5LBBA

Hif prolyl hydroxylase 2 (phd2/egln1) r396t variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/un9)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
233
structure length
229
Chain Sequence
b'NGQTLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADETARAKVKYLTGGVRVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 61
structure length 229
sequence length 233
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbbA00
2JIJA 3KT4A 4ZONA 3NNJA 4NAOA 2RDRA 5L9RA 4NMIA 4MHRA 4UWDA 2FCTA 5IAXA 4Q5OA 2HBTA 2G1MA 3EMRA 3NNMA 5HV0A 5DAVA 5EQUA 2HBUA 2FCVA 3PL0A 3OBZA 3MGUA 2JIGA 5DAQA 5LB6A 3GJAA 5LBCA 3NNFA 3ITQA 2OPWA 4IW3A 5L9BA 2A1XA 2G19A 4XAAA 5LBBA 3HQRA 4NHXA 5LBFA 5L9VA 5HV4A 3HQUA 5EP9A 3W21A 2FCUA 4XCBA 4Y5SA 3NNLA 5ERLA 2V4AA 4KBZA 4J25A 2RDSA 5DAWA 5LATA 5M0TA 5C5UA 3DKQA 3OUIA 3OUJA 5EPAA 5DAXA 3GJBA 5LA9A 2RDNA 4NHYA 5DAPA 4XABA 4MHUA 5LBEA 4XCAA 4NHKA 5IATA 4ZPIA 4XACA 2Y34A 2Y33A 3W20A 2RDQA 5C5TA 5LASA 5A3UA 3OUHA 4JZRA 4Y5TA 5IAVA 4BQYA 4BQXA 4XC9A 4BQWA 2RG4A 3BVCA 3KT1A 3KT7A 4NHMA 3GZEA 4NHLA
chains in the Genus database with same CATH superfamily
3ZN6A 3MYXA 4LLOA 2RS32 3ZMNA 4C0HA 4CE8A 4LBMA 2K0GA 4CCDA 1Y43B 3ACIA 4WM8C 1PVC1 1BLZA 1TME1 1UY2A 4NROA 1BBT2 3ZFFA 4D94A 2UYAA 5ACA2 1W6QB 2XVGA 4KGQA 3QACA 1MQTC 3KLSA 2LS6A 5A7WA 1FMD2 4BQ1A 1PX3A 4LBLA 1K12A 1RVF2 2J1TA 3IZOA 1N3QA 5GKAC 3I2OA 3R4DB 2R16A 3ACLA 5CB7A 1DHKB 3WNLA 4EYUA 2XUMA 1GKBA 3RZKA 3CDZB 3CLPA 1HRI2 1WCDJ 2OIIA 1MPXA 2VJXA 3FWEA 5ANNA 4JX0A 4UFKA 4IV3B 4PHZA 4RD7A 1IGOA 1HV1A 1J3RA 5GZEA 5FPAA 5LBFA 2A73B 4N90A 2Y6LA 3BYWA 3VBRA 3HMYA 5IVFA 4WZCA 3WP6A 3SH4A 1SFNA 3W21A 3ZIXA 2IWGB 3RVHA 3ZXKA 1A8MA 3KS7A 1NA1B 1EUUA 2FBEA 4FPYA 4I3GA 4MGYE 3F95A 2VR4A 1NT0A 5EJ3A 1ZZCA 4M4PA 2QQOA 1AYM1 2BW8A 2WLPA 5T54A 4AK3A 3R4UA 2WWUA 3DXTA 5F3CA 3AFKA 1AR61 4PF5A 4LBQD 1KD7A 4FTEA 2D6KA 3AZYA 3K48A 3KHCA 3D4KA 3PDQA 1HQWA 2ARAA 2G9FA 1AZDA 1WBLA 4MGIE 1Y9GA 2VBBA 4CPBA 4Y24A 3VKOA 1NLQA 4ZS3A 3VZKA 3WD5A 1SG3A 2XUEA 1ZBA1 1NCQB 3K3NA 2ZAHA 1IPJA 5JCTA 3BB6A 5KXCA 4X8NA 1QJEA 4Q4Y2 4XF3A 5FO8B 1QDOA 3H1WA 4LKSA 1N1SA 4FOYA 2VNVA 4IDZA 4NHYA 2WNVC 4XUQA 2VZVA 2E9QA 1W9SA 3INAA 1VBC2 4LPLA 4CCLA 1WA4A 4HN0A 3T0DA 2D6OX 1BHGA 4AQ2A 2XVLA 5CYYA 1JYCA 2R062 2F4PA 2WYFA 3LE0A 5IATA 1LB2A 1JH5A 4L8QA 1FPN2 3C8XA 1CPNA 1GNZA 2ZCWA 3MHZA 3MI8A 4AQSA 3C7OA 2NMOA 4CDXC 1G9CA 2Y33A 1S55A 1W2OA 5LASA 3ZXGA 1PO13 2G4IA 4IV3A 1DG6A 3OY8B 4R52A 3CJIC 1YO8A 2IVJA 3SCGA 3VBSB 4MO3M 4CDQB 1RC6A 4BQYA 2YBKA 4NN0A 4QXHA 4WM7C 2R32A 4INDA 2JB4A 1WLWA 2QCSB 4RGKA 1IQDC 1VP6A 2WNOA 2IUWA 1LGBA 2YBSA 4Q26A 3BGAA 2HWE2 4JV4A 4OHXA 1DQ5A 4BISA 5FPXA 1UKGA 4YVSC 5I93A 2BVBA 2YGMA 1WMXA 4I01A 1CONA 5JI7A 5LRSA 4RFT0 2C5DA 1O4TA 4ET7A 1XYNA 1YXWA 2YPJA 1W28A 3PLQA 3O1RA 3SH3A 2JENA 5C4WB 4CU9A 2ZEXA 1XXNA 1RUNA 1JYTA 3ECQA 1V6LA 3PUIA 1RUI2 2C24A 4O9EA 3MPBA 1REFA 1XC6A 4QPIB 2GC1A 4AFCA 2PLV1 1L7RA 3OEAA 4XBQA 3UT0A 1WCQA 2VD7A 3GZAA 2FDKA 2HEVF 1LAJA 1HN1A 4PQQA 1PM4A 1C57A 4UFHA 1NCQA 4AHZA 1ODNA 2VC9A 2GZWA 1G7YA 3MLJA 3O1VA 4IEUA 2QQJA 1SACA 3T4HB 2W94A 2YXSA 3CJXA 4D7YA 3W9AA 5IVCA 1QJX2 1RHI1 4QDSA 1Y4WA 2IFRA 4RL7A 1S0GA 3PVOA 2DBIA 1U12A 3NV4A 4BH9A 4XAEA 3T2TA 3SXWA 4LK6A 3RZGA 4PI2A 2CSGA 1MEC1 4QMAA 2R071 3IBMA 1S0DA 3HQUA 4FPJA 4M3CB 2HWD1 4HMZA 3T1MA 3WG1A 1H9PA 3LAGA 5LCWL 3QH6A 3KF5A 2R043 3DGTA 5FUNA 3I2IA 3ETQA 4ZXKA 5GLTA 1PGL2 1N3PA 2IXLA 3ZXDA 1TG7A 3MLKA 4FP2A 3VBSA 1IHMA 1UZ0A 1YNAA 1W39A 4QPYA 3AYEA 4CDQA 5A3WA 4FPCA 5FBJA 1RUC1 2X8KA 1PZ9A 1Z7S1 4XFGA 1HKDA 5IHRA 5FZMA 5T55A 1VMHA 4Q4V2 1R093 2DVDA 2Q4SA 3TN91 3M3OA 3DYOA 1AR71 2JKXA 2WS92 4L2NA 4YVWA 4COWA 1RUJ1 5IT6A 1W6MA 3SLIA 2VOWA 2OT7A 4QHOA 5BNNC 1ZA7A 4A7YA 1KQRA 2A5ZA 5C4WA 3SCHA 1AR91 4Y5Z0 4QX7A 4YZ3A 1EUTA 2BFUL 4DEVA 1YRZA 1H6YA 4UFMA 3M2MA 1A3KA 1CESA 3GJBA 3O14A 4H14A 1WZXA 2GN3A 2BBAA 4QPIA 4F83A 1ZRCA 1KRIA 2Y6KA 2CWMA 3BIWE 4NPMA 4Q4W2 4AZZA 4DIQA 5CBLA 2CDOA 1GBGA 1OC1A 1GQHA 1ZM1A 2RM23 2RS53 4NHKA 3S7EA 4IEVA 3BIEA 3KZ4C 3M3QA 2QUOA 1QDCA 1UNBA 4UBHA 5KWRA 4BA6A 4GB33 4R4XA 3GHNA 1OA4A 4JDOA 1C28A 4WVZA 2RDQA 2YPDA 3Q9OA 5F32A 3ZLIA 5CKMA 4A42A 4BQ5A 5D2AA 5EIYB 1OQEA 4AF9A 2HYXA 1W8NA 2WNUB 1H2NA 2ZX0A 4PF1A 1FNYA 4I02A 4XC9A 4M3CA 4ISQA 3PVBB 1DYOA 2ZGTA 4QHBA 1H4GA 2JDNA 4C8DA 4K1ZA 4NHLA 4AFAA 3VZMA 5FY9A 1FATA 1EAH2 3M3EA 1SCSA 4L97A 5IK4A 5LA1A 1LOBA 1JODA 1T2XA 3I2FA 3N9LA 1YI7A 4E9KA 2W1QA 3E6BA 4OYUA 4QX2A 1H8TC 2W9XA 3POFA 5KHKA 2VUAA 4EZHA 1DQ0A 1LJ7A 3GCWA 3SKVA 1RMU3 2XVKA 5EHDA 5G05L 2E6VA 1AJKA 1HXS2 1OFNA 4FPHA 3ME2A 4MH0E 4NE9A 4PBOA 4RQPA 5EFUA 4WM8B 4KWLA 3UV9A 4P9LA 1NAEA 3R0RA 4KMQA 4IE5A 5T5JA 3S7IA 1XNBA 4FXKB 1I6XA 4IETA 2Z4FA 3OBZA 1MQTB 2JWPA 2Y60A 2DVAA 4LJHA 1O8PA 4QX3A 2D3RA 2AEYA 2OPWA 3RDIA 4L99A 3N36A 4AR2A 1US3A 2G19A 4N53C 1CAUB 5LBBA 1W8OA 2XKPA 1RUF2 2O1QA 1L7LA 1VBB1 4QAWA 4Q8LA 3O1PA 1AX2A 3FFZA 4QGLA 1UIJA 1HRV2 3K3OA 4X6QB 3KM5A 4AI8A 4DXRA 5D8AC 1RITA 2ZXQA 4OVEA 2VQ0A 1TVGA 3DPRC 4TTGA 1UOBA 3BU7A 1OURA 5GZDA 1QOSA 2O8QA 1RUH2 5SV8A 2X5IC 1ZX5A 3JBG2 2TNFA 5FYBA 1FX5A 1OVPA 4P08A 3WW1A 5JIUA 5A3NA 4C1XA 2BWAA 5FZAA 4QT6A 2Q30A 4IGPA 1V9U2 4PIZA 1C8M1 3V56A 3FHAA 3OYWB 2XG3A 1REDA 5C71A 4S2FA 1F31A 5LY1A 4ZXEA 1JHNA 3AB0A 1NCRC 1PIV3 1X9PA 2Y0OA 4Z2WA 5FUPA 5FYVA 3DXUA 2BNMA 1ZREA 3POWA 4MGZE 4I2OA 3OUJA 3RS6A 3ZXLA 4DUVA 4CZSA 5BNQA 3HBKA 2QE3A 5EXOA 3CL1A 3KGZA 2GMEA 2VOTA 3FLTA 4OQ9A 4UBGA 1ZRIA 4MZUA 5I8SA 3LOBA 1OBNA 4BXFA 4I0BA 3LIHA 4YARA 4JVAA 1COV1 1QQP3 5AC92 1VJ2A 1PGSA 3HWJA 1YCIA 1S0CA 4L92A 2NQYA 4MHUA 2CAUA 2ZABA 1CAVB 1UPIA 2VH9A 1ENXA 2WFF2 4XJAA 3Q8CA 5FJKA 1XE7A 4UW4A 3MEPA 4LXLA 3ZDSA 5F3EA 4HVOA 1N1TA 2EA7A 2WNVB 5C6CA 1UMIA 1ULGA 1TMF3 3GALA 2WRAA 3POGA 1W9YA 2UWBA 2VZ1A 1WW7A 4R8HA 4P9WA 3NKTA 2C6SA 4SLIA 4Y1XA 1ALYA 3FBMA 2J1UA 3GBFA 3PIGA 5LY2A 3VDDC 4CDXB 2RJ2A 5IYYA 1XYPA 3BCWA 4G4FA 2HWF3 3MZHA 3HIFA 3OD0A 3C7GA 4IV1C 2BOJA 1OKQA 5DUUA 2Y8KA 3CJIB 4XFHA 4HETA 3AYDA 2K9ZA 4RS5C 5CKQA 1K45A 2PN5A 2VTXA 4B3NA 3W5NA 4WM7B 4FI9A 4G3YC 3SKJE 2XBO3 5KR7A 4LT5A 2H6CA 2CWSA 3KWVA 5FXXA 3MBWA 4FVVA 2KXLA 2PTMA 1VBD1 2B7YA 3L2YA 4MXVA 1LGNA 2PHTA 3OYWA 2HBTA 4RGGA 2HWB1 3SISA 2P3IA 1VLNA 3NKGA 3EMRA 5FY1A 1OA2A 1CR7A 3ZYRA 3RWNA 4XW3A 1U5IA 3PMSA 4FT8A 1UU6A 4H55A 5DDJ3 3VDCA 4YW7A 1JYNA 1AL22 4UOJA 1LKNA 3I2DA 2EAKA 2JIGA 3LZZA 3AL5A 2VCAA 3EQEA 5FO7B 4AGGA 3VZJA 1D2SA 1XBFA 4E8DA 4ZS2A 3IM0A 4HPKA 3I59B 4UYBA 5ANQA 5L9BA 4EWEA 3IDEA 5K7PA 2HH9A 2O0OA 4W8JA 3BI3A 1QWRA 5FY0A 3MW4A 1M06G 2CGNA 1HQLA 4P9YA 5A3TA 1WLTA 5EP9A 2BJSA 4KG0A 1RUE1 4ZKTB 4GAZA 3RQ0A 1KFUL 3N9QA 1WLCA 3RZJA 2VNGA 1JOPA 2WNVA 4XCBA 5L73A 2XJRA 1W9TA 4JGZC 5FZ3A 1LEMA 2E32A 2A71A 1EV13 1LESA 5KC6A 2V72A 1NQJA 2D43A 5K4LA 1O3RA 1A8DA 5F7UA 1AL0G 1Z0HA 1NXMA 1IS6A 2EF6A 5DZEA 2EIDA 1AR81 3O1MA 4CDXA 1OD3A 2NMNA 4W4ZA 3WF3A 5IVVA 4DQAA 4KL1A 3IDAA 2ZKNA 3OGRA 4JTNA 1DDLA 1ULPA 2WWSA 3CJIA 3TAYA 3NL1A 1R083 3D8CA 3KQRA 5EV7A 1ZZBA 1BVP1 2W1SA 1H2MA 3HD8B 1RUD3 3N35A 5CKNA 3WF0A 4CEWC 4A3ZA 1SFYA 2QQWA 3GNEA 2V09A 1TNRA 4JAAA 5FKBA 3JD73 1ASJ1 1OLQA 3NJYA 4YVSA 1SBFA 1W0PA 3TB0A 3HNMA 4XZPA 5FIXA 2B9VA 5KBFA 1JYVA 4J6GA 3ACFA 3ORJA 4XTPA 3WV6A 5J3UA 4NIIA 5BNNB 4HK8A 1AYN3 1KS4A 2Q8DA 1UWWA 1KFXL 4JTOA 3WCRA 2LROA 4N43C 2V5YA 4CCEA 1J83A 4GMP1 3NJZA 4XPVA 2GNBA 5FREA 1U5XA 4CEYA 1JZ2A 1ZBE2 3IMMA 4MOAA 4DPNA 1JN2P 1Q43A 3OCPA 4QX1A 2RS13 3AZVA 3D3AA 4NUBA 4HVQA 3MF9A 5BV6A 5LEJA 3S30A 2YZ4A 3AMQA 4Y20B 4Y5TA 5A3UA 1YFUA 5BNPC 2MEV2 1GP5A 2MHFA 2YDEA 3ILRA 4HSLA 2CGPA 2J7MA 1QJY2 5C9AC 2CYFA 2VW2A 2IXKA 1VAMA 1VBE3 2RG4A 3KT1A 5KXEA 3U37A 2YU1A 4ES8A 5CFDC 3KCYA 4IERA 1LHUA 5T5OA 5H9PA 1WKYA 2LRPA 5CIRA 5FY5A 3S57A 3KT4A 2FDGA 2VNRA 1OMIA 1XPWA 5GALA 4AG4A 4BMEA 3J26N 5A6ZA 4KWKA 2RR13 2XLFA 4NPRA 4LUKA 3N9NA 2B46X 3LEMA 3M7AA 4N8MA 3SEPA 2BP6A 2XDVA 5HCFA 1BEV2 2P4EA 1MS3A 1POV0 4KU8A 1NG0A 2C4XA 4MGKE 3FHIB 3POBA 2ARBA 5FY4A 1VBA1 2Q8OA 1KDMA 3IPVB 3WCSA 2RS33 3JCIA 3VV1A 5FMBA 1OKOA 1H8TB 2WUHA 4RSUA 2UURA 2RE9A 5FYCA 3U4SA 4ZU4A 1BBT3 1U5YA 3HJRA 1AR72 5FYTA 5FYHA 5ACA3 2FDHA 4YYOA 4AVCA 1FMD3 2QQIA 3UESA 1Y3TA 5FK8A 2YFZA 1L3JA 3U10A 4CCOA 2XL9A 1ND3C 5FZBA 1RVF3 2JDMA 1B09A 1TQ5A 3T08A 2Y64A 5FLIA 4QPWA 3BTXA 3RPQA 3L9JT 4BIFA 3ZSMA 5A1AA 2VZSA 5E16A 3VBUC 2P5BA 1HRI3 2AR6A 4IEWA 2ENRA 2E63A 2ZS6B 4JCKA 5FP8A 3T2PA 4QKNA 1MS1A 2XL7A 2QZ3A 3C2UA 4A44A 5AFBA 4N53B 1SBEA 4YWAA 5FBZA 2BNNA 3DECA 4B4QA 4D6QA 3ZYJB 1CX1A 1T6BX 1W06A 2NYYA 4QXKA 1NUKA 1VRH2 1CJPA 2XJQA 1UCXA 4P9XA 2CGOA 2SBAA 5IWFA 5D8AB 3NW4A 2R1BA 4IUGA 5FMCA 1GQGA 2WA4A 3DPRB 1EV12 1UF2C 4XIOA 1W3VA 5F39A 1JYIA 2A7AA 3E97A 1JXNA 2X5IB 2Z5WA 3O5SA 3ZFGA 3W59A 1A78A 3LDRA 5GLZA 5FZ7A 2XJPA 1KXGA 4KWJA 3BODA 3THTA 4JKKA 4NJ4A 4CUAA 5A6XA 2JXAA 4LITA 1HDKA 4YGEA 4COUA 4TZDA 2E33A 3WP3A 1IKQA 3I4IA 3IIAA 1BVVA 4OUMA 1NCRB 1WGPA 2RDNA 3IPVA 2VZTA 1DF0A 2RMU2 4Y3OA 4NPLA 2Z79A 2XWJB 1I5PA 3WHTA 4B7EA 4WVWA 2P37A 1GWKA 4RGAA 4XCAA 4I30A 1UYZA 1PO11 3AMHA 4LHSA 4XQ4A 2OQ7A 1SLLA 4QKBA 2XWBB 3DUIA 4ZPIA 4Q4Y3 4XACA 3M3CA 3QCWA 3K77A 4FP3A 1AYN2 3NWKA 1F15A 4HBNA 4LOSA 3WZ1A 4LIVA 1RJ7A 1W8HA 4P9GA 4BB3A 1WMEA 4AVTA 1T6GC 1VBC3 3N7JA 4NO4A 2WABA 5FP4A 2OXBA 2R063 1ENSA 2VOKA 4BK5A 1JUHA 1FPN3 5C8CC 3B02A 4YFWA 3OGSA 4FSJA 4FPOB 4NIHA 2BU9A 2X05A 2JIJA 1RGSA 3R05A 1DQ4A 3IIIA 3NAPC 3ZXAC 1PO21 4GMP0 2D5FA 2RDRA 3V0BB 1Q8QA 2NP0A 3AFGA 5L9RA 5LRRA 2AACA 4RR3C 3O1TA 4IV1B 5FLHA 3U14A 5D8AA 1MS4A 3ACHA 4GKYA 4Q5OA 3DPRA 4I0AA 2HWE3 4RS5B 1S0EA 3V0AA 2YU2A 2RV9A 2UU8A 1I9RA 2X5IA 5A6QA 3ZKUA 5BUVA 4AEDC 5E88A 4RFRB 3HBZA 5T5PA 3M3IA 4JKMA 4WVVA 1H6XA 1QGLA 3OB8A 1SDDB 1ULFA 3HNYM 4YG0A 4UFLA 3ZPOA 3P3NA 1WCKA 3ROUA 5T3NA 3ZSLA 4LKFA 1NCRA 4OI2A 1RUI3 4F7ZA 1WD4A 2WIIB 3ZSKA 2R041 3ENRA 3CO2A 3H9AA 1W99A 2SLIA 3OOXA 3VBFB 5J7MA 3SCFA 3O0WA 2LM3A 1D7PM 4QU1A 1GUIA 2QKDA 1H9WA 3GYDA 4K8RB 4ISRA 3RI8A 4FFHA 4ASLA 1E5SA 1DLLA 3IB3A 5HPOA 1HIXA 1QJX3 1W9FA 5J96B 4IEOA 4YLZA 1BMV1 2F6BA 1S0JA 3OGGA 2QVSB 1R091 4D7TA 5EJZB 4K6BA 3AJYA 3DYMA 1XNKA 3UL2A 2WZR2 2YV8A 1DQ2A 1QY4A 3POSA 4WVMA 1W2AX 4JGZB 2ZJCA 2JG9C 3JQWA 1JZ6A 1FAYA 3CF6E 3VZNA 1QKQA 3A21A 3EBRA 5JZGA 4W6XA 5ABJC 2RVAA 1F4HA 3KVAA 2ARXA 4W6WA 3VL8A 4XF4A 1N1YA 1OF3A 2ZGLA 4HONA 5AVPA 3ZFEB 3VDDA 1V6KA 3N9MA 1NQDA 4GKXA 1X9TA 5BNOA 4DO0A 4QGMA 5FJHA 2EAAA 2R30A 4OI0A 3H8UA 2DWRA 1X7NA 1YFWA 5EPAA 3K2OA 3VKNA 4Q4V3 2RM21 2RS51 1XNAA 4RS5A 2NN8A 2IXJA 3RFRA 5LA0A 1H1AA 4CCCA 2WS93 3ZN5A 1SEFA 4CEWB 1DBNA 2ZGRA 1QH7A 2JX9A 1Q8OA 4XABA 5CADA 3MPPG 1ZNPA 4GB31 4HXCA 3J4UH 3JB4C 4YSFA 1MS0A 1LU1A 2G9ZA 4HFSA 4Q4X2 2VULA 4YFZA 4LBQB 4KU7A 2XLGA 4AVAA 1JU4A 3U4XA 5FZIA 1CN1A 5A7PA 3IDBB 3GZTB 5FPVA 4NIAA 3ZSEA 3SH5A 2HKXA 3VHPA 2R49A 2DCKA 2FMDA 2MNGA 4LO4B 4L0PA 2BGOA 4N43B 3VD9A 1RXGA 3CIHA 4Q4W3 3ATGA 3MFCA 1XOYA 1H30A 3BU0A 5FYZA 2P6CA 2A3YA 3T09A 1W6QA 2WSUA 1MVQA 4B4PA 2A6YA 4A3XA 2ZZJA 3C7FA 1OLMA 1OH4A 2WBKA 3POJA 5BNPB 5KC5A 1W6NB 2Q5TA 2E31A 3A4UA 3ES4A 3W5MA 3NV1A 1RMU1 4Q0PA 5C9AB 1H0BA 3LA7A 5DG2A 1UX6A 3I49A 4LOTA 4QQHA 2ZGUA 4MGQA 2DCYA 2Y6JA 4FOVA 1LULA 2E7QA 1RUG1 5C70A 2C9AA 1O8SA 2JKBA 5CFDB 1ZRRA 4K9SA 1ZVFA 2KR2A 3VKFC 5JAXA 1O7FA 2E26A 2LTNA 3OGJA 1CZSA 2NM1A 3IAQA 5H9RA 1NZCA 2PHRA 3QOPA 1AVBA 5F2SA 1JZ8A 5HCHA 2I2SA 1EAH3 4D69A 3MF6A 1U5ZA 1RTVA 5FZGA 3FJSA 1YEWA 3DKWA 5JXHA 4UI9L 3RMYA 1VE0A 2VCCA 3PJQA 3KMHA 5FZEA 1NA1A 2ZOEB 2TBVA 3ZYFA 1RL3A 2GNTA 2GSYA 1C5HA 3HOBA 3B00A 4BQ2A 3RZHA 1HXS3 4NWWA 2W95A 3D6EA 3GZUC 4CEWA 2MPFA 2JEMA 2W39A 1D4M2 4XVHA 5I0SA 1AXZA 2GC3A 5FXWA 3TWIA 1CZTA 1REEA 3TYJA 4SBVA 4LHLA 1XRUA 4A2UA 2X09A 1GU3A 2OQ6A 2PHLA 4LBQA 2WA3A 1BZWA 1G9DA 3OTFA 4N7IA 3UYJA 1R1A1 3SQOA 1O4YA 3H8XA 1ND3B 4V2VA 3NNLA 4DNYA 3S5AA 1O6UA 2IVIB 5FP3A 2Z69A 4I3PA 1XSQA 4N43A 4QB2A 3VBUB 4OHZA 5FWJA 1RUF3 5C3SA 2VVFA 4OFGA 3OGVA 1W6OB 4W65A 5DAWA 2Y0IA 1BK1A 4ONUA 3TBDA 1NXD1 1PIV1 4XFBA 2VTFA 1UY0A 1JHJA 1HRV3 1W3XA 5A70A 4XXPA 5K0UC 5BNPA 1W6NA 3UNPA 3HR9A 4BK4A 2DVFA 1H8VA 3ZN4A 5C9AA 2Y38A 4OQ8A 4XF1A 1RUH3 2OS2A 5FR3A 1PGW1 3P1IA 4PI0A 3JBG3 3NV3A 1SLAA 2BTVC 3OUIA 4XDOA 1QQP1 2JDZA 2P3YA 4GH4C 4XZUG 4E2SA 5FV3A 1GZ9A 1V9U3 1UD1A 3T3YA 4LBOA 2PMWB 3OY8A 4RHV2 3T4VA 4QB6A 3PURA 3PTYA 3AKPA 3WDWA 1TMF1 3CZJA 1PK6C 5FP9A 1Y9MA 2KM2A 5JPMB 4BCUA 1OFSA 2YHJA 3WG3A 4JGYC 2LUWA 1V70A 1E5IA 2AGSA 5JSOA 5C5TA 1DQ1A 1V6JA 2HWF1 3LPGA 1QJU2 1V6IA 1W2TA 1FOD2 5EZWA 5AC93 5FK7A 4LLFA 2JICA 5A33B 1LCLA 3KT7A 2WFF3 4ZZ8A 4DXTA 1K5JA 3A0KA 1KEXA 4XUNA 2XBO1 1JS9A 3I97A 3MV01 1ND2C 4J1WA 3WNXA 1YC61 2ZGNA 1AJOA 3P6BA 4KG8A 4MXWB 2W68A 3NRUA 3WNPA 3AP4A 3B93A 3IAPA 4QU2A 2AENA 2FD8A 1SMVA 4L9BA 3JXSA 5C8CB 2W5FA 3AK0A 2BFUS 4UWDA 3LA2A 5DDJ1 4B29A 3MV11 5FOJB 4AW7A 4ZU5A 4DOUA 2EVXA 1AX0A 3NAPB 4COZA 4TSVA 4AHWA 4CTEA 1VIWB 1GV9A 5C33A 1XJAA 3WQ1A 4FBFA 4IXLA 5FXVA 5DQ0A 1IG0A 4RR3B 4XHBA 2QNKA 4Q8KA 4GWMA 1UZWA 4ZZ5A 2ILMA 2CDPA 4LKDA 1ULOA 1YLLA 2Y6FA 4KH9A 4YGBA 4FOQA 5C3PA 5LB6A 1NY71 4EWDA 2J42A 4YW5A 1X33A 3EYPA 2DURA 3DL3A 4IW3A 2HWC2 2P6HA 4AEDB 5FOBB 1NZIA 1EP0A 2YMZA 4XAAA 1UOFA 3J8F2 1GWMA 3GHMA 1V6NA 1EY2A 1UXXX 2TEPA 4KNCA 1W0NA 4CA9A 3BOWA 2ZHLA 4FCAA 3FMGA 4TYSA 1AL23 3ZYIB 1F8VA 1I5ZA 4LK7A 5IK8A 5FPLA 2J1AA 2OPKA 1F2NA 2Q8EA 2B39A 1AX1A 1CJDA 1EPWA 1UW8A 4AI9A 4CRQA 4IL7A 4KQ7A 4CDUC 1PMHX 5AFEA 1VAKA 1CZVA 1ZBA3 2VMHA 1RJ8A 4KBZA 2NLRA 2YY1A 2ZX4A 3PVEA 5FY8A 2VL4A 1R081 1SFPA 1X82A 5F5CA 1YIPA 3KGLA 4KGGA 1RUD1 3NQHA 2WZPP 3LCPA 3JD71 4YW1A 5FZ1A 3WUCA 2CAVA 2PQQA 3OPZA 4FPLA 3AP9A 4MADA 4EROA 4AXOA 5A32B 3ZXFA 5LK5A 4AVVA 2JG9B 4W6YA 4OMDA 4R9BA 2CNAA 2JDYA 3D82A 5ABJB 4NRQA 5DABA 1MR5A 5FZLA 3T30A 3NAPA 1KGYA 4YM1A 4ARXA 1UIKA 4OCTA 4N7UA 4BDVB 2WNUA 3BTZA 1RUOA 5GLWA 2WAAA 4DINB 2RS11 4RR3A 4PIXA 5JOXA 1LNSA 3PTRB 1WCSA 2CY6A 2GMMA 4NRMA 2WQ4A 2D93A 2W1UA 3VLBB 1VRBA 4XJZA 3ZPYA 2ZMLA 3NNGA 4PQ9A 1CPMA 1VBE1 1W6PB 2BERA 2V5DA 2VUJA 4XJ9A 4YM2A 4YNIA 2KD7A 2VCMA 5A7SA 5TSWA 3U11A 1VPHA 3K4DA 1IPKA 2V4VA 5CZKA 2BQPA 5BYNA 2W92A 4ITCA 4PT6A 5FPBA 1SDWA 3PU8A 4LE3A 1KJRA 1ZBE3 4PDWC 5HCAA 5ISLA 1PVC2 1DZQA 2VECA 1TME2 3FL7A 4WM8A 4DS0A 3MIEA 4YZ2A 1XNCA 2W08A 4LEJA 1HB2A 3BPZA 2FMYA 3N7LA 2MEV3 3M4FA 4ORFA 3VZLA 4O65A 1MQTA 4RA0A 3WSOA 3H42B 1QJY3 1PMJX 2RS31 3ZKYA 4N9IA 3S6PA 5DXDA 3USUB 1AUYA 1J1TA 2X29A 4M0NA 1DP0A 1POV1 4NRPA 4DXZA 1QIQA 1Q5OA 2P1BA 3ZFFC 1VB2A 1CAUA 2VMCA 5C3QA 1FI2A 1HX6A 2DF7A 5ACA1 1IS4A 3WNOA 5E89A 4DY5A 2XJSA 5DAVA 4BHPA 1YQ2A 1FMD1 5LA2A 2HJIA 3T2QA 4EJRA 2JG9A 4OLLA 4HL0A 1RVF1 5F3GA 3CU7A 5FRAA 2VZQA 4AWDA 1W8ZA 1XSRA 3A0NA 3MLLA 1BEV3 5LW9A 1G9AA 3WF1A 2D97A 5L7OC 1HRI1 1D4VB 1RIRA 3WX5A 2VTXJ 2WLQA 4XE9A 3PVNA 3U75A 1O3TA 2WT1A 5L9VA 4R4ZA 3O7OA 1Z78A 2CTVA 2ZBJA 1ACCA 4E4DX 2XB6C 3WR0A 3N7MA 3ABZA 3FC0A 1AR73 2JE9A 4OI4A 4Y1ZA 5JOWA 1V6OA 1OUSA 2QQKA 2ZGSA 2IC1A 1AYM2 2XJTA 4PLMA 5JXGA 4Y5SA 4I0WB 3O12A 1KJLA 4HK9A 3B5LB 2I74A 3AZXA 5IVBA 2WQZC 1AR62 5GM0A 5CFCB 2XPJA 3C7EA 3GBGA 3K4AA 1C8NA 2V4AA 3VBFC 1UZYA 2WN3A 2ZA9A 4AVSA 4Q0VA 4JRAA 4P02B 4A6SA 2DUOA 4M0HA 1MACA 4YM0A 4BPZA 1ZBA2 1WBFA 3ACGA 2D98A 2OKXA 1SLIA 2PXJA 1NKGA 4LE4A 2PFWA 2XJVA 3TOJA 4YRDA 1YFXA 5E8AA 1CAVA 3WW4A 2OW4A 3AP6A 4Q1RA 4NVPA 1VRH3 1LOFC 1H2LA 2DFBA 2W2IA 4UW6A 1O3SA 2YYOA 4M3CE 1OSGA 1Y7BA 3IMNA 3USUA 1X8EA 5K0UB 5LK7B 2ZEWA 2A6WA 1ST8A 5FPZA 3MW3A 4UFJA 2PA7A 4AYUA 1QXPA 3O1OA 3JQXA 4Q4Y1 2WINB 3RJRA 2ID4A 3ZYGA 3ZFEC 5LBEA 4GH4B 4JHZA 2XGXA 1WLDA 4XUTA 4CYDA 2ZACA 2EXIA 5K9YA 1FT9A 4JDNA 2VM9A 4AE2A 4Q0UA 1VBC1 3HNBM 1XE0A 3RMXA 5JUVA 4K3UA 3EO6A 3LD8A 1WW6A 2R061 1UY1A 5C8WA 4I09A 3OBRA 2JG8B 4WM7A 1FPN1 2RMU3 4G9SB 1PK6B 4QKFA 3H0OA 4JQRA 1DGRA 3KCXA 4C91A 1S0BA 4MUVA 2E51A 2Y6HA 5FCCA 4JGYB 3BVCA 4Y1YA 4GIQA 1UN1A 1QJZA 4B1MA 1ONAA 2XLAA 1WW4A 4Q0SA 2VQTA 2WJSA 3THCA 2W87A 4E2GA 3RNSA 4MVTA 2R0FA 3NVCA 2ES3A 2BPA2 3D5OA 2HWE1 1UOGA 2ZPXA 3VDBA 1E57A 4NMIA 5D1IA 1IS3A 5DUXA 3CZUA 5C3RA 2FDFA 3VL9A 1HJFA 2PLV2 1ND2B 1UZZA 2GALA 3VHNA 4QHZA 2J1EA 3I59A 4YG6A 5JXJA 4HZFA 4OHVA 4BLJA 2EIEA 4EN8B 1CD3G 2JB8A 1BYHA 5F5IA 3BKZA 3T2OA 5F37A 1RHI2 3USSA 1HB4A 1OVSA 2A3XA 1RUI1 1PNGA 4OMCA 3URFA 4LKEA 3MGUA 1QEXA 2HEWF 2JD9A 2QDNA 5HXVA 2I45A 5DAQA 3PUHA 4TN7A 3SEEA 3VBHC 4A45A 3WXPA 4FFIA 1MEC2 4JHTA 2OYZA 2R072 2DU0A 3MIHA 3ZYHA 1SQ4A 2UY9A 1LU2A 2HWD2 3RRDA 2K2SA 3POEA 3ZDVA 1OF4A 4PCRA 3N7KA 2DV9A 4YGCA 1QJX1 4GH4A 2VXJA 4QB1A 2OX0A 1PMIA 3B94A 3KSCA 3J7MA 1X50A 5H9QA 2YFUA 3RZMA 2WAOA 1I1EA 1RUC2 4UF0B 1Z7S2 4XDQA 5JOZA 3IKWA 4Q1PA 2OUJA 3WUDA 4U2AA 4EE2A 3I8TA 5F5AA 5K8SA 3TN92 2JDUA 4IGQA 4JGYA 1RUJ2 1PGL1 1GMMA 4CDUB 1J3PA 4QDRA 1G6NA 2EALA 3H3ZA 5BNNA 3MW2A 5B4NA 1MS5A 1LHVA 1W04A 1VMFA 4YGDA 1DZRA 5FZOB 2WR9A 4AL9A 1AR92 3J7HA 1H4HA 3OG2A 4Q4V1 4YVWC 2WS91 5GZFA 3TNPB 5J48A 1YJLA 2F4LA 2WZR3 4OUSA 4ASKA 4FXGB 4YZ4A 2Q8CA 3IN9A 4AVBA 1ND2A 1ZYBA 1M4WA 5EYYA 5FZFA 1YQ5A 4XMIA 4Y20A 4GJYA 2PQSA 4XEZA 2O8OA 1F4AA 4JRLA 1TEIA 2WWJA 5IW0A 3RGBA 4CCKA 1HB1A 5DUWA 1K5MB 2B8MA 2D6PA 5CVRA 3UGHA 4UAPA 1FYUA 1LODA 1NOVA 2UY8A 1PZ8A 1DYPA 3ELNA 3LSEA 4IQPA 4H2AA 3CQOA 4Q4W1 1W8UA 4C0BA 1JU3A 5I0RA 4BXSV 2Y34A 1UY4A 4GJZA 3OD4A 1XNDA 2VXRA 2Q1ZB 1JYWA 1IG3A 2RJLA 2CV6A 1D0GA 2G9GA 3RYRA 2BVVA 4BOWA 5SV5A 1PVXA 5HBAA 5EYXA 1B35C 4Q4X3 3I7DA 2HWB3 3LA3A 2D40A 1CIYA 2WO1A 2W3JA 4YPJA 3G7DA 1ENRA 4FTSA 5I8TA 4QQ2A 1WMDA 5DZFA 2ZEZA 4DUWA 1JZ4A 4Y22B 3BOPA 4UF0A 3K4ZA 1H8TA 1OI6A 5F6LB 1VR3A 3AP5A 3VHRA 4E4ZA 3J7NA 4L11A 4CUGA 5CEHA 2IFWA 1GP6A 2EIGA 3RZLA 1DFQA 3AL6A 3WQ0A 4PDWB 1EAH1 3NV2A 3QD6A 4FFFA 2ZGKA 1CWPA 4AEJA 1Q8SA 3DF0A 3L2HA 1HLCA 4ZY9A 2VZPA 1DGRN 4X6RB 4K7JA 3TEXA 2B5HA 3WG4A 3PJYA 3B9CA 5HV0A 3ZN6B 4XUPA 4HKLA 1HN0A 3PIJA 3WNKA 4RQPC 3HN3A 3NJVA 1HXS1 4RYDA 2D5HA 3K51A 4URTA 1JOJA 3WDTA 4D0QA 4YM3A 5JMOA 4AI1A 3ZFFB 2ORZA 4N53A 3RWKX 2B9UA 1C3HA 3H1YA 2JE7A 4CSWA 4DRRA 1VBB2 5A7WB 3KV6A 4F3JA 4FTBA 3RYKA 2WO7A 1DGWX 4AI3A 3ZXJA 2PAKA 1N3OA 1DGLA 3M8LA 1GSLA 5HV4A 1SLTA 5KHJA 2GP5A 5L7OB 3H1MA 1CX4A 2HLEA 2PAMA 1RUF1 5CG9A 1UU4A 2FCUA 1ZZ7A 2VVEA 4OZXA 4A7ZA 2ZGPA 2WC2A 3I54A 3EHKA 2VUCA 3EB7A 5F6KA 2BEOA 1AXKA 3AZWA 1IQAA 1D4M3 1HRV1 3IT8A 4CCJA 5CG8A 1C8M2 1ASJ3 4DXSA 1DIWA 3D0SA 3VBRB 1SLBA 2PHFA 2C1FA 4Y4RA 5LATA 3UJQA 2DU1A 3BUCA 1O4ZA 3ILFA 5FYMA 3J9SA 3FFQA 5HI0A 4P9IA 5M0TA 1OLRA 3ZYPA 3NO8A 1RUH1 4AI2A 2BV4A 3I2KA 1PM7A 4R9DA 3WDVA 2GMPA 3JBG1 1BKZA 4NAMA 1SHWB 4LHNA 4XF9A 4Y22A 1GZCA 4A4AA 3ZM8A 1ULCA 5FKCA 1UXZA 1V9U1 4XJWA 1GNHA 2H0BA 4CUBA 4PDWA 2BZDA 1COV2 1W8TA 3RYPA 3DCQA 5FYSA 3ZVXA 2VBPA 3RZZA 2E53A 2GN7A 3FBYA 3QH7A 3KQ4B 1OPMA 4IE4A 3UK9A 2ZTNA 4CPBD 3W58A 4AGRA 3AJZA 4UW5A 4D8MA 4FQZA 3KVBA 4XBLA 2FDIA 1S4CA 1JTZX 2Y26A 4LQRA 4OULA 1ZA4A 1ENQA 5AC91 1ZRDA 5A7OA 1C1FA 1HJGA 1QH6A 1DCSA 2W91A 4P5HA 5HCBA 3RG0A 2ERFA 1N1VA 3AC0A 3FUOA 3WP5A 2WFF1 1BJQA 1GOHA 3POYA 4RHV3 4IESA 2WT2A 3AX4A 3V0BA 3THPA 3RI9A 2GC0A 4IV1A 4BQXA 3KHBA 4ZHNA 4XOGA 5FWEA 4NHMA 5L7OA 1VBA3 4ARYA 5KHIA 2J1RA 5L19A 1XB9A 4Y4YA 3POIA 5IK5A 4EWAA 4MV2A 3LEGA 5E1RA 3LEKA 4ZONA 5IK7A 3FX3A 2R7EB 5FYUA 1QJU3 1VBD2 4Z07A 1FOD3 4O9GA 5FYYA 3WDUA 1GYKA 2EXJA 2HWB2 5FFOC 3FUQA 3HPNA 1OD5A 4Q29A 3K75B 1V6MA 4HOOA 2VGDA 2VBDA 4MHRA 4CP9B 5FQ0B 4AI0A 2D6LX 4UFIA 4XDPA 4FAHA 2BUKA 4M4RA 3VBFA 4LORA 4EN9B 1IKPA 3T1LA 5EQUA 4EN0A 1PX4A 2O14A 1UAIA 2GP3A 2IXHA 3A23A 3AKRA 4AEKA 1F35A 3T0AA 4OUEA 1N47A 4AFMA 1US2A 2JJ6A 5FZ0A 3NJXA 5KXBA 5LBCA 3NNFA 1J59A 3GGLA 1E5HA 1AL21 3R6SA 4D6RA 1JW6A 1RUE2 2QQPA 2EXKA 1AHSA 2QQVA 2VZOA 3HQRA 4EN7B 4EQVA 5A3OA 1URXA 1LOFA 1J84A 2AH2A 2Y6GA 3ZXEA 3R4SA 1KITA 3ES1A 4JGZA 3VBHB 3PMEA 4AFBA 2VW0A 3MDPA 1XU2A 3MIDA 1UU5A 3FZ3A 2VQUA 3LKJA 1AR82 4JKLA 5JI9A 2HWC3 1ULDA 3ZFEA 1Q8VA 2L9LA 2BGCA 3J8F3 1FV2A 3N3HA 2QQUA 1I3HA 3LDKA 3VHOA 3JUUA 2J1SA 3OPTA 3MFAA 4D6SA 3WW3A 3WHUA 2E7AA 3MO4A 1PHMA 2PHXA 4E8CA 1ASJ2 4HSJA 1NX9A 4BJ0A 5CFCC 3WOGA 4BLIA 2ARCA 2VPVA 3SMHA 5DG1A 4GULA 3DEMA 2WZEA 4MGTA 3PNAA 3UGFA 2WSVA 3AKSA 2ZMNA 3VB9A 4QX0A 1F5FA 4K8FA 4CP9A 2GNDA 4CU7A 1BXHA 2PHDA 3OPWA 5FQ0A 4JDMA 2WN2A 3K46A 1CQ9A 1TZOA 3H8RA 5LA9A 4A41A 3CNAA 1HQNA 3UJOA 4YVWB 3RJ2X 1YJKA 1CAXB 1G8WA 1W6MB 2XMLA 5GLUA 1UX7A 4CDWC 4NIGA 2GU9A 3AMMA 4XXAA 4Z1VA 3GBWA 4CP0A 2DCTA 1K3IA 3ETPA 2OVUA 3LF7A 5FZ4A 3KV5A 4QWNA 5A3MA 4GA9A 4LO7A 1XQNA 1DGWA 1LOCA 3GXUA 3LDBA 1PO23 4YG3A 4BQ3A 4CP2A 4CEYC 5CA6A 4Z92B 4XMAA 1UKRA 4ATEA 3BN6A 5I0TA 1S2EA 1UZVA 4Z8BA 4PLNA 1ZBE1 1KDKA 3AXEA 1O91A 5CISA 1VB4A 1YI9A 2JDAA 5CFDA 3I3EA 2B4KA 5KHHA 5T52A 3VBHA 1NE6A 4LUMA 2ZHKA 5E6HA 2XONA 2MEV1 2VG9A 3EXUA 3QBQA 4Y33A 1XU1A 2OA2A 3AKTA 1FXZA 3AVSA 1QMJA 1JZ5A 1JZ7A 1QJY1 3SHRA 5B4XA 1APNA 3LPFA 1SPPB 2JG8C 4PLOA 4NAOA 5GZCA 1XYOA 1GZWB 1B35B 2WO2A 3FHQA 4HKWA 1P8JA 2TUNA 4F8AA 1VBA2 4QQPA 5FZ9A 4NOTA 4M3CF 4META 3ILNA 5GZGA 1WWYA 3J7LA 5LWBA 3LB9A 4XFFA 1JI6A 4DFSA 1PVC3 3B69A 3SC7X 1H1IA 1TME3 4LO8A 3QLQA 1OH3A 4QGNA 1A34A 2ZAAA 5F2WA 4H7MA 1BEV1 2PHWA 4XHXA 3X29B 1G9BA 3G6JB 5B2GB 2WYSA 1NLRA 1X8MA 1HB3A 2HBUA 3E5QA 4RN5A 2PELA 4GWIA 1PZ7A 4KI5M 2JDPA 1W90A 2FDJA 3AP7A 1DQ6A 1W8WA 1BQPA 2VW1A 4TLFA 3GJAA 1ND3A 5IFPA 1W8FA 3ZMOA 3CBNA 3ITQA 4AAPA 1J58A 3ZOIA 3VBUA 2C26A 4RQPB 2A1XA 5FLJA 3OJBA 1CAXA 4NHXA 1W6OA 2DFCA 2JDKA 3HN1A 4CVUA 3CEWA 1S0FA 3HEIA 1AXYA 2W0XA 5AVAA 5L36A 2FZ1A 4FO9A 3WP4A 2IZWA 1IZ3A 4DB5A 1XNTA 1V0AA 5GJ6A 3U1XA 2ZX2A 3SITA 3ZO0B 1D2QA 2WO3A 2AREA 1S2BA 2FHRA 2QDRA 4BZ4A 4H3WA 5FP7A 3KD4A 4K1YA 2CU5A 5I8YA 4NIDA 3B7MA 3ZR6A 4M01A 5IUQA 2RDSA 1UQXA 2RJKA 3F2ZA 5C7GA 2DUPA 1O5LA 3MUY1 2FZ2A 1LOEA 2VU9A 3AZZA 1VRH1 4XFAA 3WQBA 3U0ZA 1AYM3 1IS5A 2QJVA 3OSDA 4BMBA 4QPGC 4E27A 2A3WA 1LR5A 1EPZA 3LGRA 1SBDA 3APBA 1Q8PA 2XOMA 4CCNA 1AR63 5JSRA 5J37A 1SPPA 2GNMA 3JB8A 3V64A 4P9JA 1GZWA 1EV11 1B35A 1IPSA 2Z2SB 3A7QA 3KF3A 4LA3A 4DMIA 3AYAA 4DY3A 2P34A 4XILA 4QX8A 3ZFGC 3EJKA 3E6CC 4IE0A 3WNMA 5DAXA 1RXFA 3WG2A 3WDXA 1DU3D 2YC4A 2AYHA 4E4HA 3HVDA 2GH8A 1OLME 4HG6B 2DVBA 5IVJA 4GXLA 1PO12 1OUXA 2C9KA 1LOAA 5G04L 5J09A 2QBXA 5FMDA 4A6OA 2AC1A 2IXCA 5A33A 1JYXA 3VBOC 1C1LA 3TRSB 4Y26A 1HW5A 2RMU1 3KV9A 4QM9A 2ET7A 3LFMA 3PUSA 3VN4A 5KHGA 5A3LA 4LO6B 1J1LA 1CVNA 3BTYA 3UGGA 4MXWA 4PBPA 3PUAA 2ATFA 1Q3EA 4XBNA 2ZX3A 2GDFA 4WZFA 3VZOA 2AZ5A 2QQLA 2X53S 1RUG3 5IAVA 1OXCA 1TNFA 1K5MC 2GAUA 5F8PA 4AAXA 4BU2A 5C8CA 1CAWB 1AYN1 4HKOA 4XTMA 2QQMA 2DBNA 3I3QA 1PO22 2LALA 4MYEA 3PHMA 4YZ5A 1X36A 4XJUA 1LGCA 2PAEA 3MIGA 4OI1A 1H1MA 4LNVA 4WV8A 4XUOA 1BCXA 5EWSA 3H3UA 1DLCA 3NNJA 1VALA 5FYIA 5I0UA 1MZ6A 2JDHA 4MG2A 1JMUB 4DEQA 3B01A 3I2GA 2UWAA 4XURA 2FCTA 1OOPC 4S2GA 5IAXA 3IWZA 5FXZA 2VMEA 5J98B 4DRVA 1GQPA 4AEDA 2VE1A 4PJYA 5LEKA 3NNMA 2H6BA 4IEQA 4GZ9A 4GQ7A 2VOVA 3UETA 5A1LA 1MS8A 1YYNA 1ZZ6A 2EIBA 2FCVA 2VO5A 1ZRFA 2AEZA 3H50A 1R1A3 2P3JA 4J1XA 5H9SA 1QXJA 2RR11 3I3MA 2PLV3 2R042 2W47A 2V73A 5BY5A 2DCJA 2VVDA 1BK0A 2UYBA 1JOBA 1FV3A 2A6VA 4QD2A 4UXAA 4AEMA 2VCBA 4QM8A 4PIYA 1GOGA 3GDBA 4E4SA 4O61A 2BDRA 1RHI3 1R1ZA 4URAA 1BMV2 2K46A 4R9CA 3N4MA 3AVRA 1L7QA 1R092 1OT5A 1BBT1 1GICA 1W2UA 3O0XA 1QOTA 1MEC3 3PU3A 3RSJA 2R073 3AM2A 3OEBA 2VZ3A 5J36A 4FFGA 3UKTA 2HEYF 4HPKB 2HWD3 4FOWA 3AXDA 5A32A 3JU9A 3NMBA 3B9IA 5BPXA 5A6YA 4FPFA 2OZ6A 4J25A 1CAWA 2VMGA 1WCUA 4CUCA 4GWJA 5ABJA 4YW4A 1GR3A 4EN6B 1QJFA 5C5UA 4XFCA 5D21A 1OA3A 1LECA 2A6XA 4JQTA 4TWTA 4AFDA 2WZR1 4LIUA 5FZHA 4COVA 2DUQA 3Q8AA 4HLTA 3TEWA 1RUC3 1PNFA 1Z7S3 5KXDA 4HVRA 5JZGC 3VD5A 2RM22 2RS52 5IVYA 3TN93 4BYYA 4ZU7A 2XHNA 3VBRC 3WF2A 1UPSA 3WINE 2Q1MA 2QZ2A 3UKVA 1RUJ3 3HQXA 2XH6A 2VMFA 4AQ6A 1LHNA 4GB32 2DVGA 2P3KA 1U0AA 3AMPA 3ALQA 1W6PA 5BNOC 4DUXA 2ZGOA 2VZUA 5JLVA 1YQCA 5DAPA 2BRTA 1UMHA 1ODMA 1GNYA 4HT1T 1MZFA 2D7FA 1AR93 4QQOA 3VD7A 3ASIA 3CKHA 1UMZA 5I91A 4ATFA 1KS5A 5F5QA 2D3PA 1MVEA 2Q0AA 1F5JA 4IGOA 4LULA 2BBVA 2B42B 5IJRA 2E7TA 3LFIA 2J22A 1RINA 4CXXA 5FDBA 4YVSB 5FAXA 5JR7B 1UYPA 3LSDA 4XJ8A 5DUVA 1VMJA 2B45X 2ADEA 4Q4X1 4QX5A 3OUHA 4AHXA 4CDWB 2PHUA 1NYWA 2H0VA 2XQRA 5A7NA 4CXYA 2RHPA 5F3IA 1UO9A 2C0ZA 5I0DA 3WDYA 2IXIA 2NZ9A 1MZEA 3AYCA 4LHKA 1RMU2 1YWKA 4CEYB 3GZEA 5IVEA 3MICA 3O1UA 4KBBA 2I07B 3NSTA 1RUG2 3VKMA 3FLPA 3C7HA 4YW3A 3E1F1 3DN7A 4FPGA 1RYYA 1NLSA 4Q27A 3WW2A 2ADDA 1S0IA 5A1FA 1S1AA 1YIFA 2WT0A 5FZ6A 3ZYBA 1A6CA 3E5XA 2R6QA 1K42A 2EXHA 4LO5B 1GOFA 1DZTA 2GC2A 4AQTA 5FUIA 1GZTA 1H2KA 2GH2A 3P3PA 2A6ZA 3HT2A 4OHWA 2BWCA 1C4RA 2YB7A 4IV3C 3PUQA 4HANA 2ZGMA 1E5RA 5FO9B 4R9AA 4IEYA 2YROA 2P2KA 4A7KA 2VUDA 5HXMA 4GALA 4LA2A 1D0HA 1WD3A 4X8PA 5CFCA 1LRHA 1NA1C 4CU6A 4Y1UA 1GWLA 3LWCA 2XXZA 5FZKA 4QXBA 5T50A 1R1A2 5F1RA 3M1HA 3WEZA 3DV8A 3C3VA 1XE8A 2XQXA 1D4M1 2WZ8A 4B1LA 4DZGA 4QXCA 5JIAA 2YBPA 5JWPA 1OPOA 1GP4A 1Y9QA 5GLVA 3SNMA 2ZX1A 1VBB3 3KCCA 2W1WA 4CDWA 1PIV2 2Q1FA 4AGVA 2DYCA 3BALA 3IDCB 2KA3A 5BXXA 1SCRA 4LMFA 3MIBA 5J1XA 3LIGA 5JR2A 1QHDA 1JBCA 3Q8BA 5K0UA 4D7SA 2BOIA 1W05A 3D0JA 2R1DA 5DMYA 1NCQC 4K21A 2F17A 2AUYA 1GANA 4YW2A 3GF6A 5FZCA 3O1SA 1PGW2 4MGSA 2DCZA 1QQP2 2PYTA 3DKQA 4EZ4A 2JD4A 2W46A 3ZSJA 2BGPA 4P14A 1C8M3 1O5UA 2A75A 4HN1A 5IFTA 1EYBA 1YHFA 4C90A 4Y1VA 1ZZ9A 3UKNA 2WFPA 3M70A 1UOJA 4QPGB 3AMNA 1LTEA 1LHOA 2EICA 4BM8A 1TMF2 4JC1A 2WQ8A 2JG8A 3I3BA 2YC2A 1PK6A 2XJUA 4OZOA 3VKLA 2YG0A 2Z42A 1JUIA 4LR4A 3VD3A 4ES9A 4FPEA 3H7JA 3ZFGB 5JOYA 4H7LA 1YQ6A 2BNOA 3VBSC 3HT1A 1SZBA 1WMFA 1MZ5A 4RHV1 4KWUA 4CP1A 4CU8A 4TXWA 5JSPA 2HWF2 3TNQA 4CDQC 4IEZA 1COV3 1UL9A 5FTTC 5FPUA 2YGLA 1VAVA 4MLOA 4Q0QA 5FY7A 3W20A 5EJ1B 1POQA 2DDUA 4W50A 3ST7A 2ZGQA 4P5YA 3VBOB 5A3PA 2A70A 1GLHA 2XBO2 1W9WA 3ZX7A 5F9TA 2DTYA 4C1WA 4XETA 1POV3 4UT5A 1G9FA 4IEPA 1QJU1 4IEXA 1O59A 1FOD1 4LBJA 3ON7A 2WDBA 5C4WC 3OF1A 3VGIA 3LOIA 1TE1B 1ZZ8A 4LBKA 1WUVA 3WY6A 1WA6X 1FNZA 5DDJ2 3H7YA 1QF3A 4QPIC 1Q56A 2JE8A 4TLGA 2ZMKA 4Z2AA 1RB8G 5FZ8A 4YZ1A 3VUOA 2VNOA 1YQ8A 3V65A 3WQ7A 4S2DA 2XHKA 4LTAA 2QFEA 3U07A 4AHYA 3MUZ1 2ZHNA 2J1VA 2G1MA 2VOXA 1W03A 3H3LA 4GWNA 3FLRA 4MX3A 2UWCA 3A22A 2CL2A 3WF4A 5JDBA 1NY72 4P00B 3GM8A 4YW6A 3VD4A 1VBD3 5A80A 3T0BA 4AOCA 1JZ3A 3E6DA 1OOPB 3PL0A 1LENA 1OHFA 2X10A 4IE7A 2YC0A 3BTAA 4FPKA 2HYKA 3ZIWA 3KB5A 1F9KA 1QOOA 4QPGA 4BIOA 5JMCA 3P5BA 4B7KA 1YFYA 4BQ4A 3FN9A 3LEIA 5APAA 5FMOL 2ETEA 2VMIA 3V0AB 1AF9A 4OHYA 2VMDA 2VQAA 5JPNB 3I2HA 1OQDA 3LQCA 2HWC1 3KV4A 4CDUA 3S0MA 2ZZQA 4MSVA 4XQWA 3WLUA 1STMA 4LBNA 4XFIA 1LEDA 4WBBA 3J8F1 1G86A 2JECA 4COYA 2DTWA 3THDA 1MS9A 1LOGA 2D3SA 2YUEA 2P17A 2NPIA 1ULEA 5FZOA 5FZDA 1WW5A 5FMOS 5ERLA 1R082 3I2JA 1RUE3 3VBOA 1QU0A 2N7GA 2ZEYA 1RUD2 3OBTA 4QQLA 3WT3A 3GCXA 1LHWA 4XQDA 1GFF2 2ZHMA 4QKDA 1IOAA 1O3QA 3JD72 1QNYA 1QXRA 3AKQA 3WVJA 4B4RA 3JZVA 2D6MA 4FQ4A 3O0VA 4K40A 4N9HA 4IE6A 1CIWA 4EV0A 2WL1A 3I3DA 1C5IA 2D6NA 1CGPA 1AR83 1K5MA 1UYYA 1W2NA 2VY0A 3Q8EA 4UW3A 4XF0A 1QNWA 1UYXA 1S2KA 2BYVE 5DZGA 5T5LA 3TEYA 4S2HA 3TEZA 2W52A 5CAZA 1HV0A 2VZRA 2VAUA 1R64A 3BPSA 4WVMB 2RS12 1OQ1A 2QQNA 4D3WA 5JVVA 4NR1A 4U36A 2R0HA 2XKOA 3FE5A 5JZGB 2WNEA 5DPNA 3N9PA 3U78A 5CNAA 5CU1A 4GD4A 3E5UA 2ET1A 2QTWB 3B3QE 2ORXA 4BWOA 2CHHA 4E2QA 2FQPA 1OOPA 1YUDA 3VDDB 3ZR5A 2OUHA 1VBE2 2WNUC 3H8OA 3S5QA 4XIKA 5BNOB 2OZJA 3DYPA 1SLCA 2XR4A 3CHXA 3VDAA 4BE3A 4NWVA 4B8EA 2ZKLA 1UY3A 3HAGA 1W0OA 5LZ6A 3WNNA 4Q2FA 3MIFA 4ASMB 4O7XA 4GMP3 5C3OA 4JZRA 2D44A 4FAGA 4Z82A 4M00A 2RR12 3CMGA 3N9OA 4XYXA 1V00A 1DYKA 1J3QA 2LW8A 4QDQA 5A7QA 4BQWA 1NE4A 4K20A 3Q8FA 5DN2A 3OBAA 4CCMA 4CXWA 5JXIA 4V1PA 4V2WA 2WKKA
chains in the Genus database with same CATH topology
2JIJA 3KT4A 4ZONA 3NNJA 4NAOA 2RDRA 5L9RA 4NMIA 4MHRA 4UWDA 2FCTA 5IAXA 4Q5OA 2HBTA 2G1MA 3EMRA 3NNMA 5HV0A 5DAVA 5EQUA 2HBUA 2FCVA 3PL0A 3OBZA 3MGUA 2JIGA 5DAQA 5LB6A 3GJAA 5LBCA 3NNFA 3ITQA 2OPWA 4IW3A 5L9BA 2A1XA 2G19A 4XAAA 5LBBA 3HQRA 4NHXA 5LBFA 5L9VA 5HV4A 3HQUA 5EP9A 3W21A 2FCUA 4XCBA 4Y5SA 3NNLA 5ERLA 2V4AA 4KBZA 4J25A 2RDSA 5DAWA 5LATA 5M0TA 5C5UA 3DKQA 3OUIA 3OUJA 5EPAA 5DAXA 3GJBA 5LA9A 2RDNA 4NHYA 5DAPA 4XABA 4MHUA 5LBEA 4XCAA 4NHKA 5IATA 4ZPIA 4XACA 2Y34A 2Y33A 3W20A 2RDQA 5C5TA 5LASA 5A3UA 3OUHA 4JZRA 4Y5TA 5IAVA 4BQYA 4BQXA 4XC9A 4BQWA 2RG4A 3BVCA 3KT1A 3KT7A 4NHMA 3GZEA 4NHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JIJ A;  3KT4 A;  4ZON A;  3NNJ A;  4NAO A;  2RDR A;  5L9R A;  4NMI A;  4MHR A;  4UWD A;  2FCT A;  5IAX A;  4Q5O A;  2HBT A;  2G1M A;  3EMR A;  3NNM A;  5HV0 A;  5DAV A;  5EQU A;  2HBU A;  2FCV A;  3PL0 A;  3OBZ A;  3MGU A;  2JIG A;  5DAQ A;  5LB6 A;  3GJA A;  5LBC A;  3NNF A;  3ITQ A;  2OPW A;  4IW3 A;  5L9B A;  2A1X A;  2G19 A;  4XAA A;  5LBB A;  3HQR A;  4NHX A;  5LBF A;  5L9V A;  5HV4 A;  3HQU A;  5EP9 A;  3W21 A;  2FCU A;  4XCB A;  4Y5S A;  3NNL A;  5ERL A;  2V4A A;  4KBZ A;  4J25 A;  2RDS A;  5DAW A;  5LAT A;  5M0T A;  5C5U A;  3DKQ A;  3OUI A;  3OUJ A;  5EPA A;  5DAX A;  3GJB A;  5LA9 A;  2RDN A;  4NHY A;  5DAP A;  4XAB A;  4MHU A;  5LBE A;  4XCA A;  4NHK A;  5IAT A;  4ZPI A;  4XAC A;  2Y34 A;  2Y33 A;  3W20 A;  2RDQ A;  5C5T A;  5LAS A;  5A3U A;  3OUH A;  4JZR A;  4Y5T A;  5IAV A;  4BQY A;  4BQX A;  4XC9 A;  4BQW A;  2RG4 A;  3BVC A;  3KT1 A;  3KT7 A;  4NHM A;  3GZE A;  4NHL A; 
#chains in the Genus database with same CATH topology
 3ZN6 A;  3MYX A;  4LLO A;  2RS3 2;  3ZMN A;  4C0H A;  4CE8 A;  4LBM A;  2K0G A;  4CCD A;  1Y43 B;  3ACI A;  4WM8 C;  1PVC 1;  1BLZ A;  1TME 1;  1UY2 A;  4NRO A;  1BBT 2;  3ZFF A;  4D94 A;  2UYA A;  5ACA 2;  1W6Q B;  2XVG A;  4KGQ A;  3QAC A;  1MQT C;  3KLS A;  2LS6 A;  5A7W A;  1FMD 2;  4BQ1 A;  1PX3 A;  4LBL A;  1K12 A;  1RVF 2;  2J1T A;  3IZO A;  1N3Q A;  5GKA C;  3I2O A;  3R4D B;  2R16 A;  3ACL A;  5CB7 A;  1DHK B;  3WNL A;  4EYU A;  2XUM A;  1GKB A;  3RZK A;  3CDZ B;  3CLP A;  1HRI 2;  1WCD J;  2OII A;  1MPX A;  2VJX A;  3FWE A;  5ANN A;  4JX0 A;  4UFK A;  4IV3 B;  4PHZ A;  4RD7 A;  1IGO A;  1HV1 A;  1J3R A;  5GZE A;  5FPA A;  5LBF A;  2A73 B;  4N90 A;  2Y6L A;  3BYW A;  3VBR A;  3HMY A;  5IVF A;  4WZC A;  3WP6 A;  3SH4 A;  1SFN A;  3W21 A;  3ZIX A;  2IWG B;  3RVH A;  3ZXK A;  1A8M A;  3KS7 A;  1NA1 B;  1EUU A;  2FBE A;  4FPY A;  4I3G A;  4MGY E;  3F95 A;  2VR4 A;  1NT0 A;  5EJ3 A;  1ZZC A;  4M4P A;  2QQO A;  1AYM 1;  2BW8 A;  2WLP A;  5T54 A;  4AK3 A;  3R4U A;  2WWU A;  3DXT A;  5F3C A;  3AFK A;  1AR6 1;  4PF5 A;  4LBQ D;  1KD7 A;  4FTE A;  2D6K A;  3AZY A;  3K48 A;  3KHC A;  3D4K A;  3PDQ A;  1HQW A;  2ARA A;  2G9F A;  1AZD A;  1WBL A;  4MGI E;  1Y9G A;  2VBB A;  4CPB A;  4Y24 A;  3VKO A;  1NLQ A;  4ZS3 A;  3VZK A;  3WD5 A;  1SG3 A;  2XUE A;  1ZBA 1;  1NCQ B;  3K3N A;  2ZAH A;  1IPJ A;  5JCT A;  3BB6 A;  5KXC A;  4X8N A;  1QJE A;  4Q4Y 2;  4XF3 A;  5FO8 B;  1QDO A;  3H1W A;  4LKS A;  1N1S A;  4FOY A;  2VNV A;  4IDZ A;  4NHY A;  2WNV C;  4XUQ A;  2VZV A;  2E9Q A;  1W9S A;  3INA A;  1VBC 2;  4LPL A;  4CCL A;  1WA4 A;  4HN0 A;  3T0D A;  2D6O X;  1BHG A;  4AQ2 A;  2XVL A;  5CYY A;  1JYC A;  2R06 2;  2F4P A;  2WYF A;  3LE0 A;  5IAT A;  1LB2 A;  1JH5 A;  4L8Q A;  1FPN 2;  3C8X A;  1CPN A;  1GNZ A;  2ZCW A;  3MHZ A;  3MI8 A;  4AQS A;  3C7O A;  2NMO A;  4CDX C;  1G9C A;  2Y33 A;  1S55 A;  1W2O A;  5LAS A;  3ZXG A;  1PO1 3;  2G4I A;  4IV3 A;  1DG6 A;  3OY8 B;  4R52 A;  3CJI C;  1YO8 A;  2IVJ A;  3SCG A;  3VBS B;  4MO3 M;  4CDQ B;  1RC6 A;  4BQY A;  2YBK A;  4NN0 A;  4QXH A;  4WM7 C;  2R32 A;  4IND A;  2JB4 A;  1WLW A;  2QCS B;  4RGK A;  1IQD C;  1VP6 A;  2WNO A;  2IUW A;  1LGB A;  2YBS A;  4Q26 A;  3BGA A;  2HWE 2;  4JV4 A;  4OHX A;  1DQ5 A;  4BIS A;  5FPX A;  1UKG A;  4YVS C;  5I93 A;  2BVB A;  2YGM A;  1WMX A;  4I01 A;  1CON A;  5JI7 A;  5LRS A;  4RFT 0;  2C5D A;  1O4T A;  4ET7 A;  1XYN A;  1YXW A;  2YPJ A;  1W28 A;  3PLQ A;  3O1R A;  3SH3 A;  2JEN A;  5C4W B;  4CU9 A;  2ZEX A;  1XXN A;  1RUN A;  1JYT A;  3ECQ A;  1V6L A;  3PUI A;  1RUI 2;  2C24 A;  4O9E A;  3MPB A;  1REF A;  1XC6 A;  4QPI B;  2GC1 A;  4AFC A;  2PLV 1;  1L7R A;  3OEA A;  4XBQ A;  3UT0 A;  1WCQ A;  2VD7 A;  3GZA A;  2FDK A;  2HEV F;  1LAJ A;  1HN1 A;  4PQQ A;  1PM4 A;  1C57 A;  4UFH A;  1NCQ A;  4AHZ A;  1ODN A;  2VC9 A;  2GZW A;  1G7Y A;  3MLJ A;  3O1V A;  4IEU A;  2QQJ A;  1SAC A;  3T4H B;  2W94 A;  2YXS A;  3CJX A;  4D7Y A;  3W9A A;  5IVC A;  1QJX 2;  1RHI 1;  4QDS A;  1Y4W A;  2IFR A;  4RL7 A;  1S0G A;  3PVO A;  2DBI A;  1U12 A;  3NV4 A;  4BH9 A;  4XAE A;  3T2T A;  3SXW A;  4LK6 A;  3RZG A;  4PI2 A;  2CSG A;  1MEC 1;  4QMA A;  2R07 1;  3IBM A;  1S0D A;  3HQU A;  4FPJ A;  4M3C B;  2HWD 1;  4HMZ A;  3T1M A;  3WG1 A;  1H9P A;  3LAG A;  5LCW L;  3QH6 A;  3KF5 A;  2R04 3;  3DGT A;  5FUN A;  3I2I A;  3ETQ A;  4ZXK A;  5GLT A;  1PGL 2;  1N3P A;  2IXL A;  3ZXD A;  1TG7 A;  3MLK A;  4FP2 A;  3VBS A;  1IHM A;  1UZ0 A;  1YNA A;  1W39 A;  4QPY A;  3AYE A;  4CDQ A;  5A3W A;  4FPC A;  5FBJ A;  1RUC 1;  2X8K A;  1PZ9 A;  1Z7S 1;  4XFG A;  1HKD A;  5IHR A;  5FZM A;  5T55 A;  1VMH A;  4Q4V 2;  1R09 3;  2DVD A;  2Q4S A;  3TN9 1;  3M3O A;  3DYO A;  1AR7 1;  2JKX A;  2WS9 2;  4L2N A;  4YVW A;  4COW A;  1RUJ 1;  5IT6 A;  1W6M A;  3SLI A;  2VOW A;  2OT7 A;  4QHO A;  5BNN C;  1ZA7 A;  4A7Y A;  1KQR A;  2A5Z A;  5C4W A;  3SCH A;  1AR9 1;  4Y5Z 0;  4QX7 A;  4YZ3 A;  1EUT A;  2BFU L;  4DEV A;  1YRZ A;  1H6Y A;  4UFM A;  3M2M A;  1A3K A;  1CES A;  3GJB A;  3O14 A;  4H14 A;  1WZX A;  2GN3 A;  2BBA A;  4QPI A;  4F83 A;  1ZRC A;  1KRI A;  2Y6K A;  2CWM A;  3BIW E;  4NPM A;  4Q4W 2;  4AZZ A;  4DIQ A;  5CBL A;  2CDO A;  1GBG A;  1OC1 A;  1GQH A;  1ZM1 A;  2RM2 3;  2RS5 3;  4NHK A;  3S7E A;  4IEV A;  3BIE A;  3KZ4 C;  3M3Q A;  2QUO A;  1QDC A;  1UNB A;  4UBH A;  5KWR A;  4BA6 A;  4GB3 3;  4R4X A;  3GHN A;  1OA4 A;  4JDO A;  1C28 A;  4WVZ A;  2RDQ A;  2YPD A;  3Q9O A;  5F32 A;  3ZLI A;  5CKM A;  4A42 A;  4BQ5 A;  5D2A A;  5EIY B;  1OQE A;  4AF9 A;  2HYX A;  1W8N A;  2WNU B;  1H2N A;  2ZX0 A;  4PF1 A;  1FNY A;  4I02 A;  4XC9 A;  4M3C A;  4ISQ A;  3PVB B;  1DYO A;  2ZGT A;  4QHB A;  1H4G A;  2JDN A;  4C8D A;  4K1Z A;  4NHL A;  4AFA A;  3VZM A;  5FY9 A;  1FAT A;  1EAH 2;  3M3E A;  1SCS A;  4L97 A;  5IK4 A;  5LA1 A;  1LOB A;  1JOD A;  1T2X A;  3I2F A;  3N9L A;  1YI7 A;  4E9K A;  2W1Q A;  3E6B A;  4OYU A;  4QX2 A;  1H8T C;  2W9X A;  3POF A;  5KHK A;  2VUA A;  4EZH A;  1DQ0 A;  1LJ7 A;  3GCW A;  3SKV A;  1RMU 3;  2XVK A;  5EHD A;  5G05 L;  2E6V A;  1AJK A;  1HXS 2;  1OFN A;  4FPH A;  3ME2 A;  4MH0 E;  4NE9 A;  4PBO A;  4RQP A;  5EFU A;  4WM8 B;  4KWL A;  3UV9 A;  4P9L A;  1NAE A;  3R0R A;  4KMQ A;  4IE5 A;  5T5J A;  3S7I A;  1XNB A;  4FXK B;  1I6X A;  4IET A;  2Z4F A;  3OBZ A;  1MQT B;  2JWP A;  2Y60 A;  2DVA A;  4LJH A;  1O8P A;  4QX3 A;  2D3R A;  2AEY A;  2OPW A;  3RDI A;  4L99 A;  3N36 A;  4AR2 A;  1US3 A;  2G19 A;  4N53 C;  1CAU B;  5LBB A;  1W8O A;  2XKP A;  1RUF 2;  2O1Q A;  1L7L A;  1VBB 1;  4QAW A;  4Q8L A;  3O1P A;  1AX2 A;  3FFZ A;  4QGL A;  1UIJ A;  1HRV 2;  3K3O A;  4X6Q B;  3KM5 A;  4AI8 A;  4DXR A;  5D8A C;  1RIT A;  2ZXQ A;  4OVE A;  2VQ0 A;  1TVG A;  3DPR C;  4TTG A;  1UOB A;  3BU7 A;  1OUR A;  5GZD A;  1QOS A;  2O8Q A;  1RUH 2;  5SV8 A;  2X5I C;  1ZX5 A;  3JBG 2;  2TNF A;  5FYB A;  1FX5 A;  1OVP A;  4P08 A;  3WW1 A;  5JIU A;  5A3N A;  4C1X A;  2BWA A;  5FZA A;  4QT6 A;  2Q30 A;  4IGP A;  1V9U 2;  4PIZ A;  1C8M 1;  3V56 A;  3FHA A;  3OYW B;  2XG3 A;  1RED A;  5C71 A;  4S2F A;  1F31 A;  5LY1 A;  4ZXE A;  1JHN A;  3AB0 A;  1NCR C;  1PIV 3;  1X9P A;  2Y0O A;  4Z2W A;  5FUP A;  5FYV A;  3DXU A;  2BNM A;  1ZRE A;  3POW A;  4MGZ E;  4I2O A;  3OUJ A;  3RS6 A;  3ZXL A;  4DUV A;  4CZS A;  5BNQ A;  3HBK A;  2QE3 A;  5EXO A;  3CL1 A;  3KGZ A;  2GME A;  2VOT A;  3FLT A;  4OQ9 A;  4UBG A;  1ZRI A;  4MZU A;  5I8S A;  3LOB A;  1OBN A;  4BXF A;  4I0B A;  3LIH A;  4YAR A;  4JVA A;  1COV 1;  1QQP 3;  5AC9 2;  1VJ2 A;  1PGS A;  3HWJ A;  1YCI A;  1S0C A;  4L92 A;  2NQY A;  4MHU A;  2CAU A;  2ZAB A;  1CAV B;  1UPI A;  2VH9 A;  1ENX A;  2WFF 2;  4XJA A;  3Q8C A;  5FJK A;  1XE7 A;  4UW4 A;  3MEP A;  4LXL A;  3ZDS A;  5F3E A;  4HVO A;  1N1T A;  2EA7 A;  2WNV B;  5C6C A;  1UMI A;  1ULG A;  1TMF 3;  3GAL A;  2WRA A;  3POG A;  1W9Y A;  2UWB A;  2VZ1 A;  1WW7 A;  4R8H A;  4P9W A;  3NKT A;  2C6S A;  4SLI A;  4Y1X A;  1ALY A;  3FBM A;  2J1U A;  3GBF A;  3PIG A;  5LY2 A;  3VDD C;  4CDX B;  2RJ2 A;  5IYY A;  1XYP A;  3BCW A;  4G4F A;  2HWF 3;  3MZH A;  3HIF A;  3OD0 A;  3C7G A;  4IV1 C;  2BOJ A;  1OKQ A;  5DUU A;  2Y8K A;  3CJI B;  4XFH A;  4HET A;  3AYD A;  2K9Z A;  4RS5 C;  5CKQ A;  1K45 A;  2PN5 A;  2VTX A;  4B3N A;  3W5N A;  4WM7 B;  4FI9 A;  4G3Y C;  3SKJ E;  2XBO 3;  5KR7 A;  4LT5 A;  2H6C A;  2CWS A;  3KWV A;  5FXX A;  3MBW A;  4FVV A;  2KXL A;  2PTM A;  1VBD 1;  2B7Y A;  3L2Y A;  4MXV A;  1LGN A;  2PHT A;  3OYW A;  2HBT A;  4RGG A;  2HWB 1;  3SIS A;  2P3I A;  1VLN A;  3NKG A;  3EMR A;  5FY1 A;  1OA2 A;  1CR7 A;  3ZYR A;  3RWN A;  4XW3 A;  1U5I A;  3PMS A;  4FT8 A;  1UU6 A;  4H55 A;  5DDJ 3;  3VDC A;  4YW7 A;  1JYN A;  1AL2 2;  4UOJ A;  1LKN A;  3I2D A;  2EAK A;  2JIG A;  3LZZ A;  3AL5 A;  2VCA A;  3EQE A;  5FO7 B;  4AGG A;  3VZJ A;  1D2S A;  1XBF A;  4E8D A;  4ZS2 A;  3IM0 A;  4HPK A;  3I59 B;  4UYB A;  5ANQ A;  5L9B A;  4EWE A;  3IDE A;  5K7P A;  2HH9 A;  2O0O A;  4W8J A;  3BI3 A;  1QWR A;  5FY0 A;  3MW4 A;  1M06 G;  2CGN A;  1HQL A;  4P9Y A;  5A3T A;  1WLT A;  5EP9 A;  2BJS A;  4KG0 A;  1RUE 1;  4ZKT B;  4GAZ A;  3RQ0 A;  1KFU L;  3N9Q A;  1WLC A;  3RZJ A;  2VNG A;  1JOP A;  2WNV A;  4XCB A;  5L73 A;  2XJR A;  1W9T A;  4JGZ C;  5FZ3 A;  1LEM A;  2E32 A;  2A71 A;  1EV1 3;  1LES A;  5KC6 A;  2V72 A;  1NQJ A;  2D43 A;  5K4L A;  1O3R A;  1A8D A;  5F7U A;  1AL0 G;  1Z0H A;  1NXM A;  1IS6 A;  2EF6 A;  5DZE A;  2EID A;  1AR8 1;  3O1M A;  4CDX A;  1OD3 A;  2NMN A;  4W4Z A;  3WF3 A;  5IVV A;  4DQA A;  4KL1 A;  3IDA A;  2ZKN A;  3OGR A;  4JTN A;  1DDL A;  1ULP A;  2WWS A;  3CJI A;  3TAY A;  3NL1 A;  1R08 3;  3D8C A;  3KQR A;  5EV7 A;  1ZZB A;  1BVP 1;  2W1S A;  1H2M A;  3HD8 B;  1RUD 3;  3N35 A;  5CKN A;  3WF0 A;  4CEW C;  4A3Z A;  1SFY A;  2QQW A;  3GNE A;  2V09 A;  1TNR A;  4JAA A;  5FKB A;  3JD7 3;  1ASJ 1;  1OLQ A;  3NJY A;  4YVS A;  1SBF A;  1W0P A;  3TB0 A;  3HNM A;  4XZP A;  5FIX A;  2B9V A;  5KBF A;  1JYV A;  4J6G A;  3ACF A;  3ORJ A;  4XTP A;  3WV6 A;  5J3U A;  4NII A;  5BNN B;  4HK8 A;  1AYN 3;  1KS4 A;  2Q8D A;  1UWW A;  1KFX L;  4JTO A;  3WCR A;  2LRO A;  4N43 C;  2V5Y A;  4CCE A;  1J83 A;  4GMP 1;  3NJZ A;  4XPV A;  2GNB A;  5FRE A;  1U5X A;  4CEY A;  1JZ2 A;  1ZBE 2;  3IMM A;  4MOA A;  4DPN A;  1JN2 P;  1Q43 A;  3OCP A;  4QX1 A;  2RS1 3;  3AZV A;  3D3A A;  4NUB A;  4HVQ A;  3MF9 A;  5BV6 A;  5LEJ A;  3S30 A;  2YZ4 A;  3AMQ A;  4Y20 B;  4Y5T A;  5A3U A;  1YFU A;  5BNP C;  2MEV 2;  1GP5 A;  2MHF A;  2YDE A;  3ILR A;  4HSL A;  2CGP A;  2J7M A;  1QJY 2;  5C9A C;  2CYF A;  2VW2 A;  2IXK A;  1VAM A;  1VBE 3;  2RG4 A;  3KT1 A;  5KXE A;  3U37 A;  2YU1 A;  4ES8 A;  5CFD C;  3KCY A;  4IER A;  1LHU A;  5T5O A;  5H9P A;  1WKY A;  2LRP A;  5CIR A;  5FY5 A;  3S57 A;  3KT4 A;  2FDG A;  2VNR A;  1OMI A;  1XPW A;  5GAL A;  4AG4 A;  4BME A;  3J26 N;  5A6Z A;  4KWK A;  2RR1 3;  2XLF A;  4NPR A;  4LUK A;  3N9N A;  2B46 X;  3LEM A;  3M7A A;  4N8M A;  3SEP A;  2BP6 A;  2XDV A;  5HCF A;  1BEV 2;  2P4E A;  1MS3 A;  1POV 0;  4KU8 A;  1NG0 A;  2C4X A;  4MGK E;  3FHI B;  3POB A;  2ARB A;  5FY4 A;  1VBA 1;  2Q8O A;  1KDM A;  3IPV B;  3WCS A;  2RS3 3;  3JCI A;  3VV1 A;  5FMB A;  1OKO A;  1H8T B;  2WUH A;  4RSU A;  2UUR A;  2RE9 A;  5FYC A;  3U4S A;  4ZU4 A;  1BBT 3;  1U5Y A;  3HJR A;  1AR7 2;  5FYT A;  5FYH A;  5ACA 3;  2FDH A;  4YYO A;  4AVC A;  1FMD 3;  2QQI A;  3UES A;  1Y3T A;  5FK8 A;  2YFZ A;  1L3J A;  3U10 A;  4CCO A;  2XL9 A;  1ND3 C;  5FZB A;  1RVF 3;  2JDM A;  1B09 A;  1TQ5 A;  3T08 A;  2Y64 A;  5FLI A;  4QPW A;  3BTX A;  3RPQ A;  3L9J T;  4BIF A;  3ZSM A;  5A1A A;  2VZS A;  5E16 A;  3VBU C;  2P5B A;  1HRI 3;  2AR6 A;  4IEW A;  2ENR A;  2E63 A;  2ZS6 B;  4JCK A;  5FP8 A;  3T2P A;  4QKN A;  1MS1 A;  2XL7 A;  2QZ3 A;  3C2U A;  4A44 A;  5AFB A;  4N53 B;  1SBE A;  4YWA A;  5FBZ A;  2BNN A;  3DEC A;  4B4Q A;  4D6Q A;  3ZYJ B;  1CX1 A;  1T6B X;  1W06 A;  2NYY A;  4QXK A;  1NUK A;  1VRH 2;  1CJP A;  2XJQ A;  1UCX A;  4P9X A;  2CGO A;  2SBA A;  5IWF A;  5D8A B;  3NW4 A;  2R1B A;  4IUG A;  5FMC A;  1GQG A;  2WA4 A;  3DPR B;  1EV1 2;  1UF2 C;  4XIO A;  1W3V A;  5F39 A;  1JYI A;  2A7A A;  3E97 A;  1JXN A;  2X5I B;  2Z5W A;  3O5S A;  3ZFG A;  3W59 A;  1A78 A;  3LDR A;  5GLZ A;  5FZ7 A;  2XJP A;  1KXG A;  4KWJ A;  3BOD A;  3THT A;  4JKK A;  4NJ4 A;  4CUA A;  5A6X A;  2JXA A;  4LIT A;  1HDK A;  4YGE A;  4COU A;  4TZD A;  2E33 A;  3WP3 A;  1IKQ A;  3I4I A;  3IIA A;  1BVV A;  4OUM A;  1NCR B;  1WGP A;  2RDN A;  3IPV A;  2VZT A;  1DF0 A;  2RMU 2;  4Y3O A;  4NPL A;  2Z79 A;  2XWJ B;  1I5P A;  3WHT A;  4B7E A;  4WVW A;  2P37 A;  1GWK A;  4RGA A;  4XCA A;  4I30 A;  1UYZ A;  1PO1 1;  3AMH A;  4LHS A;  4XQ4 A;  2OQ7 A;  1SLL A;  4QKB A;  2XWB B;  3DUI A;  4ZPI A;  4Q4Y 3;  4XAC A;  3M3C A;  3QCW A;  3K77 A;  4FP3 A;  1AYN 2;  3NWK A;  1F15 A;  4HBN A;  4LOS A;  3WZ1 A;  4LIV A;  1RJ7 A;  1W8H A;  4P9G A;  4BB3 A;  1WME A;  4AVT A;  1T6G C;  1VBC 3;  3N7J A;  4NO4 A;  2WAB A;  5FP4 A;  2OXB A;  2R06 3;  1ENS A;  2VOK A;  4BK5 A;  1JUH A;  1FPN 3;  5C8C C;  3B02 A;  4YFW A;  3OGS A;  4FSJ A;  4FPO B;  4NIH A;  2BU9 A;  2X05 A;  2JIJ A;  1RGS A;  3R05 A;  1DQ4 A;  3III A;  3NAP C;  3ZXA C;  1PO2 1;  4GMP 0;  2D5F A;  2RDR A;  3V0B B;  1Q8Q A;  2NP0 A;  3AFG A;  5L9R A;  5LRR A;  2AAC A;  4RR3 C;  3O1T A;  4IV1 B;  5FLH A;  3U14 A;  5D8A A;  1MS4 A;  3ACH A;  4GKY A;  4Q5O A;  3DPR A;  4I0A A;  2HWE 3;  4RS5 B;  1S0E A;  3V0A A;  2YU2 A;  2RV9 A;  2UU8 A;  1I9R A;  2X5I A;  5A6Q A;  3ZKU A;  5BUV A;  4AED C;  5E88 A;  4RFR B;  3HBZ A;  5T5P A;  3M3I A;  4JKM A;  4WVV A;  1H6X A;  1QGL A;  3OB8 A;  1SDD B;  1ULF A;  3HNY M;  4YG0 A;  4UFL A;  3ZPO A;  3P3N A;  1WCK A;  3ROU A;  5T3N A;  3ZSL A;  4LKF A;  1NCR A;  4OI2 A;  1RUI 3;  4F7Z A;  1WD4 A;  2WII B;  3ZSK A;  2R04 1;  3ENR A;  3CO2 A;  3H9A A;  1W99 A;  2SLI A;  3OOX A;  3VBF B;  5J7M A;  3SCF A;  3O0W A;  2LM3 A;  1D7P M;  4QU1 A;  1GUI A;  2QKD A;  1H9W A;  3GYD A;  4K8R B;  4ISR A;  3RI8 A;  4FFH A;  4ASL A;  1E5S A;  1DLL A;  3IB3 A;  5HPO A;  1HIX A;  1QJX 3;  1W9F A;  5J96 B;  4IEO A;  4YLZ A;  1BMV 1;  2F6B A;  1S0J A;  3OGG A;  2QVS B;  1R09 1;  4D7T A;  5EJZ B;  4K6B A;  3AJY A;  3DYM A;  1XNK A;  3UL2 A;  2WZR 2;  2YV8 A;  1DQ2 A;  1QY4 A;  3POS A;  4WVM A;  1W2A X;  4JGZ B;  2ZJC A;  2JG9 C;  3JQW A;  1JZ6 A;  1FAY A;  3CF6 E;  3VZN A;  1QKQ A;  3A21 A;  3EBR A;  5JZG A;  4W6X A;  5ABJ C;  2RVA A;  1F4H A;  3KVA A;  2ARX A;  4W6W A;  3VL8 A;  4XF4 A;  1N1Y A;  1OF3 A;  2ZGL A;  4HON A;  5AVP A;  3ZFE B;  3VDD A;  1V6K A;  3N9M A;  1NQD A;  4GKX A;  1X9T A;  5BNO A;  4DO0 A;  4QGM A;  5FJH A;  2EAA A;  2R30 A;  4OI0 A;  3H8U A;  2DWR A;  1X7N A;  1YFW A;  5EPA A;  3K2O A;  3VKN A;  4Q4V 3;  2RM2 1;  2RS5 1;  1XNA A;  4RS5 A;  2NN8 A;  2IXJ A;  3RFR A;  5LA0 A;  1H1A A;  4CCC A;  2WS9 3;  3ZN5 A;  1SEF A;  4CEW B;  1DBN A;  2ZGR A;  1QH7 A;  2JX9 A;  1Q8O A;  4XAB A;  5CAD A;  3MPP G;  1ZNP A;  4GB3 1;  4HXC A;  3J4U H;  3JB4 C;  4YSF A;  1MS0 A;  1LU1 A;  2G9Z A;  4HFS A;  4Q4X 2;  2VUL A;  4YFZ A;  4LBQ B;  4KU7 A;  2XLG A;  4AVA A;  1JU4 A;  3U4X A;  5FZI A;  1CN1 A;  5A7P A;  3IDB B;  3GZT B;  5FPV A;  4NIA A;  3ZSE A;  3SH5 A;  2HKX A;  3VHP A;  2R49 A;  2DCK A;  2FMD A;  2MNG A;  4LO4 B;  4L0P A;  2BGO A;  4N43 B;  3VD9 A;  1RXG A;  3CIH A;  4Q4W 3;  3ATG A;  3MFC A;  1XOY A;  1H30 A;  3BU0 A;  5FYZ A;  2P6C A;  2A3Y A;  3T09 A;  1W6Q A;  2WSU A;  1MVQ A;  4B4P A;  2A6Y A;  4A3X A;  2ZZJ A;  3C7F A;  1OLM A;  1OH4 A;  2WBK A;  3POJ A;  5BNP B;  5KC5 A;  1W6N B;  2Q5T A;  2E31 A;  3A4U A;  3ES4 A;  3W5M A;  3NV1 A;  1RMU 1;  4Q0P A;  5C9A B;  1H0B A;  3LA7 A;  5DG2 A;  1UX6 A;  3I49 A;  4LOT A;  4QQH A;  2ZGU A;  4MGQ A;  2DCY A;  2Y6J A;  4FOV A;  1LUL A;  2E7Q A;  1RUG 1;  5C70 A;  2C9A A;  1O8S A;  2JKB A;  5CFD B;  1ZRR A;  4K9S A;  1ZVF A;  2KR2 A;  3VKF C;  5JAX A;  1O7F A;  2E26 A;  2LTN A;  3OGJ A;  1CZS A;  2NM1 A;  3IAQ A;  5H9R A;  1NZC A;  2PHR A;  3QOP A;  1AVB A;  5F2S A;  1JZ8 A;  5HCH A;  2I2S A;  1EAH 3;  4D69 A;  3MF6 A;  1U5Z A;  1RTV A;  5FZG A;  3FJS A;  1YEW A;  3DKW A;  5JXH A;  4UI9 L;  3RMY A;  1VE0 A;  2VCC A;  3PJQ A;  3KMH A;  5FZE A;  1NA1 A;  2ZOE B;  2TBV A;  3ZYF A;  1RL3 A;  2GNT A;  2GSY A;  1C5H A;  3HOB A;  3B00 A;  4BQ2 A;  3RZH A;  1HXS 3;  4NWW A;  2W95 A;  3D6E A;  3GZU C;  4CEW A;  2MPF A;  2JEM A;  2W39 A;  1D4M 2;  4XVH A;  5I0S A;  1AXZ A;  2GC3 A;  5FXW A;  3TWI A;  1CZT A;  1REE A;  3TYJ A;  4SBV A;  4LHL A;  1XRU A;  4A2U A;  2X09 A;  1GU3 A;  2OQ6 A;  2PHL A;  4LBQ A;  2WA3 A;  1BZW A;  1G9D A;  3OTF A;  4N7I A;  3UYJ A;  1R1A 1;  3SQO A;  1O4Y A;  3H8X A;  1ND3 B;  4V2V A;  3NNL A;  4DNY A;  3S5A A;  1O6U A;  2IVI B;  5FP3 A;  2Z69 A;  4I3P A;  1XSQ A;  4N43 A;  4QB2 A;  3VBU B;  4OHZ A;  5FWJ A;  1RUF 3;  5C3S A;  2VVF A;  4OFG A;  3OGV A;  1W6O B;  4W65 A;  5DAW A;  2Y0I A;  1BK1 A;  4ONU A;  3TBD A;  1NXD 1;  1PIV 1;  4XFB A;  2VTF A;  1UY0 A;  1JHJ A;  1HRV 3;  1W3X A;  5A70 A;  4XXP A;  5K0U C;  5BNP A;  1W6N A;  3UNP A;  3HR9 A;  4BK4 A;  2DVF A;  1H8V A;  3ZN4 A;  5C9A A;  2Y38 A;  4OQ8 A;  4XF1 A;  1RUH 3;  2OS2 A;  5FR3 A;  1PGW 1;  3P1I A;  4PI0 A;  3JBG 3;  3NV3 A;  1SLA A;  2BTV C;  3OUI A;  4XDO A;  1QQP 1;  2JDZ A;  2P3Y A;  4GH4 C;  4XZU G;  4E2S A;  5FV3 A;  1GZ9 A;  1V9U 3;  1UD1 A;  3T3Y A;  4LBO A;  2PMW B;  3OY8 A;  4RHV 2;  3T4V A;  4QB6 A;  3PUR A;  3PTY A;  3AKP A;  3WDW A;  1TMF 1;  3CZJ A;  1PK6 C;  5FP9 A;  1Y9M A;  2KM2 A;  5JPM B;  4BCU A;  1OFS A;  2YHJ A;  3WG3 A;  4JGY C;  2LUW A;  1V70 A;  1E5I A;  2AGS A;  5JSO A;  5C5T A;  1DQ1 A;  1V6J A;  2HWF 1;  3LPG A;  1QJU 2;  1V6I A;  1W2T A;  1FOD 2;  5EZW A;  5AC9 3;  5FK7 A;  4LLF A;  2JIC A;  5A33 B;  1LCL A;  3KT7 A;  2WFF 3;  4ZZ8 A;  4DXT A;  1K5J A;  3A0K A;  1KEX A;  4XUN A;  2XBO 1;  1JS9 A;  3I97 A;  3MV0 1;  1ND2 C;  4J1W A;  3WNX A;  1YC6 1;  2ZGN A;  1AJO A;  3P6B A;  4KG8 A;  4MXW B;  2W68 A;  3NRU A;  3WNP A;  3AP4 A;  3B93 A;  3IAP A;  4QU2 A;  2AEN A;  2FD8 A;  1SMV A;  4L9B A;  3JXS A;  5C8C B;  2W5F A;  3AK0 A;  2BFU S;  4UWD A;  3LA2 A;  5DDJ 1;  4B29 A;  3MV1 1;  5FOJ B;  4AW7 A;  4ZU5 A;  4DOU A;  2EVX A;  1AX0 A;  3NAP B;  4COZ A;  4TSV A;  4AHW A;  4CTE A;  1VIW B;  1GV9 A;  5C33 A;  1XJA A;  3WQ1 A;  4FBF A;  4IXL A;  5FXV A;  5DQ0 A;  1IG0 A;  4RR3 B;  4XHB A;  2QNK A;  4Q8K A;  4GWM A;  1UZW A;  4ZZ5 A;  2ILM A;  2CDP A;  4LKD A;  1ULO A;  1YLL A;  2Y6F A;  4KH9 A;  4YGB A;  4FOQ A;  5C3P A;  5LB6 A;  1NY7 1;  4EWD A;  2J42 A;  4YW5 A;  1X33 A;  3EYP A;  2DUR A;  3DL3 A;  4IW3 A;  2HWC 2;  2P6H A;  4AED B;  5FOB B;  1NZI A;  1EP0 A;  2YMZ A;  4XAA A;  1UOF A;  3J8F 2;  1GWM A;  3GHM A;  1V6N A;  1EY2 A;  1UXX X;  2TEP A;  4KNC A;  1W0N A;  4CA9 A;  3BOW A;  2ZHL A;  4FCA A;  3FMG A;  4TYS A;  1AL2 3;  3ZYI B;  1F8V A;  1I5Z A;  4LK7 A;  5IK8 A;  5FPL A;  2J1A A;  2OPK A;  1F2N A;  2Q8E A;  2B39 A;  1AX1 A;  1CJD A;  1EPW A;  1UW8 A;  4AI9 A;  4CRQ A;  4IL7 A;  4KQ7 A;  4CDU C;  1PMH X;  5AFE A;  1VAK A;  1CZV A;  1ZBA 3;  2VMH A;  1RJ8 A;  4KBZ A;  2NLR A;  2YY1 A;  2ZX4 A;  3PVE A;  5FY8 A;  2VL4 A;  1R08 1;  1SFP A;  1X82 A;  5F5C A;  1YIP A;  3KGL A;  4KGG A;  1RUD 1;  3NQH A;  2WZP P;  3LCP A;  3JD7 1;  4YW1 A;  5FZ1 A;  3WUC A;  2CAV A;  2PQQ A;  3OPZ A;  4FPL A;  3AP9 A;  4MAD A;  4ERO A;  4AXO A;  5A32 B;  3ZXF A;  5LK5 A;  4AVV A;  2JG9 B;  4W6Y A;  4OMD A;  4R9B A;  2CNA A;  2JDY A;  3D82 A;  5ABJ B;  4NRQ A;  5DAB A;  1MR5 A;  5FZL A;  3T30 A;  3NAP A;  1KGY A;  4YM1 A;  4ARX A;  1UIK A;  4OCT A;  4N7U A;  4BDV B;  2WNU A;  3BTZ A;  1RUO A;  5GLW A;  2WAA A;  4DIN B;  2RS1 1;  4RR3 A;  4PIX A;  5JOX A;  1LNS A;  3PTR B;  1WCS A;  2CY6 A;  2GMM A;  4NRM A;  2WQ4 A;  2D93 A;  2W1U A;  3VLB B;  1VRB A;  4XJZ A;  3ZPY A;  2ZML A;  3NNG A;  4PQ9 A;  1CPM A;  1VBE 1;  1W6P B;  2BER A;  2V5D A;  2VUJ A;  4XJ9 A;  4YM2 A;  4YNI A;  2KD7 A;  2VCM A;  5A7S A;  5TSW A;  3U11 A;  1VPH A;  3K4D A;  1IPK A;  2V4V A;  5CZK A;  2BQP A;  5BYN A;  2W92 A;  4ITC A;  4PT6 A;  5FPB A;  1SDW A;  3PU8 A;  4LE3 A;  1KJR A;  1ZBE 3;  4PDW C;  5HCA A;  5ISL A;  1PVC 2;  1DZQ A;  2VEC A;  1TME 2;  3FL7 A;  4WM8 A;  4DS0 A;  3MIE A;  4YZ2 A;  1XNC A;  2W08 A;  4LEJ A;  1HB2 A;  3BPZ A;  2FMY A;  3N7L A;  2MEV 3;  3M4F A;  4ORF A;  3VZL A;  4O65 A;  1MQT A;  4RA0 A;  3WSO A;  3H42 B;  1QJY 3;  1PMJ X;  2RS3 1;  3ZKY A;  4N9I A;  3S6P A;  5DXD A;  3USU B;  1AUY A;  1J1T A;  2X29 A;  4M0N A;  1DP0 A;  1POV 1;  4NRP A;  4DXZ A;  1QIQ A;  1Q5O A;  2P1B A;  3ZFF C;  1VB2 A;  1CAU A;  2VMC A;  5C3Q A;  1FI2 A;  1HX6 A;  2DF7 A;  5ACA 1;  1IS4 A;  3WNO A;  5E89 A;  4DY5 A;  2XJS A;  5DAV A;  4BHP A;  1YQ2 A;  1FMD 1;  5LA2 A;  2HJI A;  3T2Q A;  4EJR A;  2JG9 A;  4OLL A;  4HL0 A;  1RVF 1;  5F3G A;  3CU7 A;  5FRA A;  2VZQ A;  4AWD A;  1W8Z A;  1XSR A;  3A0N A;  3MLL A;  1BEV 3;  5LW9 A;  1G9A A;  3WF1 A;  2D97 A;  5L7O C;  1HRI 1;  1D4V B;  1RIR A;  3WX5 A;  2VTX J;  2WLQ A;  4XE9 A;  3PVN A;  3U75 A;  1O3T A;  2WT1 A;  5L9V A;  4R4Z A;  3O7O A;  1Z78 A;  2CTV A;  2ZBJ A;  1ACC A;  4E4D X;  2XB6 C;  3WR0 A;  3N7M A;  3ABZ A;  3FC0 A;  1AR7 3;  2JE9 A;  4OI4 A;  4Y1Z A;  5JOW A;  1V6O A;  1OUS A;  2QQK A;  2ZGS A;  2IC1 A;  1AYM 2;  2XJT A;  4PLM A;  5JXG A;  4Y5S A;  4I0W B;  3O12 A;  1KJL A;  4HK9 A;  3B5L B;  2I74 A;  3AZX A;  5IVB A;  2WQZ C;  1AR6 2;  5GM0 A;  5CFC B;  2XPJ A;  3C7E A;  3GBG A;  3K4A A;  1C8N A;  2V4A A;  3VBF C;  1UZY A;  2WN3 A;  2ZA9 A;  4AVS A;  4Q0V A;  4JRA A;  4P02 B;  4A6S A;  2DUO A;  4M0H A;  1MAC A;  4YM0 A;  4BPZ A;  1ZBA 2;  1WBF A;  3ACG A;  2D98 A;  2OKX A;  1SLI A;  2PXJ A;  1NKG A;  4LE4 A;  2PFW A;  2XJV A;  3TOJ A;  4YRD A;  1YFX A;  5E8A A;  1CAV A;  3WW4 A;  2OW4 A;  3AP6 A;  4Q1R A;  4NVP A;  1VRH 3;  1LOF C;  1H2L A;  2DFB A;  2W2I A;  4UW6 A;  1O3S A;  2YYO A;  4M3C E;  1OSG A;  1Y7B A;  3IMN A;  3USU A;  1X8E A;  5K0U B;  5LK7 B;  2ZEW A;  2A6W A;  1ST8 A;  5FPZ A;  3MW3 A;  4UFJ A;  2PA7 A;  4AYU A;  1QXP A;  3O1O A;  3JQX A;  4Q4Y 1;  2WIN B;  3RJR A;  2ID4 A;  3ZYG A;  3ZFE C;  5LBE A;  4GH4 B;  4JHZ A;  2XGX A;  1WLD A;  4XUT A;  4CYD A;  2ZAC A;  2EXI A;  5K9Y A;  1FT9 A;  4JDN A;  2VM9 A;  4AE2 A;  4Q0U A;  1VBC 1;  3HNB M;  1XE0 A;  3RMX A;  5JUV A;  4K3U A;  3EO6 A;  3LD8 A;  1WW6 A;  2R06 1;  1UY1 A;  5C8W A;  4I09 A;  3OBR A;  2JG8 B;  4WM7 A;  1FPN 1;  2RMU 3;  4G9S B;  1PK6 B;  4QKF A;  3H0O A;  4JQR A;  1DGR A;  3KCX A;  4C91 A;  1S0B A;  4MUV A;  2E51 A;  2Y6H A;  5FCC A;  4JGY B;  3BVC A;  4Y1Y A;  4GIQ A;  1UN1 A;  1QJZ A;  4B1M A;  1ONA A;  2XLA A;  1WW4 A;  4Q0S A;  2VQT A;  2WJS A;  3THC A;  2W87 A;  4E2G A;  3RNS A;  4MVT A;  2R0F A;  3NVC A;  2ES3 A;  2BPA 2;  3D5O A;  2HWE 1;  1UOG A;  2ZPX A;  3VDB A;  1E57 A;  4NMI A;  5D1I A;  1IS3 A;  5DUX A;  3CZU A;  5C3R A;  2FDF A;  3VL9 A;  1HJF A;  2PLV 2;  1ND2 B;  1UZZ A;  2GAL A;  3VHN A;  4QHZ A;  2J1E A;  3I59 A;  4YG6 A;  5JXJ A;  4HZF A;  4OHV A;  4BLJ A;  2EIE A;  4EN8 B;  1CD3 G;  2JB8 A;  1BYH A;  5F5I A;  3BKZ A;  3T2O A;  5F37 A;  1RHI 2;  3USS A;  1HB4 A;  1OVS A;  2A3X A;  1RUI 1;  1PNG A;  4OMC A;  3URF A;  4LKE A;  3MGU A;  1QEX A;  2HEW F;  2JD9 A;  2QDN A;  5HXV A;  2I45 A;  5DAQ A;  3PUH A;  4TN7 A;  3SEE A;  3VBH C;  4A45 A;  3WXP A;  4FFI A;  1MEC 2;  4JHT A;  2OYZ A;  2R07 2;  2DU0 A;  3MIH A;  3ZYH A;  1SQ4 A;  2UY9 A;  1LU2 A;  2HWD 2;  3RRD A;  2K2S A;  3POE A;  3ZDV A;  1OF4 A;  4PCR A;  3N7K A;  2DV9 A;  4YGC A;  1QJX 1;  4GH4 A;  2VXJ A;  4QB1 A;  2OX0 A;  1PMI A;  3B94 A;  3KSC A;  3J7M A;  1X50 A;  5H9Q A;  2YFU A;  3RZM A;  2WAO A;  1I1E A;  1RUC 2;  4UF0 B;  1Z7S 2;  4XDQ A;  5JOZ A;  3IKW A;  4Q1P A;  2OUJ A;  3WUD A;  4U2A A;  4EE2 A;  3I8T A;  5F5A A;  5K8S A;  3TN9 2;  2JDU A;  4IGQ A;  4JGY A;  1RUJ 2;  1PGL 1;  1GMM A;  4CDU B;  1J3P A;  4QDR A;  1G6N A;  2EAL A;  3H3Z A;  5BNN A;  3MW2 A;  5B4N A;  1MS5 A;  1LHV A;  1W04 A;  1VMF A;  4YGD A;  1DZR A;  5FZO B;  2WR9 A;  4AL9 A;  1AR9 2;  3J7H A;  1H4H A;  3OG2 A;  4Q4V 1;  4YVW C;  2WS9 1;  5GZF A;  3TNP B;  5J48 A;  1YJL A;  2F4L A;  2WZR 3;  4OUS A;  4ASK A;  4FXG B;  4YZ4 A;  2Q8C A;  3IN9 A;  4AVB A;  1ND2 A;  1ZYB A;  1M4W A;  5EYY A;  5FZF A;  1YQ5 A;  4XMI A;  4Y20 A;  4GJY A;  2PQS A;  4XEZ A;  2O8O A;  1F4A A;  4JRL A;  1TEI A;  2WWJ A;  5IW0 A;  3RGB A;  4CCK A;  1HB1 A;  5DUW A;  1K5M B;  2B8M A;  2D6P A;  5CVR A;  3UGH A;  4UAP A;  1FYU A;  1LOD A;  1NOV A;  2UY8 A;  1PZ8 A;  1DYP A;  3ELN A;  3LSE A;  4IQP A;  4H2A A;  3CQO A;  4Q4W 1;  1W8U A;  4C0B A;  1JU3 A;  5I0R A;  4BXS V;  2Y34 A;  1UY4 A;  4GJZ A;  3OD4 A;  1XND A;  2VXR A;  2Q1Z B;  1JYW A;  1IG3 A;  2RJL A;  2CV6 A;  1D0G A;  2G9G A;  3RYR A;  2BVV A;  4BOW A;  5SV5 A;  1PVX A;  5HBA A;  5EYX A;  1B35 C;  4Q4X 3;  3I7D A;  2HWB 3;  3LA3 A;  2D40 A;  1CIY A;  2WO1 A;  2W3J A;  4YPJ A;  3G7D A;  1ENR A;  4FTS A;  5I8T A;  4QQ2 A;  1WMD A;  5DZF A;  2ZEZ A;  4DUW A;  1JZ4 A;  4Y22 B;  3BOP A;  4UF0 A;  3K4Z A;  1H8T A;  1OI6 A;  5F6L B;  1VR3 A;  3AP5 A;  3VHR A;  4E4Z A;  3J7N A;  4L11 A;  4CUG A;  5CEH A;  2IFW A;  1GP6 A;  2EIG A;  3RZL A;  1DFQ A;  3AL6 A;  3WQ0 A;  4PDW B;  1EAH 1;  3NV2 A;  3QD6 A;  4FFF A;  2ZGK A;  1CWP A;  4AEJ A;  1Q8S A;  3DF0 A;  3L2H A;  1HLC A;  4ZY9 A;  2VZP A;  1DGR N;  4X6R B;  4K7J A;  3TEX A;  2B5H A;  3WG4 A;  3PJY A;  3B9C A;  5HV0 A;  3ZN6 B;  4XUP A;  4HKL A;  1HN0 A;  3PIJ A;  3WNK A;  4RQP C;  3HN3 A;  3NJV A;  1HXS 1;  4RYD A;  2D5H A;  3K51 A;  4URT A;  1JOJ A;  3WDT A;  4D0Q A;  4YM3 A;  5JMO A;  4AI1 A;  3ZFF B;  2ORZ A;  4N53 A;  3RWK X;  2B9U A;  1C3H A;  3H1Y A;  2JE7 A;  4CSW A;  4DRR A;  1VBB 2;  5A7W B;  3KV6 A;  4F3J A;  4FTB A;  3RYK A;  2WO7 A;  1DGW X;  4AI3 A;  3ZXJ A;  2PAK A;  1N3O A;  1DGL A;  3M8L A;  1GSL A;  5HV4 A;  1SLT A;  5KHJ A;  2GP5 A;  5L7O B;  3H1M A;  1CX4 A;  2HLE A;  2PAM A;  1RUF 1;  5CG9 A;  1UU4 A;  2FCU A;  1ZZ7 A;  2VVE A;  4OZX A;  4A7Z A;  2ZGP A;  2WC2 A;  3I54 A;  3EHK A;  2VUC A;  3EB7 A;  5F6K A;  2BEO A;  1AXK A;  3AZW A;  1IQA A;  1D4M 3;  1HRV 1;  3IT8 A;  4CCJ A;  5CG8 A;  1C8M 2;  1ASJ 3;  4DXS A;  1DIW A;  3D0S A;  3VBR B;  1SLB A;  2PHF A;  2C1F A;  4Y4R A;  5LAT A;  3UJQ A;  2DU1 A;  3BUC A;  1O4Z A;  3ILF A;  5FYM A;  3J9S A;  3FFQ A;  5HI0 A;  4P9I A;  5M0T A;  1OLR A;  3ZYP A;  3NO8 A;  1RUH 1;  4AI2 A;  2BV4 A;  3I2K A;  1PM7 A;  4R9D A;  3WDV A;  2GMP A;  3JBG 1;  1BKZ A;  4NAM A;  1SHW B;  4LHN A;  4XF9 A;  4Y22 A;  1GZC A;  4A4A A;  3ZM8 A;  1ULC A;  5FKC A;  1UXZ A;  1V9U 1;  4XJW A;  1GNH A;  2H0B A;  4CUB A;  4PDW A;  2BZD A;  1COV 2;  1W8T A;  3RYP A;  3DCQ A;  5FYS A;  3ZVX A;  2VBP A;  3RZZ A;  2E53 A;  2GN7 A;  3FBY A;  3QH7 A;  3KQ4 B;  1OPM A;  4IE4 A;  3UK9 A;  2ZTN A;  4CPB D;  3W58 A;  4AGR A;  3AJZ A;  4UW5 A;  4D8M A;  4FQZ A;  3KVB A;  4XBL A;  2FDI A;  1S4C A;  1JTZ X;  2Y26 A;  4LQR A;  4OUL A;  1ZA4 A;  1ENQ A;  5AC9 1;  1ZRD A;  5A7O A;  1C1F A;  1HJG A;  1QH6 A;  1DCS A;  2W91 A;  4P5H A;  5HCB A;  3RG0 A;  2ERF A;  1N1V A;  3AC0 A;  3FUO A;  3WP5 A;  2WFF 1;  1BJQ A;  1GOH A;  3POY A;  4RHV 3;  4IES A;  2WT2 A;  3AX4 A;  3V0B A;  3THP A;  3RI9 A;  2GC0 A;  4IV1 A;  4BQX A;  3KHB A;  4ZHN A;  4XOG A;  5FWE A;  4NHM A;  5L7O A;  1VBA 3;  4ARY A;  5KHI A;  2J1R A;  5L19 A;  1XB9 A;  4Y4Y A;  3POI A;  5IK5 A;  4EWA A;  4MV2 A;  3LEG A;  5E1R A;  3LEK A;  4ZON A;  5IK7 A;  3FX3 A;  2R7E B;  5FYU A;  1QJU 3;  1VBD 2;  4Z07 A;  1FOD 3;  4O9G A;  5FYY A;  3WDU A;  1GYK A;  2EXJ A;  2HWB 2;  5FFO C;  3FUQ A;  3HPN A;  1OD5 A;  4Q29 A;  3K75 B;  1V6M A;  4HOO A;  2VGD A;  2VBD A;  4MHR A;  4CP9 B;  5FQ0 B;  4AI0 A;  2D6L X;  4UFI A;  4XDP A;  4FAH A;  2BUK A;  4M4R A;  3VBF A;  4LOR A;  4EN9 B;  1IKP A;  3T1L A;  5EQU A;  4EN0 A;  1PX4 A;  2O14 A;  1UAI A;  2GP3 A;  2IXH A;  3A23 A;  3AKR A;  4AEK A;  1F35 A;  3T0A A;  4OUE A;  1N47 A;  4AFM A;  1US2 A;  2JJ6 A;  5FZ0 A;  3NJX A;  5KXB A;  5LBC A;  3NNF A;  1J59 A;  3GGL A;  1E5H A;  1AL2 1;  3R6S A;  4D6R A;  1JW6 A;  1RUE 2;  2QQP A;  2EXK A;  1AHS A;  2QQV A;  2VZO A;  3HQR A;  4EN7 B;  4EQV A;  5A3O A;  1URX A;  1LOF A;  1J84 A;  2AH2 A;  2Y6G A;  3ZXE A;  3R4S A;  1KIT A;  3ES1 A;  4JGZ A;  3VBH B;  3PME A;  4AFB A;  2VW0 A;  3MDP A;  1XU2 A;  3MID A;  1UU5 A;  3FZ3 A;  2VQU A;  3LKJ A;  1AR8 2;  4JKL A;  5JI9 A;  2HWC 3;  1ULD A;  3ZFE A;  1Q8V A;  2L9L A;  2BGC A;  3J8F 3;  1FV2 A;  3N3H A;  2QQU A;  1I3H A;  3LDK A;  3VHO A;  3JUU A;  2J1S A;  3OPT A;  3MFA A;  4D6S A;  3WW3 A;  3WHU A;  2E7A A;  3MO4 A;  1PHM A;  2PHX A;  4E8C A;  1ASJ 2;  4HSJ A;  1NX9 A;  4BJ0 A;  5CFC C;  3WOG A;  4BLI A;  2ARC A;  2VPV A;  3SMH A;  5DG1 A;  4GUL A;  3DEM A;  2WZE A;  4MGT A;  3PNA A;  3UGF A;  2WSV A;  3AKS A;  2ZMN A;  3VB9 A;  4QX0 A;  1F5F A;  4K8F A;  4CP9 A;  2GND A;  4CU7 A;  1BXH A;  2PHD A;  3OPW A;  5FQ0 A;  4JDM A;  2WN2 A;  3K46 A;  1CQ9 A;  1TZO A;  3H8R A;  5LA9 A;  4A41 A;  3CNA A;  1HQN A;  3UJO A;  4YVW B;  3RJ2 X;  1YJK A;  1CAX B;  1G8W A;  1W6M B;  2XML A;  5GLU A;  1UX7 A;  4CDW C;  4NIG A;  2GU9 A;  3AMM A;  4XXA A;  4Z1V A;  3GBW A;  4CP0 A;  2DCT A;  1K3I A;  3ETP A;  2OVU A;  3LF7 A;  5FZ4 A;  3KV5 A;  4QWN A;  5A3M A;  4GA9 A;  4LO7 A;  1XQN A;  1DGW A;  1LOC A;  3GXU A;  3LDB A;  1PO2 3;  4YG3 A;  4BQ3 A;  4CP2 A;  4CEY C;  5CA6 A;  4Z92 B;  4XMA A;  1UKR A;  4ATE A;  3BN6 A;  5I0T A;  1S2E A;  1UZV A;  4Z8B A;  4PLN A;  1ZBE 1;  1KDK A;  3AXE A;  1O91 A;  5CIS A;  1VB4 A;  1YI9 A;  2JDA A;  5CFD A;  3I3E A;  2B4K A;  5KHH A;  5T52 A;  3VBH A;  1NE6 A;  4LUM A;  2ZHK A;  5E6H A;  2XON A;  2MEV 1;  2VG9 A;  3EXU A;  3QBQ A;  4Y33 A;  1XU1 A;  2OA2 A;  3AKT A;  1FXZ A;  3AVS A;  1QMJ A;  1JZ5 A;  1JZ7 A;  1QJY 1;  3SHR A;  5B4X A;  1APN A;  3LPF A;  1SPP B;  2JG8 C;  4PLO A;  4NAO A;  5GZC A;  1XYO A;  1GZW B;  1B35 B;  2WO2 A;  3FHQ A;  4HKW A;  1P8J A;  2TUN A;  4F8A A;  1VBA 2;  4QQP A;  5FZ9 A;  4NOT A;  4M3C F;  4MET A;  3ILN A;  5GZG A;  1WWY A;  3J7L A;  5LWB A;  3LB9 A;  4XFF A;  1JI6 A;  4DFS A;  1PVC 3;  3B69 A;  3SC7 X;  1H1I A;  1TME 3;  4LO8 A;  3QLQ A;  1OH3 A;  4QGN A;  1A34 A;  2ZAA A;  5F2W A;  4H7M A;  1BEV 1;  2PHW A;  4XHX A;  3X29 B;  1G9B A;  3G6J B;  5B2G B;  2WYS A;  1NLR A;  1X8M A;  1HB3 A;  2HBU A;  3E5Q A;  4RN5 A;  2PEL A;  4GWI A;  1PZ7 A;  4KI5 M;  2JDP A;  1W90 A;  2FDJ A;  3AP7 A;  1DQ6 A;  1W8W A;  1BQP A;  2VW1 A;  4TLF A;  3GJA A;  1ND3 A;  5IFP A;  1W8F A;  3ZMO A;  3CBN A;  3ITQ A;  4AAP A;  1J58 A;  3ZOI A;  3VBU A;  2C26 A;  4RQP B;  2A1X A;  5FLJ A;  3OJB A;  1CAX A;  4NHX A;  1W6O A;  2DFC A;  2JDK A;  3HN1 A;  4CVU A;  3CEW A;  1S0F A;  3HEI A;  1AXY A;  2W0X A;  5AVA A;  5L36 A;  2FZ1 A;  4FO9 A;  3WP4 A;  2IZW A;  1IZ3 A;  4DB5 A;  1XNT A;  1V0A A;  5GJ6 A;  3U1X A;  2ZX2 A;  3SIT A;  3ZO0 B;  1D2Q A;  2WO3 A;  2ARE A;  1S2B A;  2FHR A;  2QDR A;  4BZ4 A;  4H3W A;  5FP7 A;  3KD4 A;  4K1Y A;  2CU5 A;  5I8Y A;  4NID A;  3B7M A;  3ZR6 A;  4M01 A;  5IUQ A;  2RDS A;  1UQX A;  2RJK A;  3F2Z A;  5C7G A;  2DUP A;  1O5L A;  3MUY 1;  2FZ2 A;  1LOE A;  2VU9 A;  3AZZ A;  1VRH 1;  4XFA A;  3WQB A;  3U0Z A;  1AYM 3;  1IS5 A;  2QJV A;  3OSD A;  4BMB A;  4QPG C;  4E27 A;  2A3W A;  1LR5 A;  1EPZ A;  3LGR A;  1SBD A;  3APB A;  1Q8P A;  2XOM A;  4CCN A;  1AR6 3;  5JSR A;  5J37 A;  1SPP A;  2GNM A;  3JB8 A;  3V64 A;  4P9J A;  1GZW A;  1EV1 1;  1B35 A;  1IPS A;  2Z2S B;  3A7Q A;  3KF3 A;  4LA3 A;  4DMI A;  3AYA A;  4DY3 A;  2P34 A;  4XIL A;  4QX8 A;  3ZFG C;  3EJK A;  3E6C C;  4IE0 A;  3WNM A;  5DAX A;  1RXF A;  3WG2 A;  3WDX A;  1DU3 D;  2YC4 A;  2AYH A;  4E4H A;  3HVD A;  2GH8 A;  1OLM E;  4HG6 B;  2DVB A;  5IVJ A;  4GXL A;  1PO1 2;  1OUX A;  2C9K A;  1LOA A;  5G04 L;  5J09 A;  2QBX A;  5FMD A;  4A6O A;  2AC1 A;  2IXC A;  5A33 A;  1JYX A;  3VBO C;  1C1L A;  3TRS B;  4Y26 A;  1HW5 A;  2RMU 1;  3KV9 A;  4QM9 A;  2ET7 A;  3LFM A;  3PUS A;  3VN4 A;  5KHG A;  5A3L A;  4LO6 B;  1J1L A;  1CVN A;  3BTY A;  3UGG A;  4MXW A;  4PBP A;  3PUA A;  2ATF A;  1Q3E A;  4XBN A;  2ZX3 A;  2GDF A;  4WZF A;  3VZO A;  2AZ5 A;  2QQL A;  2X53 S;  1RUG 3;  5IAV A;  1OXC A;  1TNF A;  1K5M C;  2GAU A;  5F8P A;  4AAX A;  4BU2 A;  5C8C A;  1CAW B;  1AYN 1;  4HKO A;  4XTM A;  2QQM A;  2DBN A;  3I3Q A;  1PO2 2;  2LAL A;  4MYE A;  3PHM A;  4YZ5 A;  1X36 A;  4XJU A;  1LGC A;  2PAE A;  3MIG A;  4OI1 A;  1H1M A;  4LNV A;  4WV8 A;  4XUO A;  1BCX A;  5EWS A;  3H3U A;  1DLC A;  3NNJ A;  1VAL A;  5FYI A;  5I0U A;  1MZ6 A;  2JDH A;  4MG2 A;  1JMU B;  4DEQ A;  3B01 A;  3I2G A;  2UWA A;  4XUR A;  2FCT A;  1OOP C;  4S2G A;  5IAX A;  3IWZ A;  5FXZ A;  2VME A;  5J98 B;  4DRV A;  1GQP A;  4AED A;  2VE1 A;  4PJY A;  5LEK A;  3NNM A;  2H6B A;  4IEQ A;  4GZ9 A;  4GQ7 A;  2VOV A;  3UET A;  5A1L A;  1MS8 A;  1YYN A;  1ZZ6 A;  2EIB A;  2FCV A;  2VO5 A;  1ZRF A;  2AEZ A;  3H50 A;  1R1A 3;  2P3J A;  4J1X A;  5H9S A;  1QXJ A;  2RR1 1;  3I3M A;  2PLV 3;  2R04 2;  2W47 A;  2V73 A;  5BY5 A;  2DCJ A;  2VVD A;  1BK0 A;  2UYB A;  1JOB A;  1FV3 A;  2A6V A;  4QD2 A;  4UXA A;  4AEM A;  2VCB A;  4QM8 A;  4PIY A;  1GOG A;  3GDB A;  4E4S A;  4O61 A;  2BDR A;  1RHI 3;  1R1Z A;  4URA A;  1BMV 2;  2K46 A;  4R9C A;  3N4M A;  3AVR A;  1L7Q A;  1R09 2;  1OT5 A;  1BBT 1;  1GIC A;  1W2U A;  3O0X A;  1QOT A;  1MEC 3;  3PU3 A;  3RSJ A;  2R07 3;  3AM2 A;  3OEB A;  2VZ3 A;  5J36 A;  4FFG A;  3UKT A;  2HEY F;  4HPK B;  2HWD 3;  4FOW A;  3AXD A;  5A32 A;  3JU9 A;  3NMB A;  3B9I A;  5BPX A;  5A6Y A;  4FPF A;  2OZ6 A;  4J25 A;  1CAW A;  2VMG A;  1WCU A;  4CUC A;  4GWJ A;  5ABJ A;  4YW4 A;  1GR3 A;  4EN6 B;  1QJF A;  5C5U A;  4XFC A;  5D21 A;  1OA3 A;  1LEC A;  2A6X A;  4JQT A;  4TWT A;  4AFD A;  2WZR 1;  4LIU A;  5FZH A;  4COV A;  2DUQ A;  3Q8A A;  4HLT A;  3TEW A;  1RUC 3;  1PNF A;  1Z7S 3;  5KXD A;  4HVR A;  5JZG C;  3VD5 A;  2RM2 2;  2RS5 2;  5IVY A;  3TN9 3;  4BYY A;  4ZU7 A;  2XHN A;  3VBR C;  3WF2 A;  1UPS A;  3WIN E;  2Q1M A;  2QZ2 A;  3UKV A;  1RUJ 3;  3HQX A;  2XH6 A;  2VMF A;  4AQ6 A;  1LHN A;  4GB3 2;  2DVG A;  2P3K A;  1U0A A;  3AMP A;  3ALQ A;  1W6P A;  5BNO C;  4DUX A;  2ZGO A;  2VZU A;  5JLV A;  1YQC A;  5DAP A;  2BRT A;  1UMH A;  1ODM A;  1GNY A;  4HT1 T;  1MZF A;  2D7F A;  1AR9 3;  4QQO A;  3VD7 A;  3ASI A;  3CKH A;  1UMZ A;  5I91 A;  4ATF A;  1KS5 A;  5F5Q A;  2D3P A;  1MVE A;  2Q0A A;  1F5J A;  4IGO A;  4LUL A;  2BBV A;  2B42 B;  5IJR A;  2E7T A;  3LFI A;  2J22 A;  1RIN A;  4CXX A;  5FDB A;  4YVS B;  5FAX A;  5JR7 B;  1UYP A;  3LSD A;  4XJ8 A;  5DUV A;  1VMJ A;  2B45 X;  2ADE A;  4Q4X 1;  4QX5 A;  3OUH A;  4AHX A;  4CDW B;  2PHU A;  1NYW A;  2H0V A;  2XQR A;  5A7N A;  4CXY A;  2RHP A;  5F3I A;  1UO9 A;  2C0Z A;  5I0D A;  3WDY A;  2IXI A;  2NZ9 A;  1MZE A;  3AYC A;  4LHK A;  1RMU 2;  1YWK A;  4CEY B;  3GZE A;  5IVE A;  3MIC A;  3O1U A;  4KBB A;  2I07 B;  3NST A;  1RUG 2;  3VKM A;  3FLP A;  3C7H A;  4YW3 A;  3E1F 1;  3DN7 A;  4FPG A;  1RYY A;  1NLS A;  4Q27 A;  3WW2 A;  2ADD A;  1S0I A;  5A1F A;  1S1A A;  1YIF A;  2WT0 A;  5FZ6 A;  3ZYB A;  1A6C A;  3E5X A;  2R6Q A;  1K42 A;  2EXH A;  4LO5 B;  1GOF A;  1DZT A;  2GC2 A;  4AQT A;  5FUI A;  1GZT A;  1H2K A;  2GH2 A;  3P3P A;  2A6Z A;  3HT2 A;  4OHW A;  2BWC A;  1C4R A;  2YB7 A;  4IV3 C;  3PUQ A;  4HAN A;  2ZGM A;  1E5R A;  5FO9 B;  4R9A A;  4IEY A;  2YRO A;  2P2K A;  4A7K A;  2VUD A;  5HXM A;  4GAL A;  4LA2 A;  1D0H A;  1WD3 A;  4X8P A;  5CFC A;  1LRH A;  1NA1 C;  4CU6 A;  4Y1U A;  1GWL A;  3LWC A;  2XXZ A;  5FZK A;  4QXB A;  5T50 A;  1R1A 2;  5F1R A;  3M1H A;  3WEZ A;  3DV8 A;  3C3V A;  1XE8 A;  2XQX A;  1D4M 1;  2WZ8 A;  4B1L A;  4DZG A;  4QXC A;  5JIA A;  2YBP A;  5JWP A;  1OPO A;  1GP4 A;  1Y9Q A;  5GLV A;  3SNM A;  2ZX1 A;  1VBB 3;  3KCC A;  2W1W A;  4CDW A;  1PIV 2;  2Q1F A;  4AGV A;  2DYC A;  3BAL A;  3IDC B;  2KA3 A;  5BXX A;  1SCR A;  4LMF A;  3MIB A;  5J1X A;  3LIG A;  5JR2 A;  1QHD A;  1JBC A;  3Q8B A;  5K0U A;  4D7S A;  2BOI A;  1W05 A;  3D0J A;  2R1D A;  5DMY A;  1NCQ C;  4K21 A;  2F17 A;  2AUY A;  1GAN A;  4YW2 A;  3GF6 A;  5FZC A;  3O1S A;  1PGW 2;  4MGS A;  2DCZ A;  1QQP 2;  2PYT A;  3DKQ A;  4EZ4 A;  2JD4 A;  2W46 A;  3ZSJ A;  2BGP A;  4P14 A;  1C8M 3;  1O5U A;  2A75 A;  4HN1 A;  5IFT A;  1EYB A;  1YHF A;  4C90 A;  4Y1V A;  1ZZ9 A;  3UKN A;  2WFP A;  3M70 A;  1UOJ A;  4QPG B;  3AMN A;  1LTE A;  1LHO A;  2EIC A;  4BM8 A;  1TMF 2;  4JC1 A;  2WQ8 A;  2JG8 A;  3I3B A;  2YC2 A;  1PK6 A;  2XJU A;  4OZO A;  3VKL A;  2YG0 A;  2Z42 A;  1JUI A;  4LR4 A;  3VD3 A;  4ES9 A;  4FPE A;  3H7J A;  3ZFG B;  5JOY A;  4H7L A;  1YQ6 A;  2BNO A;  3VBS C;  3HT1 A;  1SZB A;  1WMF A;  1MZ5 A;  4RHV 1;  4KWU A;  4CP1 A;  4CU8 A;  4TXW A;  5JSP A;  2HWF 2;  3TNQ A;  4CDQ C;  4IEZ A;  1COV 3;  1UL9 A;  5FTT C;  5FPU A;  2YGL A;  1VAV A;  4MLO A;  4Q0Q A;  5FY7 A;  3W20 A;  5EJ1 B;  1POQ A;  2DDU A;  4W50 A;  3ST7 A;  2ZGQ A;  4P5Y A;  3VBO B;  5A3P A;  2A70 A;  1GLH A;  2XBO 2;  1W9W A;  3ZX7 A;  5F9T A;  2DTY A;  4C1W A;  4XET A;  1POV 3;  4UT5 A;  1G9F A;  4IEP A;  1QJU 1;  4IEX A;  1O59 A;  1FOD 1;  4LBJ A;  3ON7 A;  2WDB A;  5C4W C;  3OF1 A;  3VGI A;  3LOI A;  1TE1 B;  1ZZ8 A;  4LBK A;  1WUV A;  3WY6 A;  1WA6 X;  1FNZ A;  5DDJ 2;  3H7Y A;  1QF3 A;  4QPI C;  1Q56 A;  2JE8 A;  4TLG A;  2ZMK A;  4Z2A A;  1RB8 G;  5FZ8 A;  4YZ1 A;  3VUO A;  2VNO A;  1YQ8 A;  3V65 A;  3WQ7 A;  4S2D A;  2XHK A;  4LTA A;  2QFE A;  3U07 A;  4AHY A;  3MUZ 1;  2ZHN A;  2J1V A;  2G1M A;  2VOX A;  1W03 A;  3H3L A;  4GWN A;  3FLR A;  4MX3 A;  2UWC A;  3A22 A;  2CL2 A;  3WF4 A;  5JDB A;  1NY7 2;  4P00 B;  3GM8 A;  4YW6 A;  3VD4 A;  1VBD 3;  5A80 A;  3T0B A;  4AOC A;  1JZ3 A;  3E6D A;  1OOP B;  3PL0 A;  1LEN A;  1OHF A;  2X10 A;  4IE7 A;  2YC0 A;  3BTA A;  4FPK A;  2HYK A;  3ZIW A;  3KB5 A;  1F9K A;  1QOO A;  4QPG A;  4BIO A;  5JMC A;  3P5B A;  4B7K A;  1YFY A;  4BQ4 A;  3FN9 A;  3LEI A;  5APA A;  5FMO L;  2ETE A;  2VMI A;  3V0A B;  1AF9 A;  4OHY A;  2VMD A;  2VQA A;  5JPN B;  3I2H A;  1OQD A;  3LQC A;  2HWC 1;  3KV4 A;  4CDU A;  3S0M A;  2ZZQ A;  4MSV A;  4XQW A;  3WLU A;  1STM A;  4LBN A;  4XFI A;  1LED A;  4WBB A;  3J8F 1;  1G86 A;  2JEC A;  4COY A;  2DTW A;  3THD A;  1MS9 A;  1LOG A;  2D3S A;  2YUE A;  2P17 A;  2NPI A;  1ULE A;  5FZO A;  5FZD A;  1WW5 A;  5FMO S;  5ERL A;  1R08 2;  3I2J A;  1RUE 3;  3VBO A;  1QU0 A;  2N7G A;  2ZEY A;  1RUD 2;  3OBT A;  4QQL A;  3WT3 A;  3GCX A;  1LHW A;  4XQD A;  1GFF 2;  2ZHM A;  4QKD A;  1IOA A;  1O3Q A;  3JD7 2;  1QNY A;  1QXR A;  3AKQ A;  3WVJ A;  4B4R A;  3JZV A;  2D6M A;  4FQ4 A;  3O0V A;  4K40 A;  4N9H A;  4IE6 A;  1CIW A;  4EV0 A;  2WL1 A;  3I3D A;  1C5I A;  2D6N A;  1CGP A;  1AR8 3;  1K5M A;  1UYY A;  1W2N A;  2VY0 A;  3Q8E A;  4UW3 A;  4XF0 A;  1QNW A;  1UYX A;  1S2K A;  2BYV E;  5DZG A;  5T5L A;  3TEY A;  4S2H A;  3TEZ A;  2W52 A;  5CAZ A;  1HV0 A;  2VZR A;  2VAU A;  1R64 A;  3BPS A;  4WVM B;  2RS1 2;  1OQ1 A;  2QQN A;  4D3W A;  5JVV A;  4NR1 A;  4U36 A;  2R0H A;  2XKO A;  3FE5 A;  5JZG B;  2WNE A;  5DPN A;  3N9P A;  3U78 A;  5CNA A;  5CU1 A;  4GD4 A;  3E5U A;  2ET1 A;  2QTW B;  3B3Q E;  2ORX A;  4BWO A;  2CHH A;  4E2Q A;  2FQP A;  1OOP A;  1YUD A;  3VDD B;  3ZR5 A;  2OUH A;  1VBE 2;  2WNU C;  3H8O A;  3S5Q A;  4XIK A;  5BNO B;  2OZJ A;  3DYP A;  1SLC A;  2XR4 A;  3CHX A;  3VDA A;  4BE3 A;  4NWV A;  4B8E A;  2ZKL A;  1UY3 A;  3HAG A;  1W0O A;  5LZ6 A;  3WNN A;  4Q2F A;  3MIF A;  4ASM B;  4O7X A;  4GMP 3;  5C3O A;  4JZR A;  2D44 A;  4FAG A;  4Z82 A;  4M00 A;  2RR1 2;  3CMG A;  3N9O A;  4XYX A;  1V00 A;  1DYK A;  1J3Q A;  2LW8 A;  4QDQ A;  5A7Q A;  4BQW A;  1NE4 A;  4K20 A;  3Q8F A;  5DN2 A;  3OBA A;  4CCM A;  4CXW A;  5JXI A;  4V1P A;  4V2W A;  2WKK A; 
#chains in the Genus database with same CATH homology
 2JIJ A;  3KT4 A;  4ZON A;  3NNJ A;  4NAO A;  2RDR A;  5L9R A;  4NMI A;  4MHR A;  4UWD A;  2FCT A;  5IAX A;  4Q5O A;  2HBT A;  2G1M A;  3EMR A;  3NNM A;  5HV0 A;  5DAV A;  5EQU A;  2HBU A;  2FCV A;  3PL0 A;  3OBZ A;  3MGU A;  2JIG A;  5DAQ A;  5LB6 A;  3GJA A;  5LBC A;  3NNF A;  3ITQ A;  2OPW A;  4IW3 A;  5L9B A;  2A1X A;  2G19 A;  4XAA A;  5LBB A;  3HQR A;  4NHX A;  5LBF A;  5L9V A;  5HV4 A;  3HQU A;  5EP9 A;  3W21 A;  2FCU A;  4XCB A;  4Y5S A;  3NNL A;  5ERL A;  2V4A A;  4KBZ A;  4J25 A;  2RDS A;  5DAW A;  5LAT A;  5M0T A;  5C5U A;  3DKQ A;  3OUI A;  3OUJ A;  5EPA A;  5DAX A;  3GJB A;  5LA9 A;  2RDN A;  4NHY A;  5DAP A;  4XAB A;  4MHU A;  5LBE A;  4XCA A;  4NHK A;  5IAT A;  4ZPI A;  4XAC A;  2Y34 A;  2Y33 A;  3W20 A;  2RDQ A;  5C5T A;  5LAS A;  5A3U A;  3OUH A;  4JZR A;  4Y5T A;  5IAV A;  4BQY A;  4BQX A;  4XC9 A;  4BQW A;  2RG4 A;  3BVC A;  3KT1 A;  3KT7 A;  4NHM A;  3GZE A;  4NHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...