5LBBA

Hif prolyl hydroxylase 2 (phd2/egln1) r396t variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
229
Chain Sequence
NGQTLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADETARAKVKYLTGGVRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 61
structure length 229
sequence length 233
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbbA00
4XCAA 4IW3A 4XABA 4XC9A 2RDQA 3W20A 2HBUA 4UWDA 3HQUA 5DAPA 4MHUA 2FCUA 2JIGA 2RDSA 5LASA 3MGUA 4KBZA 3EMRA 5LBBA 5M0TA 5IAVA 5DAQA 2JIJA 2FCTA 4NHXA 3KT7A 3PL0A 5EQUA 4J25A 4XCBA 5LATA 5C5UA 5LBFA 4MHRA 2Y34A 4NHKA 5LA9A 5LB6A 4Y5TA 3GZEA 2Y33A 3NNFA 4ZONA 5DAVA 3BVCA 2HBTA 4Q5OA 5ERLA 5L9RA 4NHYA 3GJAA 4XACA 5IAXA 2A1XA 4NMIA 3DKQA 2G1MA 4BQWA 2V4AA 5HV0A 3NNLA 5DAWA 2RDRA 3OBZA 4NAOA 5A3UA 3KT1A 4BQYA 5L9BA 5HV4A 3HQRA 5EP9A 3GJBA 4JZRA 3W21A 2RG4A 5DAXA 4NHMA 2FCVA 3OUIA 4XAAA 5LBCA 3OUHA 5IATA 3NNJA 3OUJA 4ZPIA 5EPAA 3ITQA 5LBEA 2OPWA 4NHLA 2G19A 4BQXA 5L9VA 3KT4A 4Y5SA 5C5TA 3NNMA 2RDNA
chains in the Genus database with same CATH superfamily
3EJKA 4RS5A 3MZHA 4M3CF 4IV1B 3VL9A 1AR91 5FZMA 1Z7S3 1OD5A 1S0EA 1PZ8A 2RS11 2OT7A 3POIA 2BPA2 4A4AA 4XF4A 5IVYA 4GKYA 2R043 3WNLA 3D0JA 5EZWA 1H6YA 4IEWA 4HVQA 3CEWA 5A80A 4D6SA 5ACA1 3WW2A 5IT6A 2A6XA 1OMIA 2R1BA 1LHNA 3KSCA 4URTA 2AREA 4JGZC 3I3DA 2WNOA 4OI0A 1QJFA 2LS6A 4CP9A 3BN6A 1YQCA 2J1EA 4AZZA 1RUI3 4Y20A 4GULA 3WVJA 1UX7A 2ZBJA 3KS7A 4RFRB 4PF5A 3FLPA 4XIOA 2GMMA 1WKYA 2WZR2 3HT1A 3KM5A 4NROA 5I93A 1QJEA 3KD4A 2HEVF 4HKLA 5KXBA 2DDUA 4Z1VA 3SEEA 4R9CA 5J1XA 4LBQB 1YFXA 2PLV1 1VBA3 1GQHA 4QDRA 3VZLA 1POQA 3PHMA 3ROUA 3NQHA 4OZOA 4UFKA 4XEZA 4RA0A 5FV3A 4AEDC 3WQ1A 3ILNA 1XNKA 2D6PA 2BUKA 1YRZA 1F4AA 2ZMLA 1Y9GA 4QX1A 1G9BA 1QOOA 3BVCA 2PXJA 1YQ8A 1PVC3 3ELNA 3I2HA 1CR7A 2J1TA 4HMZA 1Z0HA 2BOIA 3L2HA 5GLZA 4AFMA 5JPNB 3ZVXA 3LPGA 1VP6A 5C8CA 1MR5A 5F5CA 3MW3A 4I0WB 3H7YA 3IMMA 1OBNA 5LEJA 2MEV2 4AVBA 1GLHA 2GP5A 3KQRA 2NMOA 2VZPA 2XKOA 3I2FA 4FPJA 1HXS1 2VO5A 3GM8A 4OYUA 4BLIA 4CDXB 3VDBA 1WBLA 3ON7A 4FCAA 3HBZA 2Y6HA 5A3UA 4MVTA 2P3JA 1OPOA 3ZYRA 4LLFA 1OKOA 3UK9A 5FZGA 1GFF2 1S4CA 4LJHA 1W2OA 5FO8B 5CFCC 2YFUA 3MV01 1H2KA 5DXDA 4COYA 4R4ZA 1LGNA 4NIGA 1LHVA 5HV4A 4YW6A 3RZKA 1V9U1 4E4SA 1BVP1 3FX3A 1GQGA 1YQ6A 2VG9A 3T1LA 1CX1A 4QAWA 2XXZA 3LDRA 1NA1B 2XBO2 4NOTA 3T09A 3AMQA 4RSUA 4RQPC 5JCTA 5FYZA 5BNPA 1PM7A 3NMBA 3OUIA 4YGEA 5LBCA 4CCJA 2VZRA 4AI0A 4EYUA 3O0WA 3A4UA 2IXCA 3R05A 4CUBA 3J4UH 2VZTA 5CFDB 4IEOA 3V56A 4D94A 4OZXA 1WLTA 4AVVA 5DDJ1 1H1AA 3Q8EA 3WW3A 2Y64A 2HLEA 2BTVC 1FYUA 2WDBA 1GANA 2ZAAA 3NAPA 4RN5A 2DCKA 1MZ6A 4ZZ5A 1RUC3 1V9U2 3IDCB 1QJU2 5A32B 2W5FA 1NQDA 4GMP0 5E8AA 3WT3A 2IWGB 4AGRA 5FPUA 4CXYA 2IZWA 4LKFA 1YHFA 4HT1T 3A0NA 4XJZA 2Y60A 3LA3A 4ONUA 5LWBA 4E4ZA 1NAEA 1QOTA 2VBDA 2YY1A 4CEWB 5IVFA 1OA3A 5FFOC 1W8HA 4DXSA 2NP0A 1VBB3 4E27A 5CKNA 2Y8KA 2G9GA 3CU7A 4GB33 1RUOA 1AR82 4CDQB 5AFEA 1G8WA 2HWE2 3UKTA 4C1WA 1KRIA 1LEDA 3AZWA 4YNIA 5CIRA 4MGIE 3T0BA 3NAPC 1SHWB 2IC1A 3AYAA 5H9SA 2YROA 4LO8A 3POSA 1FV3A 2AH2A 4HKWA 4ZU4A 4XXPA 4IQPA 1ND2B 1YLLA 4Y3OA 5T54A 4ARXA 5FZEA 2XPJA 1W0NA 3E6BA 3AVSA 5J36A 2HYKA 3FZ3A 2XBO3 1HX6A 1NCRA 3H8UA 3JXSA 4CA9A 1CAVA 4XAEA 5IVJA 2HWF1 4K21A 4QB1A 1FOD2 1PNFA 1TME2 2XDVA 2GALA 2Q5TA 1MS4A 2PHFA 3GZEA 1X33A 4N53A 1RUD3 1AR81 1NE4A 1PGW2 1S2KA 4I3PA 3ZXLA 3U0ZA 1H8VA 4ZONA 3VBUA 1H1MA 3I49A 1E57A 2R1DA 1OOPB 1KDKA 2EF6A 4E8DA 4FTEA 1XYNA 4E4DX 3S5QA 2X8KA 1T6GC 1WLCA 4R9BA 1QWRA 1RTVA 3PUSA 1RUI1 4UW5A 5FZFA 1NLRA 1MQTA 1AL23 1K5MA 2WWJA 1CZVA 5HV0A 1DZRA 1U12A 2VQTA 3ENRA 2X5IC 4WM8C 4XQ4A 4PDWC 3WDUA 3H8OA 2DCYA 1VJ2A 4FQ4A 1R082 3FE5A 1AR71 3ACIA 3I97A 1OF3A 1ZA7A 3KT1A 4NPMA 5IJRA 4CEYC 3V0BA 1TMF1 1W8TA 2Q0AA 2JG9C 2D7FA 3KVBA 1UW8A 2XQRA 2YPJA 1CONA 4B7KA 3GCXA 2XMLA 3BIWE 4N90A 4R8HA 4TLGA 5F9TA 1HRV1 4K20A 4QQOA 1RB8G 4QQHA 1MQTB 1NZCA 3T08A 2A3WA 1ULPA 3THTA 2RG4A 5C3QA 3A22A 2EAKA 1R1A1 4YG6A 2UY9A 4LULA 3ZR6A 2BFUL 3NJXA 2RR12 4AI2A 3NNJA 2UYAA 2XJUA 4HSLA 2OS2A 3OTFA 2TEPA 1E5RA 4WVMB 4QDSA 1OT5A 5EPAA 5C3PA 1US2A 3WNOA 2VR4A 1HN0A 3TEXA 3LWCA 4XURA 4F3JA 1LEMA 5F3CA 2P3KA 5G04L 4IXLA 2J22A 5FO7B 3RWNA 3H8XA 1DZQA 4Q27A 5DDJ3 5F6LB 4Y20B 1LOFA 3OB8A 3JCIA 5FZIA 3TWIA 4CP9B 2ZGMA 3FUQA 2VZSA 3J9SA 2N7GA 4AEMA 3RZZA 3IAQA 4MZUA 2DVDA 5ANNA 4N9HA 1C5IA 4B8EA 1HB2A 3LKJA 5GALA 2FQPA 3OCPA 4A7ZA 1DGWX 1F2NA 3E97A 1C1LA 1MS0A 2VMDA 4C0BA 1XYOA 4RR3A 1WW4A 4Q0UA 4QX0A 4IE5A 2VOVA 3C7OA 1X7NA 2A75A 5FYYA 3UJQA 2I2SA 1LECA 2QJVA 1XQNA 3WHTA 1U5IA 3HD8B 4XHBA 5FZ3A 1GZCA 1K5JA 2BW8A 3N9MA 4MXWA 5HCHA 5J48A 4ZS2A 3VBSB 2ZEXA 2ZHMA 4O65A 4P9XA 4BE3A 2DU1A 1MS9A 5M0TA 2AYHA 1R64A 2FCTA 1GZWB 3LEKA 4LITA 5LW9A 3WXPA 3VD9A 3AK0A 4BIOA 3WHUA 5FREA 1ZX5A 5BNNC 4RGGA 2C9KA 2JDNA 5CISA 2ZS6B 1LAJA 2FDGA 2ZJCA 4LKDA 1LTEA 1ZBA3 1S0IA 3K3OA 2W94A 2YU1A 4XETA 4Y5TA 3RQ0A 2W39A 1BXHA 1OSGA 2CWSA 4LIVA 4BB3A 5A3PA 1FPN2 3ZDSA 5JLVA 5KHIA 2MEV1 2NMNA 4P00B 3SLIA 4Q4V3 4LHLA 5C9AB 2Z4FA 1RUC2 2XLGA 3C7EA 4A3XA 4YVSA 1WMXA 4DNYA 3MV11 2GNTA 5T5PA 5C33A 4FPLA 4RQPA 2XVGA 4QM9A 1UU4A 1O8PA 2XQXA 4EWAA 4EZ4A 3VDAA 3MFAA 3T2TA 4D7YA 1W2TA 5BNNA 2ET1A 4QGNA 2JG9A 3RMYA 2FD8A 1DQ5A 1LU1A 1NA1A 4DS0A 2GDFA 3MIHA 2R49A 4Y1VA 3X29B 1AR83 2VQAA 5T5LA 4WZCA 3AMPA 5FY1A 5IK5A 3T0DA 2CWMA 3LEGA 2JJ6A 4Z2AA 3KF3A 1D4M3 1B35B 1WA4A 2CDOA 1POV0 1ULDA 2XR4A 1QDOA 5CKQA 3ZFGA 4D6QA 5BNNB 1ND3B 1ENXA 4A7YA 3HPNA 3EYPA 5AC92 4KGQA 4BQ2A 1PMJX 1YIFA 3WF2A 4K40A 5FZ6A 1ZBE2 2VNVA 3A0KA 3Q8AA 1X8MA 2QZ2A 5C9AA 5CEHA 2EIGA 4E4HA 2JB8A 3E5XA 4AQTA 1NZIA 3W5MA 2RS13 1QJU1 2BWAA 1Z7S1 4GJZA 1NUKA 3GF6A 4NAMA 1W9TA 5C8CB 1S0FA 2BQPA 2D6LX 3OUJA 2VVFA 3QCWA 3SCHA 4TYSA 3S6PA 3DGTA 4BH9A 4BXFA 5LBEA 3O1OA 3O1PA 5E6HA 5FMDA 5BY5A 2JD9A 4UFLA 2LRPA 1A34A 1DDLA 3J7NA 1VRH2 1ALYA 1J1TA 1YXWA 1ASJ1 1VALA 4ASLA 2NQYA 5FZ1A 4RL7A 2AEYA 4V2WA 1XE8A 4E2GA 4YFWA 1JBCA 2WNVA 5LA1A 3O1RA 1G86A 2UY8A 3OYWA 1WA6X 4GJYA 2A6WA 1Q8SA 2GNDA 5H9PA 4LK7A 5FBJA 4IW3A 3EHKA 4XABA 3M1HA 3DPRA 2ERFA 3HN3A 3N9PA 4MOAA 1ZBE1 1UU5A 3ACFA 4NR1A 2W1SA 5FPXA 4UW3A 4YGBA 4JGZA 4BA6A 2BERA 1NY72 5A3NA 4Q4X1 2ZX4A 3AZZA 4HLTA 5BNOA 2PHWA 2PYTA 3ECQA 3OPWA 3UNPA 5LASA 1JXNA 4P02B 3HNYM 4FOQA 4XZPA 1CAXB 3KV6A 4Y33A 1BEV3 1OC1A 2JIJA 2WNVC 2JD4A 2XVKA 3GHNA 3A21A 4E9KA 4C0HA 4CE8A 3JD71 1IS3A 1PVC1 4IV1A 4AQ6A 4ZU7A 2VE1A 3VUOA 5CBLA 1ULCA 4JGYC 4J25A 4CEYB 1XJAA 4DUXA 2F4LA 1VMHA 3OBRA 3EO6A 4META 5C7GA 2UWCA 1AZDA 4BQ4A 1V00A 5GZEA 1UOJA 5DUXA 1PZ9A 1SBDA 3LGRA 3USUA 1HDKA 5E88A 1E5IA 4Q8KA 3RZLA 1XNDA 5FZ9A 2RS52 2F4PA 3K77A 4ZZ8A 4Q4X2 3I3EA 1ACCA 2XJVA 1G9CA 4TSVA 5DAVA 2HBTA 3POWA 3AP6A 4W6WA 3THCA 1W6NB 5FZ8A 2F17A 2G4IA 4P9LA 1OQDA 3UKNA 4AEDB 5T55A 4H3WA 2WZPP 3VKNA 1JHNA 1BCXA 3G7DA 3AP7A 4JX0A 1ZBA1 4R9AA 2XUMA 1IG3A 1SEFA 2XLFA 5KXDA 4Z82A 1JZ4A 3VKMA 1UD1A 2QBXA 2BNMA 3WW4A 1OHFA 1XXNA 4XPVA 5A7OA 4ZU5A 2ZX0A 4KWUA 4FXKB 1WLDA 1OD3A 5IVCA 3D5OA 4LBQD 1YWKA 5F2SA 3KZ4C 4X8NA 3PURA 1CJDA 5KXEA 1BHGA 3BPSA 1PM4A 2RM22 4L11A 1C5HA 4JKKA 4IUGA 3WZ1A 1ONAA 3ZN6B 2QDRA 3GJBA 4EN6B 2VW0A 3P5BA 3VBUB 2Q4SA 1RVF2 1PVXA 4NUBA 2QKDA 2BU9A 1X82A 2Z2SB 3DN7A 4TLFA 1GNHA 3K2OA 2JECA 1H2LA 5E1RA 5HBAA 2FDKA 4I2OA 1UY3A 4M01A 1C8NA 1FPN3 3K75B 4I30A 1MVEA 4NE9A 1GNYA 1ND2A 2BZDA 3D0SA 4I01A 3CF6E 4AK3A 5D1IA 4AOCA 1BMV2 1DYOA 1T6BX 3WR0A 1JH5A 3GBFA 4PLOA 2JKXA 1C1FA 1YI7A 3ILFA 4IE0A 4CU8A 3U75A 3ZKUA 1XC6A 2MEV3 1O5UA 2CL2A 3ZXEA 4LBNA 3BTAA 3RZJA 1OQEA 1RJ8A 3VBFB 4BZ4A 2VM9A 2BOJA 1TVGA 1QNYA 5IHRA 2I74A 1EY2A 1D0GA 3ZYJB 1SFPA 3I3BA 1OLME 4R52A 5A33B 5C9AC 5DG1A 4UWDA 1UY1A 2OX0A 1UL9A 2EIBA 2ZGNA 4J1WA 4XE9A 1UYZA 1UNBA 3VD5A 1RXFA 4QU1A 1X9TA 3MIEA 1NKGA 3M3IA 5I8SA 3V64A 4FFFA 4YGDA 3SKVA 4MO3M 4K7JA 2P6HA 3ZYPA 3WDTA 3FBMA 3HT2A 1RGSA 4EWDA 2XL9A 3APBA 2VZOA 3MUZ1 4MUVA 3MLLA 1IS6A 1J3QA 1ZRRA 2WO2A 2D6KA 2ZTNA 3PL0A 3U10A 4DQAA 2ZAHA 3GDBA 3U14A 5JWPA 5D21A 5FPVA 3PLQA 4GAZA 2VQ0A 1AL21 3IZOA 3LPFA 2QNKA 3AKSA 3MF9A 3FHAA 3TBDA 5JVVA 4KI5M 1UY0A 3WW1A 3RI9A 2FHRA 4W50A 1NCQC 2YGMA 3OGRA 3ZFEA 1X50A 1VBD2 3NNFA 3I2DA 5A3TA 2KM2A 3H8RA 1NXMA 3RRDA 4GH4B 1B35A 2ZX2A 3TAYA 1VPHA 4KH9A 3C7HA 4KU7A 2C6SA 1RUD1 4C90A 1QU0A 3ZM8A 3KHBA 2R073 5FYIA 4XACA 1I3HA 4KMQA 1DFQA 5A1LA 2E32A 4TTGA 5E89A 4UF0A 3H0OA 2JG9B 4WV8A 4XFCA 2BVBA 3KQ4B 3HMYA 1WW7A 1PIV2 3VGIA 1LOCA 4KNCA 4XUPA 4AI3A 3EQEA 4CDXA 1OH3A 1R1A3 4Q0PA 3WF0A 5FJHA 4BOWA 2Q8EA 3LCPA 2QQLA 2WZR1 2HWE1 3CDZB 4H14A 1KD7A 1OVPA 2Y6KA 2QFEA 3ZSKA 2R16A 1IKQA 3H3UA 4B1LA 1RUG1 1ZZ8A 4AEKA 3ORJA 1O59A 3RJRA 1X8EA 3U1XA 3O1MA 3MIGA 4ASKA 1ZZBA 2WINB 4EN0A 3CQOA 4IEPA 4LHKA 4MH0E 4Q4W1 5LCWL 1AR73 1C28A 1NG0A 5DABA 2W2IA 5FZLA 5FY5A 3UL2A 2B42B 1KFXL 1MS8A 1QJX2 3ST7A 4K8FA 2HWD1 4DIQA 3BIEA 1C57A 4FOWA 4P9YA 3LDKA 2A71A 3OUHA 3VHRA 1RUD2 4E2SA 1C3HA 1W3XA 2XH6A 2WFF2 5HPOA 5FJKA 2RVAA 2EXJA 2GC0A 2RM21 3S0MA 3O14A 1COV3 5A6YA 1KFUL 2ARCA 2YC4A 4IEXA 4B1MA 3DV8A 2GH2A 1RVF3 2TNFA 2VNRA 1RL3A 4RYDA 1QGLA 4IL7A 3MIFA 4GZ9A 2VPVA 5C70A 2VUAA 3DYPA 5FTTC 3LD8A 4CUCA 3B93A 5J37A 2WL1A 1RUE1 3ES4A 3H1WA 3GCWA 4DOUA 4NWWA 4AHZA 1BK1A 2W87A 3T1MA 1UMHA 4TZDA 1OVSA 1YJKA 2VMFA 3N7LA 1N1YA 1JZ5A 2B4KA 1WD4A 2PMWB 3SISA 3ZR5A 2JE7A 1O8SA 4PHZA 3R0RA 5JUVA 2RHPA 1TE1B 4FP2A 1AX1A 2A70A 2EXKA 1HXS2 1ZYBA 2YBSA 3AKRA 4LOSA 5FY8A 1DGRN 2JDHA 3FUOA 3HNMA 3LA7A 4IERA 3T30A 1R1A2 4YVWC 4JQTA 2K2SA 2NPIA 5IYYA 3IT8A 3J8F1 3DL3A 2JWPA 3ZXGA 4COZA 3EMRA 4H2AA 2CNAA 1CPNA 5LY1A 3HEIA 4V1PA 2QQWA 1G9DA 4ATEA 3B5LB 5FQ0B 1K45A 5FY0A 4WVWA 4IETA 2R30A 2FZ1A 4P9IA 4HKOA 4HN1A 2AZ5A 2BJSA 5DUVA 1KJLA 3RVHA 1AR72 1W39A 1AJKA 4IEQA 3VBSC 2ZHNA 1R092 2RMU2 1NX9A 3WLUA 2HWB1 4N43B 4LQRA 1JHJA 3PVEA 2E26A 1STMA 4A44A 2VC9A 4DMIA 1CZSA 3IB3A 1DGLA 1J58A 1ZBA2 3WDVA 2B45X 4GQ7A 3SH5A 3VZKA 4RHV2 3ALQA 1LCLA 3CIHA 4PBPA 3VBOA 3QBQA 5ERLA 2ZMKA 2KR2A 3JBG2 3TRSB 3V0AA 3O5SA 4LT5A 1GV9A 2WBKA 4RD7A 2WO3A 2BP6A 2W68A 4FPOB 2WQ8A 3I7DA 2GMPA 2J1SA 2WKKA 3IKWA 4ITCA 4KU8A 4N7IA 5EWSA 2RS53 3FLRA 4CCCA 1R091 5CNAA 3MICA 2VW2A 2HH9A 4OI2A 3D6EA 5KHGA 2Q8CA 3WG3A 1AR92 1K3IA 1TNRA 2Z5WA 3IPVB 2VNOA 2QQKA 4P5HA 4OQ8A 2A5ZA 2BWCA 1HJGA 1Y9MA 3TOJA 2VXJA 1EV11 4FSJA 4WM7C 1FATA 4WVVA 4CCDA 1J3RA 1QXPA 1SG3A 3SXWA 3ZPOA 5GZDA 4EROA 4Q4W3 3Q8FA 3J7HA 4YGCA 3N36A 2QQJA 2C1FA 2A3XA 3E1F1 4FI9A 3WG1A 4QPGB 1JYNA 1ZNPA 1SDDB 3NW4A 2D97A 3EXUA 2VQUA 1EAH2 1OPMA 1OLRA 3SH3A 2V73A 3SITA 5FMOS 1JU3A 4Y1XA 4AYUA 4GWNA 5JOYA 3ITQA 1YJLA 1A8DA 2A6YA 2GNBA 2CSGA 4P9JA 2OPWA 1U0AA 5FZHA 3C8XA 3OGSA 4CDQA 2IVIB 2D6MA 5KHHA 3TNQA 1GOHA 3UKVA 4AI8A 1AYM1 1CAUB 1W9WA 2X53S 1M06G 4DINB 4MGTA 1QJX3 1FMD2 4WBBA 2RS33 1RUE3 2WYSA 4BK4A 3FFQA 4HFSA 2PLV3 2WT1A 1FXZA 5FO9B 2XB6C 1SMVA 1QY4A 3D8CA 3JD72 1UIJA 4GALA 4IGQA 4K8RB 2BNNA 3UGHA 5A6ZA 4KBBA 1LB2A 5BXXA 5DAPA 4H55A 1QJX1 4QXKA 1TZOA 5KHKA 4QPYA 5FXXA 4OHWA 1OFSA 5ANQA 3HN1A 5FYSA 5CFCA 3EB7A 2WA3A 3HWJA 4OHXA 1UPIA 4LNVA 1O4ZA 4C8DA 5J3UA 3N9LA 1H9PA 1O4YA 2YPDA 3MW2A 4WM8B 3PMSA 5GZFA 3VZOA 3OEBA 1JZ3A 5DAQA 4UOJA 4HVRA 3VL8A 4YZ3A 4I0BA 2Q8OA 4EE2A 3NV4A 1RYYA 3ZLIA 3OG2A 4DEVA 2IFWA 4XXAA 2IXHA 2EA7A 5F3EA 1LOFC 3BODA 4XCBA 2DVGA 1CIWA 1BZWA 3PUAA 5FZDA 5GLVA 4MHRA 2AGSA 1RUG3 4JQRA 4N53C 1ZZ9A 2W1QA 1SLTA 4LEJA 3FFZA 1ENRA 1PIV1 3RJ2X 3ZSMA 1W6MB 5IK7A 2VXRA 1UAIA 1GP6A 1BKZA 1VBB1 3H1YA 3KV9A 4XF9A 1Q5OA 5A1AA 3CZUA 3PIJA 2JG8A 2ADEA 2C9AA 4EZHA 5DMYA 5GLUA 1D4VB 4ET7A 2CY6A 3GZAA 1YUDA 2E7TA 4BQ1A 2FMDA 1REEA 4UBGA 2W08A 4CRQA 5LA0A 2ADDA 2P37A 4NMIA 2VOKA 1Q8PA 2YBPA 3AMNA 5FYTA 3KCYA 3S30A 3U07A 1CGPA 1FMD1 5FK8A 4BQWA 5CA6A 3ZMOA 2ZHKA 3ZN5A 5L36A 1PK6A 1SFYA 4CP2A 4YW3A 3ZYIB 3WX5A 1WZXA 1LRHA 5JSOA 1EP0A 3I3MA 1GZ9A 3DXTA 4QPGC 5FYUA 4CDWB 3IMNA 3KGLA 3WINE 3KHCA 4Z92B 1SLLA 2D43A 4HXCA 5FMCA 4BMBA 1EV13 3MPPG 4DO0A 3TEYA 2YDEA 4GKXA 1KS4A 2R7EB 3KV5A 4CXWA 1CQ9A 1G7YA 1Q3EA 1UOBA 1V6IA 3LIGA 3ZYHA 4IV3C 1ZRDA 2AEZA 4B4QA 1FV2A 5H9QA 1IZ3A 4FAGA 1RXGA 2P3YA 5CZKA 3FN9A 2ZZJA 1H4HA 2FCVA 3WDYA 4C91A 5C71A 2LROA 1WCDJ 4LXLA 4K6BA 3IDBB 4OUEA 1RUF3 1QJY2 2GMEA 1MS1A 2YG0A 4UFIA 4UF0B 1VBD3 4BM8A 2RMU3 5AC93 1HRI1 5SV5A 1HXS3 5JOZA 2K0GA 4TWTA 3ZFFA 3IAPA 4M00A 1V6NA 1FPN1 2ARXA 2X10A 2WT2A 2XG3A 2ZEZA 4CDUB 4CP1A 5I91A 4MG2A 1UKRA 5I0TA 4BQXA 4QXBA 1I1EA 1RITA 2YC0A 4XUQA 1PX3A 4QXHA 4EN7B 2PHDA 4UW6A 2FDFA 1RHI1 4Q0VA 2VZ1A 2J1RA 3M2MA 3SHRA 3DPRB 1WGPA 5FZAA 1TEIA 5JR7B 2DTWA 2Y6GA 4AL9A 4XC9A 4CDWC 3AYDA 1W9FA 3PVNA 1URXA 1V9U3 4YM2A 5HI0A 4AI1A 3WNMA 2IXJA 3FMGA 3HQUA 2EALA 1W28A 4Q29A 3OY8A 5AVAA 3NV2A 3T2QA 1LKNA 1EAH1 1SLAA 2EIDA 5LRRA 2RR13 1H2MA 5T50A 4F7ZA 4XDQA 4IEUA 3UESA 2FCUA 5EHDA 2PHUA 1V0AA 1AX0A 4M3CB 2PHXA 2LW8A 5FXZA 1TME1 2UURA 3N3HA 4KBZA 2QUOA 5A7WA 4QT6A 2HWB2 2WLQA 4Q1PA 1FAYA 4HSJA 1VR3A 1XPWA 5CG9A 2HWC2 1LJ7A 4YYOA 2WQZC 4JRLA 1IPKA 5A7NA 5C8WA 4BYYA 4JDOA 1D0HA 1GWKA 5LBFA 5DZGA 1RMU3 1LU2A 4YVSC 1OLQA 2VCBA 3ZSJA 2CGPA 5FP8A 5A33A 3PNAA 5D2AA 4ZY9A 4AAPA 2R6QA 3TEWA 1RUNA 1HRV3 5FLHA 1T2XA 4NIIA 1IS4A 2C5DA 1O5LA 5JIAA 4CCOA 1UYXA 2UWAA 1D4M2 4A3ZA 1FMD3 4BXSV 2H0VA 4U36A 1J1LA 4KL1A 3RGBA 4Q4Y3 2NLRA 2Y6LA 4PDWB 4EQVA 2VVDA 3ACLA 5A3OA 1Q43A 1SCSA 4HG6B 3K51A 1PMIA 4A45A 4CSWA 3IN9A 1W0OA 4UW4A 1HV0A 1A3KA 3CKHA 4JDMA 2RV9A 1YC61 3QH6A 4GWJA 3MFCA 4W4ZA 3DKQA 4MX3A 2CAVA 4BU2A 4BK5A 1SPPB 4DY5A 5L7OB 2C4XA 1BLZA 1NE6A 1YQ5A 3ZIWA 4P08A 5C6CA 3VBFC 1ZRFA 4MGQA 3WG4A 4BMEA 2JICA 4O7XA 5LY2A 2D6NA 3GALA 5AVPA 2WUHA 3FHIB 4N8MA 3VKFC 4D7SA 4DXTA 3MW4A 2VVEA 2WFF1 1LOEA 3POGA 2WLPA 4QD2A 3LAGA 3ZN6A 4ES9A 1QXRA 2ARBA 2BBAA 2C26A 2ZOEB 1W6QA 3O1TA 1WBFA 1HB4A 2VMGA 3QLQA 4LO5B 3IWZA 2E7AA 4CDWA 4BCUA 3VZJA 3P6BA 4XMAA 1DCSA 3AKPA 4XF3A 5F5AA 3AP4A 1S0JA 2ZA9A 3FBYA 4LPLA 4AFBA 4I3GA 3H3ZA 4AVSA 1W04A 3WCRA 3M4FA 4G4FA 5KWRA 1S0GA 2J1AA 4XBQA 2DBIA 5FZOB 3VBUC 3UYJA 4XJAA 4A6SA 1V70A 1UKGA 4BJ0A 1RHI2 4SLIA 1LGCA 2D44A 4COUA 1REFA 5F7UA 1J3PA 2RE9A 3POJA 2D98A 2RR11 5L73A 4XIKA 3MLJA 3ZKYA 2ZHLA 1H0BA 2DVAA 5FYBA 4CEWC 3MBWA 4NIDA 3NSTA 4RR3B 3NNMA 4FPKA 3MLKA 1JZ8A 1AVBA 1NCQB 1W8NA 4GWIA 2KA3A 4S2GA 4QHBA 5B2GB 1W6MA 1R1ZA 2WSUA 3AL5A 3CJIB 2BV4A 2WNEA 3JB8A 4FPCA 4Q4V1 5CYYA 1DU3D 1ODNA 4K1YA 3ZXJA 1QJY1 2YHJA 1AXKA 1VB2A 1JMUB 1MACA 2VECA 5C3SA 5F5QA 2C24A 4CEYA 2HEYF 4URAA 3OEAA 3O1VA 1U5XA 1TMF2 3ZXAC 1JUIA 1LR5A 4FP3A 2V72A 1IG0A 1W3VA 2I07B 4JDNA 4QX7A 2E31A 2ETEA 3B3QE 3PJYA 4IE7A 1JTZX 1Z78A 5FYHA 1XSQA 3J7LA 4DUWA 1SLBA 2VMCA 3VKOA 4NJ4A 1CJPA 3KWVA 1GYKA 3TEZA 1X9PA 1NCQA 1L7LA 4OQ9A 3AZXA 2VD7A 4BIFA 3AMMA 2IFRA 3AXDA 2K46A 5LA9A 1COV2 5EYYA 1DF0A 4JC1A 4XUNA 1V6KA 5JIUA 1XNCA 1WMDA 3I3QA 3OYWB 1MEC3 2H0BA 3ZPYA 3NJVA 1JN2P 1S1AA 3DYOA 4NRQA 1AXZA 5K0UC 3VDDC 4FT8A 5L7OC 2O1QA 2E9QA 2JDAA 2X5IB 3I2IA 1QQP3 2WRAA 2WYFA 3LQCA 3VBRA 4XFBA 2WS92 1AR63 1CX4A 1RUH2 3Q8BA 4YSFA 1HRI3 4Z8BA 2Z79A 3MPBA 2G9FA 1AXYA 3RYKA 5HXMA 5FYMA 3BB6A 1ZA4A 2HWC1 3GHMA 4CYDA 1RMU1 4M3CE 1MEC2 4RFT0 1BBT2 3CNAA 4FTSA 4D6RA 5F8PA 3HR9A 2VW1A 5EYXA 3RI8A 4DY3A 1MQTC 3M7AA 3RSJA 1UCXA 1TG7A 2PTMA 4X6QB 4UAPA 5IVEA 1QJY3 2BBVA 1AL22 1XB9A 1LNSA 2G9ZA 2ET7A 1C8M1 2JE8A 4LA2A 3T2OA 5FR3A 1JYXA 3T3YA 4AQ2A 3K4ZA 2GNMA 2Y6FA 4OI4A 1AYN3 2WC2A 1DBNA 4QHOA 1LHUA 1HW5A 4RGAA 3ZDVA 1ND3A 2HYXA 3W21A 1JZ2A 3ZFGB 2BVVA 3M3OA 2VUDA 3BPZA 1RUF1 3VHOA 1UXZA 2HJIA 4OI1A 1W99A 4FVVA 5ACA2 2QQPA 4XAAA 2YB7A 5JAXA 3B69A 5J96B 2Q1ZB 5BNQA 3L9JT 1LULA 2LALA 5IATA 1VBC1 4A41A 2ZABA 1LENA 4LTAA 2EXHA 1CVNA 1HKDA 2VCMA 1H4GA 4FQZA 4NPLA 4XBLA 5SV8A 3V0AB 3ZFEC 4AVAA 1OA2A 1ZRCA 2VZVA 5F37A 4Y1UA 1HB1A 2BDRA 4YVSB 2QDNA 2GH8A 1SLIA 1YI9A 1IHMA 3WQ7A 4PIYA 4XHXA 4AAXA 2DFCA 3HIFA 3N9OA 3NKTA 5FYCA 5LZ6A 1WWYA 4NN0A 1WMEA 3I54A 1ZBE3 5BYNA 4IV3A 1O3QA 1LODA 3AC0A 5K9YA 1ENQA 1VBE2 2ILMA 1RUH3 3VZMA 2DFBA 1ZREA 1Y9QA 3MO4A 4LORA 3DECA 1GBGA 4K3UA 4B3NA 3VD4A 3C3VA 1H1IA 4HETA 4YW1A 2RM23 2LUWA 1BVVA 4MHUA 4M3CA 2OZ6A 4YZ5A 4JTNA 5K7PA 3MYXA 2QQUA 1KITA 4H7LA 5FWJA 1BEV1 2SLIA 4Q8LA 1NYWA 4Y1YA 1N1TA 1W2UA 1ZRIA 1XNBA 2DVFA 4LE3A 1OF4A 2E33A 5IAVA 4QGLA 1O4TA 2RS12 2PAKA 4MXWB 4QKFA 4RGKA 5LK5A 4PIZA 3OSDA 5FY4A 4HANA 2DVBA 4KWJA 1VRBA 1EPWA 1VAVA 1W90A 3LA2A 4XMIA 1OUXA 1GOGA 2YU2A 1WD3A 4BWOA 5GJ6A 5KR7A 1SBFA 3U4XA 5B4XA 5LB6A 2YGLA 4Y22A 2D3SA 2V5DA 2ZX1A 5IVVA 1KEXA 2WABA 4XZUG 4CDUA 3P1IA 2UU8A 1Q56A 2Y33A 3DXUA 2A3YA 5ABJC 5T5OA 4MGYE 4XJ8A 3K4AA 3O1SA 2W1UA 1XE7A 5JZGC 3Q9OA 1P8JA 4UI9L 3VZNA 5FPLA 1I5PA 3BYWA 3GBWA 1N3QA 2IXKA 2W92A 4W6XA 2W91A 1GKBA 4QPWA 2A1XA 2WZEA 3CJXA 1OLMA 3AB0A 3CZJA 3WEZA 2B9UA 4L92A 1N47A 4OULA 1UPSA 3HBKA 4I09A 4WM7A 3TYJA 2VNGA 4L0PA 3M3CA 4A6OA 1F5JA 4OVEA 1S55A 4V2VA 1V6MA 5GLTA 3U4SA 3VB9A 3B9IA 4F8AA 4M4PA 5EJ3A 1DHKB 2E63A 3HVDA 2B7YA 1Y3TA 5IK4A 1B09A 2J1UA 2V5YA 1WUVA 3C2UA 4EJRA 3HQXA 1PO12 1E5HA 1HRI2 3PDQA 2ZGLA 1K42A 2JDZA 4MGKE 3HQRA 4CUGA 2X5IA 3OF1A 1PK6B 3VBRB 4JZRA 5T3NA 5B4NA 3H50A 1YCIA 5T5JA 3B02A 1Q8OA 2JB4A 1XE0A 3KF5A 4YZ2A 1B35C 1VBC3 2P2KA 2SBAA 3U11A 1MVQA 2XJPA 4NHMA 4LBMA 4UT5A 2ZPXA 3VBOC 2L9LA 5H9RA 4A7KA 2C0ZA 1PMHX 3JBG1 3NVCA 4O61A 2IUWA 4CCLA 3WD5A 5A6XA 2JE9A 4HN0A 4QU2A 1ND2C 2E6VA 1YFYA 5BV6A 3IIAA 2B5HA 4XJ9A 2JDYA 3RZMA 2TBVA 2H6BA 3H42B 1DYPA 1DIWA 2WIIB 4GH4A 3KVAA 1GQPA 5L9VA 3SC7X 4CP0A 2WAAA 3ZFEB 3E6CC 4D3WA 5FUIA 1RHI3 2EIEA 1IGOA 1VRH1 2QTWB 4QPIA 4XILA 5EIYB 4YW5A 3RFRA 2UYBA 3ZOIA 3GGLA 4XCAA 1DQ2A 4LO4B 1XU2A 3RG0A 1GOFA 4QKDA 5FZ4A 2ZGSA 1JOPA 1CAVB 1UY2A 3PJQA 5C4WB 3CBNA 5D8AB 2OA2A 3MEPA 4WM8A 1BBT3 4NRMA 2NM1A 1Z7S2 4WVZA 1GU3A 2JXAA 2ARAA 4LO7A 2NYYA 2DUOA 4HVOA 1W9YA 2QQIA 4H7MA 2JDMA 3MGUA 3T2PA 1UZYA 1COV1 1O91A 4Z07A 4IEVA 2PLV2 2ZGOA 3AKQA 4OLLA 1IQAA 4GIQA 1PO13 4NHXA 2A73B 5KC5A 3BTXA 4FTBA 1U5YA 3KCCA 2XKPA 4EWEA 1VBE1 4G9SB 2HWB3 4FOYA 4CDQC 1HQLA 2JENA 5JMOA 2W3JA 1OURA 5FZKA 1QDCA 2ZGRA 2ES3A 4UFHA 1POV1 3TN93 4G3YC 4XJUA 3I2OA 1F4HA 2VMIA 2OIIA 1BBT1 4QX2A 1QMJA 2WO1A 1GR3A 2OQ7A 1AJOA 2PFWA 3GZUC 5A32A 3VD7A 2QE3A 1UZ0A 4COVA 4JVAA 1AR93 1J83A 2GN7A 3J8F3 5DPNA 2V09A 5FYVA 3NJYA 1GZTA 4QWNA 4CZSA 3H3LA 1VLNA 4HZFA 4ISRA 4E8CA 3CL1A 2JDPA 4JCKA 4P5YA 2XHKA 3K48A 1WCSA 2CU5A 3GJAA 3JU9A 2YYOA 1VBE3 4JV4A 5CFDA 3I2GA 5LK7B 1ENSA 4CPBA 4JAAA 1QH7A 3VHNA 5K8SA 1CIYA 2W52A 2J1VA 5EJ1B 4MADA 3HOBA 4D8MA 2DTYA 3AL6A 1N1SA 2V4AA 2ZMNA 1JS9A 1ZM1A 1PO21 4L9BA 4KWKA 5I8YA 4RR3C 1SPPA 3POYA 5IFPA 1OUSA 1AYM2 5HCBA 3OBZA 5F1RA 3M3EA 1UX6A 1L3JA 2E51A 3URFA 2ORZA 2EXIA 1FX5A 3LFMA 4X8PA 1V6OA 1XBFA 5IFTA 1DQ1A 4XOGA 3MF6A 3VV1A 3EBRA 1N3OA 4LHNA 1CN1A 1LOAA 3FJSA 4UFMA 1O3RA 2ZKLA 1BYHA 3O12A 4UFJA 3BKZA 4DZGA 5JZGA 2CDPA 5CFDC 1RMU2 1HLCA 1LESA 2ID4A 5ABJB 4QKBA 4LBLA 3R4DB 2WS93 3ETPA 4XW3A 3WQBA 3NKGA 1YEWA 5I0UA 1QF3A 4PJYA 5CVRA 4YFZA 2VZ3A 2BEOA 3N4MA 1UU6A 1NCRC 2NZ9A 4NVPA 2WR9A 3IBMA 4X6RB 1HB3A 1EV12 1GMMA 5FUNA 5A3LA 3AKTA 4YM3A 3LOIA 2VOWA 1A78A 5FPBA 1C4RA 1CD3G 1H8TA 1MZEA 1ULGA 1UN1A 1QJU3 4AEDA 4LIUA 1VIWB 3ME2A 5GLWA 4I02A 4XUTA 4DEQA 2WNUC 3VBHA 3PUQA 2WAOA 5JXJA 4N43C 4Y24A 3J8F2 2WZR3 5I8TA 1XSRA 2DWRA 3WF1A 1UWWA 1AYN2 1ND3C 2VY0A 4CU6A 2XHNA 4FO9A 4GA9A 3WCSA 2VTFA 3OY8B 3KMHA 3WUDA 2HBUA 3OBAA 4FFIA 4CTEA 4YG0A 1BK0A 1KQRA 3OGJA 1K5MC 5FMOL 2R0HA 3ZFGC 2RS51 3PVOA 2FBEA 3UT0A 1PZ7A 3AX4A 1IOAA 4XFIA 4AWDA 4E2QA 1UY4A 1AHSA 1RJ7A 1CAXA 4YM1A 1S0DA 1US3A 2YV8A 5CU1A 3VBHC 3WY6A 4EN9B 1ULEA 2VCCA 2VUCA 4Q26A 2BNOA 4QMAA 2ZKNA 1PVC2 4COWA 5LATA 2RS32 5C5UA 2WS91 1POV3 4K9SA 3TN91 2VGDA 3NRUA 3INAA 2JDUA 1H30A 5DUWA 2Y34A 1WCKA 3I8TA 4BISA 2BFUS 4CCEA 5FBZA 1O6UA 1KGYA 5JOXA 4YM0A 2PAMA 4QQLA 3WP6A 3ZIXA 5FDBA 1IS5A 3CO2A 3KGZA 4JGYA 3RWKX 4HBNA 1NY71 4TXWA 3WNXA 4QX5A 3I4IA 1TME3 2WA4A 3PU8A 4J6GA 4NO4A 4XYXA 5A7QA 4AE2A 2P34A 5APAA 2W1WA 2DF7A 4YW4A 4PLMA 2AC1A 4MSVA 5FUPA 3AP9A 4CCKA 1F5FA 3GZTB 4M0HA 5KHJA 4NHYA 3BI3A 4IE6A 5EXOA 3ZXKA 1PO23 4PI0A 3NL1A 4PLNA 2VOTA 4RHV3 4S2DA 2ZX3A 4INDA 1QQP2 2W0XA 4N7UA 5F3GA 1HIXA 3OD4A 1RUJ2 1NOVA 1VBA2 2WO7A 4U2AA 4UYBA 5DN2A 4BDVB 4QQPA 1O3SA 3ZXFA 2XOMA 1N3PA 2XL7A 1W8UA 2DURA 2WFPA 3O0VA 4IEZA 4ARYA 2PHTA 2PHLA 3JQWA 1L7QA 2W46A 3AYEA 4WM7B 3ZMNA 3MIDA 1X36A 2QQNA 1NA1C 3HNBM 4GB32 4P9GA 4QQ2A 5L9BA 1WMFA 3VLBB 3WOGA 2VBPA 3A23A 4JGYB 3WV6A 1W8WA 4QPIC 3M8LA 2QVSB 4QDQA 1JYIA 1LHOA 2X05A 3SH4A 2YUEA 4MXVA 5TSWA 5L7OA 1EAH3 3OBTA 4DXRA 1TQ5A 1VBD1 3CMGA 5HCFA 4F83A 2ORXA 4PCRA 1OA4A 1PGL1 2Y6JA 4Y4RA 4FXGB 5BPXA 2B9VA 4MGZE 4GH4C 2XJTA 2GP3A 4Y22B 4CCNA 2PAEA 4Q4W2 2OUJA 1RIRA 1W06A 5F2WA 1C8M3 1APNA 2P17A 2Y0IA 3I59A 3N9NA 3VHPA 3WNKA 1GP5A 2J42A 3ZYBA 2OYZA 2DCTA 2P3IA 4CUAA 2DCJA 1A6CA 4RQPB 5CB7A 5F39A 1CAWA 2WN2A 1RC6A 1W6PB 4FPGA 4FBFA 1GWMA 2ATFA 4CXXA 3ATGA 2D93A 4Y5SA 4HPKA 4OHVA 1JI6A 2PN5A 2D6OX 2VMEA 1G9AA 1ZVFA 1UF2C 2ENRA 2I45A 3ASIA 4YW7A 4GXLA 3T0AA 5CFCB 4OMCA 2CTVA 3WG2A 3MHZA 3ABZA 4LK6A 2HWE3 1H2NA 4LMFA 1YFUA 2BGOA 1AL0G 4PQ9A 4AGVA 5IVBA 1JW6A 2XVLA 1SCRA 3PUIA 5A7WB 4ZS3A 4FAHA 3JD73 1RUF2 2ZEWA 1ASJ3 4K1ZA 1IKPA 4IV3B 5CKMA 3UGFA 1YQ2A 2BRTA 1XOYA 3L2YA 3H9AA 4AHYA 1W8OA 4QM8A 1UMZA 1MS5A 4DRVA 2DU0A 4YWAA 4B29A 2WWSA 4Q1RA 2XLAA 3ACGA 3V65A 2AUYA 1XNTA 1AUYA 3HJRA 3LE0A 4IEYA 4LR4A 1UZVA 2IXLA 5DZFA 5A7SA 3QOPA 5J7MA 3W58A 5KBFA 2DBNA 3W5NA 3WQ0A 3U78A 3GNEA 2JX9A 5ABJA 2VU9A 1WCQA 5FWEA 1QJZA 1DGRA 1GP4A 2FDHA 2GC3A 2A6VA 1YO8A 4MLOA 2A6ZA 4P9WA 1AF9A 4AI9A 4Z2WA 1GUIA 2VULA 3AMHA 3CLPA 1Y7BA 1DG6A 4XBNA 4AVTA 4FPFA 4KQ7A 4XTMA 1UOFA 5FRAA 4LO6B 2A7AA 3SNMA 4Y1ZA 1Y43B 4EV0A 4BQ3A 1D7PM 4PF1A 1YIPA 3ZN4A 4HK8A 4W6YA 3BUCA 4Q5OA 1JOJA 1W6OB 5F32A 2VZUA 5BNPC 4LBKA 1W0PA 3MUY1 3LDBA 2ZXQA 4B7EA 2OQ6A 1SZBA 1BEV2 3IPVA 1F9KA 2CHHA 1OKQA 1WW6A 1JYVA 4LE4A 5FK7A 2O14A 3PMEA 4Q4Y2 3P3NA 3UGGA 4HONA 1QH6A 3JBG3 2DUQA 4CU7A 1ODMA 2RJKA 3O0XA 5DAWA 1QXJA 2RDRA 3BOWA 5FLIA 5BNOC 1JYTA 2XUEA 4XQWA 3WNPA 1LOBA 3E5UA 1Q8QA 4QXCA 4MV2A 1CPMA 4UBHA 1JZ7A 5JDBA 2R042 5J98B 4OCTA 3VDCA 3ZSEA 1U5ZA 2FDIA 2O8OA 2YMZA 4ORFA 1MPXA 3AZVA 4OUMA 4NIHA 3VBOB 1JZ6A 2OW4A 4KWLA 2VCAA 4LUMA 1YYNA 4AVCA 3S7IA 3V0BB 4RS5C 2PQQA 1HJFA 3VN4A 3WDXA 3N7KA 4XTPA 1M4WA 4QB2A 5LEKA 1MZ5A 3QACA 5HXVA 3VBRC 1RUH1 2EAAA 2WNUB 4JHTA 3JUUA 4AW7A 4BPZA 4YARA 1CWPA 1W03A 3ZFFC 4FPEA 5FP3A 3IDAA 4GB31 1EPZA 4EN8B 2O0OA 4FFHA 3F95A 2E53A 2ZZQA 4LKEA 1DP0A 4Q2FA 4A42A 1YFWA 5FQ0A 2GSYA 1OOPA 3KLSA 1S0CA 3M3QA 4XQDA 3T4HB 1VB4A 4AHXA 3BCWA 4QHZA 5C5TA 1JODA 3S57A 2R071 3MI8A 3LFIA 1K12A 3NJZA 4YLZA 4D7TA 4AFDA 5K0UB 4PI2A 4DB5A 2VUJA 4DPNA 2VBBA 2B8MA 1JUHA 3R6SA 1ZZ6A 4QPIB 1XRUA 1NXD1 2NN8A 2OXBA 4QGMA 2WZ8A 2CGNA 4RHV1 5FZCA 3RS6A 1J59A 1F8VA 3E5QA 3N7JA 4AHWA 2VTXJ 2ZGKA 1VAMA 4PQQA 5EFUA 5E16A 1F35A 2VAUA 3DPRC 3LEMA 2JIGA 2RDSA 2ZEYA 1QEXA 2WT0A 3CJIC 1RINA 3POFA 2PQSA 5LBBA 3SCFA 4B4RA 1MEC1 4L99A 1QNWA 3LZZA 2R062 1HQNA 3RNSA 1MS3A 2Q30A 2R0FA 5C3RA 2WNUA 4P14A 3DYMA 5FCCA 3RDIA 5A3MA 5JSPA 3IM0A 3WF4A 2FMYA 1JOBA 1D2QA 1OXCA 2XWJB 3POEA 5F5IA 1NLSA 1FI2A 2WNVB 3SEPA 1HV1A 1GNZA 4R9DA 1JYCA 4S2HA 3VDDA 4AFCA 3TNPB 2QCSB 1UOGA 1VBA1 4AGGA 2IXIA 1PIV3 2Q1FA 4W65A 4IGOA 2XGXA 4ATFA 1AR61 1LGBA 4ISQA 2Y0OA 4AF9A 4NIAA 3PTYA 2WN3A 1QQP1 5JXHA 4S2FA 5FIXA 1CZTA 1UQXA 3OGGA 5GZGA 4IESA 2R32A 5BUVA 1W6QB 4ZHNA 1UXXX 2WSVA 5L9RA 3BTYA 5FPZA 2O8QA 3GYDA 4GWMA 3R4SA 5I0RA 3JQXA 3ES1A 2D5FA 2QZ3A 4QPGA 1NLQA 2HWC3 1PGL2 1NQJA 2R072 5JXIA 2HWF2 3NNLA 5JI9A 3U37A 5BNPB 3LOBA 1UIKA 2RMU1 4PT6A 1E5SA 1KJRA 4NAOA 5DZEA 3DUIA 4J1XA 4Q4V2 1FNYA 5CAZA 2Q1MA 1IPSA 2QQVA 3K3NA 3N7MA 4YVWA 1DLLA 2TUNA 4QX8A 3T4VA 1ULOA 3DF0A 3ZYGA 5I0DA 2XJSA 1I6XA 4PDWA 5C4WC 4UXAA 3ACHA 1OFNA 2Y26A 4L2NA 3WP5A 5C8CC 1DQ4A 1G6NA 2CV6A 4YVWB 1XYPA 1RUJ1 4NRPA 1VRH3 4DRRA 1RUI2 1F15A 3BOPA 5JI7A 2GZWA 2E7QA 4XDOA 3O7OA 3BU0A 2HWD3 4QKNA 2HKXA 5T52A 5KC6A 5A7PA 5A70A 1VE0A 4D0QA 3ETQA 5A6QA 3RZGA 3KB5A 1G9FA 3OD0A 4CPBD 2DUPA 4CCMA 4LOTA 3R4UA 3SQOA 5EJZB 5L19A 2BGPA 4HOOA 1C8M2 2VZQA 4DUVA 1PX4A 5CG8A 1ULFA 1RVF1 4MYEA 1UYYA 2F6BA 5FOBB 2W95A 4AQSA 1PO22 3POBA 1FOD1 2P1BA 3P3PA 4ZKTB 4BLJA 3KV4A 1S2EA 1QOSA 1BQPA 4XDPA 3AP5A 4AEJA 1QIQA 2RDNA 5JMCA 1HN1A 2K9ZA 3H1MA 4LBQA 1LOGA 1GZWA 1HRV2 3W20A 1F31A 3VDDB 1PK6C 5FKCA 3WP4A 2DV9A 2CYFA 4HPKB 2WQ4A 4FPHA 2GC1A 2PELA 3O1UA 3LB9A 3BGAA 4LHSA 2ZGPA 1SBEA 4CVUA 3NV3A 3GXUA 5ISLA 2MNGA 1GSLA 1I5ZA 3VBFA 2EVXA 1R081 1W8ZA 4XF1A 1CESA 1IPJA 1PNGA 1ZZCA 2ZACA 5HCAA 5FP9A 4L8QA 4YW2A 1W8FA 4FFGA 3THDA 2VMHA 2PA7A 4XFGA 3KT7A 5F6KA 4XUOA 4FPYA 1V6JA 1OH4A 2VL4A 3ZFFB 2JDKA 5EQUA 5G05L 1PGW1 2GN3A 2DCZA 2QQMA 3QD6A 3DCQA 4XFHA 2Y38A 4Q0QA 4XFFA 3FL7A 3UV9A 3THPA 4RS5B 5A1FA 3S7EA 5K0UA 3WP3A 2XJQA 1KS5A 5GM0A 5C3OA 1R093 1SFNA 3OPZA 3JB4C 2WFF3 2W9XA 4XJWA 4LBOA 1UMIA 3UETA 4WVMA 4YG3A 1LHWA 4ASMB 3ZXDA 5FMBA 2EICA 2WJSA 5AFBA 4XFAA 4DFSA 3DKWA 4LA3A 4NPRA 4JKMA 4PIXA 3WDWA 4YZ4A 4OHZA 5JPMB 2P4EA 2XJRA 2Z42A 4JHZA 3BU7A 3D3AA 3M70A 4CU9A 2XBO1 2LM3A 1XU1A 2VOXA 5KXCA 4KG0A 3K46A 3RYPA 2YC2A 2AR6A 2YFZA 2W47A 4Y5Z0 3DEMA 1YNAA 2ZGTA 5CADA 1I9RA 1RUJ3 1SACA 3AFKA 2RJ2A 4Q4X3 3SCGA 3OGVA 3FWEA 5FP7A 2YXSA 4O9EA 4W8JA 1AX2A 3BTZA 1OI6A 4CDXC 5FXWA 2R063 3LSEA 4KGGA 1VAKA 4KG8A 2RJLA 4R4XA 3TB0A 3W9AA 1W6NA 2XWBB 3AVRA 5IWFA 1L7RA 1EYBA 1UZZA 2MPFA 2OPKA 1K5MB 3B01A 1DGWA 3HAGA 5IUQA 2OKXA 2ZCWA 1S0BA 4HK9A 3FLTA 1OQ1A 2B46X 5FY9A 3USSA 4YPJA 4GD4A 4Y4YA 2JG8B 1TNFA 2B39A 3AM2A 3PUHA 3QH7A 1RUE2 4O9GA 3SKJE 1WCUA 5FOJB 3USUB 3E6DA 1H8TC 1SDWA 1WW5A 1NT0A 1Y4WA 3B7MA 3N9QA 1BJQA 3PU3A 3I2JA 4SBVA 4XVHA 1VMJA 5F3IA 4YZ1A 2GC2A 3C7GA 3CHXA 1PO11 3AYCA 3PVBB 1DLCA 4MGSA 5EV7A 5LRSA 1SQ4A 5FP4A 1FOD3 3NWKA 1KDMA 2YBKA 3AXEA 2JG8C 4N53B 4IV1C 3H7JA 4NHLA 1S2BA 1O3TA 4M0NA 2AENA 1H9WA 1Q8VA 4I0AA 2G19A 4OHYA 1W6OA 1VBB2 1A8MA 2OVUA 3NNGA 2HWD2 5I0SA 5JOWA 3B94A 1NCRB 4LLOA 4M4RA 5AC91 1KXGA 5DUUA 3S5AA 2VJXA 5FLJA 5BNOB 1SLCA 3G6JB 2D3PA 3CJIA 5IW0A 4HL0A 5DG2A 3PTRB 1UO9A 4JRAA 2RDQA 5FPAA 4JGZB 2D5HA 4AG4A 3MDPA 1JU4A 1REDA 1VMFA 3AJYA 2OZJA 1QKQA 1RUG2 3ILRA 3N35A 5K4LA 2J7MA 3MIBA 3PIGA 3VBHB 4OFGA 5FAXA 4IDZA 1D4M1 3BALA 1ZZ7A 2CAUA 3LIHA 3J26N 2X29A 1H8TB 3ZO0B 4WZFA 5FZOA 3WUCA 4ES8A 1CAUA 1J84A 4XF0A 4LUKA 4N9IA 4PBOA 5GKAC 1N1VA 2LTNA 4DXZA 2JEMA 5ACA3 1W05A 1FNZA 3K4DA 3SMHA 2X09A 5FZ0A 5FZBA 3RZHA 3WNNA 2FZ2A 4CDUC 3LEIA 3C7FA 2R061 1QHDA 2YZ4A 2IVJA 2Z69A 4NHKA 3JZVA 1TMF3 3NAPB 3ZSLA 5JZGB 3IIIA 4TN7A 3W59A 4C1XA 2GU9A 2HEWF 4B4PA 1FT9A 2P5BA 2PHRA 2XONA 4D69A 1BMV1 1UYPA 1JYWA 2VTXA 2FDJA 1DQ0A 4QX3A 4BQ5A 3AJZA 1DZTA 1W6PA 3LF7A 1CAWB 4AR2A 4LKSA 2CGOA 2R041 1EUUA 4ZXEA 4BHPA 5IAXA 1UZWA 3I2KA 4AFAA 3FC0A 4LBJA 3RPQA 5FZ7A 1W2AX 1XNAA 2VH9A 3NO8A 4NWVA 2G1MA 4YRDA 3D4KA 3WSOA 1DYKA 3ZX7A 1AR62 4ZXKA 3I59B 1DQ6A 2GAUA 2QQOA 3AFGA 1ASJ2 5FY7A 3VD3A 2KD7A 5JR2A 2JKBA 3TN92 3OOXA 2RS31 1MZFA 3IDEA 5DDJ2 1PHMA 5IK8A 3NV1A 4OUSA 4BQYA 3FHQA 2HWF3 2V4VA 4JKLA 2MHFA 4Q0SA 3VKLA 4AXOA 1VBC2 2BYVE 3KCXA 5EP9A 5FKBA 5JXGA 2ZGUA 1RUC1 5GZCA 1V6LA 1W9SA 2AACA 4GMP1 5D8AC 4OMDA 2DYCA 2Q8DA 5DAXA 1ST8A 1W2NA 2KXLA 3LSDA 2P6CA 1WLWA 4L97A 4Y26A 3F2ZA 3OJBA 2WWUA 3WF3A 2D40A 4N43A 5J09A 1GWLA 1R083 3ZYFA 1OOPC 5FXVA 4ZPIA 1EUTA 1O7FA 3Q8CA 4GMP3 5DQ0A 1D2SA 4CEWA 3GBGA 4IGPA 4QB6A 1AYN1 1AYM3 2OUHA 3B9CA 4IE4A 3AZYA 3UJOA 2ZGQA 1HQWA 4A2UA 3B00A 1GICA 3J7MA 1IQDC 3KT4A 5D8AA 3D82A 5A3WA 5LA2A 4FOVA 2UWBA 3RMXA 3RYRA 2H6CA 3A7QA 1PGSA 5C4WA 3VBSA 2BGCA 2D3RA 4JTOA 4Q4Y1 5JSRA 3OPTA 1H6XA
chains in the Genus database with same CATH topology
4XCAA 4IW3A 4XABA 4XC9A 2RDQA 3W20A 2HBUA 4UWDA 3HQUA 5DAPA 4MHUA 2FCUA 2JIGA 2RDSA 5LASA 3MGUA 4KBZA 3EMRA 5LBBA 5M0TA 5IAVA 5DAQA 2JIJA 2FCTA 4NHXA 3KT7A 3PL0A 5EQUA 4J25A 4XCBA 5LATA 5C5UA 5LBFA 4MHRA 2Y34A 4NHKA 5LA9A 5LB6A 4Y5TA 3GZEA 2Y33A 3NNFA 4ZONA 5DAVA 3BVCA 2HBTA 4Q5OA 5ERLA 5L9RA 4NHYA 3GJAA 4XACA 5IAXA 2A1XA 4NMIA 3DKQA 2G1MA 4BQWA 2V4AA 5HV0A 3NNLA 5DAWA 2RDRA 3OBZA 4NAOA 5A3UA 3KT1A 4BQYA 5L9BA 5HV4A 3HQRA 5EP9A 3GJBA 4JZRA 3W21A 2RG4A 5DAXA 4NHMA 2FCVA 3OUIA 4XAAA 5LBCA 3OUHA 5IATA 3NNJA 3OUJA 4ZPIA 5EPAA 3ITQA 5LBEA 2OPWA 4NHLA 2G19A 4BQXA 5L9VA 3KT4A 4Y5SA 5C5TA 3NNMA 2RDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XCA A;  4IW3 A;  4XAB A;  4XC9 A;  2RDQ A;  3W20 A;  2HBU A;  4UWD A;  3HQU A;  5DAP A;  4MHU A;  2FCU A;  2JIG A;  2RDS A;  5LAS A;  3MGU A;  4KBZ A;  3EMR A;  5LBB A;  5M0T A;  5IAV A;  5DAQ A;  2JIJ A;  2FCT A;  4NHX A;  3KT7 A;  3PL0 A;  5EQU A;  4J25 A;  4XCB A;  5LAT A;  5C5U A;  5LBF A;  4MHR A;  2Y34 A;  4NHK A;  5LA9 A;  5LB6 A;  4Y5T A;  3GZE A;  2Y33 A;  3NNF A;  4ZON A;  5DAV A;  3BVC A;  2HBT A;  4Q5O A;  5ERL A;  5L9R A;  4NHY A;  3GJA A;  4XAC A;  5IAX A;  2A1X A;  4NMI A;  3DKQ A;  2G1M A;  4BQW A;  2V4A A;  5HV0 A;  3NNL A;  5DAW A;  2RDR A;  3OBZ A;  4NAO A;  5A3U A;  3KT1 A;  4BQY A;  5L9B A;  5HV4 A;  3HQR A;  5EP9 A;  3GJB A;  4JZR A;  3W21 A;  2RG4 A;  5DAX A;  4NHM A;  2FCV A;  3OUI A;  4XAA A;  5LBC A;  3OUH A;  5IAT A;  3NNJ A;  3OUJ A;  4ZPI A;  5EPA A;  3ITQ A;  5LBE A;  2OPW A;  4NHL A;  2G19 A;  4BQX A;  5L9V A;  3KT4 A;  4Y5S A;  5C5T A;  3NNM A;  2RDN A; 
#chains in the Genus database with same CATH topology
 3EJK A;  4RS5 A;  3MZH A;  4M3C F;  4IV1 B;  3VL9 A;  1AR9 1;  5FZM A;  1Z7S 3;  1OD5 A;  1S0E A;  1PZ8 A;  2RS1 1;  2OT7 A;  3POI A;  2BPA 2;  4A4A A;  4XF4 A;  5IVY A;  4GKY A;  2R04 3;  3WNL A;  3D0J A;  5EZW A;  1H6Y A;  4IEW A;  4HVQ A;  3CEW A;  5A80 A;  4D6S A;  5ACA 1;  3WW2 A;  5IT6 A;  2A6X A;  1OMI A;  2R1B A;  1LHN A;  3KSC A;  4URT A;  2ARE A;  4JGZ C;  3I3D A;  2WNO A;  4OI0 A;  1QJF A;  2LS6 A;  4CP9 A;  3BN6 A;  1YQC A;  2J1E A;  4AZZ A;  1RUI 3;  4Y20 A;  4GUL A;  3WVJ A;  1UX7 A;  2ZBJ A;  3KS7 A;  4RFR B;  4PF5 A;  3FLP A;  4XIO A;  2GMM A;  1WKY A;  2WZR 2;  3HT1 A;  3KM5 A;  4NRO A;  5I93 A;  1QJE A;  3KD4 A;  2HEV F;  4HKL A;  5KXB A;  2DDU A;  4Z1V A;  3SEE A;  4R9C A;  5J1X A;  4LBQ B;  1YFX A;  2PLV 1;  1VBA 3;  1GQH A;  4QDR A;  3VZL A;  1POQ A;  3PHM A;  3ROU A;  3NQH A;  4OZO A;  4UFK A;  4XEZ A;  4RA0 A;  5FV3 A;  4AED C;  3WQ1 A;  3ILN A;  1XNK A;  2D6P A;  2BUK A;  1YRZ A;  1F4A A;  2ZML A;  1Y9G A;  4QX1 A;  1G9B A;  1QOO A;  3BVC A;  2PXJ A;  1YQ8 A;  1PVC 3;  3ELN A;  3I2H A;  1CR7 A;  2J1T A;  4HMZ A;  1Z0H A;  2BOI A;  3L2H A;  5GLZ A;  4AFM A;  5JPN B;  3ZVX A;  3LPG A;  1VP6 A;  5C8C A;  1MR5 A;  5F5C A;  3MW3 A;  4I0W B;  3H7Y A;  3IMM A;  1OBN A;  5LEJ A;  2MEV 2;  4AVB A;  1GLH A;  2GP5 A;  3KQR A;  2NMO A;  2VZP A;  2XKO A;  3I2F A;  4FPJ A;  1HXS 1;  2VO5 A;  3GM8 A;  4OYU A;  4BLI A;  4CDX B;  3VDB A;  1WBL A;  3ON7 A;  4FCA A;  3HBZ A;  2Y6H A;  5A3U A;  4MVT A;  2P3J A;  1OPO A;  3ZYR A;  4LLF A;  1OKO A;  3UK9 A;  5FZG A;  1GFF 2;  1S4C A;  4LJH A;  1W2O A;  5FO8 B;  5CFC C;  2YFU A;  3MV0 1;  1H2K A;  5DXD A;  4COY A;  4R4Z A;  1LGN A;  4NIG A;  1LHV A;  5HV4 A;  4YW6 A;  3RZK A;  1V9U 1;  4E4S A;  1BVP 1;  3FX3 A;  1GQG A;  1YQ6 A;  2VG9 A;  3T1L A;  1CX1 A;  4QAW A;  2XXZ A;  3LDR A;  1NA1 B;  2XBO 2;  4NOT A;  3T09 A;  3AMQ A;  4RSU A;  4RQP C;  5JCT A;  5FYZ A;  5BNP A;  1PM7 A;  3NMB A;  3OUI A;  4YGE A;  5LBC A;  4CCJ A;  2VZR A;  4AI0 A;  4EYU A;  3O0W A;  3A4U A;  2IXC A;  3R05 A;  4CUB A;  3J4U H;  2VZT A;  5CFD B;  4IEO A;  3V56 A;  4D94 A;  4OZX A;  1WLT A;  4AVV A;  5DDJ 1;  1H1A A;  3Q8E A;  3WW3 A;  2Y64 A;  2HLE A;  2BTV C;  1FYU A;  2WDB A;  1GAN A;  2ZAA A;  3NAP A;  4RN5 A;  2DCK A;  1MZ6 A;  4ZZ5 A;  1RUC 3;  1V9U 2;  3IDC B;  1QJU 2;  5A32 B;  2W5F A;  1NQD A;  4GMP 0;  5E8A A;  3WT3 A;  2IWG B;  4AGR A;  5FPU A;  4CXY A;  2IZW A;  4LKF A;  1YHF A;  4HT1 T;  3A0N A;  4XJZ A;  2Y60 A;  3LA3 A;  4ONU A;  5LWB A;  4E4Z A;  1NAE A;  1QOT A;  2VBD A;  2YY1 A;  4CEW B;  5IVF A;  1OA3 A;  5FFO C;  1W8H A;  4DXS A;  2NP0 A;  1VBB 3;  4E27 A;  5CKN A;  2Y8K A;  2G9G A;  3CU7 A;  4GB3 3;  1RUO A;  1AR8 2;  4CDQ B;  5AFE A;  1G8W A;  2HWE 2;  3UKT A;  4C1W A;  1KRI A;  1LED A;  3AZW A;  4YNI A;  5CIR A;  4MGI E;  3T0B A;  3NAP C;  1SHW B;  2IC1 A;  3AYA A;  5H9S A;  2YRO A;  4LO8 A;  3POS A;  1FV3 A;  2AH2 A;  4HKW A;  4ZU4 A;  4XXP A;  4IQP A;  1ND2 B;  1YLL A;  4Y3O A;  5T54 A;  4ARX A;  5FZE A;  2XPJ A;  1W0N A;  3E6B A;  3AVS A;  5J36 A;  2HYK A;  3FZ3 A;  2XBO 3;  1HX6 A;  1NCR A;  3H8U A;  3JXS A;  4CA9 A;  1CAV A;  4XAE A;  5IVJ A;  2HWF 1;  4K21 A;  4QB1 A;  1FOD 2;  1PNF A;  1TME 2;  2XDV A;  2GAL A;  2Q5T A;  1MS4 A;  2PHF A;  3GZE A;  1X33 A;  4N53 A;  1RUD 3;  1AR8 1;  1NE4 A;  1PGW 2;  1S2K A;  4I3P A;  3ZXL A;  3U0Z A;  1H8V A;  4ZON A;  3VBU A;  1H1M A;  3I49 A;  1E57 A;  2R1D A;  1OOP B;  1KDK A;  2EF6 A;  4E8D A;  4FTE A;  1XYN A;  4E4D X;  3S5Q A;  2X8K A;  1T6G C;  1WLC A;  4R9B A;  1QWR A;  1RTV A;  3PUS A;  1RUI 1;  4UW5 A;  5FZF A;  1NLR A;  1MQT A;  1AL2 3;  1K5M A;  2WWJ A;  1CZV A;  5HV0 A;  1DZR A;  1U12 A;  2VQT A;  3ENR A;  2X5I C;  4WM8 C;  4XQ4 A;  4PDW C;  3WDU A;  3H8O A;  2DCY A;  1VJ2 A;  4FQ4 A;  1R08 2;  3FE5 A;  1AR7 1;  3ACI A;  3I97 A;  1OF3 A;  1ZA7 A;  3KT1 A;  4NPM A;  5IJR A;  4CEY C;  3V0B A;  1TMF 1;  1W8T A;  2Q0A A;  2JG9 C;  2D7F A;  3KVB A;  1UW8 A;  2XQR A;  2YPJ A;  1CON A;  4B7K A;  3GCX A;  2XML A;  3BIW E;  4N90 A;  4R8H A;  4TLG A;  5F9T A;  1HRV 1;  4K20 A;  4QQO A;  1RB8 G;  4QQH A;  1MQT B;  1NZC A;  3T08 A;  2A3W A;  1ULP A;  3THT A;  2RG4 A;  5C3Q A;  3A22 A;  2EAK A;  1R1A 1;  4YG6 A;  2UY9 A;  4LUL A;  3ZR6 A;  2BFU L;  3NJX A;  2RR1 2;  4AI2 A;  3NNJ A;  2UYA A;  2XJU A;  4HSL A;  2OS2 A;  3OTF A;  2TEP A;  1E5R A;  4WVM B;  4QDS A;  1OT5 A;  5EPA A;  5C3P A;  1US2 A;  3WNO A;  2VR4 A;  1HN0 A;  3TEX A;  3LWC A;  4XUR A;  4F3J A;  1LEM A;  5F3C A;  2P3K A;  5G04 L;  4IXL A;  2J22 A;  5FO7 B;  3RWN A;  3H8X A;  1DZQ A;  4Q27 A;  5DDJ 3;  5F6L B;  4Y20 B;  1LOF A;  3OB8 A;  3JCI A;  5FZI A;  3TWI A;  4CP9 B;  2ZGM A;  3FUQ A;  2VZS A;  3J9S A;  2N7G A;  4AEM A;  3RZZ A;  3IAQ A;  4MZU A;  2DVD A;  5ANN A;  4N9H A;  1C5I A;  4B8E A;  1HB2 A;  3LKJ A;  5GAL A;  2FQP A;  3OCP A;  4A7Z A;  1DGW X;  1F2N A;  3E97 A;  1C1L A;  1MS0 A;  2VMD A;  4C0B A;  1XYO A;  4RR3 A;  1WW4 A;  4Q0U A;  4QX0 A;  4IE5 A;  2VOV A;  3C7O A;  1X7N A;  2A75 A;  5FYY A;  3UJQ A;  2I2S A;  1LEC A;  2QJV A;  1XQN A;  3WHT A;  1U5I A;  3HD8 B;  4XHB A;  5FZ3 A;  1GZC A;  1K5J A;  2BW8 A;  3N9M A;  4MXW A;  5HCH A;  5J48 A;  4ZS2 A;  3VBS B;  2ZEX A;  2ZHM A;  4O65 A;  4P9X A;  4BE3 A;  2DU1 A;  1MS9 A;  5M0T A;  2AYH A;  1R64 A;  2FCT A;  1GZW B;  3LEK A;  4LIT A;  5LW9 A;  3WXP A;  3VD9 A;  3AK0 A;  4BIO A;  3WHU A;  5FRE A;  1ZX5 A;  5BNN C;  4RGG A;  2C9K A;  2JDN A;  5CIS A;  2ZS6 B;  1LAJ A;  2FDG A;  2ZJC A;  4LKD A;  1LTE A;  1ZBA 3;  1S0I A;  3K3O A;  2W94 A;  2YU1 A;  4XET A;  4Y5T A;  3RQ0 A;  2W39 A;  1BXH A;  1OSG A;  2CWS A;  4LIV A;  4BB3 A;  5A3P A;  1FPN 2;  3ZDS A;  5JLV A;  5KHI A;  2MEV 1;  2NMN A;  4P00 B;  3SLI A;  4Q4V 3;  4LHL A;  5C9A B;  2Z4F A;  1RUC 2;  2XLG A;  3C7E A;  4A3X A;  4YVS A;  1WMX A;  4DNY A;  3MV1 1;  2GNT A;  5T5P A;  5C33 A;  4FPL A;  4RQP A;  2XVG A;  4QM9 A;  1UU4 A;  1O8P A;  2XQX A;  4EWA A;  4EZ4 A;  3VDA A;  3MFA A;  3T2T A;  4D7Y A;  1W2T A;  5BNN A;  2ET1 A;  4QGN A;  2JG9 A;  3RMY A;  2FD8 A;  1DQ5 A;  1LU1 A;  1NA1 A;  4DS0 A;  2GDF A;  3MIH A;  2R49 A;  4Y1V A;  3X29 B;  1AR8 3;  2VQA A;  5T5L A;  4WZC A;  3AMP A;  5FY1 A;  5IK5 A;  3T0D A;  2CWM A;  3LEG A;  2JJ6 A;  4Z2A A;  3KF3 A;  1D4M 3;  1B35 B;  1WA4 A;  2CDO A;  1POV 0;  1ULD A;  2XR4 A;  1QDO A;  5CKQ A;  3ZFG A;  4D6Q A;  5BNN B;  1ND3 B;  1ENX A;  4A7Y A;  3HPN A;  3EYP A;  5AC9 2;  4KGQ A;  4BQ2 A;  1PMJ X;  1YIF A;  3WF2 A;  4K40 A;  5FZ6 A;  1ZBE 2;  2VNV A;  3A0K A;  3Q8A A;  1X8M A;  2QZ2 A;  5C9A A;  5CEH A;  2EIG A;  4E4H A;  2JB8 A;  3E5X A;  4AQT A;  1NZI A;  3W5M A;  2RS1 3;  1QJU 1;  2BWA A;  1Z7S 1;  4GJZ A;  1NUK A;  3GF6 A;  4NAM A;  1W9T A;  5C8C B;  1S0F A;  2BQP A;  2D6L X;  3OUJ A;  2VVF A;  3QCW A;  3SCH A;  4TYS A;  3S6P A;  3DGT A;  4BH9 A;  4BXF A;  5LBE A;  3O1O A;  3O1P A;  5E6H A;  5FMD A;  5BY5 A;  2JD9 A;  4UFL A;  2LRP A;  1A34 A;  1DDL A;  3J7N A;  1VRH 2;  1ALY A;  1J1T A;  1YXW A;  1ASJ 1;  1VAL A;  4ASL A;  2NQY A;  5FZ1 A;  4RL7 A;  2AEY A;  4V2W A;  1XE8 A;  4E2G A;  4YFW A;  1JBC A;  2WNV A;  5LA1 A;  3O1R A;  1G86 A;  2UY8 A;  3OYW A;  1WA6 X;  4GJY A;  2A6W A;  1Q8S A;  2GND A;  5H9P A;  4LK7 A;  5FBJ A;  4IW3 A;  3EHK A;  4XAB A;  3M1H A;  3DPR A;  2ERF A;  3HN3 A;  3N9P A;  4MOA A;  1ZBE 1;  1UU5 A;  3ACF A;  4NR1 A;  2W1S A;  5FPX A;  4UW3 A;  4YGB A;  4JGZ A;  4BA6 A;  2BER A;  1NY7 2;  5A3N A;  4Q4X 1;  2ZX4 A;  3AZZ A;  4HLT A;  5BNO A;  2PHW A;  2PYT A;  3ECQ A;  3OPW A;  3UNP A;  5LAS A;  1JXN A;  4P02 B;  3HNY M;  4FOQ A;  4XZP A;  1CAX B;  3KV6 A;  4Y33 A;  1BEV 3;  1OC1 A;  2JIJ A;  2WNV C;  2JD4 A;  2XVK A;  3GHN A;  3A21 A;  4E9K A;  4C0H A;  4CE8 A;  3JD7 1;  1IS3 A;  1PVC 1;  4IV1 A;  4AQ6 A;  4ZU7 A;  2VE1 A;  3VUO A;  5CBL A;  1ULC A;  4JGY C;  4J25 A;  4CEY B;  1XJA A;  4DUX A;  2F4L A;  1VMH A;  3OBR A;  3EO6 A;  4MET A;  5C7G A;  2UWC A;  1AZD A;  4BQ4 A;  1V00 A;  5GZE A;  1UOJ A;  5DUX A;  1PZ9 A;  1SBD A;  3LGR A;  3USU A;  1HDK A;  5E88 A;  1E5I A;  4Q8K A;  3RZL A;  1XND A;  5FZ9 A;  2RS5 2;  2F4P A;  3K77 A;  4ZZ8 A;  4Q4X 2;  3I3E A;  1ACC A;  2XJV A;  1G9C A;  4TSV A;  5DAV A;  2HBT A;  3POW A;  3AP6 A;  4W6W A;  3THC A;  1W6N B;  5FZ8 A;  2F17 A;  2G4I A;  4P9L A;  1OQD A;  3UKN A;  4AED B;  5T55 A;  4H3W A;  2WZP P;  3VKN A;  1JHN A;  1BCX A;  3G7D A;  3AP7 A;  4JX0 A;  1ZBA 1;  4R9A A;  2XUM A;  1IG3 A;  1SEF A;  2XLF A;  5KXD A;  4Z82 A;  1JZ4 A;  3VKM A;  1UD1 A;  2QBX A;  2BNM A;  3WW4 A;  1OHF A;  1XXN A;  4XPV A;  5A7O A;  4ZU5 A;  2ZX0 A;  4KWU A;  4FXK B;  1WLD A;  1OD3 A;  5IVC A;  3D5O A;  4LBQ D;  1YWK A;  5F2S A;  3KZ4 C;  4X8N A;  3PUR A;  1CJD A;  5KXE A;  1BHG A;  3BPS A;  1PM4 A;  2RM2 2;  4L11 A;  1C5H A;  4JKK A;  4IUG A;  3WZ1 A;  1ONA A;  3ZN6 B;  2QDR A;  3GJB A;  4EN6 B;  2VW0 A;  3P5B A;  3VBU B;  2Q4S A;  1RVF 2;  1PVX A;  4NUB A;  2QKD A;  2BU9 A;  1X82 A;  2Z2S B;  3DN7 A;  4TLF A;  1GNH A;  3K2O A;  2JEC A;  1H2L A;  5E1R A;  5HBA A;  2FDK A;  4I2O A;  1UY3 A;  4M01 A;  1C8N A;  1FPN 3;  3K75 B;  4I30 A;  1MVE A;  4NE9 A;  1GNY A;  1ND2 A;  2BZD A;  3D0S A;  4I01 A;  3CF6 E;  4AK3 A;  5D1I A;  4AOC A;  1BMV 2;  1DYO A;  1T6B X;  3WR0 A;  1JH5 A;  3GBF A;  4PLO A;  2JKX A;  1C1F A;  1YI7 A;  3ILF A;  4IE0 A;  4CU8 A;  3U75 A;  3ZKU A;  1XC6 A;  2MEV 3;  1O5U A;  2CL2 A;  3ZXE A;  4LBN A;  3BTA A;  3RZJ A;  1OQE A;  1RJ8 A;  3VBF B;  4BZ4 A;  2VM9 A;  2BOJ A;  1TVG A;  1QNY A;  5IHR A;  2I74 A;  1EY2 A;  1D0G A;  3ZYJ B;  1SFP A;  3I3B A;  1OLM E;  4R52 A;  5A33 B;  5C9A C;  5DG1 A;  4UWD A;  1UY1 A;  2OX0 A;  1UL9 A;  2EIB A;  2ZGN A;  4J1W A;  4XE9 A;  1UYZ A;  1UNB A;  3VD5 A;  1RXF A;  4QU1 A;  1X9T A;  3MIE A;  1NKG A;  3M3I A;  5I8S A;  3V64 A;  4FFF A;  4YGD A;  3SKV A;  4MO3 M;  4K7J A;  2P6H A;  3ZYP A;  3WDT A;  3FBM A;  3HT2 A;  1RGS A;  4EWD A;  2XL9 A;  3APB A;  2VZO A;  3MUZ 1;  4MUV A;  3MLL A;  1IS6 A;  1J3Q A;  1ZRR A;  2WO2 A;  2D6K A;  2ZTN A;  3PL0 A;  3U10 A;  4DQA A;  2ZAH A;  3GDB A;  3U14 A;  5JWP A;  5D21 A;  5FPV A;  3PLQ A;  4GAZ A;  2VQ0 A;  1AL2 1;  3IZO A;  3LPF A;  2QNK A;  3AKS A;  3MF9 A;  3FHA A;  3TBD A;  5JVV A;  4KI5 M;  1UY0 A;  3WW1 A;  3RI9 A;  2FHR A;  4W50 A;  1NCQ C;  2YGM A;  3OGR A;  3ZFE A;  1X50 A;  1VBD 2;  3NNF A;  3I2D A;  5A3T A;  2KM2 A;  3H8R A;  1NXM A;  3RRD A;  4GH4 B;  1B35 A;  2ZX2 A;  3TAY A;  1VPH A;  4KH9 A;  3C7H A;  4KU7 A;  2C6S A;  1RUD 1;  4C90 A;  1QU0 A;  3ZM8 A;  3KHB A;  2R07 3;  5FYI A;  4XAC A;  1I3H A;  4KMQ A;  1DFQ A;  5A1L A;  2E32 A;  4TTG A;  5E89 A;  4UF0 A;  3H0O A;  2JG9 B;  4WV8 A;  4XFC A;  2BVB A;  3KQ4 B;  3HMY A;  1WW7 A;  1PIV 2;  3VGI A;  1LOC A;  4KNC A;  4XUP A;  4AI3 A;  3EQE A;  4CDX A;  1OH3 A;  1R1A 3;  4Q0P A;  3WF0 A;  5FJH A;  4BOW A;  2Q8E A;  3LCP A;  2QQL A;  2WZR 1;  2HWE 1;  3CDZ B;  4H14 A;  1KD7 A;  1OVP A;  2Y6K A;  2QFE A;  3ZSK A;  2R16 A;  1IKQ A;  3H3U A;  4B1L A;  1RUG 1;  1ZZ8 A;  4AEK A;  3ORJ A;  1O59 A;  3RJR A;  1X8E A;  3U1X A;  3O1M A;  3MIG A;  4ASK A;  1ZZB A;  2WIN B;  4EN0 A;  3CQO A;  4IEP A;  4LHK A;  4MH0 E;  4Q4W 1;  5LCW L;  1AR7 3;  1C28 A;  1NG0 A;  5DAB A;  2W2I A;  5FZL A;  5FY5 A;  3UL2 A;  2B42 B;  1KFX L;  1MS8 A;  1QJX 2;  3ST7 A;  4K8F A;  2HWD 1;  4DIQ A;  3BIE A;  1C57 A;  4FOW A;  4P9Y A;  3LDK A;  2A71 A;  3OUH A;  3VHR A;  1RUD 2;  4E2S A;  1C3H A;  1W3X A;  2XH6 A;  2WFF 2;  5HPO A;  5FJK A;  2RVA A;  2EXJ A;  2GC0 A;  2RM2 1;  3S0M A;  3O14 A;  1COV 3;  5A6Y A;  1KFU L;  2ARC A;  2YC4 A;  4IEX A;  4B1M A;  3DV8 A;  2GH2 A;  1RVF 3;  2TNF A;  2VNR A;  1RL3 A;  4RYD A;  1QGL A;  4IL7 A;  3MIF A;  4GZ9 A;  2VPV A;  5C70 A;  2VUA A;  3DYP A;  5FTT C;  3LD8 A;  4CUC A;  3B93 A;  5J37 A;  2WL1 A;  1RUE 1;  3ES4 A;  3H1W A;  3GCW A;  4DOU A;  4NWW A;  4AHZ A;  1BK1 A;  2W87 A;  3T1M A;  1UMH A;  4TZD A;  1OVS A;  1YJK A;  2VMF A;  3N7L A;  1N1Y A;  1JZ5 A;  2B4K A;  1WD4 A;  2PMW B;  3SIS A;  3ZR5 A;  2JE7 A;  1O8S A;  4PHZ A;  3R0R A;  5JUV A;  2RHP A;  1TE1 B;  4FP2 A;  1AX1 A;  2A70 A;  2EXK A;  1HXS 2;  1ZYB A;  2YBS A;  3AKR A;  4LOS A;  5FY8 A;  1DGR N;  2JDH A;  3FUO A;  3HNM A;  3LA7 A;  4IER A;  3T30 A;  1R1A 2;  4YVW C;  4JQT A;  2K2S A;  2NPI A;  5IYY A;  3IT8 A;  3J8F 1;  3DL3 A;  2JWP A;  3ZXG A;  4COZ A;  3EMR A;  4H2A A;  2CNA A;  1CPN A;  5LY1 A;  3HEI A;  4V1P A;  2QQW A;  1G9D A;  4ATE A;  3B5L B;  5FQ0 B;  1K45 A;  5FY0 A;  4WVW A;  4IET A;  2R30 A;  2FZ1 A;  4P9I A;  4HKO A;  4HN1 A;  2AZ5 A;  2BJS A;  5DUV A;  1KJL A;  3RVH A;  1AR7 2;  1W39 A;  1AJK A;  4IEQ A;  3VBS C;  2ZHN A;  1R09 2;  2RMU 2;  1NX9 A;  3WLU A;  2HWB 1;  4N43 B;  4LQR A;  1JHJ A;  3PVE A;  2E26 A;  1STM A;  4A44 A;  2VC9 A;  4DMI A;  1CZS A;  3IB3 A;  1DGL A;  1J58 A;  1ZBA 2;  3WDV A;  2B45 X;  4GQ7 A;  3SH5 A;  3VZK A;  4RHV 2;  3ALQ A;  1LCL A;  3CIH A;  4PBP A;  3VBO A;  3QBQ A;  5ERL A;  2ZMK A;  2KR2 A;  3JBG 2;  3TRS B;  3V0A A;  3O5S A;  4LT5 A;  1GV9 A;  2WBK A;  4RD7 A;  2WO3 A;  2BP6 A;  2W68 A;  4FPO B;  2WQ8 A;  3I7D A;  2GMP A;  2J1S A;  2WKK A;  3IKW A;  4ITC A;  4KU8 A;  4N7I A;  5EWS A;  2RS5 3;  3FLR A;  4CCC A;  1R09 1;  5CNA A;  3MIC A;  2VW2 A;  2HH9 A;  4OI2 A;  3D6E A;  5KHG A;  2Q8C A;  3WG3 A;  1AR9 2;  1K3I A;  1TNR A;  2Z5W A;  3IPV B;  2VNO A;  2QQK A;  4P5H A;  4OQ8 A;  2A5Z A;  2BWC A;  1HJG A;  1Y9M A;  3TOJ A;  2VXJ A;  1EV1 1;  4FSJ A;  4WM7 C;  1FAT A;  4WVV A;  4CCD A;  1J3R A;  1QXP A;  1SG3 A;  3SXW A;  3ZPO A;  5GZD A;  4ERO A;  4Q4W 3;  3Q8F A;  3J7H A;  4YGC A;  3N36 A;  2QQJ A;  2C1F A;  2A3X A;  3E1F 1;  4FI9 A;  3WG1 A;  4QPG B;  1JYN A;  1ZNP A;  1SDD B;  3NW4 A;  2D97 A;  3EXU A;  2VQU A;  1EAH 2;  1OPM A;  1OLR A;  3SH3 A;  2V73 A;  3SIT A;  5FMO S;  1JU3 A;  4Y1X A;  4AYU A;  4GWN A;  5JOY A;  3ITQ A;  1YJL A;  1A8D A;  2A6Y A;  2GNB A;  2CSG A;  4P9J A;  2OPW A;  1U0A A;  5FZH A;  3C8X A;  3OGS A;  4CDQ A;  2IVI B;  2D6M A;  5KHH A;  3TNQ A;  1GOH A;  3UKV A;  4AI8 A;  1AYM 1;  1CAU B;  1W9W A;  2X53 S;  1M06 G;  4DIN B;  4MGT A;  1QJX 3;  1FMD 2;  4WBB A;  2RS3 3;  1RUE 3;  2WYS A;  4BK4 A;  3FFQ A;  4HFS A;  2PLV 3;  2WT1 A;  1FXZ A;  5FO9 B;  2XB6 C;  1SMV A;  1QY4 A;  3D8C A;  3JD7 2;  1UIJ A;  4GAL A;  4IGQ A;  4K8R B;  2BNN A;  3UGH A;  5A6Z A;  4KBB A;  1LB2 A;  5BXX A;  5DAP A;  4H55 A;  1QJX 1;  4QXK A;  1TZO A;  5KHK A;  4QPY A;  5FXX A;  4OHW A;  1OFS A;  5ANQ A;  3HN1 A;  5FYS A;  5CFC A;  3EB7 A;  2WA3 A;  3HWJ A;  4OHX A;  1UPI A;  4LNV A;  1O4Z A;  4C8D A;  5J3U A;  3N9L A;  1H9P A;  1O4Y A;  2YPD A;  3MW2 A;  4WM8 B;  3PMS A;  5GZF A;  3VZO A;  3OEB A;  1JZ3 A;  5DAQ A;  4UOJ A;  4HVR A;  3VL8 A;  4YZ3 A;  4I0B A;  2Q8O A;  4EE2 A;  3NV4 A;  1RYY A;  3ZLI A;  3OG2 A;  4DEV A;  2IFW A;  4XXA A;  2IXH A;  2EA7 A;  5F3E A;  1LOF C;  3BOD A;  4XCB A;  2DVG A;  1CIW A;  1BZW A;  3PUA A;  5FZD A;  5GLV A;  4MHR A;  2AGS A;  1RUG 3;  4JQR A;  4N53 C;  1ZZ9 A;  2W1Q A;  1SLT A;  4LEJ A;  3FFZ A;  1ENR A;  1PIV 1;  3RJ2 X;  3ZSM A;  1W6M B;  5IK7 A;  2VXR A;  1UAI A;  1GP6 A;  1BKZ A;  1VBB 1;  3H1Y A;  3KV9 A;  4XF9 A;  1Q5O A;  5A1A A;  3CZU A;  3PIJ A;  2JG8 A;  2ADE A;  2C9A A;  4EZH A;  5DMY A;  5GLU A;  1D4V B;  4ET7 A;  2CY6 A;  3GZA A;  1YUD A;  2E7T A;  4BQ1 A;  2FMD A;  1REE A;  4UBG A;  2W08 A;  4CRQ A;  5LA0 A;  2ADD A;  2P37 A;  4NMI A;  2VOK A;  1Q8P A;  2YBP A;  3AMN A;  5FYT A;  3KCY A;  3S30 A;  3U07 A;  1CGP A;  1FMD 1;  5FK8 A;  4BQW A;  5CA6 A;  3ZMO A;  2ZHK A;  3ZN5 A;  5L36 A;  1PK6 A;  1SFY A;  4CP2 A;  4YW3 A;  3ZYI B;  3WX5 A;  1WZX A;  1LRH A;  5JSO A;  1EP0 A;  3I3M A;  1GZ9 A;  3DXT A;  4QPG C;  5FYU A;  4CDW B;  3IMN A;  3KGL A;  3WIN E;  3KHC A;  4Z92 B;  1SLL A;  2D43 A;  4HXC A;  5FMC A;  4BMB A;  1EV1 3;  3MPP G;  4DO0 A;  3TEY A;  2YDE A;  4GKX A;  1KS4 A;  2R7E B;  3KV5 A;  4CXW A;  1CQ9 A;  1G7Y A;  1Q3E A;  1UOB A;  1V6I A;  3LIG A;  3ZYH A;  4IV3 C;  1ZRD A;  2AEZ A;  4B4Q A;  1FV2 A;  5H9Q A;  1IZ3 A;  4FAG A;  1RXG A;  2P3Y A;  5CZK A;  3FN9 A;  2ZZJ A;  1H4H A;  2FCV A;  3WDY A;  4C91 A;  5C71 A;  2LRO A;  1WCD J;  4LXL A;  4K6B A;  3IDB B;  4OUE A;  1RUF 3;  1QJY 2;  2GME A;  1MS1 A;  2YG0 A;  4UFI A;  4UF0 B;  1VBD 3;  4BM8 A;  2RMU 3;  5AC9 3;  1HRI 1;  5SV5 A;  1HXS 3;  5JOZ A;  2K0G A;  4TWT A;  3ZFF A;  3IAP A;  4M00 A;  1V6N A;  1FPN 1;  2ARX A;  2X10 A;  2WT2 A;  2XG3 A;  2ZEZ A;  4CDU B;  4CP1 A;  5I91 A;  4MG2 A;  1UKR A;  5I0T A;  4BQX A;  4QXB A;  1I1E A;  1RIT A;  2YC0 A;  4XUQ A;  1PX3 A;  4QXH A;  4EN7 B;  2PHD A;  4UW6 A;  2FDF A;  1RHI 1;  4Q0V A;  2VZ1 A;  2J1R A;  3M2M A;  3SHR A;  3DPR B;  1WGP A;  5FZA A;  1TEI A;  5JR7 B;  2DTW A;  2Y6G A;  4AL9 A;  4XC9 A;  4CDW C;  3AYD A;  1W9F A;  3PVN A;  1URX A;  1V9U 3;  4YM2 A;  5HI0 A;  4AI1 A;  3WNM A;  2IXJ A;  3FMG A;  3HQU A;  2EAL A;  1W28 A;  4Q29 A;  3OY8 A;  5AVA A;  3NV2 A;  3T2Q A;  1LKN A;  1EAH 1;  1SLA A;  2EID A;  5LRR A;  2RR1 3;  1H2M A;  5T50 A;  4F7Z A;  4XDQ A;  4IEU A;  3UES A;  2FCU A;  5EHD A;  2PHU A;  1V0A A;  1AX0 A;  4M3C B;  2PHX A;  2LW8 A;  5FXZ A;  1TME 1;  2UUR A;  3N3H A;  4KBZ A;  2QUO A;  5A7W A;  4QT6 A;  2HWB 2;  2WLQ A;  4Q1P A;  1FAY A;  4HSJ A;  1VR3 A;  1XPW A;  5CG9 A;  2HWC 2;  1LJ7 A;  4YYO A;  2WQZ C;  4JRL A;  1IPK A;  5A7N A;  5C8W A;  4BYY A;  4JDO A;  1D0H A;  1GWK A;  5LBF A;  5DZG A;  1RMU 3;  1LU2 A;  4YVS C;  1OLQ A;  2VCB A;  3ZSJ A;  2CGP A;  5FP8 A;  5A33 A;  3PNA A;  5D2A A;  4ZY9 A;  4AAP A;  2R6Q A;  3TEW A;  1RUN A;  1HRV 3;  5FLH A;  1T2X A;  4NII A;  1IS4 A;  2C5D A;  1O5L A;  5JIA A;  4CCO A;  1UYX A;  2UWA A;  1D4M 2;  4A3Z A;  1FMD 3;  4BXS V;  2H0V A;  4U36 A;  1J1L A;  4KL1 A;  3RGB A;  4Q4Y 3;  2NLR A;  2Y6L A;  4PDW B;  4EQV A;  2VVD A;  3ACL A;  5A3O A;  1Q43 A;  1SCS A;  4HG6 B;  3K51 A;  1PMI A;  4A45 A;  4CSW A;  3IN9 A;  1W0O A;  4UW4 A;  1HV0 A;  1A3K A;  3CKH A;  4JDM A;  2RV9 A;  1YC6 1;  3QH6 A;  4GWJ A;  3MFC A;  4W4Z A;  3DKQ A;  4MX3 A;  2CAV A;  4BU2 A;  4BK5 A;  1SPP B;  4DY5 A;  5L7O B;  2C4X A;  1BLZ A;  1NE6 A;  1YQ5 A;  3ZIW A;  4P08 A;  5C6C A;  3VBF C;  1ZRF A;  4MGQ A;  3WG4 A;  4BME A;  2JIC A;  4O7X A;  5LY2 A;  2D6N A;  3GAL A;  5AVP A;  2WUH A;  3FHI B;  4N8M A;  3VKF C;  4D7S A;  4DXT A;  3MW4 A;  2VVE A;  2WFF 1;  1LOE A;  3POG A;  2WLP A;  4QD2 A;  3LAG A;  3ZN6 A;  4ES9 A;  1QXR A;  2ARB A;  2BBA A;  2C26 A;  2ZOE B;  1W6Q A;  3O1T A;  1WBF A;  1HB4 A;  2VMG A;  3QLQ A;  4LO5 B;  3IWZ A;  2E7A A;  4CDW A;  4BCU A;  3VZJ A;  3P6B A;  4XMA A;  1DCS A;  3AKP A;  4XF3 A;  5F5A A;  3AP4 A;  1S0J A;  2ZA9 A;  3FBY A;  4LPL A;  4AFB A;  4I3G A;  3H3Z A;  4AVS A;  1W04 A;  3WCR A;  3M4F A;  4G4F A;  5KWR A;  1S0G A;  2J1A A;  4XBQ A;  2DBI A;  5FZO B;  3VBU C;  3UYJ A;  4XJA A;  4A6S A;  1V70 A;  1UKG A;  4BJ0 A;  1RHI 2;  4SLI A;  1LGC A;  2D44 A;  4COU A;  1REF A;  5F7U A;  1J3P A;  2RE9 A;  3POJ A;  2D98 A;  2RR1 1;  5L73 A;  4XIK A;  3MLJ A;  3ZKY A;  2ZHL A;  1H0B A;  2DVA A;  5FYB A;  4CEW C;  3MBW A;  4NID A;  3NST A;  4RR3 B;  3NNM A;  4FPK A;  3MLK A;  1JZ8 A;  1AVB A;  1NCQ B;  1W8N A;  4GWI A;  2KA3 A;  4S2G A;  4QHB A;  5B2G B;  1W6M A;  1R1Z A;  2WSU A;  3AL5 A;  3CJI B;  2BV4 A;  2WNE A;  3JB8 A;  4FPC A;  4Q4V 1;  5CYY A;  1DU3 D;  1ODN A;  4K1Y A;  3ZXJ A;  1QJY 1;  2YHJ A;  1AXK A;  1VB2 A;  1JMU B;  1MAC A;  2VEC A;  5C3S A;  5F5Q A;  2C24 A;  4CEY A;  2HEY F;  4URA A;  3OEA A;  3O1V A;  1U5X A;  1TMF 2;  3ZXA C;  1JUI A;  1LR5 A;  4FP3 A;  2V72 A;  1IG0 A;  1W3V A;  2I07 B;  4JDN A;  4QX7 A;  2E31 A;  2ETE A;  3B3Q E;  3PJY A;  4IE7 A;  1JTZ X;  1Z78 A;  5FYH A;  1XSQ A;  3J7L A;  4DUW A;  1SLB A;  2VMC A;  3VKO A;  4NJ4 A;  1CJP A;  3KWV A;  1GYK A;  3TEZ A;  1X9P A;  1NCQ A;  1L7L A;  4OQ9 A;  3AZX A;  2VD7 A;  4BIF A;  3AMM A;  2IFR A;  3AXD A;  2K46 A;  5LA9 A;  1COV 2;  5EYY A;  1DF0 A;  4JC1 A;  4XUN A;  1V6K A;  5JIU A;  1XNC A;  1WMD A;  3I3Q A;  3OYW B;  1MEC 3;  2H0B A;  3ZPY A;  3NJV A;  1JN2 P;  1S1A A;  3DYO A;  4NRQ A;  1AXZ A;  5K0U C;  3VDD C;  4FT8 A;  5L7O C;  2O1Q A;  2E9Q A;  2JDA A;  2X5I B;  3I2I A;  1QQP 3;  2WRA A;  2WYF A;  3LQC A;  3VBR A;  4XFB A;  2WS9 2;  1AR6 3;  1CX4 A;  1RUH 2;  3Q8B A;  4YSF A;  1HRI 3;  4Z8B A;  2Z79 A;  3MPB A;  2G9F A;  1AXY A;  3RYK A;  5HXM A;  5FYM A;  3BB6 A;  1ZA4 A;  2HWC 1;  3GHM A;  4CYD A;  1RMU 1;  4M3C E;  1MEC 2;  4RFT 0;  1BBT 2;  3CNA A;  4FTS A;  4D6R A;  5F8P A;  3HR9 A;  2VW1 A;  5EYX A;  3RI8 A;  4DY3 A;  1MQT C;  3M7A A;  3RSJ A;  1UCX A;  1TG7 A;  2PTM A;  4X6Q B;  4UAP A;  5IVE A;  1QJY 3;  2BBV A;  1AL2 2;  1XB9 A;  1LNS A;  2G9Z A;  2ET7 A;  1C8M 1;  2JE8 A;  4LA2 A;  3T2O A;  5FR3 A;  1JYX A;  3T3Y A;  4AQ2 A;  3K4Z A;  2GNM A;  2Y6F A;  4OI4 A;  1AYN 3;  2WC2 A;  1DBN A;  4QHO A;  1LHU A;  1HW5 A;  4RGA A;  3ZDV A;  1ND3 A;  2HYX A;  3W21 A;  1JZ2 A;  3ZFG B;  2BVV A;  3M3O A;  2VUD A;  3BPZ A;  1RUF 1;  3VHO A;  1UXZ A;  2HJI A;  4OI1 A;  1W99 A;  4FVV A;  5ACA 2;  2QQP A;  4XAA A;  2YB7 A;  5JAX A;  3B69 A;  5J96 B;  2Q1Z B;  5BNQ A;  3L9J T;  1LUL A;  2LAL A;  5IAT A;  1VBC 1;  4A41 A;  2ZAB A;  1LEN A;  4LTA A;  2EXH A;  1CVN A;  1HKD A;  2VCM A;  1H4G A;  4FQZ A;  4NPL A;  4XBL A;  5SV8 A;  3V0A B;  3ZFE C;  4AVA A;  1OA2 A;  1ZRC A;  2VZV A;  5F37 A;  4Y1U A;  1HB1 A;  2BDR A;  4YVS B;  2QDN A;  2GH8 A;  1SLI A;  1YI9 A;  1IHM A;  3WQ7 A;  4PIY A;  4XHX A;  4AAX A;  2DFC A;  3HIF A;  3N9O A;  3NKT A;  5FYC A;  5LZ6 A;  1WWY A;  4NN0 A;  1WME A;  3I54 A;  1ZBE 3;  5BYN A;  4IV3 A;  1O3Q A;  1LOD A;  3AC0 A;  5K9Y A;  1ENQ A;  1VBE 2;  2ILM A;  1RUH 3;  3VZM A;  2DFB A;  1ZRE A;  1Y9Q A;  3MO4 A;  4LOR A;  3DEC A;  1GBG A;  4K3U A;  4B3N A;  3VD4 A;  3C3V A;  1H1I A;  4HET A;  4YW1 A;  2RM2 3;  2LUW A;  1BVV A;  4MHU A;  4M3C A;  2OZ6 A;  4YZ5 A;  4JTN A;  5K7P A;  3MYX A;  2QQU A;  1KIT A;  4H7L A;  5FWJ A;  1BEV 1;  2SLI A;  4Q8L A;  1NYW A;  4Y1Y A;  1N1T A;  1W2U A;  1ZRI A;  1XNB A;  2DVF A;  4LE3 A;  1OF4 A;  2E33 A;  5IAV A;  4QGL A;  1O4T A;  2RS1 2;  2PAK A;  4MXW B;  4QKF A;  4RGK A;  5LK5 A;  4PIZ A;  3OSD A;  5FY4 A;  4HAN A;  2DVB A;  4KWJ A;  1VRB A;  1EPW A;  1VAV A;  1W90 A;  3LA2 A;  4XMI A;  1OUX A;  1GOG A;  2YU2 A;  1WD3 A;  4BWO A;  5GJ6 A;  5KR7 A;  1SBF A;  3U4X A;  5B4X A;  5LB6 A;  2YGL A;  4Y22 A;  2D3S A;  2V5D A;  2ZX1 A;  5IVV A;  1KEX A;  2WAB A;  4XZU G;  4CDU A;  3P1I A;  2UU8 A;  1Q56 A;  2Y33 A;  3DXU A;  2A3Y A;  5ABJ C;  5T5O A;  4MGY E;  4XJ8 A;  3K4A A;  3O1S A;  2W1U A;  1XE7 A;  5JZG C;  3Q9O A;  1P8J A;  4UI9 L;  3VZN A;  5FPL A;  1I5P A;  3BYW A;  3GBW A;  1N3Q A;  2IXK A;  2W92 A;  4W6X A;  2W91 A;  1GKB A;  4QPW A;  2A1X A;  2WZE A;  3CJX A;  1OLM A;  3AB0 A;  3CZJ A;  3WEZ A;  2B9U A;  4L92 A;  1N47 A;  4OUL A;  1UPS A;  3HBK A;  4I09 A;  4WM7 A;  3TYJ A;  2VNG A;  4L0P A;  3M3C A;  4A6O A;  1F5J A;  4OVE A;  1S55 A;  4V2V A;  1V6M A;  5GLT A;  3U4S A;  3VB9 A;  3B9I A;  4F8A A;  4M4P A;  5EJ3 A;  1DHK B;  2E63 A;  3HVD A;  2B7Y A;  1Y3T A;  5IK4 A;  1B09 A;  2J1U A;  2V5Y A;  1WUV A;  3C2U A;  4EJR A;  3HQX A;  1PO1 2;  1E5H A;  1HRI 2;  3PDQ A;  2ZGL A;  1K42 A;  2JDZ A;  4MGK E;  3HQR A;  4CUG A;  2X5I A;  3OF1 A;  1PK6 B;  3VBR B;  4JZR A;  5T3N A;  5B4N A;  3H50 A;  1YCI A;  5T5J A;  3B02 A;  1Q8O A;  2JB4 A;  1XE0 A;  3KF5 A;  4YZ2 A;  1B35 C;  1VBC 3;  2P2K A;  2SBA A;  3U11 A;  1MVQ A;  2XJP A;  4NHM A;  4LBM A;  4UT5 A;  2ZPX A;  3VBO C;  2L9L A;  5H9R A;  4A7K A;  2C0Z A;  1PMH X;  3JBG 1;  3NVC A;  4O61 A;  2IUW A;  4CCL A;  3WD5 A;  5A6X A;  2JE9 A;  4HN0 A;  4QU2 A;  1ND2 C;  2E6V A;  1YFY A;  5BV6 A;  3IIA A;  2B5H A;  4XJ9 A;  2JDY A;  3RZM A;  2TBV A;  2H6B A;  3H42 B;  1DYP A;  1DIW A;  2WII B;  4GH4 A;  3KVA A;  1GQP A;  5L9V A;  3SC7 X;  4CP0 A;  2WAA A;  3ZFE B;  3E6C C;  4D3W A;  5FUI A;  1RHI 3;  2EIE A;  1IGO A;  1VRH 1;  2QTW B;  4QPI A;  4XIL A;  5EIY B;  4YW5 A;  3RFR A;  2UYB A;  3ZOI A;  3GGL A;  4XCA A;  1DQ2 A;  4LO4 B;  1XU2 A;  3RG0 A;  1GOF A;  4QKD A;  5FZ4 A;  2ZGS A;  1JOP A;  1CAV B;  1UY2 A;  3PJQ A;  5C4W B;  3CBN A;  5D8A B;  2OA2 A;  3MEP A;  4WM8 A;  1BBT 3;  4NRM A;  2NM1 A;  1Z7S 2;  4WVZ A;  1GU3 A;  2JXA A;  2ARA A;  4LO7 A;  2NYY A;  2DUO A;  4HVO A;  1W9Y A;  2QQI A;  4H7M A;  2JDM A;  3MGU A;  3T2P A;  1UZY A;  1COV 1;  1O91 A;  4Z07 A;  4IEV A;  2PLV 2;  2ZGO A;  3AKQ A;  4OLL A;  1IQA A;  4GIQ A;  1PO1 3;  4NHX A;  2A73 B;  5KC5 A;  3BTX A;  4FTB A;  1U5Y A;  3KCC A;  2XKP A;  4EWE A;  1VBE 1;  4G9S B;  2HWB 3;  4FOY A;  4CDQ C;  1HQL A;  2JEN A;  5JMO A;  2W3J A;  1OUR A;  5FZK A;  1QDC A;  2ZGR A;  2ES3 A;  4UFH A;  1POV 1;  3TN9 3;  4G3Y C;  4XJU A;  3I2O A;  1F4H A;  2VMI A;  2OII A;  1BBT 1;  4QX2 A;  1QMJ A;  2WO1 A;  1GR3 A;  2OQ7 A;  1AJO A;  2PFW A;  3GZU C;  5A32 A;  3VD7 A;  2QE3 A;  1UZ0 A;  4COV A;  4JVA A;  1AR9 3;  1J83 A;  2GN7 A;  3J8F 3;  5DPN A;  2V09 A;  5FYV A;  3NJY A;  1GZT A;  4QWN A;  4CZS A;  3H3L A;  1VLN A;  4HZF A;  4ISR A;  4E8C A;  3CL1 A;  2JDP A;  4JCK A;  4P5Y A;  2XHK A;  3K48 A;  1WCS A;  2CU5 A;  3GJA A;  3JU9 A;  2YYO A;  1VBE 3;  4JV4 A;  5CFD A;  3I2G A;  5LK7 B;  1ENS A;  4CPB A;  4JAA A;  1QH7 A;  3VHN A;  5K8S A;  1CIY A;  2W52 A;  2J1V A;  5EJ1 B;  4MAD A;  3HOB A;  4D8M A;  2DTY A;  3AL6 A;  1N1S A;  2V4A A;  2ZMN A;  1JS9 A;  1ZM1 A;  1PO2 1;  4L9B A;  4KWK A;  5I8Y A;  4RR3 C;  1SPP A;  3POY A;  5IFP A;  1OUS A;  1AYM 2;  5HCB A;  3OBZ A;  5F1R A;  3M3E A;  1UX6 A;  1L3J A;  2E51 A;  3URF A;  2ORZ A;  2EXI A;  1FX5 A;  3LFM A;  4X8P A;  1V6O A;  1XBF A;  5IFT A;  1DQ1 A;  4XOG A;  3MF6 A;  3VV1 A;  3EBR A;  1N3O A;  4LHN A;  1CN1 A;  1LOA A;  3FJS A;  4UFM A;  1O3R A;  2ZKL A;  1BYH A;  3O12 A;  4UFJ A;  3BKZ A;  4DZG A;  5JZG A;  2CDP A;  5CFD C;  1RMU 2;  1HLC A;  1LES A;  2ID4 A;  5ABJ B;  4QKB A;  4LBL A;  3R4D B;  2WS9 3;  3ETP A;  4XW3 A;  3WQB A;  3NKG A;  1YEW A;  5I0U A;  1QF3 A;  4PJY A;  5CVR A;  4YFZ A;  2VZ3 A;  2BEO A;  3N4M A;  1UU6 A;  1NCR C;  2NZ9 A;  4NVP A;  2WR9 A;  3IBM A;  4X6R B;  1HB3 A;  1EV1 2;  1GMM A;  5FUN A;  5A3L A;  3AKT A;  4YM3 A;  3LOI A;  2VOW A;  1A78 A;  5FPB A;  1C4R A;  1CD3 G;  1H8T A;  1MZE A;  1ULG A;  1UN1 A;  1QJU 3;  4AED A;  4LIU A;  1VIW B;  3ME2 A;  5GLW A;  4I02 A;  4XUT A;  4DEQ A;  2WNU C;  3VBH A;  3PUQ A;  2WAO A;  5JXJ A;  4N43 C;  4Y24 A;  3J8F 2;  2WZR 3;  5I8T A;  1XSR A;  2DWR A;  3WF1 A;  1UWW A;  1AYN 2;  1ND3 C;  2VY0 A;  4CU6 A;  2XHN A;  4FO9 A;  4GA9 A;  3WCS A;  2VTF A;  3OY8 B;  3KMH A;  3WUD A;  2HBU A;  3OBA A;  4FFI A;  4CTE A;  4YG0 A;  1BK0 A;  1KQR A;  3OGJ A;  1K5M C;  5FMO L;  2R0H A;  3ZFG C;  2RS5 1;  3PVO A;  2FBE A;  3UT0 A;  1PZ7 A;  3AX4 A;  1IOA A;  4XFI A;  4AWD A;  4E2Q A;  1UY4 A;  1AHS A;  1RJ7 A;  1CAX A;  4YM1 A;  1S0D A;  1US3 A;  2YV8 A;  5CU1 A;  3VBH C;  3WY6 A;  4EN9 B;  1ULE A;  2VCC A;  2VUC A;  4Q26 A;  2BNO A;  4QMA A;  2ZKN A;  1PVC 2;  4COW A;  5LAT A;  2RS3 2;  5C5U A;  2WS9 1;  1POV 3;  4K9S A;  3TN9 1;  2VGD A;  3NRU A;  3INA A;  2JDU A;  1H30 A;  5DUW A;  2Y34 A;  1WCK A;  3I8T A;  4BIS A;  2BFU S;  4CCE A;  5FBZ A;  1O6U A;  1KGY A;  5JOX A;  4YM0 A;  2PAM A;  4QQL A;  3WP6 A;  3ZIX A;  5FDB A;  1IS5 A;  3CO2 A;  3KGZ A;  4JGY A;  3RWK X;  4HBN A;  1NY7 1;  4TXW A;  3WNX A;  4QX5 A;  3I4I A;  1TME 3;  2WA4 A;  3PU8 A;  4J6G A;  4NO4 A;  4XYX A;  5A7Q A;  4AE2 A;  2P34 A;  5APA A;  2W1W A;  2DF7 A;  4YW4 A;  4PLM A;  2AC1 A;  4MSV A;  5FUP A;  3AP9 A;  4CCK A;  1F5F A;  3GZT B;  4M0H A;  5KHJ A;  4NHY A;  3BI3 A;  4IE6 A;  5EXO A;  3ZXK A;  1PO2 3;  4PI0 A;  3NL1 A;  4PLN A;  2VOT A;  4RHV 3;  4S2D A;  2ZX3 A;  4IND A;  1QQP 2;  2W0X A;  4N7U A;  5F3G A;  1HIX A;  3OD4 A;  1RUJ 2;  1NOV A;  1VBA 2;  2WO7 A;  4U2A A;  4UYB A;  5DN2 A;  4BDV B;  4QQP A;  1O3S A;  3ZXF A;  2XOM A;  1N3P A;  2XL7 A;  1W8U A;  2DUR A;  2WFP A;  3O0V A;  4IEZ A;  4ARY A;  2PHT A;  2PHL A;  3JQW A;  1L7Q A;  2W46 A;  3AYE A;  4WM7 B;  3ZMN A;  3MID A;  1X36 A;  2QQN A;  1NA1 C;  3HNB M;  4GB3 2;  4P9G A;  4QQ2 A;  5L9B A;  1WMF A;  3VLB B;  3WOG A;  2VBP A;  3A23 A;  4JGY B;  3WV6 A;  1W8W A;  4QPI C;  3M8L A;  2QVS B;  4QDQ A;  1JYI A;  1LHO A;  2X05 A;  3SH4 A;  2YUE A;  4MXV A;  5TSW A;  5L7O A;  1EAH 3;  3OBT A;  4DXR A;  1TQ5 A;  1VBD 1;  3CMG A;  5HCF A;  4F83 A;  2ORX A;  4PCR A;  1OA4 A;  1PGL 1;  2Y6J A;  4Y4R A;  4FXG B;  5BPX A;  2B9V A;  4MGZ E;  4GH4 C;  2XJT A;  2GP3 A;  4Y22 B;  4CCN A;  2PAE A;  4Q4W 2;  2OUJ A;  1RIR A;  1W06 A;  5F2W A;  1C8M 3;  1APN A;  2P17 A;  2Y0I A;  3I59 A;  3N9N A;  3VHP A;  3WNK A;  1GP5 A;  2J42 A;  3ZYB A;  2OYZ A;  2DCT A;  2P3I A;  4CUA A;  2DCJ A;  1A6C A;  4RQP B;  5CB7 A;  5F39 A;  1CAW A;  2WN2 A;  1RC6 A;  1W6P B;  4FPG A;  4FBF A;  1GWM A;  2ATF A;  4CXX A;  3ATG A;  2D93 A;  4Y5S A;  4HPK A;  4OHV A;  1JI6 A;  2PN5 A;  2D6O X;  2VME A;  1G9A A;  1ZVF A;  1UF2 C;  2ENR A;  2I45 A;  3ASI A;  4YW7 A;  4GXL A;  3T0A A;  5CFC B;  4OMC A;  2CTV A;  3WG2 A;  3MHZ A;  3ABZ A;  4LK6 A;  2HWE 3;  1H2N A;  4LMF A;  1YFU A;  2BGO A;  1AL0 G;  4PQ9 A;  4AGV A;  5IVB A;  1JW6 A;  2XVL A;  1SCR A;  3PUI A;  5A7W B;  4ZS3 A;  4FAH A;  3JD7 3;  1RUF 2;  2ZEW A;  1ASJ 3;  4K1Z A;  1IKP A;  4IV3 B;  5CKM A;  3UGF A;  1YQ2 A;  2BRT A;  1XOY A;  3L2Y A;  3H9A A;  4AHY A;  1W8O A;  4QM8 A;  1UMZ A;  1MS5 A;  4DRV A;  2DU0 A;  4YWA A;  4B29 A;  2WWS A;  4Q1R A;  2XLA A;  3ACG A;  3V65 A;  2AUY A;  1XNT A;  1AUY A;  3HJR A;  3LE0 A;  4IEY A;  4LR4 A;  1UZV A;  2IXL A;  5DZF A;  5A7S A;  3QOP A;  5J7M A;  3W58 A;  5KBF A;  2DBN A;  3W5N A;  3WQ0 A;  3U78 A;  3GNE A;  2JX9 A;  5ABJ A;  2VU9 A;  1WCQ A;  5FWE A;  1QJZ A;  1DGR A;  1GP4 A;  2FDH A;  2GC3 A;  2A6V A;  1YO8 A;  4MLO A;  2A6Z A;  4P9W A;  1AF9 A;  4AI9 A;  4Z2W A;  1GUI A;  2VUL A;  3AMH A;  3CLP A;  1Y7B A;  1DG6 A;  4XBN A;  4AVT A;  4FPF A;  4KQ7 A;  4XTM A;  1UOF A;  5FRA A;  4LO6 B;  2A7A A;  3SNM A;  4Y1Z A;  1Y43 B;  4EV0 A;  4BQ3 A;  1D7P M;  4PF1 A;  1YIP A;  3ZN4 A;  4HK8 A;  4W6Y A;  3BUC A;  4Q5O A;  1JOJ A;  1W6O B;  5F32 A;  2VZU A;  5BNP C;  4LBK A;  1W0P A;  3MUY 1;  3LDB A;  2ZXQ A;  4B7E A;  2OQ6 A;  1SZB A;  1BEV 2;  3IPV A;  1F9K A;  2CHH A;  1OKQ A;  1WW6 A;  1JYV A;  4LE4 A;  5FK7 A;  2O14 A;  3PME A;  4Q4Y 2;  3P3N A;  3UGG A;  4HON A;  1QH6 A;  3JBG 3;  2DUQ A;  4CU7 A;  1ODM A;  2RJK A;  3O0X A;  5DAW A;  1QXJ A;  2RDR A;  3BOW A;  5FLI A;  5BNO C;  1JYT A;  2XUE A;  4XQW A;  3WNP A;  1LOB A;  3E5U A;  1Q8Q A;  4QXC A;  4MV2 A;  1CPM A;  4UBH A;  1JZ7 A;  5JDB A;  2R04 2;  5J98 B;  4OCT A;  3VDC A;  3ZSE A;  1U5Z A;  2FDI A;  2O8O A;  2YMZ A;  4ORF A;  1MPX A;  3AZV A;  4OUM A;  4NIH A;  3VBO B;  1JZ6 A;  2OW4 A;  4KWL A;  2VCA A;  4LUM A;  1YYN A;  4AVC A;  3S7I A;  3V0B B;  4RS5 C;  2PQQ A;  1HJF A;  3VN4 A;  3WDX A;  3N7K A;  4XTP A;  1M4W A;  4QB2 A;  5LEK A;  1MZ5 A;  3QAC A;  5HXV A;  3VBR C;  1RUH 1;  2EAA A;  2WNU B;  4JHT A;  3JUU A;  4AW7 A;  4BPZ A;  4YAR A;  1CWP A;  1W03 A;  3ZFF C;  4FPE A;  5FP3 A;  3IDA A;  4GB3 1;  1EPZ A;  4EN8 B;  2O0O A;  4FFH A;  3F95 A;  2E53 A;  2ZZQ A;  4LKE A;  1DP0 A;  4Q2F A;  4A42 A;  1YFW A;  5FQ0 A;  2GSY A;  1OOP A;  3KLS A;  1S0C A;  3M3Q A;  4XQD A;  3T4H B;  1VB4 A;  4AHX A;  3BCW A;  4QHZ A;  5C5T A;  1JOD A;  3S57 A;  2R07 1;  3MI8 A;  3LFI A;  1K12 A;  3NJZ A;  4YLZ A;  4D7T A;  4AFD A;  5K0U B;  4PI2 A;  4DB5 A;  2VUJ A;  4DPN A;  2VBB A;  2B8M A;  1JUH A;  3R6S A;  1ZZ6 A;  4QPI B;  1XRU A;  1NXD 1;  2NN8 A;  2OXB A;  4QGM A;  2WZ8 A;  2CGN A;  4RHV 1;  5FZC A;  3RS6 A;  1J59 A;  1F8V A;  3E5Q A;  3N7J A;  4AHW A;  2VTX J;  2ZGK A;  1VAM A;  4PQQ A;  5EFU A;  5E16 A;  1F35 A;  2VAU A;  3DPR C;  3LEM A;  2JIG A;  2RDS A;  2ZEY A;  1QEX A;  2WT0 A;  3CJI C;  1RIN A;  3POF A;  2PQS A;  5LBB A;  3SCF A;  4B4R A;  1MEC 1;  4L99 A;  1QNW A;  3LZZ A;  2R06 2;  1HQN A;  3RNS A;  1MS3 A;  2Q30 A;  2R0F A;  5C3R A;  2WNU A;  4P14 A;  3DYM A;  5FCC A;  3RDI A;  5A3M A;  5JSP A;  3IM0 A;  3WF4 A;  2FMY A;  1JOB A;  1D2Q A;  1OXC A;  2XWJ B;  3POE A;  5F5I A;  1NLS A;  1FI2 A;  2WNV B;  3SEP A;  1HV1 A;  1GNZ A;  4R9D A;  1JYC A;  4S2H A;  3VDD A;  4AFC A;  3TNP B;  2QCS B;  1UOG A;  1VBA 1;  4AGG A;  2IXI A;  1PIV 3;  2Q1F A;  4W65 A;  4IGO A;  2XGX A;  4ATF A;  1AR6 1;  1LGB A;  4ISQ A;  2Y0O A;  4AF9 A;  4NIA A;  3PTY A;  2WN3 A;  1QQP 1;  5JXH A;  4S2F A;  5FIX A;  1CZT A;  1UQX A;  3OGG A;  5GZG A;  4IES A;  2R32 A;  5BUV A;  1W6Q B;  4ZHN A;  1UXX X;  2WSV A;  5L9R A;  3BTY A;  5FPZ A;  2O8Q A;  3GYD A;  4GWM A;  3R4S A;  5I0R A;  3JQX A;  3ES1 A;  2D5F A;  2QZ3 A;  4QPG A;  1NLQ A;  2HWC 3;  1PGL 2;  1NQJ A;  2R07 2;  5JXI A;  2HWF 2;  3NNL A;  5JI9 A;  3U37 A;  5BNP B;  3LOB A;  1UIK A;  2RMU 1;  4PT6 A;  1E5S A;  1KJR A;  4NAO A;  5DZE A;  3DUI A;  4J1X A;  4Q4V 2;  1FNY A;  5CAZ A;  2Q1M A;  1IPS A;  2QQV A;  3K3N A;  3N7M A;  4YVW A;  1DLL A;  2TUN A;  4QX8 A;  3T4V A;  1ULO A;  3DF0 A;  3ZYG A;  5I0D A;  2XJS A;  1I6X A;  4PDW A;  5C4W C;  4UXA A;  3ACH A;  1OFN A;  2Y26 A;  4L2N A;  3WP5 A;  5C8C C;  1DQ4 A;  1G6N A;  2CV6 A;  4YVW B;  1XYP A;  1RUJ 1;  4NRP A;  1VRH 3;  4DRR A;  1RUI 2;  1F15 A;  3BOP A;  5JI7 A;  2GZW A;  2E7Q A;  4XDO A;  3O7O A;  3BU0 A;  2HWD 3;  4QKN A;  2HKX A;  5T52 A;  5KC6 A;  5A7P A;  5A70 A;  1VE0 A;  4D0Q A;  3ETQ A;  5A6Q A;  3RZG A;  3KB5 A;  1G9F A;  3OD0 A;  4CPB D;  2DUP A;  4CCM A;  4LOT A;  3R4U A;  3SQO A;  5EJZ B;  5L19 A;  2BGP A;  4HOO A;  1C8M 2;  2VZQ A;  4DUV A;  1PX4 A;  5CG8 A;  1ULF A;  1RVF 1;  4MYE A;  1UYY A;  2F6B A;  5FOB B;  2W95 A;  4AQS A;  1PO2 2;  3POB A;  1FOD 1;  2P1B A;  3P3P A;  4ZKT B;  4BLJ A;  3KV4 A;  1S2E A;  1QOS A;  1BQP A;  4XDP A;  3AP5 A;  4AEJ A;  1QIQ A;  2RDN A;  5JMC A;  1HN1 A;  2K9Z A;  3H1M A;  4LBQ A;  1LOG A;  1GZW A;  1HRV 2;  3W20 A;  1F31 A;  3VDD B;  1PK6 C;  5FKC A;  3WP4 A;  2DV9 A;  2CYF A;  4HPK B;  2WQ4 A;  4FPH A;  2GC1 A;  2PEL A;  3O1U A;  3LB9 A;  3BGA A;  4LHS A;  2ZGP A;  1SBE A;  4CVU A;  3NV3 A;  3GXU A;  5ISL A;  2MNG A;  1GSL A;  1I5Z A;  3VBF A;  2EVX A;  1R08 1;  1W8Z A;  4XF1 A;  1CES A;  1IPJ A;  1PNG A;  1ZZC A;  2ZAC A;  5HCA A;  5FP9 A;  4L8Q A;  4YW2 A;  1W8F A;  4FFG A;  3THD A;  2VMH A;  2PA7 A;  4XFG A;  3KT7 A;  5F6K A;  4XUO A;  4FPY A;  1V6J A;  1OH4 A;  2VL4 A;  3ZFF B;  2JDK A;  5EQU A;  5G05 L;  1PGW 1;  2GN3 A;  2DCZ A;  2QQM A;  3QD6 A;  3DCQ A;  4XFH A;  2Y38 A;  4Q0Q A;  4XFF A;  3FL7 A;  3UV9 A;  3THP A;  4RS5 B;  5A1F A;  3S7E A;  5K0U A;  3WP3 A;  2XJQ A;  1KS5 A;  5GM0 A;  5C3O A;  1R09 3;  1SFN A;  3OPZ A;  3JB4 C;  2WFF 3;  2W9X A;  4XJW A;  4LBO A;  1UMI A;  3UET A;  4WVM A;  4YG3 A;  1LHW A;  4ASM B;  3ZXD A;  5FMB A;  2EIC A;  2WJS A;  5AFB A;  4XFA A;  4DFS A;  3DKW A;  4LA3 A;  4NPR A;  4JKM A;  4PIX A;  3WDW A;  4YZ4 A;  4OHZ A;  5JPM B;  2P4E A;  2XJR A;  2Z42 A;  4JHZ A;  3BU7 A;  3D3A A;  3M70 A;  4CU9 A;  2XBO 1;  2LM3 A;  1XU1 A;  2VOX A;  5KXC A;  4KG0 A;  3K46 A;  3RYP A;  2YC2 A;  2AR6 A;  2YFZ A;  2W47 A;  4Y5Z 0;  3DEM A;  1YNA A;  2ZGT A;  5CAD A;  1I9R A;  1RUJ 3;  1SAC A;  3AFK A;  2RJ2 A;  4Q4X 3;  3SCG A;  3OGV A;  3FWE A;  5FP7 A;  2YXS A;  4O9E A;  4W8J A;  1AX2 A;  3BTZ A;  1OI6 A;  4CDX C;  5FXW A;  2R06 3;  3LSE A;  4KGG A;  1VAK A;  4KG8 A;  2RJL A;  4R4X A;  3TB0 A;  3W9A A;  1W6N A;  2XWB B;  3AVR A;  5IWF A;  1L7R A;  1EYB A;  1UZZ A;  2MPF A;  2OPK A;  1K5M B;  3B01 A;  1DGW A;  3HAG A;  5IUQ A;  2OKX A;  2ZCW A;  1S0B A;  4HK9 A;  3FLT A;  1OQ1 A;  2B46 X;  5FY9 A;  3USS A;  4YPJ A;  4GD4 A;  4Y4Y A;  2JG8 B;  1TNF A;  2B39 A;  3AM2 A;  3PUH A;  3QH7 A;  1RUE 2;  4O9G A;  3SKJ E;  1WCU A;  5FOJ B;  3USU B;  3E6D A;  1H8T C;  1SDW A;  1WW5 A;  1NT0 A;  1Y4W A;  3B7M A;  3N9Q A;  1BJQ A;  3PU3 A;  3I2J A;  4SBV A;  4XVH A;  1VMJ A;  5F3I A;  4YZ1 A;  2GC2 A;  3C7G A;  3CHX A;  1PO1 1;  3AYC A;  3PVB B;  1DLC A;  4MGS A;  5EV7 A;  5LRS A;  1SQ4 A;  5FP4 A;  1FOD 3;  3NWK A;  1KDM A;  2YBK A;  3AXE A;  2JG8 C;  4N53 B;  4IV1 C;  3H7J A;  4NHL A;  1S2B A;  1O3T A;  4M0N A;  2AEN A;  1H9W A;  1Q8V A;  4I0A A;  2G19 A;  4OHY A;  1W6O A;  1VBB 2;  1A8M A;  2OVU A;  3NNG A;  2HWD 2;  5I0S A;  5JOW A;  3B94 A;  1NCR B;  4LLO A;  4M4R A;  5AC9 1;  1KXG A;  5DUU A;  3S5A A;  2VJX A;  5FLJ A;  5BNO B;  1SLC A;  3G6J B;  2D3P A;  3CJI A;  5IW0 A;  4HL0 A;  5DG2 A;  3PTR B;  1UO9 A;  4JRA A;  2RDQ A;  5FPA A;  4JGZ B;  2D5H A;  4AG4 A;  3MDP A;  1JU4 A;  1RED A;  1VMF A;  3AJY A;  2OZJ A;  1QKQ A;  1RUG 2;  3ILR A;  3N35 A;  5K4L A;  2J7M A;  3MIB A;  3PIG A;  3VBH B;  4OFG A;  5FAX A;  4IDZ A;  1D4M 1;  3BAL A;  1ZZ7 A;  2CAU A;  3LIH A;  3J26 N;  2X29 A;  1H8T B;  3ZO0 B;  4WZF A;  5FZO A;  3WUC A;  4ES8 A;  1CAU A;  1J84 A;  4XF0 A;  4LUK A;  4N9I A;  4PBO A;  5GKA C;  1N1V A;  2LTN A;  4DXZ A;  2JEM A;  5ACA 3;  1W05 A;  1FNZ A;  3K4D A;  3SMH A;  2X09 A;  5FZ0 A;  5FZB A;  3RZH A;  3WNN A;  2FZ2 A;  4CDU C;  3LEI A;  3C7F A;  2R06 1;  1QHD A;  2YZ4 A;  2IVJ A;  2Z69 A;  4NHK A;  3JZV A;  1TMF 3;  3NAP B;  3ZSL A;  5JZG B;  3III A;  4TN7 A;  3W59 A;  4C1X A;  2GU9 A;  2HEW F;  4B4P A;  1FT9 A;  2P5B A;  2PHR A;  2XON A;  4D69 A;  1BMV 1;  1UYP A;  1JYW A;  2VTX A;  2FDJ A;  1DQ0 A;  4QX3 A;  4BQ5 A;  3AJZ A;  1DZT A;  1W6P A;  3LF7 A;  1CAW B;  4AR2 A;  4LKS A;  2CGO A;  2R04 1;  1EUU A;  4ZXE A;  4BHP A;  5IAX A;  1UZW A;  3I2K A;  4AFA A;  3FC0 A;  4LBJ A;  3RPQ A;  5FZ7 A;  1W2A X;  1XNA A;  2VH9 A;  3NO8 A;  4NWV A;  2G1M A;  4YRD A;  3D4K A;  3WSO A;  1DYK A;  3ZX7 A;  1AR6 2;  4ZXK A;  3I59 B;  1DQ6 A;  2GAU A;  2QQO A;  3AFG A;  1ASJ 2;  5FY7 A;  3VD3 A;  2KD7 A;  5JR2 A;  2JKB A;  3TN9 2;  3OOX A;  2RS3 1;  1MZF A;  3IDE A;  5DDJ 2;  1PHM A;  5IK8 A;  3NV1 A;  4OUS A;  4BQY A;  3FHQ A;  2HWF 3;  2V4V A;  4JKL A;  2MHF A;  4Q0S A;  3VKL A;  4AXO A;  1VBC 2;  2BYV E;  3KCX A;  5EP9 A;  5FKB A;  5JXG A;  2ZGU A;  1RUC 1;  5GZC A;  1V6L A;  1W9S A;  2AAC A;  4GMP 1;  5D8A C;  4OMD A;  2DYC A;  2Q8D A;  5DAX A;  1ST8 A;  1W2N A;  2KXL A;  3LSD A;  2P6C A;  1WLW A;  4L97 A;  4Y26 A;  3F2Z A;  3OJB A;  2WWU A;  3WF3 A;  2D40 A;  4N43 A;  5J09 A;  1GWL A;  1R08 3;  3ZYF A;  1OOP C;  5FXV A;  4ZPI A;  1EUT A;  1O7F A;  3Q8C A;  4GMP 3;  5DQ0 A;  1D2S A;  4CEW A;  3GBG A;  4IGP A;  4QB6 A;  1AYN 1;  1AYM 3;  2OUH A;  3B9C A;  4IE4 A;  3AZY A;  3UJO A;  2ZGQ A;  1HQW A;  4A2U A;  3B00 A;  1GIC A;  3J7M A;  1IQD C;  3KT4 A;  5D8A A;  3D82 A;  5A3W A;  5LA2 A;  4FOV A;  2UWB A;  3RMX A;  3RYR A;  2H6C A;  3A7Q A;  1PGS A;  5C4W A;  3VBS A;  2BGC A;  2D3R A;  4JTO A;  4Q4Y 1;  5JSR A;  3OPT A;  1H6X A; 
#chains in the Genus database with same CATH homology
 4XCA A;  4IW3 A;  4XAB A;  4XC9 A;  2RDQ A;  3W20 A;  2HBU A;  4UWD A;  3HQU A;  5DAP A;  4MHU A;  2FCU A;  2JIG A;  2RDS A;  5LAS A;  3MGU A;  4KBZ A;  3EMR A;  5LBB A;  5M0T A;  5IAV A;  5DAQ A;  2JIJ A;  2FCT A;  4NHX A;  3KT7 A;  3PL0 A;  5EQU A;  4J25 A;  4XCB A;  5LAT A;  5C5U A;  5LBF A;  4MHR A;  2Y34 A;  4NHK A;  5LA9 A;  5LB6 A;  4Y5T A;  3GZE A;  2Y33 A;  3NNF A;  4ZON A;  5DAV A;  3BVC A;  2HBT A;  4Q5O A;  5ERL A;  5L9R A;  4NHY A;  3GJA A;  4XAC A;  5IAX A;  2A1X A;  4NMI A;  3DKQ A;  2G1M A;  4BQW A;  2V4A A;  5HV0 A;  3NNL A;  5DAW A;  2RDR A;  3OBZ A;  4NAO A;  5A3U A;  3KT1 A;  4BQY A;  5L9B A;  5HV4 A;  3HQR A;  5EP9 A;  3GJB A;  4JZR A;  3W21 A;  2RG4 A;  5DAX A;  4NHM A;  2FCV A;  3OUI A;  4XAA A;  5LBC A;  3OUH A;  5IAT A;  3NNJ A;  3OUJ A;  4ZPI A;  5EPA A;  3ITQ A;  5LBE A;  2OPW A;  4NHL A;  2G19 A;  4BQX A;  5L9V A;  3KT4 A;  4Y5S A;  5C5T A;  3NNM A;  2RDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...