C 1UY4A 4JDMA 4CP9B 3ZKYA 1RITA 1K5MA 4UFMA 5FZ9A 3B3QE 4AI0A 3GCXA 3E1F1 5A3OA 5FWEA 3SITA 4ES9A 4ZXKA 3RSJA 2UY9A 1D0GA 1GFF2 4AEDC 4JX0A 2ZGKA 4Z1VA 3CIHA 1GICA 3T2TA 4DB5A 1AHSA 2QJVA 4Y26A 4BQ3A 3WNKA 5FIXA 4EN7B 3VUOA 2QTWB 3NKGA 2CDOA 3ZDSA 1ST8A 2ZGRA 4U2AA 5FY0A 3VLBB 1KFUL 4JRLA 3MW3A 5B4XA 1RC6A 1VBE2 4M4PA 4YVWB 3FN9A 1O4YA 4FTBA 3IDCB 3W20A 4B4RA 3NSTA 1MS1A 2ZGSA 4IDZA 3LQCA 1FYUA 2VM9A 3ZSLA 4HLTA 5C5TA 4EE2A 2YGMA 3VHPA 1J3QA 1WCQA 1AYM2 2OW4A 4NE9A 1QEXA 2RS32 5FZ3A 2R32A 3LSEA 3WF4A 4AFMA 3NO8A 3H9AA 5GZFA 4CDQB 3AB0A 1Y4WA 4QX2A 4LHLA 5F37A 5FZ1A 3OUIA 4ITCA 3OEAA 2WN2A 4MHRA 3ZXDA 2WZPP 3I49A 3MW4A 2FD8A 1LULA 5BNPB 4S2GA 2OQ7A 3UGGA 2ZHNA 4AHXA 2ZGNA 2JE8A 4N53A 2A70A 1ULGA 2PYTA 1RUJ2 4BIOA 1PZ7A 1QQP1 3CHXA 4BH9A 1UY1A 2D3SA 4RHV3 4R9AA 1PGW1 4YSFA 2VCMA 1MZ5A 3BOWA 1D0HA 1XSRA 1Y9MA 2WAAA 2QQIA 2GC2A 3NVCA 1SLTA 3VN4A 4TSVA 3D0SA 1Q3EA 5IVYA 4XJZA 5DDJ1 5AC93 3PVOA 1U12A 3IBMA 2JDUA 3NV2A 2D93A 2E33A 3C7GA 4RN5A 1GNYA 3KMHA 3W5MA 3VDBA 4FFGA 1WMXA 1PIV3 2Z69A 1U0AA 2IC1A 1VAMA 4Q0PA 2W1UA 2D3PA 2VPVA 2ZEWA 5KC5A 5J37A 3KCYA 4I0BA 2P2KA 1RUE2 4L11A 3HN3A 4QDQA 3AFGA 1S2BA 2B39A 1RUOA 1AX1A 1GQGA 3K51A 2YV8A 5J98B 2XONA 1XB9A 4R9CA 5FZKA 3EQEA 4OZXA 5C9AC 5M0TA 2CWSA 3LPGA 1KQRA 2XWJB 3ZOIA 4WVWA 3TN91 1NYWA 5EWSA 3RMYA 3UYJA 1G9BA 1LOGA 3NJVA 4AFDA 4E2SA 4XUQA 1T2XA 3TB0A 4CCEA 1OPMA 2TBVA 1EUTA 4FPFA 4G3YC 1X9PA 3MIFA 4WM8B 1WBLA 4CDWA 1CAXA 4HT1T 3L9JT 2PFWA 3K46A 2EA7A 2HWF1 4QU1A 4YLZA 1KRIA 2VZRA 4V1PA 2GAUA 2VC9A 4FCAA 3V64A 3PLQA 4DQAA 3VD4A 4YM1A 2QFEA 4ARYA 3DCQA 1US2A 2ZPXA 4LIVA 4W65A 2Y33A 4MSVA 3U10A 3MIDA 3J4UH 5FBJA 2JDHA 4BB3A 2WRAA 2AH2A 1H2KA 1PVC3 5EXOA 1YXWA 3GNEA 4M3CB 1I9RA 1Y43B 2GN3A 4META 3S7EA 4LTAA 5DAQA 1B35C 2EALA 1WCSA 5GZEA 2JICA 3DXUA 2XVKA 5LRRA 1W8UA 4JV4A 5JOYA 2J1EA 1FOD3 1LKNA 4CEWB 2C24A 5DZFA 1JOBA 1WD3A 4HSLA 2QCSB 4QXHA 1BEV3 1POV3 2XJQA 1UYYA 2HWD1 4YW5A 4JRAA 1UY0A 4DXSA 1GANA 3OPZA 1OF4A 4IV1C 3S7IA 4PHZA 3UV9A 3ZSJA 1HLCA 1VBC2 4JGYA 4YFWA 1W8FA 3VBFB 1XNBA 5KHIA 3T30A 3V56A 3AX4A 1CAWA 1QOOA 2CDPA 4GMP0 2OPKA 4OHYA 3ZN5A 4XZPA 1ZRFA 1FATA 4I0AA 4SLIA 3LOIA 3R4SA 3BI3A 1S2KA 1VBC1 2A1XA 4MLOA 2DTYA 1M4WA 2PMWB 1QU0A 4Y22A 1S0CA 2J1UA 1RUC2 4COVA 2YC4A 4DUVA 1VPHA 3S57A 5EQUA 4GKXA 2VQ0A 2VNGA 2WSVA 4U36A 2WBKA 2XUMA 5ANNA 3QBQA 3FFZA 3RQ0A 1CN1A 2NQYA 3DPRA 4I0WB 3OY8B 1RUC1 4IGQA 3GF6A 3WVJA 4QPWA 2DCJA 1NOVA 1VMJA 1W0OA 2VJXA 2WWUA 1JW6A 1OVSA 2DBNA 2R063 4CP9A 1GP5A 5C3SA 5A7PA 2ZHMA 3I3MA 3FFQA 1UOFA 3KS7A 3PVNA 2ARXA 3PMEA 4GA9A 4V2VA 4Y1ZA 1OA3A 3KCXA 2BBAA 4XHBA 4AK3A 1L7QA 2X29A 2GNDA 4CP2A 4EWDA 4EWEA 1Q43A 5I8YA 1YHFA 1H1IA 5E89A 3MEPA 3ALQA 4FPKA 2HWC3 2RJ2A 4XTPA 3S5QA 2X5IA 2Q8OA 4IW3A 3KT4A 1CQ9A 1O8SA 3JXSA 4XIKA 4HETA 1LJ7A 3H8OA 2ZACA 4AW7A 1DIWA 1OPOA 1UMIA 3RDIA 1Z7S3 3AP6A 4O9GA 4IE6A 2FDGA 1WW6A 4YZ2A 5IK8A 1W0PA 3SMHA 1PGL2 4CDQA 4UFHA 2NMOA 5CG8A 3GBWA 5KXBA 3KGZA 1GZCA 3N9LA 1JZ6A 2CGPA 4A41A 4DMIA 1F5FA 4LKEA 1ENQA 1AR71 3IDBB 4IE0A 4IUGA 1TEIA 2ZA9A 4MG2A 1PGL1 1NZIA 1XNAA 2VZQA 4O9EA 3B69A 5BNPA 1Y9QA 4XCAA 3WQBA 1EPWA 4I01A 4MXWB 1O8PA 5BV6A 1RXGA 2DCKA 5K7PA 3N35A 4DRVA 2W5FA 2GNBA 2Y38A 2J1VA 1AL0G 5A3MA 5FXWA 2D5HA 2FDJA 2I07B 3ELNA 4LEJA 2IZWA 3CO2A 5JOZA 2HWB1 1Q8SA 4N53C 4UBGA 2ZEXA 1VRH3 2QQVA 1NCQC 2O14A 3GJAA 4Z07A 5A3PA 3KV6A 4NR1A 4R8HA 4AVVA 1ZRIA 4BDVB 2D6LX 3U4XA 4XDQA 3E5UA 1N3PA 4Q4Y2 4B4PA 1BBT3 1CX4A 4JGZC 1QWRA 1J3RA 1YJLA 2JIJA 2BEOA 3A7QA 2JD4A 4XFCA 1UCXA 1YYNA 5DZGA 2PHRA 5C3PA 1O7FA 4I09A 1BYHA 4PBOA 2O8OA 1VE0A 3E6DA 4FFFA 2YU1A 5F5AA 4Y1YA 2NN8A 1XPWA 3THDA 4QU2A 4R52A 5JVVA 1PVXA 3KVBA 2ZGUA 2CU5A 3H1WA 1W9SA 1ZZCA 2Y60A 4MADA 4BPZA 3WQ0A 2PHUA 4OVEA 3HOBA 4CE8A 1HQLA 2DURA 3K3NA 4YW1A 4RGKA 2F17A 2XMLA 5FY7A 4LXLA 4AEDB 3UT0A 3O1MA 1SBEA 3LDKA 4LIUA 5BNQA 5IVCA 4WM8A 1RVF3 4W6YA 5EJ1B 4AGRA 2C5DA 1RUH2 1HB3A 4UAPA 2W9XA 2R072 2C9AA 4FT8A 4QHZA 5J7MA 2H0VA 1AR91 2DVDA 3WNOA 4DINB 2YC0A 4BE3A 4ARXA 1RUH1 3ILFA 5JSPA 3CJIA 1XQNA 2AZ5A 1X9TA 4CDWC 1J1TA 2R071 2A3YA 2HKXA 3O0WA 4A6SA 4AGVA 1UU4A 3MFAA 4KH9A 2D6OX 3RI9A 1RUG3 2A6XA 3CEWA 4EN0A 4M3CA 5F9TA 5JLVA 1G9CA 1O3SA 3ES4A 4Q4V3 4BQXA 3FLPA 3WW4A 4AL9A 3INAA 4HBNA 4XBLA 4NIGA 3G6JB 4CEWA 4LBKA 1L3JA 2VMEA 3K77A 3S0MA 1DDLA 4B7KA 1VP6A 2MEV1 1NLSA 2HWE3 5ISLA 3WEZA 1L7RA 2YBPA 3MLKA 4QKBA 4BJ0A 1H1AA 5A6XA 2Q8DA 4MUVA 4CCMA 2CHHA 5JI9A 4LA3A 3WNMA 3QH7A 4YM2A 4AZZA 5A33B 2ZCWA 4A6OA 1YIPA 1HXS3 2YFZA 5CKMA 2J1SA 4GB31 3WINE 3BGAA 3LWCA 3ZN6B 5A7SA 1PO21 2VCAA 1NE6A 3OTFA 1HV0A 4GJZA 2WC2A 4IEWA 4LBNA 2DWRA 2DCTA 1TVGA 1MEC1 2HEVF 3IB3A 4JGYC 1RUD1 4MGZE 2LTNA 4DZGA 4IL7A 1S4CA 1PM4A 1W2AX 3ZSEA 5CYYA 4HSJA 1W3XA 3I3QA 4RA0A 1IPJA 4ATEA 2HEWF 3N9OA 3OY8A 4XW3A 2VUDA 4CUBA 5A3TA 1AJOA 3ENRA 5IK7A 2RR12 3S5AA 1AR63 2DFBA 2GDFA 5K8SA 3WF0A 3ZYGA 2WR9A 3FHQA 1O4ZA 5FYZA 1BKZA 1AR82 3H8UA 5C9AB 1RMU3 1E5IA 5LA1A 3AFKA 2RR11 2WO7A 1VB2A 4YZ5A 4P9LA 3BVCA 3VBOC 1ZRDA 1DQ5A 5H9SA 4LK7A 1SFPA 4BXSV 2XQRA 3MPPG 3PIGA 4FVVA 4OUSA 5KC6A 4FO9A 1AR81 1GWKA 1TE1B 5JAXA 2UY8A 2TUNA 4PLMA 4YM3A 1F5JA 1HN1A 2ET7A 1MS8A 3QACA 2ZHKA 4S2DA 4ZXEA 1ZA4A 2RM22 3FHAA 4QQLA 3OSDA 1IGOA 1Q8QA 1IG3A 5J96B 3O1PA 1YEWA 1JYXA 1EAH3 2RM21 5LWBA 2VOVA 5EP9A 4AI2A 1AXYA 1HRI3 3AMNA 3KF3A 1FX5A 2PELA 4QB6A 4R4ZA 4BU2A 2XL9A 4IE7A 3AL5A 1JTZX 2JDNA 4K3UA 3U07A 2FDIA 1UL9A 1I5PA 1UMHA 2V4AA 2QVSB 4YVWC 3WNLA 1YQ6A 5GM0A 2PLV1 4MOAA 2VUAA 3T08A 2BRTA 4YYOA 1NE4A 4NWWA 1LHOA 1QJZA 1B35B 2G9ZA 2XVGA 3I59B 4WM7C 4QAWA 3VHOA 1YQ2A 3FBMA 1W6OB 4MXWA 4PIZA 1XYPA 1URXA 5CFDB 2X09A 5FPBA 1CR7A 1H2LA 2QZ2A 3DL3A 5BXXA 2WQ4A 1AXKA 5FYMA 4YW3A 5GLVA 1YFYA 1V70A 1YO8A 4FOVA 2BVVA 2VW0A 2X10A 1TG7A 2XLFA 1QDOA 2WJSA 1JN2P 1EUUA 3SISA 4XJUA 4TLFA 1QJX2 2I2SA 1R1A3 4KU8A 2P1BA 4D69A 4P02B 2DUPA 2JDYA 4KI5M 3AYDA 3KD4A 5JPMB 3NL1A 1DP0A 3IWZA 3WG3A 3WX5A 2WZR1 1TME3 2YBSA 1R082 1QJX1 3RPQA 3DF0A 4XF3A 3ZIXA 2F4LA 2RS11 2W68A 1QJEA 3FHIB 4LKDA 1PM7A 3GXUA 3FUOA 4HVOA 4NAOA 4XHXA 5IAXA 2YU2A 1POQA 2OQ6A 4FSJA 3I7DA 2W1WA 4XJWA 4RS5A 2XLAA 3OGVA 1W6NB 3ZMNA 2Q30A 5FZOB 2ZMLA 4WZCA 1H0BA 3OBAA 1NUKA 3Q8AA 2Q4SA 3PJQA 3AXEA 2RVAA 3V0AB 3BUCA 4COWA 5HCAA 3M2MA 1A8DA 5FBZA 1HW5A 2VW2A 2PA7A 4INDA 2IXHA 5FY9A 1GV9A 1VLNA 4OMCA 1C5HA 3LB9A 4FPYA 4AEDA 1WBFA 3K4AA 4CUAA 4AFBA 4QKFA 4DY3A 4QPIC 4A45A 2HBTA 4YZ1A 4XIOA 3JD73 1WMEA 1FNZA 3RYKA 4AI9A 5JXGA 4IERA 4HPKB 4KBZA 4YZ3A 5ACA3 2ZKNA 5F3IA 1OA4A 1W9TA 4H7LA 5FZMA 2VZOA 1H8VA 1MR5A 4TWTA 3T0BA 1WD4A 2JECA 3WG1A 4AR2A 4COZA 3HT1A 1LNSA 1YWKA 5FP4A 2GZWA 5EFUA 3ZYIB 4FPEA 4QQHA 3BTXA 3D8CA 4XYXA 3WD5A 5HBAA 2QBXA 3VDCA 2WN3A 3WR0A 4OI0A 5JUVA 4OQ8A 4JHTA 2ZS6B 1O5LA 2QZ3A 1WCDJ 2BU9A 2Y6FA 2Y0IA 2XLGA 1SQ4A 4Z2AA 3MICA 4YW7A 4C8DA 2ZX3A 4R4XA 2V09A 1YLLA 3POGA 4NUBA 1OQDA 2K0GA 2PTMA 5DUWA 1LB2A 5J09A 3C7EA 2XDVA 4XTMA 3JQWA 4Q4W2 1OA2A 5A33A 5DG1A 3WXPA 3KCCA 3S6PA 3SCHA 2YG0A 3ZN6A 3PUSA 2LROA 5CG9A 1BLZA 3C8XA 3ILNA 3SC7X 1KEXA 4Q4W1 3THPA 4DY5A 3ZFGC 3J7HA 4LR4A 3BYWA 1NCQB 1TMF3 2IWGB 3AKRA 3IIAA 3LA7A 4XILA 3VBFC 4Q8KA 1CGPA 1ZRRA 5IVJA 1R092 3WP6A 1IKPA 1SLBA 1UN1A 1S0DA 1PO11 2RMU3 2XXZA 4JGZB 4BWOA 1V6NA 2OUHA 3QD6A 2GMEA 3AMHA 1U5XA 2D43A 2R7EB 4AHWA 2J1TA 3ZXFA 1R64A 1V9U2 1ASJ1 2D6PA 4J25A 3K4ZA 1UPIA 2XKPA 4JQRA 1LODA 5C9AA 1DQ6A 2E26A 3SNMA 2RDNA 1SBFA 4QPGC 5IVVA 4LA2A 4ZZ8A 1LTEA 4CXXA 2R1DA 4CYDA 3H8XA 4QGMA 3OYWB 4AQSA 1O6UA 4GH4B 3TYJA 3P3PA 1UZWA 4N9IA 4YGDA 4BIFA 2W39A 5FOJB 1UNBA 5IFTA 2BVBA 2WT1A 1UU5A 2XJRA 1QF3A 3WW3A 1GU3A 2XUEA 3BIWE 4YGCA 4CEYB 3AJZA 3VGIA 2ZOEB 4PQQA 1XXNA 1WUVA 3AKTA 1VBE3 5JIUA 2WDBA 2BOJA 2B5HA 3WNPA 1PX4A 1DF0A 2UYAA 3BB6A 3M3IA 5JIAA 4ORFA 3HBKA 2VZ3A 2VD7A 4X8NA 3O1TA 3MIGA 1NKGA 4DEVA 1H6XA 1AYM3 2YUEA 1WMDA 4D6SA 2GP5A 4HK9A 2RS33 1B35A 4XAAA 3I59A 2YZ4A 1PNFA 3AVSA 3MPBA 3KQRA 5FMBA 5HXVA 1W6OA 1PZ9A 4Q26A 1ZA7A 1YUDA 2Q1FA 4UI9L 5CFDA 5K4LA 4BXFA 3RWKX 4Q0QA 1JYWA 1ND3B 1W06A 4M3CF 4K8RB 2QQWA 2EXJA 2PHTA 2WS92 1VMFA 3RZKA 4IV1A 4ASMB 3GHMA 3NJYA 4W8JA 2OKXA 1RUJ3 2VBDA 1REFA 4NN0A 4F7ZA 1NQDA 4QHBA 3DN7A 4XFFA 1N47A 4FXGB 4A3ZA 3U4SA 4D6RA 2WS91 3A22A 5FZFA 2P34A 5LK7B 1DHKB 4HFSA 4Q27A 4XFGA 1MACA 2CWMA 1X8EA 5IW0A 4XABA 4A7ZA 3HQRA 1HB1A 4E9KA 4NOTA 1VJ2A 4JKKA 1DLCA 4OI4A 4CRQA 5JPNB 3AM2A 4N9HA 4H3WA 3N7MA 3W59A 3OD0A 1PMHX 3WNXA 1VIWB 2D98A 4I3PA 5LBFA 3G7DA 4FPCA 4EZHA 4P5YA 2WQ8A 4LE4A 1W6NA 2PQSA 4XF4A 1COV2 1FMD1 1RUE3 2XB6C 3J7LA 5FZOA 4CPBD 5FMOS 1D7PM 1JYNA 4XBNA 1CJPA 3BTAA 1GZWB 2R30A 5F8PA 5J3UA 1ODNA 2EXKA 3HEIA 1NXMA 3VBOB 2KR2A 2NPIA 1QJY2 1GNHA 1SCSA 2DVAA 5A3WA 3TEYA 4BISA 1TNRA 5IATA 5JOXA 3HPNA 5EYXA 5FMCA 4C0HA 5A1FA 1SG3A 5DPNA 2VXJA 2VQAA 3A21A 4HPKA 1QJY1 4IEUA 1VALA 3UNPA 3M3QA 2F6BA 4B8EA 4QX3A 3H7YA 3ZXLA 1NT0A 1GQHA 4BLJA 3WG2A 1OBNA 4IGOA 2W52A 4XUPA 5T5JA 4QKNA 5C4WC 1XE8A 2E7QA 3WOGA 1UYXA 4A7KA 1D4M1 2O8QA 3LAGA 4NRPA 2FCUA 3DYOA 1BVVA 2BW8A 4NHXA 3RNSA 1LOCA 3T2OA 3WP4A 5FO7B 4A42A 3WG4A 3FLRA 2DCYA 1LOAA 1DCSA 4BZ4A 3KSCA 4WM7B 4NIDA 5T52A 5DG2A 3HQXA 4AVTA 2BGPA 5A6QA 1KFXL 1W8TA 2JKBA 5AVPA 5C5UA 2GN7A 3VKNA 2JE9A 1UXZA 1SCRA 3P3NA 5E88A 1DZTA 4HONA 5IWFA 2J22A 3V0BB 1JYTA 1K12A 3CKHA 1QQP2 4N7IA 2FZ2A 3NNFA 1N1YA 1PZ8A 1DQ0A 3LCPA 1PGW2 1PMJX 4XUNA 1BK1A 2JDMA 3GYDA 4PIXA 1VBC3 4ZONA 2A3XA 4P9XA 3RI8A 2XBO1 1GYKA 3WDXA 4B1LA 1OH3A 3BOPA 2YC2A 5DDJ2 1NCQA 4UFIA 4YVSC 2WZEA 1LEMA 4KWKA 3WP3A 1DQ4A 4ZU5A 4YW4A 1ULPA 2FMYA 4AQ2A 4Q2FA 1WWYA 2IVIB 1JXNA 1QDCA 4JGZA 4HZFA 3KV5A 3I2DA 1RUC3 1VBA1 3HQUA 2VVFA 4UXAA 3DV8A 3HNYM 4FI9A 3USUB 1ULOA 4XF0A 1LECA 3JZVA 3DUIA 4M01A 5JR2A 2ILMA 4O61A 1O3TA 4LO8A 2XR4A 3ON7A 3PTRB 3U75A 4DNYA 3HN1A 3OBTA 5CKQA 4CXYA 3UJOA 2CGOA 3HWJA 4TXWA 3TN92 2WT2A 2CYFA 2A6VA 5C3RA 2VOWA 2VMFA 3AP4A 3C7OA 5A7QA 4CA9A 5HCHA 1A6CA 4NHMA 1JMUB 5T5LA 4XF9A 5GLWA 3H7JA 4QPIB 3EHKA 3TNQA 4AWDA 2Z5WA 4FTSA 3I2OA 1SFYA 4QX0A 1H8TB 2HWF2 4ZY9A 2GH8A 4CCLA 2KM2A 1JYCA 1UYPA 2ZGPA 2SBAA 1US3A 2JKXA 4JKMA 2K9ZA 1JUIA 2ZGOA 5H9PA 1O59A 2BP6A 2C4XA 2EXIA 3WHUA 5CFCC 5BNNC 3H50A 3ZMOA 4JAAA 4IV3B 5CB7A 3NV1A 3B5LB 3GBFA 3OD4A 3UESA 2BQPA 2WIIB 1ZZ9A 3AZVA 5C33A 3D3AA 1PK6C 5A80A 4LLOA 2MHFA 2PAKA 2RJKA 1HX6A 1WLTA 3CZJA 4JDOA 4HANA 2D97A 4LBOA 5FYBA 4XBQA 3T0DA 3RJ2X 3I2JA 2XJTA 3DEMA 3KF5A 4FPJA 4Y33A 5GZGA 4HMZA 2HWD2 1IHMA 2VNOA 4BCUA 1JHJA 4CUGA 3MV11 1RINA 1W0NA 2WNOA 4W6WA 3JU9A 5FY8A 2BV4A 4NHKA 5FPXA 4ET7A 3FC0A 5CFDC 4H55A 4H7MA 4IEYA 4L8QA 3VKLA 4P9WA 3P5BA 5ANQA 2VZTA 2XJPA 3ZFGB 5L19A 3M3CA 3POBA 2ES3A 4CPBA 5DQ0A 3NNGA 4M0NA 3VHRA 1NAEA 4XE9A 2A3WA 1HN0A 3OGGA 3I4IA 4Q4Y3 3SQOA 2RDRA 1W99A 1S0JA 3EJKA 1AF9A 4J6GA 3ZLIA 5CIRA 2E6VA 3EO6A 2Q0AA 3GJBA 1QXRA 4H2AA 5L9RA 3SKVA 2HEYF 3T4HB 2VZ1A 5A6YA 4XQWA 3E97A 1XBFA 2WQZC 1GZWA 4GXLA 4Y20B 3IKWA 2BWAA 1F9KA 3RZZA 2JENA 3VBOA 4QPGB 5HPOA 1W9FA 5FK8A 1V6MA 3IAPA 5CBLA 3WQ7A 1SMVA 2OIIA 4YG6A 3AC0A 1XSQA 4P9JA 4Q0SA 3W58A 5CEHA 3PMSA 4YARA 3S30A 4EQVA 3LZZA 1O5UA 2NYYA 3B9CA 4RHV1 1RUH3 1FV3A 4COYA 4QXCA 4B7EA 5FZ6A 3RZLA 4XMAA 1NXD1 2VGDA 2R073 3IZOA 4LE3A 1AJKA 4LO5B 4WV8A 3BTZA 4XXPA 3UKNA 3QLQA 5L73A 1ZZ7A 2B4KA 1OUSA 1QHDA 2A6WA 2VMGA 1RYYA 4YVWA 2GNMA 3AL6A 2QQPA 5KHKA 5FK7A 4MHUA 1OSGA 3KT1A 3VHNA 4NHYA 1UF2C 3ZX7A 4WM7A 4GD4A 1AR72 4ONUA 4Y1XA 4YW2A 1F35A 1GOFA 1HDKA 3KWVA 4GKYA 5HCBA 5EHDA 4JCKA 3RFRA 2GALA 2FCTA 3C3VA 5CVRA 3HBZA 1F4HA 1W03A 2E32A 4YM0A 2WT0A 4LOTA 3GZUC 4OUEA 3V0BA 2R042 2GMMA 2RJLA 4ASLA 4O7XA 4KBBA 5E16A 4LULA 1OKQA 4C1WA 4NO4A 4KMQA 5KR7A 4BM8A 1J1LA 4YFZA 3MF9A 3OGSA 4LUMA 4Y1UA 4E4HA 2R041 1W8NA 1W6MB 2HWB2 5L9BA 4XPVA 2G4IA 3W21A 1H4HA 3AZXA 1G8WA 3H3ZA 1QXPA 4RSUA 2RS52 4LBQB 2W1QA 4GWNA 3GZEA 1XRUA 2LUWA 3ZXGA 2QE3A 4P08A 5B4NA 1JU3A 3WP5A 4DFSA 2ZEYA 3VBUC 3B93A 5ABJB 1LOEA 2YGLA 3UL2A 3VBRC 2RS51 3HR9A 1OFSA 3I3BA 4BK4A 1LGBA 1AUYA 2RHPA 2WYSA 5SV5A 5KXCA 1MS0A 3N9PA 4QHOA 4HN1A 1OI6A 2RR13 2JB4A 4LBQD 5JCTA 1BQPA 4CCDA 3UKVA 4FQ4A 5FZ8A 3ASIA 4M3CE 5LW9A 4EWAA 4GMP3 4ZKTB 2E51A 1AR83 4AG4A 3Q8CA 5FZEA 5FYSA 2L9LA 3RZHA 1FOD1 3ZPOA 4Y4RA 4QPIA 4HXCA 3O1UA 2A5ZA 2EVXA 2EAKA 1POV1 4AHYA 2YY1A 4LO7A 1H8TA 2VXRA 1DG6A 2WNUC 1BK0A 1X33A 4TN7A 2YFUA 3KB5A 3GGLA 3OBZA 2RM23 1CJDA 4M4RA 3CZUA 1BHGA 3RYPA 3HD8B 1JI6A 1XYNA 4KWUA 4LNVA 4GH4C 5JZGC 5DABA 1AR92 2FQPA 5EZWA 2ZEZA 5FYIA 3WV6A 1XE7A 3LKJA 4LITA 3OUHA 5C4WB 1C8M2 2XJVA 4YGEA 4CEYC 2GU9A 1GBGA 2A7AA 4IV3A 4K1YA 3HT2A 1G9AA 1QMJA 2IXJA 4AVCA 4BQ5A 1J59A 4EN8B 1SZBA 4HL0A 1YI7A 4QGNA 1XYOA 3LOBA 1S0BA 2ARCA 4K6BA 1C8M1 2ZGMA 4OHXA 1M06G 4FPLA 5FJKA 2MEV2 3MUZ1 1BJQA 3POEA 2NP0A 3Q8BA 3NAPC 5FUIA 3ZSKA 2JDKA 1JZ3A 2CV6A 3UKTA 5FYYA 2W2IA 3D6EA 3RWNA 3TOJA 1F4AA 4CU6A 5FTTC 3WCSA 5GJ6A 3U0ZA 5FKCA 3POYA 4OI2A 4QWNA 1GR3A 1G86A 4AXOA 2Q1MA 2ZX2A 4GB32 1ND3C 2J1AA 1PO22 4GALA 1X50A 4GWIA 3ZFGA 4DUWA 5DMYA 2AGSA 1DYOA 1YNAA 3H3UA 5FYTA 1FPN2 4YVSB 1MEC2 5DZEA 3VBFA 1QJX3 1RUD2 2EXHA 2VW1A 5FP7A 1XNCA 1LESA 2VZVA 1REEA 5HI0A 4K21A 4QX7A 4BMBA 4XVHA 1V0AA 4BLIA 4Q4X2 4OULA 1BCXA 1FPN1 1GLHA 2JG9C 4IEVA 1R083 5DAPA 2ARAA 1W6PB 1SLAA 4QD2A 4XUTA 1HRV2 1Z7S1 2W95A 5H9QA 2MNGA 4QMAA 5D8AB 4BQYA 4F83A 5IFPA 2VAUA 2ZX1A 4PLNA 3O12A 2XH6A 4Q4X1 1FNYA 3ZFEC 1W2NA 2B42B 1OQEA 4FP3A 1DYKA 1BZWA 1UZVA 5GALA 4AOCA 4Y20A 1H4GA 1LOFC 3B01A 4QX8A 4QPGA 3LGRA 1HRV1 2FDKA 2XVLA 5LZ6A 1H2NA 1HV1A 3GZTB 5FPLA 5F5QA 1ZBE2 1TQ5A 2W94A 3NV4A 2C0ZA 2W87A 3ZXKA 1V00A 2Y6GA 5C7GA 4CP1A 1ZNPA 4OHZA 4LOSA 5FZHA 3VKMA 4FQZA 5CU1A 1W05A 3LSDA 1Q8VA 3WF2A 1APNA 5GZCA 3TEWA 1ZBE1 4EJRA 5FZ4A 2DU0A 3PVEA 2VMHA 4XZUG 3JBG2 3PVBB 5K0UC 3UGHA 1SEFA 2BPA2 1VBD2 2OZ6A 1UMZA 2JG8B 1RB8G 2D5FA 5F6KA 3JBG1 5CFCB 4UWDA 2PAEA 3LD8A 4QQ2A 1C5IA 1W9YA 5BNNB 4K1ZA 3AZWA 3FUQA 3HNMA 4C1XA 1OOPB 1Y3TA 3K3OA 1BBT1 1VBD1 4NIAA 2PLV2 3KLSA 3MLJA 3M1HA 4PQ9A 4D94A 3QCWA 1D2SA 1LR5A 1PK6B 2DF7A 3WHTA 5J1XA 2ADEA 3IDAA 4PDWB 1H6YA 1E57A 4XF1A 5F6LB 1WGPA 1UWWA 3IN9A 1F2NA 3EYPA 3ECQA 1G6NA 3OUJA 3FX3A 3SHRA 1DGRN 3SH4A 1TNFA 2BYVE 2IFRA 3D5OA 4CDUC 2LALA 2B45X 3WT3A 2OX0A 1CWPA 1JZ7A 1GQPA 4LJHA 3NRUA 1UQXA 3MGUA 4XAEA 2OYZA 4P00B 4Q4W3 4V2WA 2FBEA 4W4ZA 2Z2SB 4P14A 3T2QA 5C3OA 5FO9B 5KHGA 2Q8EA 1SBDA 5FOBB 2A6YA 1W6MA 2ERFA 5LB6A 2XKOA 3ETPA 4YPJA 4CU9A 2FDHA 5FYUA 3RVHA 2P5BA 1JUHA 2W08A 3MW2A 4JZRA 1HKDA 1W39A 4LBQA 2VOXA 1RVF1 4MX3A 4DOUA 5KWRA 1UZ0A 2GC1A 2GC3A 5FUPA 3I3DA 4XMIA 2A73B 1DBNA 4O65A 1VAKA 1ZZ8A 2WZR2 3R05A 1R093 2ADDA 2RS12 2RDSA 2Y26A 2ZX0A 3E5QA 2HYKA 1MS9A 4UT5A 2VOKA 3BU0A 2WYFA 3I54A 3NV3A 3PNAA 5D2AA 5ERLA 1UZZA 2ETEA 5I0TA 2D3RA 1RUG1 1V9U3 1ZREA 2QDNA 4XFIA 3ACGA 5GLZA 4OUMA 1UPSA 2XJUA 4XFHA 3BPSA 3SCFA 1W8OA 4JTNA 4KQ7A 4IGPA 2XGXA 3VKFC 3OG2A 4NAMA 2JX9A 5FZBA 4RQPB 1U5ZA 4NPRA 1MQTC 2WNVB 4GWMA 1RUNA 2D44A 5LY2A 3VDDC 4BA6A 3PURA 2P3IA 5I8SA 1HXS1 3THCA 4XQ4A 5A70A 2O1QA 4HKWA 1V6OA 2BNOA 2JEMA 4UW3A 1P8JA 5C4WA 3ZR6A 1H8TC 3WDTA 1LU2A 4AFCA 1AX0A 1UXXX 4ISQA 5DUXA 5JI7A 4CXWA 1IS4A 3BODA 3WDYA 3LE0A 4JVAA 3Q9OA 3WQ1A 1GOHA 3M4FA 4CTEA 1NLQA 2DV9A 1OKOA 2XQXA 4OQ9A 2HBUA 2E53A 3AYAA 1EY2A 1RJ7A 4UBHA 3AP5A 5FLHA 3K4DA 4OYUA 2A71A 1OLRA 3OJBA 4S2FA 5LBEA 2VY0A 2YYOA 4IV3C 1FAYA 4B4QA 1ULEA 4IQPA 2FHRA 1CONA 1K5MB 3APBA 5IVFA 1ENXA 4PBPA 1I5ZA 2E7AA 4Q0UA 3LDRA 5D21A 1XC6A 2K46A 2WS93 1IS5A 5FMOL 4PLOA 1EV12 1AXZA 2PAMA 1UO9A 1OT5A 4WVMB 5CZKA 3P1IA 2ZZQA 1UU6A 4YVSA 3H42B 2P3KA 2VZPA 1JU4A 3FE5A 2NZ9A 1RGSA 4NRQA 5FPZA 1R1ZA 3WDUA 4KL1A 1EV11 1KITA 3OPWA 4XJAA 4YG3A 2Y6LA 1MZEA 1YFXA 5F3EA 1S0GA 5LK5A 3X29B 3UK9A 1CESA 1PO12 2Z4FA 3VBUB 4Y1VA 2A6ZA 5C8WA 1C57A 2V72A 1IOAA 5JXJA 3VBRB 4XFAA 1EAH1 1XE0A 3TAYA 3L2HA 5D8AA 1W2UA 3POFA 1HRI1 1STMA 1S0EA 2B8MA 1ASJ2 2IXLA 3ZYJB 1Y7BA 3ZIWA 1ZM1A 4IEZA 1COV3 3OF1A 5LY1A 1ALYA 1O4TA 3I3EA 3IAQA 1UIJA 3KT7A 4QM9A 5A3NA 1XNKA 4I02A 3PTYA 1VAVA 1AYN2 2E9QA 4JTOA 5FPUA 4MGIE 3MLLA 1NQJA 1QJY3 2QUOA 5JXHA 1JODA 3FWEA 4CU7A 3CU7A 3AVRA 4NWVA 4P9IA 2WNUB 3TWIA 1CAUB 1AYN1 4DXRA 2W91A 4EROA 1JZ2A 1OLMA 2Y6HA 5JZGB 4N7UA 3VDAA 4C90A 2TEPA 1QGLA 4LORA 4NMIA 3AZZA 3ZFFC 2JG8A 4BHPA 4C91A 1F8VA 5CFCA 5BNNA 4Y5Z0 4HN0A 1R1A1 2D6KA 1LENA 4QX5A 5IJRA 4AI8A 5GLTA 1AL22 1VBB2 2VMCA 3B00A 1XNDA 3MFCA 2UWBA 4LO4B 1PK6A 1TME1 5A3UA 5J48A 4PDWA 4H14A 1XU2A 4MZUA 1KDKA 1S1AA 1AL21 3BU7A 3OCPA 1VBB1 4BYYA 1WMFA 4MGTA 2XHKA 2QQNA 1N1TA 1NCRC 1UAIA 4E8CA 3O1SA 1K42A 1DFQA 4QB1A 3WDVA 1GP4A 1PHMA 4Z8BA 3U37A 2BUKA 3NAPB 2Y64A 3BPZA 1RJ8A 2CAUA 2W92A 2BWCA 3HVDA 5H9RA 2FCVA 5C70A 3RZJA 1QQP3 3VZJA 5FKBA 3CQOA 5I8TA 2WFPA 3ZYBA 1CIYA 1E5HA 5GKAC 4NPMA 4XXAA 4AQTA 1QH6A 2H6CA 1QKQA 2B46X 3AXDA 2X05A 1SPPB 3PUIA 1ZYBA 4AHZA 3LIGA 2ID4A 1HB4A 3ES1A 5T5OA 1DYPA 1ULDA 5DDJ3 1X82A 1C3HA 3JD71 3VL8A 4LBLA 2WFF2 4B3NA 2VTXJ 4Z92B 4JC1A 5FWJA 3RZMA 1YQ8A 1HQNA 2JG9B 1QNYA 2PXJA 2EIDA 3Q8EA 1KXGA 4CZSA 4R9DA 5C6CA 3AZYA 2WFF1 2W47A 1DGWX 4TLGA 1MS5A 4GAZA 1JZ5A 3DXTA 3I8TA 5ABJC 2ZTNA 2ZXQA 1FMD2 3ZFEB 3HNBM 2AREA 4IETA 4ZS3A 4SBVA 4A2UA 2VUCA 1UIKA 1UW8A 3H1MA 4OHVA 3ZSMA 1NG0A 4TZDA 1OMIA 5BNOB 1ZZBA 2D6NA 3L2YA 2O0OA 4E4ZA 1ULCA 2D40A 1H2MA 5FZ0A 3TN93 2Y6KA 3AMPA 4OMDA 5FAXA 3WUDA 1DZRA 4UW4A 1LHVA 2ARBA 3V0AA 4AVAA 4R9BA 3NNMA 4YG0A 2WNVA 4E2GA 2ZMNA 4KNCA 4QKDA 2VCCA 1Q8OA 3PUAA 3KZ4C 3R4UA 4S2HA 4Q5OA 4XDPA 4ZU4A 1DGWA 2HJIA 3RG0A 3ZDVA 5I0DA 5K0UB 3LIHA 4GWJA 3J8F2 4IE5A 5A32B 5FO8B 4LBMA 3B02A 2HWF3 4RR3C 4CP0A 2EIEA 3RJRA 5EV7A 5C3QA 2ZKLA 1J83A 4C0BA 1ENSA 1JYIA 3AP9A 2ORXA 4IXLA 1G7YA 1D4M2 2WWJA 1LHWA 3J8F1 4XOGA 1RHI2 3T1MA 5E8AA 1E5RA 1UY2A 1KJLA 3M8LA 4UF0B 2RMU1 5KHHA 1GWMA 1UX7A 5F3CA 5BYNA 1W6QB 1S2EA 1I1EA 1RHI1 4XEZA 2P3JA 2VOTA 5DAXA 4AEMA 2OXBA 4Y5SA 2YXSA 4NVPA 1KS5A 4EV0A 4JKLA 5FYHA 2OA2A 1N3OA 3IT8A 4CDUB 3SLIA 4COUA 1VRBA 3ILRA 2VBPA 2WUHA 3B94A 4PF1A 3WW1A 4AYUA 1O3QA 2HWD3 3LEKA 1MS3A 1EP0A 1IPSA 3IMMA 3VBHB 3HJRA 1JH5A 4WVMA 2OS2A 2WNEA 4N90A 2XBO2 2X5IB 1MZFA 1F31A 3NJZA 4XC9A 2JB8A 5IYYA 4ES8A 3I2HA 3J9SA 1QJU2 1DLLA 1RUF2 3NWKA 2AEZA 3LA2A 5E6HA 3VBUA 3AYEA 1QY4A 2DUQA 3BALA 5KHJA 1VBA2 1X8MA 1LGNA 5FJHA 2SLIA 2PQQA 4Q8LA 3DECA 3VBRA 1POV0 3VB9A 4CDXC 1SFNA 4D6QA 1QJU1 1RUF1 3ME2A 3MDPA 1CZVA 2Y34A 5FXZA 1VBE1 1XOYA 4W50A 1RUI2 2R1BA 2YPDA 1A8MA 4L97A 4UYBA 5DUVA 4QPYA 1JYVA 1FXZA 4GQ7A 2QQMA 2WO1A 1NLRA 1IPKA 1AYM1 2XWBB 3J26N 4RD7A 1DGLA 2RS31 4LKSA 1RUI1 5D8AC 3W5NA 1LEDA 1NZCA 2CTVA 2WLQA 5FYVA 1G9DA 2DU1A 2W0XA 5DN2A 4LKFA 2ZGTA 3QOPA 3VL9A 3OOXA 5C8CB 3FBYA 2WNUA 4FAHA 1CAUA 2PHXA 3C7HA 5EYYA 2VMIA 1MQTB 3OYWA 4IESA 2QNKA 4MGQA 1RUJ1 4UW6A 2YBKA 1BMV2 3VDDB 3BN6A 2C9KA 5JZGA 4GH4A 2AENA 1U5IA 2KD7A 4RYDA 1PNGA 3H1YA 4QQPA 4HVRA 3GHNA 1OUXA 4PCRA 1GUIA 1AVBA 2CSGA 4CEYA 4E27A 1BMV1 1LHNA 3MUY1 1JHNA 5SV8A 3MHZA 5TSWA 3D82A 3AKPA 2K2SA 3PUQA 3RYRA 4ZU7A 3J7MA 1Z0HA 4GULA 2VQTA 1B09A 2UURA 4FOQA 4FXKB 4QXKA 4A4AA 2VVDA 3I2FA 2JG8C 1ZBA2 3A4UA 4LPLA 4D0QA 4N43B 5CNAA 1UYZA 4D3WA 2FZ1A 4F3JA 1AR73 1S55A 2I74A 4IEPA 4WVVA 5LA9A 5EJZB 3WF3A 1O3RA 1OOPC 1SLCA 2ZGLA 2YDEA 4LO6B 3KHBA 3NAPA 4KU7A 4QB2A 4QQOA 3SXWA 3VZMA 2VECA 1A78A 1RUE1 1ZBA1 4RFT0 4XQDA 4PDWC 2R043 1ND2C 1ZRCA 1NX9A 5AFEA 3N7JA 4AGGA 1W90A 1ND3A 2LS6A 5BPXA 4HG6B 1UKGA 3VBSC 3IDEA 1SPPA 3T3YA 4E8DA 2JIGA 2QQUA 1J3PA 2HWB3 3MO4A 4LBJA 5APAA 2VE1A 2BGCA 3VD9A 5LA0A 3FMGA 3NJXA 2AR6A 3RS6A 4AAPA 3ROUA 2RS53 5BUVA 2R0FA 3H8RA 2JG9A 3CJIB 2QQKA 3C7FA 2P37A 2WA3A 5F2SA 1EYBA 3N3HA 2B9VA 4HKOA 1LCLA 4NHLA 3SH5A 1SDWA 1W2TA 4PIYA 1WLCA 4AI1A 4Y24A 2VH9A 5FCCA 5F5CA 3ZFEA 5F2WA 1GWLA 1LOFA 3N9QA 4UW5A 5LBBA 5KXDA 1CZTA 2GC0A 5BNOA 1RTVA 2J7MA 1C4RA 2VU9A 4K9SA 5FP8A 3WZ1A 3VZKA 1H9WA 5IVEA 5FPAA 1IZ3A 1LRHA 3WF1A 3O5SA 3OB8A 3BKZA 4L9BA 3GZAA 1YC61 1T6BX 2DTWA 1UD1A 5T5PA 1HJFA 4NIHA 5HV0A 5K0UA 4RHV2 2XG3A 5LRSA 5A32A 3Q8FA 1HQWA 4L99A 4HOOA 3WNNA 1V6IA 4HVQA 1BVP1 2VBBA 2VNRA 4RQPC 3ZFFB 2MPFA 2X53S 3CF6E 3K75B 1AR93 4KGGA 1JOJA 1ACCA 2WL1A 2WNVC 3F2ZA 4NRMA 3W9AA 2D7FA 1NA1C 1ODMA 2XHNA 3M3EA 5A7NA 5AC92 2G9GA 1CIWA 1KS4A 1C8M3 4UFLA 3LEMA 3M7AA 5F39A 4TYSA 1IKQA 1QIQA 1C1LA 4UF0A 4DIQA 4B1MA 1H30A 3GALA 5CAZA 2V4VA 5AC91 2W3JA 2WWSA 4WVZA 2B9UA 4QDRA 1PIV2 1W6QA 1JZ8A 2ZX4A 3IPVB 4GJYA 5HCFA 5A7OA 5FY1A 1NCRB 4CCCA 5L7OB 4CDUA 2IXKA 2Z42A 3E6CC 1N1VA 4ZZ5A 2MEV3 4UFKA 5LASA 1FI2A 3U11A 4CUCA 2DVGA 1PIV1 4M0HA 2DFCA 1N3QA 4NJ4A 1WW7A 3RRDA 3VBHA 1SDDB 2ATFA 2BGOA 3CJXA 5A7WB 4PT6A 1QXJA 3VV1A 3ZYRA 2ZBJA 4URAA 1K5MC 2JDAA 2R6QA 3MIEA 2OVUA 3IIIA 4ZS2A 4DXZA 1RL3A 3NQHA 4GB33 4ATFA 2ZZJA 1GSLA 1PO23 2P6HA 3AK0A 4LK6A 1W28A 2ORZA 4EZ4A 1FPN3 1MEC3 1SLIA 3O0XA 4FPOB 5IAVA 5CA6A 3QH6A 2RV9A 4UFJA 1RUD3 1TZOA 5JOWA 1CPNA 1IQAA 3VZNA 2XOMA 2PHDA 4Q4X3 5CKNA 2IUWA 3CDZB 2VCBA 3LEGA 1SLLA 5FQ0B 5FDBA 4QM8A 3N7KA 1HRV3 3DKWA 2ZAAA 4ISRA 2BOIA 3CBNA 3SEPA 3U14A 5A6ZA 1PVC2 2RDQA 4QT6A 4X6RB 3NKTA 3USUA 1NY72 4ASKA 4LHKA 2Q1ZB 3EBRA 4MGSA 1S0IA 2DUOA 4JQTA 1FOD2 1PVC1 1ZBE3 2RG4A 2V73A 5C8CA 1GZTA 1YIFA 4FOWA 5JXIA 1NY71 1BEV2 4IE4A 5F5IA 1MQTA 3LEIA 1OLQA 4QDSA 2E63A 4PI0A 4A3XA 1Q8PA 2WO3A 2VL4A 4X6QB 1QH7A 3VDDA 5FLJA 1J58A 4IEXA 4YNIA 1CVNA 5D1IA 4URTA 1OFNA 3JBG3 4RR3B 1BEV1 4QXBA 1MVEA 3ZVXA 4K7JA 4XCBA 2EIGA 3TNPB 2C26A 5I0RA 5AFBA 5G05L 5IK4A 1VBD3 5LEJA 5JWPA 5T55A 3TEXA 3CLPA
chains in the Genus database with same CATH topology
4XCAA 4KBZA 5DAWA 3NNLA 4XC9A 2G1MA 5A3UA 5EPAA 2Y33A 4MHUA 3KT1A 4NHYA 5HV0A 3DKQA 4NHMA 3BVCA 4ZPIA 4XABA 4XACA 3HQRA 2Y34A 3GJAA 2FCTA 5DAPA 2FCVA 5DAQA 4BQYA 2JIJA 5LBFA 3W21A 5L9BA 5L9VA 2G19A 2HBUA 5EP9A 4Y5TA 3W20A 3GZEA 5LBEA 5LASA 2V4AA 5C5TA 5IATA 5HV4A 2A1XA 3OUIA 5EQUA 4MHRA 4BQWA 3PL0A 4UWDA 4NHKA 4J25A 5IAVA 2FCUA 2OPWA 4NHXA 5LA9A 2RDNA 3NNMA 4Q5OA 3OUJA 3EMRA 3ITQA 4BQXA 2RDRA 3OBZA 5C5UA 3NNJA 2RDQA 3MGUA 3GJBA 4IW3A 3NNFA 5L9RA 2JIGA 3KT4A 3KT7A 3OUHA 4NAOA 5IAXA 5LB6A 5LBCA 2RG4A 4ZONA 4JZRA 5DAXA 4Y5SA 5LATA 5M0TA 4NHLA 4XAAA 4XCBA 2RDSA 3HQUA 5DAVA 2HBTA 4NMIA 5LBBA 5ERLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XCA A;  4KBZ A;  5DAW A;  3NNL A;  4XC9 A;  2G1M A;  5A3U A;  5EPA A;  2Y33 A;  4MHU A;  3KT1 A;  4NHY A;  5HV0 A;  3DKQ A;  4NHM A;  3BVC A;  4ZPI A;  4XAB A;  4XAC A;  3HQR A;  2Y34 A;  3GJA A;  2FCT A;  5DAP A;  2FCV A;  5DAQ A;  4BQY A;  2JIJ A;  5LBF A;  3W21 A;  5L9B A;  5L9V A;  2G19 A;  2HBU A;  5EP9 A;  4Y5T A;  3W20 A;  3GZE A;  5LBE A;  5LAS A;  2V4A A;  5C5T A;  5IAT A;  5HV4 A;  2A1X A;  3OUI A;  5EQU A;  4MHR A;  4BQW A;  3PL0 A;  4UWD A;  4NHK A;  4J25 A;  5IAV A;  2FCU A;  2OPW A;  4NHX A;  5LA9 A;  2RDN A;  3NNM A;  4Q5O A;  3OUJ A;  3EMR A;  3ITQ A;  4BQX A;  2RDR A;  3OBZ A;  5C5U A;  3NNJ A;  2RDQ A;  3MGU A;  3GJB A;  4IW3 A;  3NNF A;  5L9R A;  2JIG A;  3KT4 A;  3KT7 A;  3OUH A;  4NAO A;  5IAX A;  5LB6 A;  5LBC A;  2RG4 A;  4ZON A;  4JZR A;  5DAX A;  4Y5S A;  5LAT A;  5M0T A;  4NHL A;  4XAA A;  4XCB A;  2RDS A;  3HQU A;  5DAV A;  2HBT A;  4NMI A;  5LBB A;  5ERL A; 
#chains in the Genus database with same CATH topology
 4MO3 M;  1YQC A;  3PU3 A;  4Y4Y A;  4NII A;  1QOS A;  3WSO A;  2CL2 A;  2WZ8 A;  4KWJ A;  2CNA A;  4LHS A;  4N43 A;  4Q4Y 1;  2PLV 3;  5IT6 A;  3H0O A;  3MIH A;  3FLT A;  4LMF A;  5EPA A;  2Z79 A;  2V5Y A;  4RS5 B;  1WKY A;  2R0H A;  3DYP A;  3TEZ A;  1H1M A;  1XU1 A;  4JDN A;  4PJY A;  4HKL A;  4D7Y A;  2XJS A;  3VD5 A;  3WCR A;  3DKQ A;  3LA3 A;  2JDZ A;  2R06 2;  4RFR B;  2P17 A;  2HH9 A;  1RXF A;  3FL7 A;  1JS9 A;  3C2U A;  2YHJ A;  2C6S A;  4MGY E;  4D8M A;  2NLR A;  2HLE A;  5FR3 A;  1W04 A;  1GP6 A;  4FFH A;  2R06 1;  1JOP A;  3ZXA C;  2VUJ A;  3JB4 C;  4XJ8 A;  3AYC A;  3UGF A;  4D7S A;  1AX2 A;  1FV2 A;  4DO0 A;  2RE9 A;  1WZX A;  3R6S A;  2BTV C;  2HWC 2;  1PMI A;  1W3V A;  2QQO A;  5HXM A;  5CIS A;  4L0P A;  4CCO A;  2BER A;  5L9V A;  2G19 A;  1YI9 A;  4Y5T A;  2HWC 1;  1WW4 A;  4CDX B;  2PHW A;  1W8W A;  3GBG A;  3MV0 1;  2WZR 3;  5G04 L;  3ZYF A;  1WCK A;  4Q29 A;  1Z7S 2;  1PX3 A;  2ET1 A;  2RS1 3;  3URF A;  2DDU A;  2DVB A;  1C8N A;  2E31 A;  4NRO A;  3KVA A;  1LHU A;  2YMZ A;  5FZ7 A;  5FZD A;  4RGG A;  3O1R A;  1CX1 A;  3ETQ A;  1UKR A;  1N1S A;  1EPZ A;  3N7L A;  5I93 A;  4AE2 A;  1OUR A;  3U78 A;  2AEY A;  4E4S A;  3K48 A;  4ZHN A;  4BQW A;  1LOB A;  4CCK A;  4AQ6 A;  2DCZ A;  2WAO A;  2IXI A;  1VMH A;  4FTE A;  1T6G C;  4GZ9 A;  5JR7 B;  5BNO C;  3ZYP A;  1W2O A;  4LQR A;  2P4E A;  5FUN A;  5FXX A;  4I30 A;  4F8A A;  2QKD A;  1C1F A;  4XET A;  2P3Y A;  2WLP A;  3OGR A;  5F7U A;  2YRO A;  1UX6 A;  3PHM A;  4DRR A;  3ZFF A;  3O1V A;  1W8H A;  3EMR A;  3ITQ A;  4KG8 A;  4Z82 A;  2GNT A;  2ZHL A;  3LFM A;  4P5H A;  3WDW A;  1OQ1 A;  1VRH 2;  1X7N A;  2VNV A;  3HIF A;  3NNJ A;  1KDM A;  5JMO A;  2NM1 A;  3A23 A;  3VD7 A;  3POI A;  4XUR A;  4AEK A;  1KJR A;  2I45 A;  3LFI A;  1BBT 2;  1XNT A;  2OUJ A;  2HYX A;  4MV2 A;  5FFO C;  1VRH 1;  3ZN4 A;  3TBD A;  3N4M A;  5FP3 A;  3IPV A;  3SKJ E;  1YRZ A;  1NCR A;  5L7O A;  4LLF A;  1Y9G A;  4L2N A;  5JSR A;  3UJQ A;  4KGQ A;  4RGA A;  4G9S B;  3DPR C;  4FFI A;  1JZ4 A;  4P9G A;  2R49 A;  3AKQ A;  4OCT A;  5LAT A;  3ZYH A;  4CCJ A;  1YFW A;  1ND2 B;  4GMP 1;  5A7W A;  1J84 A;  2VO5 A;  5FRA A;  3USS A;  5T3N A;  4AF9 A;  1PGS A;  1KGY A;  3VBS B;  1EV1 3;  1YFU A;  5FY4 A;  3WLU A;  1HIX A;  5F3G A;  2VZS A;  3T1L A;  5A1L A;  1IS3 A;  2Y0O A;  3I2G A;  3IMN A;  3D0J A;  3VBH C;  1RVF 2;  1OF3 A;  3VKO A;  1LU1 A;  2IFW A;  4P9Y A;  1GNZ A;  2BJS A;  2X5I C;  4YW6 A;  3PJY A;  3VZL A;  1YQ5 A;  1RED A;  3AJY A;  4OLL A;  4Q0V A;  3POW A;  1CAV B;  1PO1 3;  2IXC A;  1OD5 A;  5FZL A;  3ACL A;  5FQ0 A;  5I0S A;  3ZXE A;  5B2G B;  4K20 A;  1LAJ A;  2WAB A;  1HJG A;  1A3K A;  5FZC A;  5ABJ A;  4XAC A;  1GZ9 A;  4AFA A;  1RUG 2;  4MXV A;  5FP9 A;  5FRE A;  1ASJ 3;  1ONA A;  4DXT A;  3KHC A;  4Q4V 2;  3MZH A;  4MGK E;  3OPT A;  3ST7 A;  1XJA A;  2JD9 A;  4YGB A;  4CDQ C;  3ZM8 A;  3EXU A;  3AMM A;  2KA3 A;  2OZJ A;  2WO2 A;  3KV4 A;  4LUK A;  3BTY A;  3BIE A;  3U1X A;  4I2O A;  2P6C A;  2B7Y A;  1W9W A;  2J42 A;  2UU8 A;  3O7O A;  1AYN 3;  2HWE 2;  3OBR A;  4PI2 A;  4IV1 B;  4Q4V 1;  5I91 A;  4CVU A;  3PUH A;  5BNP C;  1DQ1 A;  5IK5 A;  4BQ2 A;  2PHL A;  4YWA A;  2LW8 A;  2V5D A;  4IEQ A;  2QDR A;  4WBB A;  2HWE 1;  1ZX5 A;  4RR3 A;  5FLI A;  4LT5 A;  1HXS 2;  5C8C C;  1K3I A;  3WUC A;  4QX1 A;  5FXV A;  3A0K A;  5HV4 A;  2BFU L;  1NA1 B;  3KGL A;  1SHW B;  1OH4 A;  2UYB A;  3WY6 A;  1OHF A;  2VZU A;  2GMP A;  2GSY A;  1MPX A;  3R0R A;  2GH2 A;  1AL2 3;  1VBB 3;  2UWC A;  5FV3 A;  2BZD A;  1O91 A;  3JCI A;  2WKK A;  2ZMK A;  3PL0 A;  1V6J A;  5JMC A;  1R08 1;  1IS6 A;  2FDF A;  1K45 A;  1V6K A;  3AP7 A;  4AAX A;  1LGC A;  1AR6 2;  2ZAB A;  2OPW A;  5A3L A;  2H6B A;  3LPF A;  3THT A;  3K2O A;  2ZJC A;  4N43 C;  2Q5T A;  1VR3 A;  1RMU 2;  1WA4 A;  3V65 A;  5BY5 A;  1AR6 1;  4CU8 A;  4K40 A;  2N7G A;  5A1A A;  3FZ3 A;  4HK8 A;  4CSW A;  2JJ6 A;  2ZAH A;  3CNA A;  3D4K A;  5IHR A;  1RMU 1;  1X36 A;  4FOY A;  4QGL A;  2G9F A;  5IUQ A;  2EIC A;  4OI1 A;  4DUX A;  2DYC A;  1UOB A;  1A34 A;  2VTX A;  1Q5O A;  4L92 A;  5JSO A;  5LBC A;  3ABZ A;  1E5S A;  2WIN B;  4OFG A;  4WM8 C;  4AEJ A;  1WW5 A;  4CDX A;  5LCW L;  2WFF 3;  4E4D X;  1OLM E;  1Z78 A;  2EAA A;  2EIB A;  2FMD A;  2YB7 A;  2XPJ A;  1EAH 2;  2D6M A;  3I2I A;  2VG9 A;  5FYC A;  3T4V A;  1HRI 2;  2DBI A;  3GCW A;  5FMD A;  4FPH A;  3N36 A;  3CJI C;  4MYE A;  3DYM A;  1W6P A;  2PN5 A;  1FMD 3;  2W1S A;  4TTG A;  5E1R A;  3SCG A;  3JB8 A;  2H0B A;  3GDB A;  4XUO A;  1QJF A;  4DEQ A;  4DS0 A;  2F4P A;  3JUU A;  2QQL A;  4K8F A;  5KXE A;  2JWP A;  4EN6 B;  4A7Y A;  2WA4 A;  1ZZ6 A;  5DAW A;  1YCI A;  3VD3 A;  1D4V B;  4BOW A;  3JQX A;  3PU8 A;  4CEW C;  4YZ4 A;  2Y6J A;  3B7M A;  1I3H A;  1CPM A;  3NW4 A;  5KBF A;  3A0N A;  3F95 A;  3GM8 A;  4X8P A;  4N53 B;  4NPL A;  4N8M A;  5EJ3 A;  5L36 A;  4M00 A;  3N9M A;  1DZQ A;  4XDO A;  5C71 A;  3J8F 3;  1RIR A;  4ZPI A;  1YJK A;  1D2Q A;  4CCN A;  1U5Y A;  1W8Z A;  4MH0 E;  3ATG A;  5T54 A;  1KD7 A;  2QQJ A;  3KV9 A;  1ENR A;  1R1A 2;  3OGJ A;  4WZF A;  4A44 A;  3CMG A;  1BXH A;  2VVE A;  5LEK A;  3FJS A;  1AZD A;  1D4M 3;  1RHI 3;  3ACH A;  3RMX A;  1TME 2;  3RZG A;  1R09 1;  5K9Y A;  1UOJ A;  4YRD A;  1IQD C;  1MS4 A;  4LHN A;  4BK5 A;  2CY6 A;  2ZGQ A;  4XFB A;  1OOP A;  1S0F A;  1OVP A;  3T0A A;  4DPN A;  3POS A;  3ZKU A;  2VQU A;  2AC1 A;  2UWA A;  3WW2 A;  4AI3 A;  3T2P A;  2OT7 A;  1V9U 1;  1ND2 A;  3PIJ A;  4PF5 A;  4EYU A;  4BQ4 A;  3POJ A;  2JE7 A;  4BQ1 A;  5L7O C;  2C1F A;  3VBS A;  5DXD A;  1SAC A;  1WA6 X;  2BNN A;  2VUL A;  3SEE A;  2AYH A;  2E7T A;  2BDR A;  2DVF A;  2XBO 3;  4G4F A;  1UOG A;  3AMQ A;  3N9N A;  3ZR5 A;  4EN9 B;  3E6B A;  1JBC A;  5FZI A;  3AKS A;  4Z2W A;  1G9F A;  4J1W A;  3IM0 A;  3JD7 2;  3O14 A;  2BFU S;  1QOT A;  2LRP A;  1QJU 3;  1RUF 3;  2CGN A;  3ACF A;  3HAG A;  3M70 A;  4E2Q A;  3KQ4 B;  3MI8 A;  5ACA 2;  5GLU A;  3J7N A;  1CAV A;  1F15 A;  4KG0 A;  3RGB A;  3O1O A;  5LA2 A;  5T50 A;  4CDW B;  1CAX B;  1VBA 3;  1DU3 D;  2XL7 A;  4OZO A;  3MF6 A;  4MVT A;  3MBW A;  3SH3 A;  1UZY A;  1WCU A;  2EF6 A;  2Q8C A;  5ACA 1;  3ORJ A;  1FT9 A;  1DGR A;  1RUI 3;  4B29 A;  2VTF A;  2BBV A;  3LF7 A;  5GZD A;  1GKB A;  1GMM A;  2JDP A;  2JXA A;  3I2K A;  3ZXJ A;  1CD3 G;  2TNF A;  1OD3 A;  1GOG A;  3P6B A;  2VMD A;  2X8K A;  3MIB A;  2AAC A;  1VB4 A;  4KWL A;  2W46 A;  2YPJ A;  2NMN A;  5F32 A;  2VR4 A;  1DQ2 A;  3O0V A;  1WLW A;  4RL7 A;  4AVS A;  1OC1 A;  5CAD A;  4FP2 A;  4AVB A;  2AUY A;  3B9I A;  3E5X A;  4UOJ A;  4FAG A;  1ZVF A;  4GIQ A;  3UET A;  1C28 A;  1K5J A;  1OXC A;  1Q56 A;  3H3L A;  5FZA A;  4W6X A;  4RQP A;  3LDB A;  3PDQ A;  1ULF A;  4FBF A;  5F1R A;  5AVA A;  4JGY B;  4IEO A;  3TRS B;  4I3G A;  4OHW A;  1QNW A;  1WLD A;  1NA1 A;  4Q1R A;  3BCW A;  1CAW B;  3EB7 A;  4FPG A;  1IG0 A;  1TMF 2;  4J1X A;  3CL1 A;  1MZ6 A;  2Y8K A;  5DAV A;  5EIY B;  2PHF A;  5FY5 A;  5J36 A;  3KM5 A;  2J1R A;  2LM3 A;  2A75 A;  1I6X A;  1MVQ A;  2RMU 2;  5FZG A;  3R4D B;  3DGT A;  4Y22 B;  5DUU A;  4D7T A;  3VZO A;  5I0U A;  2WSU A;  2GP3 A;  1UY3 A;  4Y3O A;  2IVJ A;  1TMF 1;  3ZPY A;  1H9P A;  3NNL A;  3I97 A;  1ZBA 3;  4Q1P A;  3OEB A;  4XJ9 A;  1V6L A;  2CAV A;  2G1M A;  3NMB A;  5FPV A;  3M3O A;  1HB2 A;  3ZO0 B;  3ACI A;  4BME A;  1L7L A;  1CZS A;  3DPR B;  3T09 A;  2ENR A;  2BNM A;  5IVB A;  2R16 A;  1COV 1;  2KXL A;  3MYX A;  5JDB A;  3HMY A;  4JHZ A;  4RS5 C;  1UY4 A;  4JDM A;  4CP9 B;  3ZKY A;  1RIT A;  1K5M A;  4UFM A;  5FZ9 A;  3B3Q E;  4AI0 A;  3GCX A;  3E1F 1;  5A3O A;  5FWE A;  3SIT A;  4ES9 A;  4ZXK A;  3RSJ A;  2UY9 A;  1D0G A;  1GFF 2;  4AED C;  4JX0 A;  2ZGK A;  4Z1V A;  3CIH A;  1GIC A;  3T2T A;  4DB5 A;  1AHS A;  2QJV A;  4Y26 A;  4BQ3 A;  3WNK A;  5FIX A;  4EN7 B;  3VUO A;  2QTW B;  3NKG A;  2CDO A;  3ZDS A;  1ST8 A;  2ZGR A;  4U2A A;  5FY0 A;  3VLB B;  1KFU L;  4JRL A;  3MW3 A;  5B4X A;  1RC6 A;  1VBE 2;  4M4P A;  4YVW B;  3FN9 A;  1O4Y A;  4FTB A;  3IDC B;  3W20 A;  4B4R A;  3NST A;  1MS1 A;  2ZGS A;  4IDZ A;  3LQC A;  1FYU A;  2VM9 A;  3ZSL A;  4HLT A;  5C5T A;  4EE2 A;  2YGM A;  3VHP A;  1J3Q A;  1WCQ A;  1AYM 2;  2OW4 A;  4NE9 A;  1QEX A;  2RS3 2;  5FZ3 A;  2R32 A;  3LSE A;  3WF4 A;  4AFM A;  3NO8 A;  3H9A A;  5GZF A;  4CDQ B;  3AB0 A;  1Y4W A;  4QX2 A;  4LHL A;  5F37 A;  5FZ1 A;  3OUI A;  4ITC A;  3OEA A;  2WN2 A;  4MHR A;  3ZXD A;  2WZP P;  3I49 A;  3MW4 A;  2FD8 A;  1LUL A;  5BNP B;  4S2G A;  2OQ7 A;  3UGG A;  2ZHN A;  4AHX A;  2ZGN A;  2JE8 A;  4N53 A;  2A70 A;  1ULG A;  2PYT A;  1RUJ 2;  4BIO A;  1PZ7 A;  1QQP 1;  3CHX A;  4BH9 A;  1UY1 A;  2D3S A;  4RHV 3;  4R9A A;  1PGW 1;  4YSF A;  2VCM A;  1MZ5 A;  3BOW A;  1D0H A;  1XSR A;  1Y9M A;  2WAA A;  2QQI A;  2GC2 A;  3NVC A;  1SLT A;  3VN4 A;  4TSV A;  3D0S A;  1Q3E A;  5IVY A;  4XJZ A;  5DDJ 1;  5AC9 3;  3PVO A;  1U12 A;  3IBM A;  2JDU A;  3NV2 A;  2D93 A;  2E33 A;  3C7G A;  4RN5 A;  1GNY A;  3KMH A;  3W5M A;  3VDB A;  4FFG A;  1WMX A;  1PIV 3;  2Z69 A;  1U0A A;  2IC1 A;  1VAM A;  4Q0P A;  2W1U A;  2D3P A;  2VPV A;  2ZEW A;  5KC5 A;  5J37 A;  3KCY A;  4I0B A;  2P2K A;  1RUE 2;  4L11 A;  3HN3 A;  4QDQ A;  3AFG A;  1S2B A;  2B39 A;  1RUO A;  1AX1 A;  1GQG A;  3K51 A;  2YV8 A;  5J98 B;  2XON A;  1XB9 A;  4R9C A;  5FZK A;  3EQE A;  4OZX A;  5C9A C;  5M0T A;  2CWS A;  3LPG A;  1KQR A;  2XWJ B;  3ZOI A;  4WVW A;  3TN9 1;  1NYW A;  5EWS A;  3RMY A;  3UYJ A;  1G9B A;  1LOG A;  3NJV A;  4AFD A;  4E2S A;  4XUQ A;  1T2X A;  3TB0 A;  4CCE A;  1OPM A;  2TBV A;  1EUT A;  4FPF A;  4G3Y C;  1X9P A;  3MIF A;  4WM8 B;  1WBL A;  4CDW A;  1CAX A;  4HT1 T;  3L9J T;  2PFW A;  3K46 A;  2EA7 A;  2HWF 1;  4QU1 A;  4YLZ A;  1KRI A;  2VZR A;  4V1P A;  2GAU A;  2VC9 A;  4FCA A;  3V64 A;  3PLQ A;  4DQA A;  3VD4 A;  4YM1 A;  2QFE A;  4ARY A;  3DCQ A;  1US2 A;  2ZPX A;  4LIV A;  4W65 A;  2Y33 A;  4MSV A;  3U10 A;  3MID A;  3J4U H;  5FBJ A;  2JDH A;  4BB3 A;  2WRA A;  2AH2 A;  1H2K A;  1PVC 3;  5EXO A;  1YXW A;  3GNE A;  4M3C B;  1I9R A;  1Y43 B;  2GN3 A;  4MET A;  3S7E A;  4LTA A;  5DAQ A;  1B35 C;  2EAL A;  1WCS A;  5GZE A;  2JIC A;  3DXU A;  2XVK A;  5LRR A;  1W8U A;  4JV4 A;  5JOY A;  2J1E A;  1FOD 3;  1LKN A;  4CEW B;  2C24 A;  5DZF A;  1JOB A;  1WD3 A;  4HSL A;  2QCS B;  4QXH A;  1BEV 3;  1POV 3;  2XJQ A;  1UYY A;  2HWD 1;  4YW5 A;  4JRA A;  1UY0 A;  4DXS A;  1GAN A;  3OPZ A;  1OF4 A;  4IV1 C;  3S7I A;  4PHZ A;  3UV9 A;  3ZSJ A;  1HLC A;  1VBC 2;  4JGY A;  4YFW A;  1W8F A;  3VBF B;  1XNB A;  5KHI A;  3T30 A;  3V56 A;  3AX4 A;  1CAW A;  1QOO A;  2CDP A;  4GMP 0;  2OPK A;  4OHY A;  3ZN5 A;  4XZP A;  1ZRF A;  1FAT A;  4I0A A;  4SLI A;  3LOI A;  3R4S A;  3BI3 A;  1S2K A;  1VBC 1;  2A1X A;  4MLO A;  2DTY A;  1M4W A;  2PMW B;  1QU0 A;  4Y22 A;  1S0C A;  2J1U A;  1RUC 2;  4COV A;  2YC4 A;  4DUV A;  1VPH A;  3S57 A;  5EQU A;  4GKX A;  2VQ0 A;  2VNG A;  2WSV A;  4U36 A;  2WBK A;  2XUM A;  5ANN A;  3QBQ A;  3FFZ A;  3RQ0 A;  1CN1 A;  2NQY A;  3DPR A;  4I0W B;  3OY8 B;  1RUC 1;  4IGQ A;  3GF6 A;  3WVJ A;  4QPW A;  2DCJ A;  1NOV A;  1VMJ A;  1W0O A;  2VJX A;  2WWU A;  1JW6 A;  1OVS A;  2DBN A;  2R06 3;  4CP9 A;  1GP5 A;  5C3S A;  5A7P A;  2ZHM A;  3I3M A;  3FFQ A;  1UOF A;  3KS7 A;  3PVN A;  2ARX A;  3PME A;  4GA9 A;  4V2V A;  4Y1Z A;  1OA3 A;  3KCX A;  2BBA A;  4XHB A;  4AK3 A;  1L7Q A;  2X29 A;  2GND A;  4CP2 A;  4EWD A;  4EWE A;  1Q43 A;  5I8Y A;  1YHF A;  1H1I A;  5E89 A;  3MEP A;  3ALQ A;  4FPK A;  2HWC 3;  2RJ2 A;  4XTP A;  3S5Q A;  2X5I A;  2Q8O A;  4IW3 A;  3KT4 A;  1CQ9 A;  1O8S A;  3JXS A;  4XIK A;  4HET A;  1LJ7 A;  3H8O A;  2ZAC A;  4AW7 A;  1DIW A;  1OPO A;  1UMI A;  3RDI A;  1Z7S 3;  3AP6 A;  4O9G A;  4IE6 A;  2FDG A;  1WW6 A;  4YZ2 A;  5IK8 A;  1W0P A;  3SMH A;  1PGL 2;  4CDQ A;  4UFH A;  2NMO A;  5CG8 A;  3GBW A;  5KXB A;  3KGZ A;  1GZC A;  3N9L A;  1JZ6 A;  2CGP A;  4A41 A;  4DMI A;  1F5F A;  4LKE A;  1ENQ A;  1AR7 1;  3IDB B;  4IE0 A;  4IUG A;  1TEI A;  2ZA9 A;  4MG2 A;  1PGL 1;  1NZI A;  1XNA A;  2VZQ A;  4O9E A;  3B69 A;  5BNP A;  1Y9Q A;  4XCA A;  3WQB A;  1EPW A;  4I01 A;  4MXW B;  1O8P A;  5BV6 A;  1RXG A;  2DCK A;  5K7P A;  3N35 A;  4DRV A;  2W5F A;  2GNB A;  2Y38 A;  2J1V A;  1AL0 G;  5A3M A;  5FXW A;  2D5H A;  2FDJ A;  2I07 B;  3ELN A;  4LEJ A;  2IZW A;  3CO2 A;  5JOZ A;  2HWB 1;  1Q8S A;  4N53 C;  4UBG A;  2ZEX A;  1VRH 3;  2QQV A;  1NCQ C;  2O14 A;  3GJA A;  4Z07 A;  5A3P A;  3KV6 A;  4NR1 A;  4R8H A;  4AVV A;  1ZRI A;  4BDV B;  2D6L X;  3U4X A;  4XDQ A;  3E5U A;  1N3P A;  4Q4Y 2;  4B4P A;  1BBT 3;  1CX4 A;  4JGZ C;  1QWR A;  1J3R A;  1YJL A;  2JIJ A;  2BEO A;  3A7Q A;  2JD4 A;  4XFC A;  1UCX A;  1YYN A;  5DZG A;  2PHR A;  5C3P A;  1O7F A;  4I09 A;  1BYH A;  4PBO A;  2O8O A;  1VE0 A;  3E6D A;  4FFF A;  2YU1 A;  5F5A A;  4Y1Y A;  2NN8 A;  1XPW A;  3THD A;  4QU2 A;  4R52 A;  5JVV A;  1PVX A;  3KVB A;  2ZGU A;  2CU5 A;  3H1W A;  1W9S A;  1ZZC A;  2Y60 A;  4MAD A;  4BPZ A;  3WQ0 A;  2PHU A;  4OVE A;  3HOB A;  4CE8 A;  1HQL A;  2DUR A;  3K3N A;  4YW1 A;  4RGK A;  2F17 A;  2XML A;  5FY7 A;  4LXL A;  4AED B;  3UT0 A;  3O1M A;  1SBE A;  3LDK A;  4LIU A;  5BNQ A;  5IVC A;  4WM8 A;  1RVF 3;  4W6Y A;  5EJ1 B;  4AGR A;  2C5D A;  1RUH 2;  1HB3 A;  4UAP A;  2W9X A;  2R07 2;  2C9A A;  4FT8 A;  4QHZ A;  5J7M A;  2H0V A;  1AR9 1;  2DVD A;  3WNO A;  4DIN B;  2YC0 A;  4BE3 A;  4ARX A;  1RUH 1;  3ILF A;  5JSP A;  3CJI A;  1XQN A;  2AZ5 A;  1X9T A;  4CDW C;  1J1T A;  2R07 1;  2A3Y A;  2HKX A;  3O0W A;  4A6S A;  4AGV A;  1UU4 A;  3MFA A;  4KH9 A;  2D6O X;  3RI9 A;  1RUG 3;  2A6X A;  3CEW A;  4EN0 A;  4M3C A;  5F9T A;  5JLV A;  1G9C A;  1O3S A;  3ES4 A;  4Q4V 3;  4BQX A;  3FLP A;  3WW4 A;  4AL9 A;  3INA A;  4HBN A;  4XBL A;  4NIG A;  3G6J B;  4CEW A;  4LBK A;  1L3J A;  2VME A;  3K77 A;  3S0M A;  1DDL A;  4B7K A;  1VP6 A;  2MEV 1;  1NLS A;  2HWE 3;  5ISL A;  3WEZ A;  1L7R A;  2YBP A;  3MLK A;  4QKB A;  4BJ0 A;  1H1A A;  5A6X A;  2Q8D A;  4MUV A;  4CCM A;  2CHH A;  5JI9 A;  4LA3 A;  3WNM A;  3QH7 A;  4YM2 A;  4AZZ A;  5A33 B;  2ZCW A;  4A6O A;  1YIP A;  1HXS 3;  2YFZ A;  5CKM A;  2J1S A;  4GB3 1;  3WIN E;  3BGA A;  3LWC A;  3ZN6 B;  5A7S A;  1PO2 1;  2VCA A;  1NE6 A;  3OTF A;  1HV0 A;  4GJZ A;  2WC2 A;  4IEW A;  4LBN A;  2DWR A;  2DCT A;  1TVG A;  1MEC 1;  2HEV F;  3IB3 A;  4JGY C;  1RUD 1;  4MGZ E;  2LTN A;  4DZG A;  4IL7 A;  1S4C A;  1PM4 A;  1W2A X;  3ZSE A;  5CYY A;  4HSJ A;  1W3X A;  3I3Q A;  4RA0 A;  1IPJ A;  4ATE A;  2HEW F;  3N9O A;  3OY8 A;  4XW3 A;  2VUD A;  4CUB A;  5A3T A;  1AJO A;  3ENR A;  5IK7 A;  2RR1 2;  3S5A A;  1AR6 3;  2DFB A;  2GDF A;  5K8S A;  3WF0 A;  3ZYG A;  2WR9 A;  3FHQ A;  1O4Z A;  5FYZ A;  1BKZ A;  1AR8 2;  3H8U A;  5C9A B;  1RMU 3;  1E5I A;  5LA1 A;  3AFK A;  2RR1 1;  2WO7 A;  1VB2 A;  4YZ5 A;  4P9L A;  3BVC A;  3VBO C;  1ZRD A;  1DQ5 A;  5H9S A;  4LK7 A;  1SFP A;  4BXS V;  2XQR A;  3MPP G;  3PIG A;  4FVV A;  4OUS A;  5KC6 A;  4FO9 A;  1AR8 1;  1GWK A;  1TE1 B;  5JAX A;  2UY8 A;  2TUN A;  4PLM A;  4YM3 A;  1F5J A;  1HN1 A;  2ET7 A;  1MS8 A;  3QAC A;  2ZHK A;  4S2D A;  4ZXE A;  1ZA4 A;  2RM2 2;  3FHA A;  4QQL A;  3OSD A;  1IGO A;  1Q8Q A;  1IG3 A;  5J96 B;  3O1P A;  1YEW A;  1JYX A;  1EAH 3;  2RM2 1;  5LWB A;  2VOV A;  5EP9 A;  4AI2 A;  1AXY A;  1HRI 3;  3AMN A;  3KF3 A;  1FX5 A;  2PEL A;  4QB6 A;  4R4Z A;  4BU2 A;  2XL9 A;  4IE7 A;  3AL5 A;  1JTZ X;  2JDN A;  4K3U A;  3U07 A;  2FDI A;  1UL9 A;  1I5P A;  1UMH A;  2V4A A;  2QVS B;  4YVW C;  3WNL A;  1YQ6 A;  5GM0 A;  2PLV 1;  4MOA A;  2VUA A;  3T08 A;  2BRT A;  4YYO A;  1NE4 A;  4NWW A;  1LHO A;  1QJZ A;  1B35 B;  2G9Z A;  2XVG A;  3I59 B;  4WM7 C;  4QAW A;  3VHO A;  1YQ2 A;  3FBM A;  1W6O B;  4MXW A;  4PIZ A;  1XYP A;  1URX A;  5CFD B;  2X09 A;  5FPB A;  1CR7 A;  1H2L A;  2QZ2 A;  3DL3 A;  5BXX A;  2WQ4 A;  1AXK A;  5FYM A;  4YW3 A;  5GLV A;  1YFY A;  1V70 A;  1YO8 A;  4FOV A;  2BVV A;  2VW0 A;  2X10 A;  1TG7 A;  2XLF A;  1QDO A;  2WJS A;  1JN2 P;  1EUU A;  3SIS A;  4XJU A;  4TLF A;  1QJX 2;  2I2S A;  1R1A 3;  4KU8 A;  2P1B A;  4D69 A;  4P02 B;  2DUP A;  2JDY A;  4KI5 M;  3AYD A;  3KD4 A;  5JPM B;  3NL1 A;  1DP0 A;  3IWZ A;  3WG3 A;  3WX5 A;  2WZR 1;  1TME 3;  2YBS A;  1R08 2;  1QJX 1;  3RPQ A;  3DF0 A;  4XF3 A;  3ZIX A;  2F4L A;  2RS1 1;  2W68 A;  1QJE A;  3FHI B;  4LKD A;  1PM7 A;  3GXU A;  3FUO A;  4HVO A;  4NAO A;  4XHX A;  5IAX A;  2YU2 A;  1POQ A;  2OQ6 A;  4FSJ A;  3I7D A;  2W1W A;  4XJW A;  4RS5 A;  2XLA A;  3OGV A;  1W6N B;  3ZMN A;  2Q30 A;  5FZO B;  2ZML A;  4WZC A;  1H0B A;  3OBA A;  1NUK A;  3Q8A A;  2Q4S A;  3PJQ A;  3AXE A;  2RVA A;  3V0A B;  3BUC A;  4COW A;  5HCA A;  3M2M A;  1A8D A;  5FBZ A;  1HW5 A;  2VW2 A;  2PA7 A;  4IND A;  2IXH A;  5FY9 A;  1GV9 A;  1VLN A;  4OMC A;  1C5H A;  3LB9 A;  4FPY A;  4AED A;  1WBF A;  3K4A A;  4CUA A;  4AFB A;  4QKF A;  4DY3 A;  4QPI C;  4A45 A;  2HBT A;  4YZ1 A;  4XIO A;  3JD7 3;  1WME A;  1FNZ A;  3RYK A;  4AI9 A;  5JXG A;  4IER A;  4HPK B;  4KBZ A;  4YZ3 A;  5ACA 3;  2ZKN A;  5F3I A;  1OA4 A;  1W9T A;  4H7L A;  5FZM A;  2VZO A;  1H8V A;  1MR5 A;  4TWT A;  3T0B A;  1WD4 A;  2JEC A;  3WG1 A;  4AR2 A;  4COZ A;  3HT1 A;  1LNS A;  1YWK A;  5FP4 A;  2GZW A;  5EFU A;  3ZYI B;  4FPE A;  4QQH A;  3BTX A;  3D8C A;  4XYX A;  3WD5 A;  5HBA A;  2QBX A;  3VDC A;  2WN3 A;  3WR0 A;  4OI0 A;  5JUV A;  4OQ8 A;  4JHT A;  2ZS6 B;  1O5L A;  2QZ3 A;  1WCD J;  2BU9 A;  2Y6F A;  2Y0I A;  2XLG A;  1SQ4 A;  4Z2A A;  3MIC A;  4YW7 A;  4C8D A;  2ZX3 A;  4R4X A;  2V09 A;  1YLL A;  3POG A;  4NUB A;  1OQD A;  2K0G A;  2PTM A;  5DUW A;  1LB2 A;  5J09 A;  3C7E A;  2XDV A;  4XTM A;  3JQW A;  4Q4W 2;  1OA2 A;  5A33 A;  5DG1 A;  3WXP A;  3KCC A;  3S6P A;  3SCH A;  2YG0 A;  3ZN6 A;  3PUS A;  2LRO A;  5CG9 A;  1BLZ A;  3C8X A;  3ILN A;  3SC7 X;  1KEX A;  4Q4W 1;  3THP A;  4DY5 A;  3ZFG C;  3J7H A;  4LR4 A;  3BYW A;  1NCQ B;  1TMF 3;  2IWG B;  3AKR A;  3IIA A;  3LA7 A;  4XIL A;  3VBF C;  4Q8K A;  1CGP A;  1ZRR A;  5IVJ A;  1R09 2;  3WP6 A;  1IKP A;  1SLB A;  1UN1 A;  1S0D A;  1PO1 1;  2RMU 3;  2XXZ A;  4JGZ B;  4BWO A;  1V6N A;  2OUH A;  3QD6 A;  2GME A;  3AMH A;  1U5X A;  2D43 A;  2R7E B;  4AHW A;  2J1T A;  3ZXF A;  1R64 A;  1V9U 2;  1ASJ 1;  2D6P A;  4J25 A;  3K4Z A;  1UPI A;  2XKP A;  4JQR A;  1LOD A;  5C9A A;  1DQ6 A;  2E26 A;  3SNM A;  2RDN A;  1SBF A;  4QPG C;  5IVV A;  4LA2 A;  4ZZ8 A;  1LTE A;  4CXX A;  2R1D A;  4CYD A;  3H8X A;  4QGM A;  3OYW B;  4AQS A;  1O6U A;  4GH4 B;  3TYJ A;  3P3P A;  1UZW A;  4N9I A;  4YGD A;  4BIF A;  2W39 A;  5FOJ B;  1UNB A;  5IFT A;  2BVB A;  2WT1 A;  1UU5 A;  2XJR A;  1QF3 A;  3WW3 A;  1GU3 A;  2XUE A;  3BIW E;  4YGC A;  4CEY B;  3AJZ A;  3VGI A;  2ZOE B;  4PQQ A;  1XXN A;  1WUV A;  3AKT A;  1VBE 3;  5JIU A;  2WDB A;  2BOJ A;  2B5H A;  3WNP A;  1PX4 A;  1DF0 A;  2UYA A;  3BB6 A;  3M3I A;  5JIA A;  4ORF A;  3HBK A;  2VZ3 A;  2VD7 A;  4X8N A;  3O1T A;  3MIG A;  1NKG A;  4DEV A;  1H6X A;  1AYM 3;  2YUE A;  1WMD A;  4D6S A;  2GP5 A;  4HK9 A;  2RS3 3;  1B35 A;  4XAA A;  3I59 A;  2YZ4 A;  1PNF A;  3AVS A;  3MPB A;  3KQR A;  5FMB A;  5HXV A;  1W6O A;  1PZ9 A;  4Q26 A;  1ZA7 A;  1YUD A;  2Q1F A;  4UI9 L;  5CFD A;  5K4L A;  4BXF A;  3RWK X;  4Q0Q A;  1JYW A;  1ND3 B;  1W06 A;  4M3C F;  4K8R B;  2QQW A;  2EXJ A;  2PHT A;  2WS9 2;  1VMF A;  3RZK A;  4IV1 A;  4ASM B;  3GHM A;  3NJY A;  4W8J A;  2OKX A;  1RUJ 3;  2VBD A;  1REF A;  4NN0 A;  4F7Z A;  1NQD A;  4QHB A;  3DN7 A;  4XFF A;  1N47 A;  4FXG B;  4A3Z A;  3U4S A;  4D6R A;  2WS9 1;  3A22 A;  5FZF A;  2P34 A;  5LK7 B;  1DHK B;  4HFS A;  4Q27 A;  4XFG A;  1MAC A;  2CWM A;  1X8E A;  5IW0 A;  4XAB A;  4A7Z A;  3HQR A;  1HB1 A;  4E9K A;  4NOT A;  1VJ2 A;  4JKK A;  1DLC A;  4OI4 A;  4CRQ A;  5JPN B;  3AM2 A;  4N9H A;  4H3W A;  3N7M A;  3W59 A;  3OD0 A;  1PMH X;  3WNX A;  1VIW B;  2D98 A;  4I3P A;  5LBF A;  3G7D A;  4FPC A;  4EZH A;  4P5Y A;  2WQ8 A;  4LE4 A;  1W6N A;  2PQS A;  4XF4 A;  1COV 2;  1FMD 1;  1RUE 3;  2XB6 C;  3J7L A;  5FZO A;  4CPB D;  5FMO S;  1D7P M;  1JYN A;  4XBN A;  1CJP A;  3BTA A;  1GZW B;  2R30 A;  5F8P A;  5J3U A;  1ODN A;  2EXK A;  3HEI A;  1NXM A;  3VBO B;  2KR2 A;  2NPI A;  1QJY 2;  1GNH A;  1SCS A;  2DVA A;  5A3W A;  3TEY A;  4BIS A;  1TNR A;  5IAT A;  5JOX A;  3HPN A;  5EYX A;  5FMC A;  4C0H A;  5A1F A;  1SG3 A;  5DPN A;  2VXJ A;  2VQA A;  3A21 A;  4HPK A;  1QJY 1;  4IEU A;  1VAL A;  3UNP A;  3M3Q A;  2F6B A;  4B8E A;  4QX3 A;  3H7Y A;  3ZXL A;  1NT0 A;  1GQH A;  4BLJ A;  3WG2 A;  1OBN A;  4IGO A;  2W52 A;  4XUP A;  5T5J A;  4QKN A;  5C4W C;  1XE8 A;  2E7Q A;  3WOG A;  1UYX A;  4A7K A;  1D4M 1;  2O8Q A;  3LAG A;  4NRP A;  2FCU A;  3DYO A;  1BVV A;  2BW8 A;  4NHX A;  3RNS A;  1LOC A;  3T2O A;  3WP4 A;  5FO7 B;  4A42 A;  3WG4 A;  3FLR A;  2DCY A;  1LOA A;  1DCS A;  4BZ4 A;  3KSC A;  4WM7 B;  4NID A;  5T52 A;  5DG2 A;  3HQX A;  4AVT A;  2BGP A;  5A6Q A;  1KFX L;  1W8T A;  2JKB A;  5AVP A;  5C5U A;  2GN7 A;  3VKN A;  2JE9 A;  1UXZ A;  1SCR A;  3P3N A;  5E88 A;  1DZT A;  4HON A;  5IWF A;  2J22 A;  3V0B B;  1JYT A;  1K12 A;  3CKH A;  1QQP 2;  4N7I A;  2FZ2 A;  3NNF A;  1N1Y A;  1PZ8 A;  1DQ0 A;  3LCP A;  1PGW 2;  1PMJ X;  4XUN A;  1BK1 A;  2JDM A;  3GYD A;  4PIX A;  1VBC 3;  4ZON A;  2A3X A;  4P9X A;  3RI8 A;  2XBO 1;  1GYK A;  3WDX A;  4B1L A;  1OH3 A;  3BOP A;  2YC2 A;  5DDJ 2;  1NCQ A;  4UFI A;  4YVS C;  2WZE A;  1LEM A;  4KWK A;  3WP3 A;  1DQ4 A;  4ZU5 A;  4YW4 A;  1ULP A;  2FMY A;  4AQ2 A;  4Q2F A;  1WWY A;  2IVI B;  1JXN A;  1QDC A;  4JGZ A;  4HZF A;  3KV5 A;  3I2D A;  1RUC 3;  1VBA 1;  3HQU A;  2VVF A;  4UXA A;  3DV8 A;  3HNY M;  4FI9 A;  3USU B;  1ULO A;  4XF0 A;  1LEC A;  3JZV A;  3DUI A;  4M01 A;  5JR2 A;  2ILM A;  4O61 A;  1O3T A;  4LO8 A;  2XR4 A;  3ON7 A;  3PTR B;  3U75 A;  4DNY A;  3HN1 A;  3OBT A;  5CKQ A;  4CXY A;  3UJO A;  2CGO A;  3HWJ A;  4TXW A;  3TN9 2;  2WT2 A;  2CYF A;  2A6V A;  5C3R A;  2VOW A;  2VMF A;  3AP4 A;  3C7O A;  5A7Q A;  4CA9 A;  5HCH A;  1A6C A;  4NHM A;  1JMU B;  5T5L A;  4XF9 A;  5GLW A;  3H7J A;  4QPI B;  3EHK A;  3TNQ A;  4AWD A;  2Z5W A;  4FTS A;  3I2O A;  1SFY A;  4QX0 A;  1H8T B;  2HWF 2;  4ZY9 A;  2GH8 A;  4CCL A;  2KM2 A;  1JYC A;  1UYP A;  2ZGP A;  2SBA A;  1US3 A;  2JKX A;  4JKM A;  2K9Z A;  1JUI A;  2ZGO A;  5H9P A;  1O59 A;  2BP6 A;  2C4X A;  2EXI A;  3WHU A;  5CFC C;  5BNN C;  3H50 A;  3ZMO A;  4JAA A;  4IV3 B;  5CB7 A;  3NV1 A;  3B5L B;  3GBF A;  3OD4 A;  3UES A;  2BQP A;  2WII B;  1ZZ9 A;  3AZV A;  5C33 A;  3D3A A;  1PK6 C;  5A80 A;  4LLO A;  2MHF A;  2PAK A;  2RJK A;  1HX6 A;  1WLT A;  3CZJ A;  4JDO A;  4HAN A;  2D97 A;  4LBO A;  5FYB A;  4XBQ A;  3T0D A;  3RJ2 X;  3I2J A;  2XJT A;  3DEM A;  3KF5 A;  4FPJ A;  4Y33 A;  5GZG A;  4HMZ A;  2HWD 2;  1IHM A;  2VNO A;  4BCU A;  1JHJ A;  4CUG A;  3MV1 1;  1RIN A;  1W0N A;  2WNO A;  4W6W A;  3JU9 A;  5FY8 A;  2BV4 A;  4NHK A;  5FPX A;  4ET7 A;  3FC0 A;  5CFD C;  4H55 A;  4H7M A;  4IEY A;  4L8Q A;  3VKL A;  4P9W A;  3P5B A;  5ANQ A;  2VZT A;  2XJP A;  3ZFG B;  5L19 A;  3M3C A;  3POB A;  2ES3 A;  4CPB A;  5DQ0 A;  3NNG A;  4M0N A;  3VHR A;  1NAE A;  4XE9 A;  2A3W A;  1HN0 A;  3OGG A;  3I4I A;  4Q4Y 3;  3SQO A;  2RDR A;  1W99 A;  1S0J A;  3EJK A;  1AF9 A;  4J6G A;  3ZLI A;  5CIR A;  2E6V A;  3EO6 A;  2Q0A A;  3GJB A;  1QXR A;  4H2A A;  5L9R A;  3SKV A;  2HEY F;  3T4H B;  2VZ1 A;  5A6Y A;  4XQW A;  3E97 A;  1XBF A;  2WQZ C;  1GZW A;  4GXL A;  4Y20 B;  3IKW A;  2BWA A;  1F9K A;  3RZZ A;  2JEN A;  3VBO A;  4QPG B;  5HPO A;  1W9F A;  5FK8 A;  1V6M A;  3IAP A;  5CBL A;  3WQ7 A;  1SMV A;  2OII A;  4YG6 A;  3AC0 A;  1XSQ A;  4P9J A;  4Q0S A;  3W58 A;  5CEH A;  3PMS A;  4YAR A;  3S30 A;  4EQV A;  3LZZ A;  1O5U A;  2NYY A;  3B9C A;  4RHV 1;  1RUH 3;  1FV3 A;  4COY A;  4QXC A;  4B7E A;  5FZ6 A;  3RZL A;  4XMA A;  1NXD 1;  2VGD A;  2R07 3;  3IZO A;  4LE3 A;  1AJK A;  4LO5 B;  4WV8 A;  3BTZ A;  4XXP A;  3UKN A;  3QLQ A;  5L73 A;  1ZZ7 A;  2B4K A;  1OUS A;  1QHD A;  2A6W A;  2VMG A;  1RYY A;  4YVW A;  2GNM A;  3AL6 A;  2QQP A;  5KHK A;  5FK7 A;  4MHU A;  1OSG A;  3KT1 A;  3VHN A;  4NHY A;  1UF2 C;  3ZX7 A;  4WM7 A;  4GD4 A;  1AR7 2;  4ONU A;  4Y1X A;  4YW2 A;  1F35 A;  1GOF A;  1HDK A;  3KWV A;  4GKY A;  5HCB A;  5EHD A;  4JCK A;  3RFR A;  2GAL A;  2FCT A;  3C3V A;  5CVR A;  3HBZ A;  1F4H A;  1W03 A;  2E32 A;  4YM0 A;  2WT0 A;  4LOT A;  3GZU C;  4OUE A;  3V0B A;  2R04 2;  2GMM A;  2RJL A;  4ASL A;  4O7X A;  4KBB A;  5E16 A;  4LUL A;  1OKQ A;  4C1W A;  4NO4 A;  4KMQ A;  5KR7 A;  4BM8 A;  1J1L A;  4YFZ A;  3MF9 A;  3OGS A;  4LUM A;  4Y1U A;  4E4H A;  2R04 1;  1W8N A;  1W6M B;  2HWB 2;  5L9B A;  4XPV A;  2G4I A;  3W21 A;  1H4H A;  3AZX A;  1G8W A;  3H3Z A;  1QXP A;  4RSU A;  2RS5 2;  4LBQ B;  2W1Q A;  4GWN A;  3GZE A;  1XRU A;  2LUW A;  3ZXG A;  2QE3 A;  4P08 A;  5B4N A;  1JU3 A;  3WP5 A;  4DFS A;  2ZEY A;  3VBU C;  3B93 A;  5ABJ B;  1LOE A;  2YGL A;  3UL2 A;  3VBR C;  2RS5 1;  3HR9 A;  1OFS A;  3I3B A;  4BK4 A;  1LGB A;  1AUY A;  2RHP A;  2WYS A;  5SV5 A;  5KXC A;  1MS0 A;  3N9P A;  4QHO A;  4HN1 A;  1OI6 A;  2RR1 3;  2JB4 A;  4LBQ D;  5JCT A;  1BQP A;  4CCD A;  3UKV A;  4FQ4 A;  5FZ8 A;  3ASI A;  4M3C E;  5LW9 A;  4EWA A;  4GMP 3;  4ZKT B;  2E51 A;  1AR8 3;  4AG4 A;  3Q8C A;  5FZE A;  5FYS A;  2L9L A;  3RZH A;  1FOD 1;  3ZPO A;  4Y4R A;  4QPI A;  4HXC A;  3O1U A;  2A5Z A;  2EVX A;  2EAK A;  1POV 1;  4AHY A;  2YY1 A;  4LO7 A;  1H8T A;  2VXR A;  1DG6 A;  2WNU C;  1BK0 A;  1X33 A;  4TN7 A;  2YFU A;  3KB5 A;  3GGL A;  3OBZ A;  2RM2 3;  1CJD A;  4M4R A;  3CZU A;  1BHG A;  3RYP A;  3HD8 B;  1JI6 A;  1XYN A;  4KWU A;  4LNV A;  4GH4 C;  5JZG C;  5DAB A;  1AR9 2;  2FQP A;  5EZW A;  2ZEZ A;  5FYI A;  3WV6 A;  1XE7 A;  3LKJ A;  4LIT A;  3OUH A;  5C4W B;  1C8M 2;  2XJV A;  4YGE A;  4CEY C;  2GU9 A;  1GBG A;  2A7A A;  4IV3 A;  4K1Y A;  3HT2 A;  1G9A A;  1QMJ A;  2IXJ A;  4AVC A;  4BQ5 A;  1J59 A;  4EN8 B;  1SZB A;  4HL0 A;  1YI7 A;  4QGN A;  1XYO A;  3LOB A;  1S0B A;  2ARC A;  4K6B A;  1C8M 1;  2ZGM A;  4OHX A;  1M06 G;  4FPL A;  5FJK A;  2MEV 2;  3MUZ 1;  1BJQ A;  3POE A;  2NP0 A;  3Q8B A;  3NAP C;  5FUI A;  3ZSK A;  2JDK A;  1JZ3 A;  2CV6 A;  3UKT A;  5FYY A;  2W2I A;  3D6E A;  3RWN A;  3TOJ A;  1F4A A;  4CU6 A;  5FTT C;  3WCS A;  5GJ6 A;  3U0Z A;  5FKC A;  3POY A;  4OI2 A;  4QWN A;  1GR3 A;  1G86 A;  4AXO A;  2Q1M A;  2ZX2 A;  4GB3 2;  1ND3 C;  2J1A A;  1PO2 2;  4GAL A;  1X50 A;  4GWI A;  3ZFG A;  4DUW A;  5DMY A;  2AGS A;  1DYO A;  1YNA A;  3H3U A;  5FYT A;  1FPN 2;  4YVS B;  1MEC 2;  5DZE A;  3VBF A;  1QJX 3;  1RUD 2;  2EXH A;  2VW1 A;  5FP7 A;  1XNC A;  1LES A;  2VZV A;  1REE A;  5HI0 A;  4K21 A;  4QX7 A;  4BMB A;  4XVH A;  1V0A A;  4BLI A;  4Q4X 2;  4OUL A;  1BCX A;  1FPN 1;  1GLH A;  2JG9 C;  4IEV A;  1R08 3;  5DAP A;  2ARA A;  1W6P B;  1SLA A;  4QD2 A;  4XUT A;  1HRV 2;  1Z7S 1;  2W95 A;  5H9Q A;  2MNG A;  4QMA A;  5D8A B;  4BQY A;  4F83 A;  5IFP A;  2VAU A;  2ZX1 A;  4PLN A;  3O12 A;  2XH6 A;  4Q4X 1;  1FNY A;  3ZFE C;  1W2N A;  2B42 B;  1OQE A;  4FP3 A;  1DYK A;  1BZW A;  1UZV A;  5GAL A;  4AOC A;  4Y20 A;  1H4G A;  1LOF C;  3B01 A;  4QX8 A;  4QPG A;  3LGR A;  1HRV 1;  2FDK A;  2XVL A;  5LZ6 A;  1H2N A;  1HV1 A;  3GZT B;  5FPL A;  5F5Q A;  1ZBE 2;  1TQ5 A;  2W94 A;  3NV4 A;  2C0Z A;  2W87 A;  3ZXK A;  1V00 A;  2Y6G A;  5C7G A;  4CP1 A;  1ZNP A;  4OHZ A;  4LOS A;  5FZH A;  3VKM A;  4FQZ A;  5CU1 A;  1W05 A;  3LSD A;  1Q8V A;  3WF2 A;  1APN A;  5GZC A;  3TEW A;  1ZBE 1;  4EJR A;  5FZ4 A;  2DU0 A;  3PVE A;  2VMH A;  4XZU G;  3JBG 2;  3PVB B;  5K0U C;  3UGH A;  1SEF A;  2BPA 2;  1VBD 2;  2OZ6 A;  1UMZ A;  2JG8 B;  1RB8 G;  2D5F A;  5F6K A;  3JBG 1;  5CFC B;  4UWD A;  2PAE A;  3LD8 A;  4QQ2 A;  1C5I A;  1W9Y A;  5BNN B;  4K1Z A;  3AZW A;  3FUQ A;  3HNM A;  4C1X A;  1OOP B;  1Y3T A;  3K3O A;  1BBT 1;  1VBD 1;  4NIA A;  2PLV 2;  3KLS A;  3MLJ A;  3M1H A;  4PQ9 A;  4D94 A;  3QCW A;  1D2S A;  1LR5 A;  1PK6 B;  2DF7 A;  3WHT A;  5J1X A;  2ADE A;  3IDA A;  4PDW B;  1H6Y A;  1E57 A;  4XF1 A;  5F6L B;  1WGP A;  1UWW A;  3IN9 A;  1F2N A;  3EYP A;  3ECQ A;  1G6N A;  3OUJ A;  3FX3 A;  3SHR A;  1DGR N;  3SH4 A;  1TNF A;  2BYV E;  2IFR A;  3D5O A;  4CDU C;  2LAL A;  2B45 X;  3WT3 A;  2OX0 A;  1CWP A;  1JZ7 A;  1GQP A;  4LJH A;  3NRU A;  1UQX A;  3MGU A;  4XAE A;  2OYZ A;  4P00 B;  4Q4W 3;  4V2W A;  2FBE A;  4W4Z A;  2Z2S B;  4P14 A;  3T2Q A;  5C3O A;  5FO9 B;  5KHG A;  2Q8E A;  1SBD A;  5FOB B;  2A6Y A;  1W6M A;  2ERF A;  5LB6 A;  2XKO A;  3ETP A;  4YPJ A;  4CU9 A;  2FDH A;  5FYU A;  3RVH A;  2P5B A;  1JUH A;  2W08 A;  3MW2 A;  4JZR A;  1HKD A;  1W39 A;  4LBQ A;  2VOX A;  1RVF 1;  4MX3 A;  4DOU A;  5KWR A;  1UZ0 A;  2GC1 A;  2GC3 A;  5FUP A;  3I3D A;  4XMI A;  2A73 B;  1DBN A;  4O65 A;  1VAK A;  1ZZ8 A;  2WZR 2;  3R05 A;  1R09 3;  2ADD A;  2RS1 2;  2RDS A;  2Y26 A;  2ZX0 A;  3E5Q A;  2HYK A;  1MS9 A;  4UT5 A;  2VOK A;  3BU0 A;  2WYF A;  3I54 A;  3NV3 A;  3PNA A;  5D2A A;  5ERL A;  1UZZ A;  2ETE A;  5I0T A;  2D3R A;  1RUG 1;  1V9U 3;  1ZRE A;  2QDN A;  4XFI A;  3ACG A;  5GLZ A;  4OUM A;  1UPS A;  2XJU A;  4XFH A;  3BPS A;  3SCF A;  1W8O A;  4JTN A;  4KQ7 A;  4IGP A;  2XGX A;  3VKF C;  3OG2 A;  4NAM A;  2JX9 A;  5FZB A;  4RQP B;  1U5Z A;  4NPR A;  1MQT C;  2WNV B;  4GWM A;  1RUN A;  2D44 A;  5LY2 A;  3VDD C;  4BA6 A;  3PUR A;  2P3I A;  5I8S A;  1HXS 1;  3THC A;  4XQ4 A;  5A70 A;  2O1Q A;  4HKW A;  1V6O A;  2BNO A;  2JEM A;  4UW3 A;  1P8J A;  5C4W A;  3ZR6 A;  1H8T C;  3WDT A;  1LU2 A;  4AFC A;  1AX0 A;  1UXX X;  4ISQ A;  5DUX A;  5JI7 A;  4CXW A;  1IS4 A;  3BOD A;  3WDY A;  3LE0 A;  4JVA A;  3Q9O A;  3WQ1 A;  1GOH A;  3M4F A;  4CTE A;  1NLQ A;  2DV9 A;  1OKO A;  2XQX A;  4OQ9 A;  2HBU A;  2E53 A;  3AYA A;  1EY2 A;  1RJ7 A;  4UBH A;  3AP5 A;  5FLH A;  3K4D A;  4OYU A;  2A71 A;  1OLR A;  3OJB A;  4S2F A;  5LBE A;  2VY0 A;  2YYO A;  4IV3 C;  1FAY A;  4B4Q A;  1ULE A;  4IQP A;  2FHR A;  1CON A;  1K5M B;  3APB A;  5IVF A;  1ENX A;  4PBP A;  1I5Z A;  2E7A A;  4Q0U A;  3LDR A;  5D21 A;  1XC6 A;  2K46 A;  2WS9 3;  1IS5 A;  5FMO L;  4PLO A;  1EV1 2;  1AXZ A;  2PAM A;  1UO9 A;  1OT5 A;  4WVM B;  5CZK A;  3P1I A;  2ZZQ A;  1UU6 A;  4YVS A;  3H42 B;  2P3K A;  2VZP A;  1JU4 A;  3FE5 A;  2NZ9 A;  1RGS A;  4NRQ A;  5FPZ A;  1R1Z A;  3WDU A;  4KL1 A;  1EV1 1;  1KIT A;  3OPW A;  4XJA A;  4YG3 A;  2Y6L A;  1MZE A;  1YFX A;  5F3E A;  1S0G A;  5LK5 A;  3X29 B;  3UK9 A;  1CES A;  1PO1 2;  2Z4F A;  3VBU B;  4Y1V A;  2A6Z A;  5C8W A;  1C57 A;  2V72 A;  1IOA A;  5JXJ A;  3VBR B;  4XFA A;  1EAH 1;  1XE0 A;  3TAY A;  3L2H A;  5D8A A;  1W2U A;  3POF A;  1HRI 1;  1STM A;  1S0E A;  2B8M A;  1ASJ 2;  2IXL A;  3ZYJ B;  1Y7B A;  3ZIW A;  1ZM1 A;  4IEZ A;  1COV 3;  3OF1 A;  5LY1 A;  1ALY A;  1O4T A;  3I3E A;  3IAQ A;  1UIJ A;  3KT7 A;  4QM9 A;  5A3N A;  1XNK A;  4I02 A;  3PTY A;  1VAV A;  1AYN 2;  2E9Q A;  4JTO A;  5FPU A;  4MGI E;  3MLL A;  1NQJ A;  1QJY 3;  2QUO A;  5JXH A;  1JOD A;  3FWE A;  4CU7 A;  3CU7 A;  3AVR A;  4NWV A;  4P9I A;  2WNU B;  3TWI A;  1CAU B;  1AYN 1;  4DXR A;  2W91 A;  4ERO A;  1JZ2 A;  1OLM A;  2Y6H A;  5JZG B;  4N7U A;  3VDA A;  4C90 A;  2TEP A;  1QGL A;  4LOR A;  4NMI A;  3AZZ A;  3ZFF C;  2JG8 A;  4BHP A;  4C91 A;  1F8V A;  5CFC A;  5BNN A;  4Y5Z 0;  4HN0 A;  1R1A 1;  2D6K A;  1LEN A;  4QX5 A;  5IJR A;  4AI8 A;  5GLT A;  1AL2 2;  1VBB 2;  2VMC A;  3B00 A;  1XND A;  3MFC A;  2UWB A;  4LO4 B;  1PK6 A;  1TME 1;  5A3U A;  5J48 A;  4PDW A;  4H14 A;  1XU2 A;  4MZU A;  1KDK A;  1S1A A;  1AL2 1;  3BU7 A;  3OCP A;  1VBB 1;  4BYY A;  1WMF A;  4MGT A;  2XHK A;  2QQN A;  1N1T A;  1NCR C;  1UAI A;  4E8C A;  3O1S A;  1K42 A;  1DFQ A;  4QB1 A;  3WDV A;  1GP4 A;  1PHM A;  4Z8B A;  3U37 A;  2BUK A;  3NAP B;  2Y64 A;  3BPZ A;  1RJ8 A;  2CAU A;  2W92 A;  2BWC A;  3HVD A;  5H9R A;  2FCV A;  5C70 A;  3RZJ A;  1QQP 3;  3VZJ A;  5FKB A;  3CQO A;  5I8T A;  2WFP A;  3ZYB A;  1CIY A;  1E5H A;  5GKA C;  4NPM A;  4XXA A;  4AQT A;  1QH6 A;  2H6C A;  1QKQ A;  2B46 X;  3AXD A;  2X05 A;  1SPP B;  3PUI A;  1ZYB A;  4AHZ A;  3LIG A;  2ID4 A;  1HB4 A;  3ES1 A;  5T5O A;  1DYP A;  1ULD A;  5DDJ 3;  1X82 A;  1C3H A;  3JD7 1;  3VL8 A;  4LBL A;  2WFF 2;  4B3N A;  2VTX J;  4Z92 B;  4JC1 A;  5FWJ A;  3RZM A;  1YQ8 A;  1HQN A;  2JG9 B;  1QNY A;  2PXJ A;  2EID A;  3Q8E A;  1KXG A;  4CZS A;  4R9D A;  5C6C A;  3AZY A;  2WFF 1;  2W47 A;  1DGW X;  4TLG A;  1MS5 A;  4GAZ A;  1JZ5 A;  3DXT A;  3I8T A;  5ABJ C;  2ZTN A;  2ZXQ A;  1FMD 2;  3ZFE B;  3HNB M;  2ARE A;  4IET A;  4ZS3 A;  4SBV A;  4A2U A;  2VUC A;  1UIK A;  1UW8 A;  3H1M A;  4OHV A;  3ZSM A;  1NG0 A;  4TZD A;  1OMI A;  5BNO B;  1ZZB A;  2D6N A;  3L2Y A;  2O0O A;  4E4Z A;  1ULC A;  2D40 A;  1H2M A;  5FZ0 A;  3TN9 3;  2Y6K A;  3AMP A;  4OMD A;  5FAX A;  3WUD A;  1DZR A;  4UW4 A;  1LHV A;  2ARB A;  3V0A A;  4AVA A;  4R9B A;  3NNM A;  4YG0 A;  2WNV A;  4E2G A;  2ZMN A;  4KNC A;  4QKD A;  2VCC A;  1Q8O A;  3PUA A;  3KZ4 C;  3R4U A;  4S2H A;  4Q5O A;  4XDP A;  4ZU4 A;  1DGW A;  2HJI A;  3RG0 A;  3ZDV A;  5I0D A;  5K0U B;  3LIH A;  4GWJ A;  3J8F 2;  4IE5 A;  5A32 B;  5FO8 B;  4LBM A;  3B02 A;  2HWF 3;  4RR3 C;  4CP0 A;  2EIE A;  3RJR A;  5EV7 A;  5C3Q A;  2ZKL A;  1J83 A;  4C0B A;  1ENS A;  1JYI A;  3AP9 A;  2ORX A;  4IXL A;  1G7Y A;  1D4M 2;  2WWJ A;  1LHW A;  3J8F 1;  4XOG A;  1RHI 2;  3T1M A;  5E8A A;  1E5R A;  1UY2 A;  1KJL A;  3M8L A;  4UF0 B;  2RMU 1;  5KHH A;  1GWM A;  1UX7 A;  5F3C A;  5BYN A;  1W6Q B;  1S2E A;  1I1E A;  1RHI 1;  4XEZ A;  2P3J A;  2VOT A;  5DAX A;  4AEM A;  2OXB A;  4Y5S A;  2YXS A;  4NVP A;  1KS5 A;  4EV0 A;  4JKL A;  5FYH A;  2OA2 A;  1N3O A;  3IT8 A;  4CDU B;  3SLI A;  4COU A;  1VRB A;  3ILR A;  2VBP A;  2WUH A;  3B94 A;  4PF1 A;  3WW1 A;  4AYU A;  1O3Q A;  2HWD 3;  3LEK A;  1MS3 A;  1EP0 A;  1IPS A;  3IMM A;  3VBH B;  3HJR A;  1JH5 A;  4WVM A;  2OS2 A;  2WNE A;  4N90 A;  2XBO 2;  2X5I B;  1MZF A;  1F31 A;  3NJZ A;  4XC9 A;  2JB8 A;  5IYY A;  4ES8 A;  3I2H A;  3J9S A;  1QJU 2;  1DLL A;  1RUF 2;  3NWK A;  2AEZ A;  3LA2 A;  5E6H A;  3VBU A;  3AYE A;  1QY4 A;  2DUQ A;  3BAL A;  5KHJ A;  1VBA 2;  1X8M A;  1LGN A;  5FJH A;  2SLI A;  2PQQ A;  4Q8L A;  3DEC A;  3VBR A;  1POV 0;  3VB9 A;  4CDX C;  1SFN A;  4D6Q A;  1QJU 1;  1RUF 1;  3ME2 A;  3MDP A;  1CZV A;  2Y34 A;  5FXZ A;  1VBE 1;  1XOY A;  4W50 A;  1RUI 2;  2R1B A;  2YPD A;  1A8M A;  4L97 A;  4UYB A;  5DUV A;  4QPY A;  1JYV A;  1FXZ A;  4GQ7 A;  2QQM A;  2WO1 A;  1NLR A;  1IPK A;  1AYM 1;  2XWB B;  3J26 N;  4RD7 A;  1DGL A;  2RS3 1;  4LKS A;  1RUI 1;  5D8A C;  3W5N A;  1LED A;  1NZC A;  2CTV A;  2WLQ A;  5FYV A;  1G9D A;  2DU1 A;  2W0X A;  5DN2 A;  4LKF A;  2ZGT A;  3QOP A;  3VL9 A;  3OOX A;  5C8C B;  3FBY A;  2WNU A;  4FAH A;  1CAU A;  2PHX A;  3C7H A;  5EYY A;  2VMI A;  1MQT B;  3OYW A;  4IES A;  2QNK A;  4MGQ A;  1RUJ 1;  4UW6 A;  2YBK A;  1BMV 2;  3VDD B;  3BN6 A;  2C9K A;  5JZG A;  4GH4 A;  2AEN A;  1U5I A;  2KD7 A;  4RYD A;  1PNG A;  3H1Y A;  4QQP A;  4HVR A;  3GHN A;  1OUX A;  4PCR A;  1GUI A;  1AVB A;  2CSG A;  4CEY A;  4E27 A;  1BMV 1;  1LHN A;  3MUY 1;  1JHN A;  5SV8 A;  3MHZ A;  5TSW A;  3D82 A;  3AKP A;  2K2S A;  3PUQ A;  3RYR A;  4ZU7 A;  3J7M A;  1Z0H A;  4GUL A;  2VQT A;  1B09 A;  2UUR A;  4FOQ A;  4FXK B;  4QXK A;  4A4A A;  2VVD A;  3I2F A;  2JG8 C;  1ZBA 2;  3A4U A;  4LPL A;  4D0Q A;  4N43 B;  5CNA A;  1UYZ A;  4D3W A;  2FZ1 A;  4F3J A;  1AR7 3;  1S55 A;  2I74 A;  4IEP A;  4WVV A;  5LA9 A;  5EJZ B;  3WF3 A;  1O3R A;  1OOP C;  1SLC A;  2ZGL A;  2YDE A;  4LO6 B;  3KHB A;  3NAP A;  4KU7 A;  4QB2 A;  4QQO A;  3SXW A;  3VZM A;  2VEC A;  1A78 A;  1RUE 1;  1ZBA 1;  4RFT 0;  4XQD A;  4PDW C;  2R04 3;  1ND2 C;  1ZRC A;  1NX9 A;  5AFE A;  3N7J A;  4AGG A;  1W90 A;  1ND3 A;  2LS6 A;  5BPX A;  4HG6 B;  1UKG A;  3VBS C;  3IDE A;  1SPP A;  3T3Y A;  4E8D A;  2JIG A;  2QQU A;  1J3P A;  2HWB 3;  3MO4 A;  4LBJ A;  5APA A;  2VE1 A;  2BGC A;  3VD9 A;  5LA0 A;  3FMG A;  3NJX A;  2AR6 A;  3RS6 A;  4AAP A;  3ROU A;  2RS5 3;  5BUV A;  2R0F A;  3H8R A;  2JG9 A;  3CJI B;  2QQK A;  3C7F A;  2P37 A;  2WA3 A;  5F2S A;  1EYB A;  3N3H A;  2B9V A;  4HKO A;  1LCL A;  4NHL A;  3SH5 A;  1SDW A;  1W2T A;  4PIY A;  1WLC A;  4AI1 A;  4Y24 A;  2VH9 A;  5FCC A;  5F5C A;  3ZFE A;  5F2W A;  1GWL A;  1LOF A;  3N9Q A;  4UW5 A;  5LBB A;  5KXD A;  1CZT A;  2GC0 A;  5BNO A;  1RTV A;  2J7M A;  1C4R A;  2VU9 A;  4K9S A;  5FP8 A;  3WZ1 A;  3VZK A;  1H9W A;  5IVE A;  5FPA A;  1IZ3 A;  1LRH A;  3WF1 A;  3O5S A;  3OB8 A;  3BKZ A;  4L9B A;  3GZA A;  1YC6 1;  1T6B X;  2DTW A;  1UD1 A;  5T5P A;  1HJF A;  4NIH A;  5HV0 A;  5K0U A;  4RHV 2;  2XG3 A;  5LRS A;  5A32 A;  3Q8F A;  1HQW A;  4L99 A;  4HOO A;  3WNN A;  1V6I A;  4HVQ A;  1BVP 1;  2VBB A;  2VNR A;  4RQP C;  3ZFF B;  2MPF A;  2X53 S;  3CF6 E;  3K75 B;  1AR9 3;  4KGG A;  1JOJ A;  1ACC A;  2WL1 A;  2WNV C;  3F2Z A;  4NRM A;  3W9A A;  2D7F A;  1NA1 C;  1ODM A;  2XHN A;  3M3E A;  5A7N A;  5AC9 2;  2G9G A;  1CIW A;  1KS4 A;  1C8M 3;  4UFL A;  3LEM A;  3M7A A;  5F39 A;  4TYS A;  1IKQ A;  1QIQ A;  1C1L A;  4UF0 A;  4DIQ A;  4B1M A;  1H30 A;  3GAL A;  5CAZ A;  2V4V A;  5AC9 1;  2W3J A;  2WWS A;  4WVZ A;  2B9U A;  4QDR A;  1PIV 2;  1W6Q A;  1JZ8 A;  2ZX4 A;  3IPV B;  4GJY A;  5HCF A;  5A7O A;  5FY1 A;  1NCR B;  4CCC A;  5L7O B;  4CDU A;  2IXK A;  2Z42 A;  3E6C C;  1N1V A;  4ZZ5 A;  2MEV 3;  4UFK A;  5LAS A;  1FI2 A;  3U11 A;  4CUC A;  2DVG A;  1PIV 1;  4M0H A;  2DFC A;  1N3Q A;  4NJ4 A;  1WW7 A;  3RRD A;  3VBH A;  1SDD B;  2ATF A;  2BGO A;  3CJX A;  5A7W B;  4PT6 A;  1QXJ A;  3VV1 A;  3ZYR A;  2ZBJ A;  4URA A;  1K5M C;  2JDA A;  2R6Q A;  3MIE A;  2OVU A;  3III A;  4ZS2 A;  4DXZ A;  1RL3 A;  3NQH A;  4GB3 3;  4ATF A;  2ZZJ A;  1GSL A;  1PO2 3;  2P6H A;  3AK0 A;  4LK6 A;  1W28 A;  2ORZ A;  4EZ4 A;  1FPN 3;  1MEC 3;  1SLI A;  3O0X A;  4FPO B;  5IAV A;  5CA6 A;  3QH6 A;  2RV9 A;  4UFJ A;  1RUD 3;  1TZO A;  5JOW A;  1CPN A;  1IQA A;  3VZN A;  2XOM A;  2PHD A;  4Q4X 3;  5CKN A;  2IUW A;  3CDZ B;  2VCB A;  3LEG A;  1SLL A;  5FQ0 B;  5FDB A;  4QM8 A;  3N7K A;  1HRV 3;  3DKW A;  2ZAA A;  4ISR A;  2BOI A;  3CBN A;  3SEP A;  3U14 A;  5A6Z A;  1PVC 2;  2RDQ A;  4QT6 A;  4X6R B;  3NKT A;  3USU A;  1NY7 2;  4ASK A;  4LHK A;  2Q1Z B;  3EBR A;  4MGS A;  1S0I A;  2DUO A;  4JQT A;  1FOD 2;  1PVC 1;  1ZBE 3;  2RG4 A;  2V73 A;  5C8C A;  1GZT A;  1YIF A;  4FOW A;  5JXI A;  1NY7 1;  1BEV 2;  4IE4 A;  5F5I A;  1MQT A;  3LEI A;  1OLQ A;  4QDS A;  2E63 A;  4PI0 A;  4A3X A;  1Q8P A;  2WO3 A;  2VL4 A;  4X6Q B;  1QH7 A;  3VDD A;  5FLJ A;  1J58 A;  4IEX A;  4YNI A;  1CVN A;  5D1I A;  4URT A;  1OFN A;  3JBG 3;  4RR3 B;  1BEV 1;  4QXB A;  1MVE A;  3ZVX A;  4K7J A;  4XCB A;  2EIG A;  3TNP B;  2C26 A;  5I0R A;  5AFB A;  5G05 L;  5IK4 A;  1VBD 3;  5LEJ A;  5JWP A;  5T55 A;  3TEX A;  3CLP A; 
#chains in the Genus database with same CATH homology
 4XCA A;  4KBZ A;  5DAW A;  3NNL A;  4XC9 A;  2G1M A;  5A3U A;  5EPA A;  2Y33 A;  4MHU A;  3KT1 A;  4NHY A;  5HV0 A;  3DKQ A;  4NHM A;  3BVC A;  4ZPI A;  4XAB A;  4XAC A;  3HQR A;  2Y34 A;  3GJA A;  2FCT A;  5DAP A;  2FCV A;  5DAQ A;  4BQY A;  2JIJ A;  5LBF A;  3W21 A;  5L9B A;  5L9V A;  2G19 A;  2HBU A;  5EP9 A;  4Y5T A;  3W20 A;  3GZE A;  5LBE A;  5LAS A;  2V4A A;  5C5T A;  5IAT A;  5HV4 A;  2A1X A;  3OUI A;  5EQU A;  4MHR A;  4BQW A;  3PL0 A;  4UWD A;  4NHK A;  4J25 A;  5IAV A;  2FCU A;  2OPW A;  4NHX A;  5LA9 A;  2RDN A;  3NNM A;  4Q5O A;  3OUJ A;  3EMR A;  3ITQ A;  4BQX A;  2RDR A;  3OBZ A;  5C5U A;  3NNJ A;  2RDQ A;  3MGU A;  3GJB A;  4IW3 A;  3NNF A;  5L9R A;  2JIG A;  3KT4 A;  3KT7 A;  3OUH A;  4NAO A;  5IAX A;  5LB6 A;  5LBC A;  2RG4 A;  4ZON A;  4JZR A;  5DAX A;  4Y5S A;  5LAT A;  5M0T A;  4NHL A;  4XAA A;  4XCB A;  2RDS A;  3HQU A;  5DAV A;  2HBT A;  4NMI A;  5LBB A;  5ERL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...