5LBEA

Hif prolyl hydroxylase 2 (phd2/egln1) g294e variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
220
Chain Sequence
b'LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINERTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLGVRVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Egl nine homolog 1
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 64
structure length 220
sequence length 226
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbeA00
2A1XA 3OUIA 4XABA 3BVCA 3NNFA 3KT7A 5DAQA 2Y34A 5LBFA 3W20A 3GJAA 4NMIA 4NHLA 4BQYA 5ERLA 5IAVA 5EP9A 2RDRA 4IW3A 2JIGA 2RG4A 5LB6A 2G1MA 4NHMA 5HV4A 4Q5OA 5M0TA 3EMRA 5LASA 4ZONA 2RDSA 5LBEA 2FCTA 5IAXA 3DKQA 5LBCA 2Y33A 5DAVA 2HBTA 4NHKA 2JIJA 2G19A 4XCBA 3OUJA 3GZEA 4XC9A 5A3UA 3NNLA 3MGUA 4UWDA 5LBBA 4Y5TA 3OUHA 4MHUA 4ZPIA 5DAPA 4NHYA 4XCAA 4XAAA 5L9VA 2V4AA 4XACA 5HV0A 5DAWA 4BQWA 3GJBA 5C5TA 2OPWA 5EPAA 2RDNA 4JZRA 3W21A 4MHRA 5LATA 4KBZA 3KT4A 5L9BA 4NHXA 5L9RA 3KT1A 4BQXA 4J25A 4NAOA 3HQUA 5DAXA 3OBZA 2HBUA 3ITQA 5IATA 3NNMA 2FCUA 5LA9A 5C5UA 2FCVA 3HQRA 2RDQA 4Y5SA 3NNJA 3PL0A 5EQUA
chains in the Genus database with same CATH superfamily
3S57A 1A3KA 2GP5A 4IDZA 1YI7A 4DQAA 1DGWA 1D4M1 3VBFC 4XABA 1VB2A 3IB3A 5FXVA 1RVF2 1OLMA 2AH2A 1OF3A 2FDKA 1V6LA 1AXZA 3UNPA 1K42A 2NN8A 2IFRA 3QBQA 1PO22 3M3OA 3MIFA 2ZZQA 2W2IA 3AP4A 3SH3A 3HN1A 4HKWA 4LA3A 4QDSA 2IXKA 3U0ZA 3IMNA 4CP9A 5CFCA 1W2AX 1AX2A 4QKNA 4LT5A 1SBFA 4P02B 2QQVA 4MGKE 5DUWA 1ZBA2 5I0SA 5DUXA 1AXKA 4MZUA 4Q0UA 4RQPB 2C5DA 3BPZA 4YW5A 1R091 1R1A2 1CD3G 5L73A 4A45A 4AEMA 3PUAA 3WP5A 3E1F1 1YEWA 3RJRA 1R1A3 5FV3A 2AGSA 3QCWA 2B7YA 2J7MA 3A22A 1VBA1 2GP3A 1QQP1 2YHJA 3LDBA 5DMYA 1OMIA 2WAOA 1AL22 1J84A 1N47A 2YV8A 2Q4SA 4P08A 3I59B 1DQ2A 2ORZA 3ZYIB 5JUVA 3LPFA 4CCOA 4XDQA 3VBRA 5CIRA 4P9JA 3Q9OA 4NIGA 3UV9A 3KV4A 1MZEA 2A6YA 4GAZA 3GZAA 3VDAA 3WG1A 2W46A 1V9U1 1W06A 5JR2A 1PIV1 4YVWB 1E5SA 1HXS2 2WZEA 2YU1A 1S55A 3FE5A 4LKSA 4XUNA 3WF3A 1HXS3 3GBFA 1CZSA 1VMFA 4AHWA 3U4XA 3HT1A 3HNYM 3T30A 4CU8A 4EWDA 1JYIA 3GGLA 3KV5A 1VALA 4LHSA 2Q1MA 3FZ3A 3VBHA 4CA9A 2XVLA 4FPGA 4HOOA 5T5PA 1SBEA 3WX5A 4URAA 1XNCA 2CWSA 4FPCA 4ZPIA 1MS9A 2JKBA 5JPNB 1QJZA 1C8M2 5GLVA 5EYYA 5FY5A 1REEA 2PQSA 3D4KA 3RQ0A 1A34A 5FPXA 4LKDA 2XQRA 1POV3 3ENRA 1YWKA 5GKAC 5A7PA 5K0UC 3GXUA 3K77A 4YLZA 2GALA 2WZR1 1PVC1 3RZMA 4Y1VA 3USUB 3GZTB 2FDIA 4PHZA 3H1YA 3DXUA 3SC7X 1EV11 1LGCA 2PAMA 2XQXA 2ARBA 1JH5A 1RUJ2 4N90A 1RJ7A 3RSJA 2A6XA 1YFWA 1RUJ3 3J8F2 4KGQA 3AZXA 1C1FA 1O8SA 4R4ZA 3CJIA 2RE9A 4EROA 4CXYA 1ASJ1 5LZ6A 1UY4A 1RUI1 5FUNA 4TZDA 2WL1A 1G6NA 3NJVA 5T3NA 2XONA 3B93A 4XFGA 4Q4Y2 2D5FA 1FMD1 2JG9C 1W39A 3NNMA 1SCRA 3POGA 5A3TA 1WBLA 1RUNA 3I3EA 1PO11 3S7IA 2XPJA 4K21A 5D8AB 1QMJA 4OI0A 3WQ7A 3H0OA 5DZGA 4QX2A 1XE0A 1L7QA 1NT0A 3I3BA 5LY1A 2VVEA 1CR7A 4URTA 3KQ4B 1LGBA 4CDXB 1NUKA 1XU2A 2X8KA 1YYNA 2DCYA 4LLFA 2WRAA 1VMJA 3O7OA 1QXPA 1DYPA 2WAAA 2FMDA 5A80A 3ZFEA 1W9SA 1ZX5A 4LPLA 1QXJA 4J6GA 4NJ4A 1JUIA 1Y3TA 2VY0A 2R0HA 1W6QA 5FFOC 1POQA 1IPKA 2BVVA 2JDYA 4JCKA 1F35A 4OCTA 3WP3A 3D8CA 3ZFGC 1F4AA 4DXRA 4B1MA 3AZWA 5KWRA 2F17A 2E51A 2YC2A 5KXBA 1QWRA 1RHI2 4C1XA 3AXDA 4E2GA 1ZYBA 1SBDA 3VBUC 1JTZX 5GJ6A 1QOTA 4ARXA 4S2FA 5G04L 4M3CF 2A71A 1OH4A 1Q8QA 4FI9A 4DUVA 1D0GA 2VW1A 2ZHNA 4HKLA 2D6OX 3AL5A 1JODA 1IS6A 2XLAA 4J1WA 5JPMB 4ZU4A 3U14A 5FKBA 1LGNA 1OOPC 5CKNA 1VBD2 3DF0A 1ZRFA 2C24A 5FAXA 2VCAA 2A5ZA 1VBD3 4JAAA 5C4WB 3UJOA 2ZTNA 1NX9A 1ZZ8A 5GLZA 4J1XA 4NHKA 2XHNA 1VBC1 1ULDA 1GNYA 3IBMA 2ZPXA 3ES4A 3POYA 3VN4A 5FLIA 1X7NA 1WA6X 2ARAA 4KWJA 1LHOA 4AVBA 4A3XA 3WXPA 3PUIA 4NROA 1WA4A 4PJYA 1M4WA 2D98A 1PM4A 3O1UA 1N3PA 1C3HA 2QUOA 1C5IA 3G6JB 3LOIA 3MUZ1 4NHYA 4NO4A 5BNNA 3T2OA 2JICA 1SPPA 4QHBA 4AE2A 4YZ2A 4F83A 4XUQA 5L9VA 3C3VA 1STMA 4P9YA 2UY8A 5J1XA 4YVSC 5I8SA 2FD8A 2Z79A 3OPWA 4XEZA 3ZYHA 3FFZA 3N9MA 1KQRA 3CNAA 2RR12 3IAQA 2JKXA 4DINB 2P3KA 1VP6A 2ZGSA 3LFMA 2RR13 1IS3A 1CESA 1DLLA 4AZZA 4BCUA 1PK6A 4PI2A 4CDQC 3A7QA 4FXKB 5FYMA 5A33A 4WZCA 5IW0A 4QGLA 2C9KA 4QPIB 4A3ZA 1AX0A 3FHQA 4FOWA 5E89A 3TB0A 3TWIA 2E63A 4JTOA 1RUD2 1N3OA 4MGQA 1RUD3 3E5XA 1W03A 5DDJ2 2K0GA 5DDJ3 1MQTA 2ZGMA 2TUNA 4OHZA 1YO8A 2JG8C 3LSDA 4YGDA 2XJUA 1GZWA 1HLCA 1W8ZA 3VBFB 5KHGA 4PIYA 1VRBA 1ZNPA 3I3QA 3TN91 2NP0A 3SMHA 5E1RA 4JV4A 3UGGA 4E4SA 1IZ3A 1ND3A 4BQ4A 1UU4A 1X50A 5CFCB 2BYVE 3HR9A 2PHXA 3AL6A 1UNBA 4WM8C 3IDEA 1CJPA 4HN1A 3NVCA 3ATGA 4H7LA 3V0BA 5FRAA 1J1LA 3LCPA 4YWAA 3VV1A 4QKDA 4NOTA 2JB8A 4IV1C 2XWBB 2X05A 2BV4A 4A41A 2XVKA 3QH6A 2Q8CA 2O0OA 5JCTA 4GWIA 1CZVA 1OKOA 1WW5A 4ATFA 3OF1A 1CAXB 3WCRA 3AMHA 1NE4A 3C8XA 3I2JA 4AAPA 1C5HA 1TMF1 1FNYA 4NMIA 1AVBA 2N7GA 4FPLA 3U78A 4L2NA 1QJX1 4UW5A 5GLUA 3CQOA 5A6YA 4FOYA 1T6GC 4H2AA 4AHXA 5JZGA 1F8VA 4FP3A 3WDWA 3F95A 1K5JA 3R0RA 1LJ7A 2WFF1 1RUE2 1AYM1 1LOFC 3WNPA 5F2WA 4IUGA 4O9EA 1RUE3 2P6CA 4QX3A 3ST7A 3NKTA 5F6LB 5JI9A 4MGYE 3K2OA 1TG7A 4DEQA 2JD4A 2W92A 5K8SA 3SH4A 5KXCA 2OKXA 3E5QA 4I3GA 4OFGA 4IEYA 3ZSJA 5DUUA 4P00B 4LNVA 2G4IA 4Y3OA 3MLJA 5FPZA 2GC0A 4B1LA 1JYNA 2P1BA 4C0BA 1H6XA 2WO7A 1UYXA 5GLWA 4XHXA 2JIJA 3FLRA 5EFUA 3CU7A 4UFJA 5A7WB 1W6PA 3CEWA 3OGRA 3MV11 4FPKA 4XCBA 1RUG3 2EAAA 1VRH3 4ZS2A 3B7MA 2ARXA 4QGMA 3V0AB 3JBG2 4P5YA 2EVXA 2XOMA 3JBG3 4UWDA 3THTA 5K0UB 5FZDA 1F4HA 1GMMA 1ULGA 2WJSA 4EN9B 5A3WA 2FDFA 3B9CA 2KA3A 2CL2A 4Q26A 2W9XA 2DFCA 4OUSA 3ZXFA 3AVSA 4FVVA 2Z2SB 2UY9A 4XUOA 1OPMA 1LEMA 3NJZA 5AC91 3N4MA 2I2SA 3ZO0B 4B8EA 3ME2A 5C3QA 2ET1A 5FDBA 4Y26A 1VBE2 3ZPYA 5IK8A 3CZJA 1IHMA 1VBE3 4XBNA 5A32A 3JB8A 4Y22A 4UW4A 1BKZA 2R062 4I2OA 4OI2A 2XLFA 3KCXA 2R063 3AKSA 4RGAA 2JG9B 1W3VA 2A75A 2WNOA 5L9RA 3WT3A 3VD9A 4UW3A 1H1AA 3FUOA 4BQXA 1JBCA 1H2LA 1V6MA 2BGPA 1SCSA 4IE7A 2VOXA 4K1YA 2P2KA 1X36A 1VMHA 1MZ5A 1H8TC 1Z78A 2NMNA 5EJ3A 2G9ZA 5J48A 2E53A 4CEWC 4FTEA 4Y20B 5FZLA 3I2FA 3RMXA 2PLV1 2WWJA 1J83A 5FZFA 2KR2A 4Q8KA 2FCVA 5JSRA 3JQWA 4KG0A 2HWF2 3I2IA 1S2KA 2WNUC 1URXA 1XB9A 2X10A 2OIIA 2PTMA 3DN7A 2EAKA 2QQWA 3LEIA 3WW4A 3ZIXA 4B7EA 3ZFGB 3KCCA 2A73B 2W95A 3I2GA 4META 5DG1A 1S0FA 3MLKA 1H4GA 3LPGA 3OSDA 2Q5TA 3BVCA 5IUQA 1AYN2 1A6CA 3ELNA 1PGW2 3P3NA 3KHBA 3VBUB 3LE0A 4XZUG 1AYN3 3ORJA 3H42B 3POIA 1E5HA 1OQ1A 2GMEA 3AKPA 1NCRC 2NLRA 3DPRA 5LBFA 3W20A 4UBGA 1QJU2 2BERA 4LE3A 4FPFA 2BFUL 4RHV2 3BTZA 3M3QA 3AKTA 2Z69A 3UESA 1W9YA 2AZ5A 1W05A 2D44A 2HWB2 2W1UA 3BCWA 4RHV3 2Y0IA 1HKDA 2W3JA 4CP0A 5IVFA 1SMVA 1AJKA 5I0DA 3O1MA 4CDWC 5FIXA 2R30A 1TEIA 4XFCA 3ILRA 1OOPB 2IUWA 5LB6A 2K46A 1OURA 1TNRA 3RS6A 1IPSA 3ZYRA 2H6CA 4EJRA 4LTAA 1CWPA 1HRI2 4TLGA 4CEYA 2JDPA 1AJOA 4GD4A 4GMP1 1HRI3 4UF0B 1ND2A 4HSJA 1GQPA 1Y9MA 2DWRA 3KF3A 3LAGA 2OQ7A 2RS53 4QDRA 3ZFFC 1AR61 1J3PA 4ASMB 1Y7BA 4XF0A 1DU3D 1E5RA 2PHUA 4Q4V2 3SISA 2PYTA 4XJ9A 3CIHA 4QQHA 4DO0A 5K4LA 2ZHMA 2KD7A 4Q4X2 2PXJA 5FYVA 3NV3A 1W0PA 4BIFA 1OUSA 2OXBA 2ATFA 4PDWA 4JGYC 3MZHA 1MS3A 2YZ4A 3GZEA 2ZGLA 2P6HA 1S0DA 4RSUA 1FT9A 4YVSB 2JEMA 4PCRA 1JXNA 2O8OA 2JDUA 3LSEA 4Y5Z0 2HKXA 1PK6B 4YW3A 1H2NA 5FKCA 1B35C 2ZXQA 4M01A 1OD3A 4YZ4A 3GCXA 4MVTA 4Q4W1 4QHZA 3WDXA 1QOSA 1IS4A 4CU6A 2ZABA 3AXEA 4RR3C 3ECQA 3VL9A 4OULA 2GH2A 5DXDA 1XYNA 1RUC3 2D6PA 4RQPA 4WM7A 3HVDA 3UK9A 3KD4A 1GZTA 1GICA 1W8HA 4YYOA 4NIDA 3IAPA 3WY6A 4S2DA 3KWVA 5FYCA 5ISLA 1MS0A 2JG8B 5GZEA 3T0AA 1OXCA 3I59A 3CHXA 3OCPA 2C4XA 4ZS3A 4JHTA 4E4ZA 4LMFA 2NYYA 3M70A 4OHWA 3K4AA 1NOVA 1H0BA 1DZRA 3I3DA 3N3HA 3K48A 3TYJA 4OMCA 2HH9A 2XUMA 2QQNA 3EBRA 2BU9A 4AW7A 1PNGA 4YVWA 3ITQA 2DUQA 1MEC1 4GB32 4IV1B 3O1PA 2DV9A 1LHWA 1TME1 2C0ZA 3B9IA 1HB4A 3KVBA 4ES9A 1UPIA 2MEV3 1OQDA 3INAA 2IFWA 5LBBA 1AZDA 4IQPA 1S4CA 3I2DA 3PMEA 5JZGB 2BNMA 3SNMA 3IIAA 4BMBA 4D94A 4MLOA 3K4ZA 1G9DA 2VMHA 4OHVA 2XKPA 4A7YA 4ONUA 1OFNA 3ZM8A 2LUWA 2WABA 1DLCA 4GJZA 2BW8A 5H9PA 1GWMA 1UY3A 1GOFA 5FZ3A 2BWAA 1ZZ9A 2PAEA 4EN6B 3ZKYA 2BRTA 2ILMA 4I30A 4WZFA 1Q8SA 2Y60A 3HOBA 3USUA 2RS11 3AMPA 1HV1A 3PJYA 2ZKLA 2OT7A 4ZXKA 1AR92 4AGVA 1AR93 2EIDA 3JD73 3OTFA 1HN0A 1G9CA 2QQJA 1CAWB 1HDKA 3W58A 5M0TA 4XHBA 1NZIA 2ADEA 1W6PB 3IIIA 4DXZA 2HWC1 4IERA 3WDVA 2EXHA 2VOWA 2ZX1A 3ZXJA 1RYYA 3U4SA 2ZGNA 3T1LA 2RDSA 2YBSA 3POWA 4UT5A 2R043 1LEDA 2FCTA 2VVFA 3ZX7A 1XXNA 1SG3A 3J7MA 1AR81 4QQ2A 5D8AA 2PHTA 4UI9L 4YM1A 3H1MA 2DCJA 5F9TA 3WNNA 1IKPA 3RYKA 3AZVA 1JN2P 2QZ2A 4NUBA 4AQ2A 1PGL2 4RD7A 5G05L 5C3OA 4CDXA 2XUEA 2YPDA 1Y43B 2ZGRA 4XETA 1WCSA 2JE9A 1UOBA 4QX5A 4DRVA 4KWUA 3VHPA 1D0HA 2ZJCA 1ZRCA 1DGWX 4XC9A 3BODA 3V64A 4EE2A 1BEV1 1W2OA 1OHFA 4DY5A 2CYFA 4CCKA 3RPQA 1SFPA 1GWKA 5TSWA 3O1VA 3VD7A 2RM22 2KM2A 5DABA 3DECA 2GDFA 1ENQA 2VU9A 3MICA 3SCHA 3TRSB 2VZQA 3GALA 2WZPP 2Y6GA 5DAWA 2TNFA 2VTXA 4YZ1A 3WW3A 4COZA 2E32A 3FHAA 4LE4A 2NZ9A 4BLIA 3WF2A 1QH7A 1LCLA 3VB9A 4MADA 2RVAA 1NAEA 2VH9A 2D93A 1H8TB 4XOGA 4BA6A 4BQ5A 1VBB3 2JXAA 2RDNA 4XZPA 3RYRA 4CEWB 4JHZA 5BY5A 5CA6A 3BOWA 3THPA 4N9HA 3MPBA 4B29A 5IFTA 2NMOA 4KWKA 2ZCWA 4MXVA 1BBT3 1YI9A 3KT1A 3LZZA 4ET7A 4FPJA 3O1TA 5C8CC 1OUXA 2WNUB 5FPBA 1RGSA 5C4WA 3ZXLA 1W28A 2VUJA 3IWZA 1LOBA 4LJHA 3HPNA 1ZZCA 4ARYA 3LQCA 2YDEA 4RS5C 3VDDC 1EPWA 3OG2A 1HRV2 2W1WA 3A4UA 3CDZB 5CEHA 1HRV3 3SH5A 1YFUA 4BH9A 5IVJA 4I09A 1FPN1 1ZZ6A 1MR5A 4XF9A 4PT6A 5F2SA 1WCUA 4A42A 1ALYA 1F2NA 2GU9A 4XFBA 5BNPC 2CAVA 4Q8LA 5EZWA 4LO8A 1TNFA 3NQHA 1QEXA 3I4IA 3SLIA 5FY7A 4Z2WA 5F8PA 4W6YA 1ZBE1 1SDWA 2DVGA 2ZBJA 5ACA2 1JHJA 2XJQA 2VMGA 3HNMA 1UW8A 4LITA 2CU5A 2VL4A 4LKFA 4CDWB 1W90A 1UD1A 1Z7S1 5FJHA 3M2MA 4R9DA 2YUEA 3FMGA 4B4RA 1W9WA 3C7EA 5LA2A 1UOGA 1V70A 3OPZA 5FPUA 3P5BA 4ES8A 4XF1A 3WF1A 1S1AA 4YG3A 1QU0A 3J7LA 2D3SA 1OH3A 5EV7A 5IAVA 4AFMA 3ZN6B 4GH4C 2RMU3 3EXUA 3ZFFB 1BXHA 4QPIA 4FPOB 1RMU3 4CXWA 3RNSA 1CIYA 4PQQA 2ZX0A 3R05A 4UYBA 4CCDA 2GN7A 3EMRA 4LHLA 4KGGA 1D4M2 3I7DA 4PDWB 4QU2A 3SKVA 2D40A 1UPSA 5FZBA 1RVF3 3THCA 4JGYB 2Y6JA 3VBFA 1PHMA 5FZAA 1DGLA 2I45A 5B4NA 1POV0 5FY9A 3LWCA 1J1TA 4ISQA 3AYAA 1PO23 2W0XA 5KBFA 5DG2A 4OVEA 1B35B 4NE9A 1X82A 4AQSA 1UXXX 4KG8A 5LW9A 1YQ2A 2NM1A 4MSVA 5E88A 1N1YA 4MYEA 3WG4A 3ACGA 2YROA 1R092 2RV9A 2ZS6B 1ZBA3 2WSUA 4FFGA 3POFA 4LBQB 4MGZE 4QQOA 4RR3B 4AYUA 1NLQA 1R093 2Y6LA 3PVEA 1K12A 5KC5A 3PIGA 1VBA2 4U2AA 1US3A 1UMHA 2VZSA 5CFDB 2Q0AA 1VBA3 2Q8OA 1CAXA 1JZ3A 3T4VA 1QGLA 3PTRB 5I8YA 1AL23 1W6NB 3VZMA 1G8WA 4FTBA 3NO8A 3KSCA 1C4RA 1V9U2 3WP6A 2WQ8A 1PIV2 1LOCA 3CZUA 3LIGA 1IGOA 3TNPB 3NNGA 3ZSMA 4AFAA 1RUOA 1V9U3 2OPWA 2CSGA 3Q8CA 4HBNA 3AJYA 4RYDA 5JDBA 1Q43A 4DRRA 2VGDA 3K3OA 4K20A 3WF4A 3RZKA 2FDJA 4Q29A 5I0TA 1KD7A 4AVCA 5JXGA 3ZMNA 1W9TA 5LATA 5C6CA 5T52A 1IQDC 1W04A 1ZZ7A 1AHSA 4L0PA 3WSOA 4BM8A 3ACHA 4MV2A 4J25A 2XGXA 3VHNA 2E31A 1LENA 2DCKA 2VQTA 3R4UA 1KJRA 3WQBA 1C1LA 2WSVA 1UXZA 3FFQA 3NRUA 2GZWA 1NG0A 4O7XA 5F5QA 2JWPA 2LRPA 1HB2A 4W6XA 4AEDC 4IETA 4QMAA 5GM0A 1JS9A 1C8M3 3T2PA 4G9SB 3BTXA 3MF9A 5J36A 1J3QA 2R071 1RUH2 3LA3A 5A7WA 1GYKA 1QIQA 1DG6A 4IEQA 4Y1YA 4UFLA 1RUH3 2WT2A 5CB7A 4DOUA 2ZEYA 3V0AA 2WZR2 4AQ6A 3E97A 4B7KA 5K0UA 4DB5A 1EV12 3K46A 3VZLA 2OVUA 2ZGKA 1Q5OA 1D4VB 2VXJA 4MUVA 1COV2 1M06G 4AVTA 1KRIA 4PIZA 2Y26A 1COV3 1LESA 1ULFA 4AHZA 2X29A 5FP9A 2K2SA 5FZHA 1PMHX 4GWNA 3WG3A 4QPWA 1EUUA 3J8F3 4HLTA 1ASJ2 4QPGC 1YRZA 1RUI2 1TE1B 4DFSA 1ASJ3 3GJAA 2X5IC 1RUI3 4NWVA 4HZFA 5FZ0A 5JOXA 1FMD2 4KNCA 5ERLA 2UYBA 3DV8A 5A6ZA 3IDCB 5A1AA 4OYUA 4Q4Y3 1G86A 3BTYA 1PO12 2JG9A 3Q8BA 1PO13 3JZVA 1MS5A 3WOGA 2VCBA 1AF9A 1YQ5A 3D0JA 4BPZA 4Z82A 3CJIC 3PVOA 3H8RA 1MVQA 2BNNA 5FZ1A 1RUJ1 2BOIA 3BU0A 3WUDA 1DIWA 4BDVB 2UYAA 4LXLA 2CGOA 2WZ8A 3FHIB 3IT8A 4NRQA 3RI8A 3VD4A 5LASA 3ZVXA 4C1WA 2ZGUA 3ZMOA 2B9VA 4Y20A 5IVVA 5LEJA 2PN5A 2VZRA 5FP3A 4I01A 1H9WA 2ENRA 4MXWB 5L19A 1WLWA 4C90A 4IE6A 2R6QA 4JRAA 4NRMA 1NXMA 3DYPA 4FSJA 5FBJA 2DYCA 2W94A 4QX8A 1ZZBA 3U10A 3ZFGA 5FO8B 1SLAA 3E6DA 3DYOA 3ZFEC 1YJKA 4RGKA 1RHI3 3ACFA 3B3QE 2JDKA 1DBNA 3T2QA 1XU1A 1L7LA 2DURA 4MX3A 3VBUA 3ZLIA 1GANA 3RG0A 1WKYA 2RJKA 2HJIA 1QF3A 1RUF2 2ZA9A 5DAPA 2DUOA 1RUF3 4LK7A 2QQMA 3HMYA 5FBZA 3C7GA 3WVJA 2AACA 3H1WA 3KQRA 3NSTA 2W08A 4CPBA 2G9FA 5C7GA 4BB3A 5HV0A 4C8DA 3I2KA 1W0OA 1C28A 2VOVA 4L8QA 5LA1A 1O3TA 5FZKA 5HXVA 1OOPA 3ZR5A 4FQZA 3ZXKA 4EN0A 1HQLA 1UKRA 1VR3A 2ZMKA 3LD8A 5C8CB 4TYSA 4BXFA 1DYOA 1OA2A 3MI8A 4FPYA 1MS4A 1UF2C 2B46X 3LEKA 5FZ8A 2ZGPA 4UF0A 4QAWA 5FZCA 3T3YA 4SBVA 2CGPA 2B42B 3ETQA 4L9BA 4OQ9A 4EN7B 3BTAA 3PUQA 4LO5B 1KS5A 1F5FA 2WNVC 4MO3M 4FBFA 4U36A 5FK7A 2DDUA 1W99A 5BNPB 4IEOA 5LWBA 5CG9A 3OD0A 3DEMA 5IJRA 2VMFA 2VMDA 4DNYA 4COWA 3HD8B 1PMIA 2W47A 3PHMA 4ZU5A 4QB2A 1RINA 1GNHA 1YIPA 1HQNA 2J1TA 1DYKA 1XBFA 2QVSB 2QTWB 5JIUA 4YG0A 4LORA 1JZ6A 3VKFC 4YVSA 3HN3A 2XJSA 1UYZA 1CZTA 1T2XA 5JMCA 3OUIA 1RC6A 2QE3A 4R52A 3HIFA 1NA1C 1YHFA 5B4XA 1JU3A 4K40A 2VTXJ 4GH4B 4G3YC 5F5AA 2G9GA 2ZGQA 2WNEA 2IXLA 1XOYA 2R1DA 1EPZA 4AL9A 5GALA 3RVHA 2FQPA 5K9YA 2DCZA 4BIOA 3OGJA 1MS1A 1UQXA 4NHLA 3O1RA 3MW2A 1ZA7A 4I3PA 3TN92 2HWE1 3BB6A 4ASKA 2JG8A 5FZEA 4FOQA 2FDGA 3TN93 3GZUC 2NQYA 1OI6A 3D82A 4IEUA 4IV3C 2IVIB 4IW3A 2PHFA 3PMSA 2TBVA 3N9QA 3RZHA 5HV4A 1JOBA 1PMJX 4XQWA 3SEEA 4LUKA 1UN1A 1DQ0A 2IWGB 2BEOA 1DF0A 1MQTC 4UFIA 3TOJA 2K9ZA 1PNFA 5FP7A 5CISA 1OQEA 1SLIA 1K5MC 1DGRA 2ZHKA 1P8JA 4IV1A 3ALQA 1S0BA 2QFEA 4JDNA 1AL0G 5KHJA 1XNKA 1TMF2 1H1IA 1BLZA 3WUCA 1QJX2 2ZAHA 4ZKTB 1I6XA 5FLHA 1QJX3 1BJQA 3T2TA 3KMHA 4XIKA 3HT2A 2QQIA 2VQ0A 2BQPA 3MBWA 2XB6C 4LBOA 2YGMA 2WFF2 3TNQA 3ABZA 1AYM2 2A3WA 5JI7A 2W5FA 4OQ8A 5A3UA 4H7MA 4WVWA 2DCTA 4XDPA 4COVA 4XXAA 4QU1A 1L3JA 3BN6A 3MGUA 5FPVA 3WG2A 1WUVA 2VOKA 2E7AA 1IG3A 4WV8A 2CDOA 1LOFA 2D6LX 1LHUA 1Q8OA 4CUBA 5FYIA 3B02A 1UZ0A 3MIHA 2V72A 4D7YA 2E9QA 3WQ1A 3KS7A 4WM7B 3H7YA 3S5QA 2SLIA 3IM0A 2D3RA 4KMQA 4OHXA 4HK8A 1NY71 1ULCA 5I8TA 2O14A 4PF5A 1CAWA 4LBMA 4PF1A 4AI9A 3OPTA 1ULOA 1O4YA 3EYPA 4HL0A 4HONA 4NPRA 3T1MA 2W91A 4AEDB 4KBZA 3KT4A 3N7KA 5L9BA 1QNWA 1IG0A 5CADA 2DU0A 1PM7A 1O4ZA 1XNDA 4DS0A 3MFCA 2EXIA 2WR9A 3LFIA 4QQPA 4HVQA 2VJXA 3D3AA 2XWJB 5A3PA 3E5UA 1PX3A 4PBOA 4CP1A 1I1EA 1H8VA 1ONAA 2PA7A 3IPVB 4XYXA 4DEVA 4GKYA 4HN0A 5FY4A 2JDMA 4SLIA 3WDYA 4TTGA 5J96B 1QDCA 3KV6A 5C3RA 2ZMNA 3B5LB 5SV8A 1RUG1 2AC1A 2LALA 1VRH1 2CWMA 4QPGB 4BK4A 4Y1XA 1VIWB 3AMNA 4L97A 3RGBA 3JBG1 1LHNA 2X5IB 2RS32 3LKJA 2XL9A 1DP0A 1MVEA 3PUHA 5EWSA 2RS33 2R49A 3KM5A 4Y4RA 1E5IA 4Z07A 1GBGA 3VBSC 4DUWA 2VXRA 4QM8A 4COUA 2VE1A 4QKBA 1JOJA 1SLBA 4XIOA 5FZ4A 3UKTA 3R4DB 4ORFA 1BMV1 3BUCA 4CTEA 5JSOA 1H8TA 5F3GA 2PLV2 2VNOA 3RWKX 1J3RA 1NQJA 2VZ1A 2XXZA 3MYXA 2E7TA 4HANA 4YG6A 5FUPA 4CEWA 2V09A 3BI3A 2YY1A 4OZXA 2C26A 2ZACA 4IGQA 5AVPA 2J1SA 2HWF3 5I0RA 4K9SA 3P6BA 2VUAA 2WNUA 1UZVA 4LHNA 4CZSA 2VZ3A 2WINB 1B09A 3MEPA 1DFQA 2BJSA 5F7UA 4M0HA 4M4PA 4LBKA 1EAH1 4XBQA 2YBKA 5JMOA 3J7NA 4YFZA 4K3UA 3DKQA 3PDQA 2VZVA 2D7FA 1UIJA 1XJAA 2OPKA 2SBAA 1S0IA 3CLPA 3KB5A 2MHFA 1QJU3 5DZFA 1V6NA 3PURA 1TQ5A 1NCRA 1UY2A 2VZUA 2WO1A 2DVBA 5JXIA 2HWB3 1BK0A 5BV6A 2ZX2A 1S0CA 4UFMA 4LBLA 1UX6A 2OW4A 2YBPA 5F1RA 4CDWA 3ZYGA 3LOBA 3WW1A 4E8DA 3M1HA 4KH9A 4R9BA 2WO2A 4I02A 5A6QA 4IEZA 5ABJC 1CONA 4AR2A 4FFHA 5SV5A 1S0JA 4Q0QA 1OVPA 1FI2A 2D3PA 2WDBA 2V5DA 4PLMA 3GHMA 5D2AA 3O12A 1AR62 4UXAA 1R081 1AR63 1FV2A 1NQDA 3RZJA 4P9LA 3ZN6A 2CDPA 2V4AA 3IMMA 2GAUA 4Y4YA 3ZFFA 2EALA 2AUYA 4JQTA 5LK5A 4QX1A 4Q4V3 5A7NA 3UKVA 2WNVB 3FN9A 5LY2A 3BYWA 4XPVA 2V4VA 4QB1A 5DUVA 1W3XA 2A6WA 1QXRA 2AEYA 2CGNA 4Q4X3 5GZFA 3WNMA 1BCXA 1N1TA 2WT1A 3D6EA 4AOCA 1OBNA 4CDUC 3WNKA 4LQRA 1GR3A 4IXLA 3RDIA 5A3LA 2KXLA 2RS51 3AMMA 3CMGA 4JGYA 4EN8B 1OLRA 4NAMA 1SEFA 5HBAA 4DUXA 4FO9A 4PI0A 2TEPA 2PQQA 4X6RB 3K4DA 2DF7A 1ENXA 3AYDA 3NWKA 4IESA 4C0HA 3O5SA 3I3MA 3PU3A 4CDQB 4Q4W2 1U5ZA 1B35A 2D6NA 1CAVB 1O59A 3I8TA 4HPKB 2WYFA 4OUEA 5FWJA 4Q4W3 5FCCA 5KC6A 1E57A 3OY8B 2VW0A 4GALA 1FOD2 2FCUA 3GNEA 3MIDA 5H9RA 4LBQA 1FOD3 2DBIA 3HQRA 4RR3A 2RDQA 5DPNA 2BFUS 4DIQA 4XDOA 1W8FA 4B4PA 1IOAA 1KDMA 5CFDA 3ASIA 2XL7A 2GC2A 3ZSEA 2XBO2 2XHKA 5JOZA 1AR72 5BUVA 2XBO3 3AK0A 5C9AC 4TXWA 2A3YA 1UU6A 5BXXA 1AR73 3KT7A 1W6NA 4IV3B 1JU4A 4ITCA 5DZEA 1HW5A 2LW8A 2W1SA 4LUMA 4A44A 3T0BA 1RUC1 2HWD1 3HJRA 4WM8B 5C3SA 1O3RA 3OGVA 1ZRRA 1AUYA 1FV3A 1MEC2 4JKLA 4A7ZA 4CCLA 4CU7A 1MEC3 1BYHA 4P14A 3W5NA 1TME2 1WD3A 1CAUB 5CG8A 4GB33 4OLLA 4XAEA 1K5MB 4I0WB 1FYUA 1WMFA 2W1QA 5J3UA 4YFWA 3VZJA 5C71A 2JIGA 2VMCA 2XLGA 3ILNA 3A0NA 5CAZA 1LOGA 5FXZA 1KXGA 4M00A 1GKBA 4NHMA 3ZSLA 3AFKA 1W8TA 5L7OC 5CKQA 1J59A 4N9IA 2YXSA 1F31A 2H0BA 4JGZC 4YPJA 1UYPA 1HX6A 4UOJA 4N8MA 3WD5A 2P37A 3URFA 1SACA 2F6BA 1OLQA 5FJKA 3RWNA 1ZREA 5A6XA 4C91A 1W9FA 5H9SA 4FPHA 3WNOA 4QD2A 5LBEA 5FMDA 3ACIA 5AFBA 5LEKA 4LBNA 4Y24A 4BJ0A 2MEV1 2H0VA 1Z0HA 1RITA 4F8AA 4MGSA 2HYKA 2RS12 1LAJA 4Y33A 5JWPA 2QJVA 5FZGA 4QM9A 4NIIA 1JZ2A 4N7UA 3TEZA 4N43C 5IVBA 3APBA 4K6BA 3Q8FA 2WS91 4E4DX 2ZHLA 3ZYPA 5DQ0A 5FXXA 1GQGA 1JZ4A 1UZZA 2VQUA 3NNLA 3MLLA 1X33A 1GZ9A 2HWC2 1UY0A 4Y1UA 3E6CC 1LOEA 1YC61 5D21A 2HWC3 1NLSA 3QOPA 2R1BA 4LBQD 4Q1RA 3H8XA 3OB8A 2V73A 1DZQA 2E7QA 2Z5WA 4YM3A 5A1LA 4QT6A 2OZJA 2VMIA 4XAAA 3RZZA 2YG0A 5A3MA 1NCQC 4JKMA 4CEYC 1UAIA 4R8HA 3C7HA 4XW3A 1AR82 4CCNA 2WA4A 3M7AA 4GIQA 3K3NA 4LO4B 1AR83 1F5JA 4XFIA 3JD71 5C5TA 4UAPA 1LKNA 3H50A 1W6OB 5F6KA 2L9LA 5A3OA 4YRDA 5HXMA 5FQ0B 1S2EA 3FBMA 2EXJA 1LU1A 1ENRA 1FAYA 1NKGA 1V0AA 1IKQA 2GSYA 3VLBB 4B3NA 1BEV2 4X8PA 3OYWB 2VR4A 3WV6A 1SQ4A 1BEV3 3KVAA 2R041 1XYPA 5JXHA 4I0BA 4LIUA 2PMWB 1UCXA 2WQ4A 3AYCA 4MXWA 4QXCA 2D6MA 5FO9B 4N53C 2IZWA 4ZZ5A 2RM23 4DXTA 5HCBA 2WC2A 3O0XA 1JZ7A 2ARCA 1XPWA 3OEAA 3ZR6A 3WF0A 2OX0A 2C9AA 3GBWA 1K3IA 3ZOIA 4RL7A 3IKWA 5LA9A 3VBSB 2BZDA 4BXSV 4JDMA 1G7YA 1ULEA 1WW7A 2O8QA 4BOWA 5FOBB 2JDNA 2YMZA 3MW4A 3N9OA 3VDBA 1LR5A 1CX1A 2P3IA 4Y1ZA 4W4ZA 2D97A 2W68A 3KCYA 3WCSA 4EQVA 3VKNA 3PTYA 2WQZC 3JCIA 2XJRA 3S6PA 3B00A 5CKMA 1ULPA 4AAXA 1C57A 4MGTA 4INDA 3M3IA 3NAPC 1GQHA 2Z4FA 5T5OA 4R9CA 5D1IA 4Z92B 4Q27A 4HFSA 1LTEA 2Q1FA 4XE9A 4CVUA 1JYXA 3GHNA 5C8CA 1WMEA 3AM2A 1W2UA 4LLOA 2XJVA 4PLOA 3AVRA 3PNAA 3ZIWA 5A7OA 4BQYA 4EV0A 3VZNA 3VDDA 3N7MA 1VBB1 4RS5A 5FZIA 1FPN2 2YC4A 3RRDA 3U75A 2JB4A 1CPNA 4NIHA 1NCRB 4RGGA 4K8FA 1KITA 1BBT1 1SZBA 3OD4A 4V2VA 3DUIA 1CX4A 4V2WA 2AREA 1ZBE2 3FLTA 4GZ9A 5FMOS 5IWFA 4D7TA 5BNPA 4GULA 4IEVA 4AVAA 1ZBE3 2VNVA 5ACA3 1SLTA 2Q8DA 1CGPA 3KZ4C 4BQ1A 1Z7S2 3OGGA 4JVAA 1BZWA 1WCKA 4RFT0 3BPSA 3N7JA 1Z7S3 4XJUA 5E6HA 4GWJA 4Q1PA 2FHRA 5I93A 3H3UA 3NJYA 5BNOC 1DDLA 4CE8A 3LIHA 4OZOA 4F3JA 5LBCA 1L7RA 4TN7A 4XVHA 4LOTA 2P5BA 1DQ5A 3DGTA 5C33A 4MOAA 1XNTA 2EF6A 2VZPA 3J7HA 5F37A 4YW1A 1OC1A 3B94A 4GH4A 2BBAA 4JQRA 1KEXA 4CCMA 4O61A 4D6RA 2OQ6A 3ZXAC 3WQ0A 4KU7A 1QJY1 1MS8A 2W87A 3AZZA 4YARA 3WLUA 1D4M3 2AEZA 1JMUB 4Q0PA 5J98B 3VBOC 3I54A 1QJEA 2VZTA 4JRLA 3R6SA 5JXJA 2B45X 2RMU1 2UWAA 4QPIC 2PFWA 3VD3A 2FMYA 3F2ZA 4AGRA 3N35A 3WR0A 5JAXA 1BQPA 1UWWA 1RMU1 1YJLA 4AFCA 3SCFA 1JZ5A 1I3HA 5FLJA 3LEGA 1HIXA 4K7JA 3AP5A 4Q0SA 4XF3A 1LU2A 1WGPA 3ZN5A 2VBPA 4P5HA 3H9AA 4MGIE 4Q0VA 1SHWB 1UOJA 4BK5A 1RVF1 3LDRA 1F15A 4LK6A 1QQP2 3M3CA 2FZ1A 1YLLA 3WEZA 4AEJA 2DVDA 4E9KA 3NKGA 1SFNA 4AI8A 3ILFA 1QQP3 1W6MB 1JYWA 2VBBA 3OBTA 1PO21 5CFCC 2YU2A 3TEWA 1YQ6A 3CO2A 4DXSA 1LECA 4Z8BA 4A6OA 4XQDA 1IPJA 2DFBA 4LA2A 3ZDSA 2CY6A 5C9AB 2VTFA 2GMPA 2PHRA 2Y38A 3UYJA 1ZBA1 5T55A 1HB3A 2ADDA 1PVXA 4XUPA 2GNBA 1PIV3 1R1A1 2Y6HA 5EQUA 4LIVA 1OD5A 3L9JT 2Y8KA 5IFPA 2WYSA 2QQLA 3H3ZA 3NV2A 5CZKA 2A1XA 3LA2A 4L99A 5FYBA 4H14A 3VBRC 1AL21 1ODMA 3JU9A 3UT0A 4FFFA 5J09A 3CBNA 4XJAA 4XMIA 2J1EA 4D0QA 1YCIA 4QQLA 4AI0A 3QH7A 5L7OB 4AI2A 4NVPA 1A8DA 1YQCA 1UU5A 3P1IA 3Q8AA 4JGZB 4QGNA 1ZM1A 3FWEA 2IXHA 5FTTC 5JLVA 2R072 4D69A 4M0NA 1HXS1 5FZ9A 4AEDA 4GA9A 2R073 4Z2AA 2RDRA 3VBHC 3WHUA 5JSPA 1V6OA 2FDHA 2G1MA 1PVC2 2QKDA 2WZR3 1PVC3 4Q5OA 4AI3A 3AJZA 4DZGA 5JOYA 2QCSB 4XBLA 1OA3A 1XSRA 1EV13 2WO3A 4M3CB 3AB0A 2D5HA 3IPVA 4N43B 2JE7A 1VAKA 2PHWA 3PVBB 1C8M1 5FYUA 2I74A 5J37A 3UL2A 1POV1 3H3LA 1H6YA 3IDAA 3QLQA 4YW2A 3USSA 1RUH1 3M3EA 4EZHA 4ZZ8A 5LK7B 4AVVA 2XMLA 1S2BA 5DAVA 5FYZA 3BALA 2QDNA 4QPGA 3HBKA 5I91A 1FMD3 4WVMB 3VKMA 2X5IA 4X6QB 1GSLA 1O8PA 2MNGA 3VL8A 1Q8PA 1NCQB 4CEYB 1PZ9A 1COV1 2QBXA 4K1ZA 3PIJA 4CCEA 3WP4A 3S0MA 3KGLA 4GQ7A 1QDOA 1GWLA 1XYOA 4FTSA 3J8F1 3MIBA 4AXOA 4GKXA 1D2QA 1WD4A 3OUHA 4LO6B 4MHUA 5FMBA 3V56A 5A7QA 3AKQA 2UWCA 2A6ZA 3T4HB 1V6IA 1PX4A 5LRSA 1FX5A 4Q4Y1 4I0AA 5FZOB 2VUDA 5FPLA 1CVNA 4HMZA 5F32A 3THDA 3C7FA 3N9PA 5F3EA 4IL7A 4S2GA 1GLHA 1Y4WA 2BGOA 3MIEA 4W8JA 5EIYB 1VB4A 2ET7A 2GNTA 1KFUL 1YFYA 2J1VA 1WMXA 2V5YA 4UFHA 4N53B 4OHYA 1QKQA 3W21A 3NV1A 3T08A 1ZRIA 3RZGA 3M4FA 2JENA 5JOWA 5CBLA 1V00A 1MZ6A 1QOOA 2GNMA 2YFUA 4R4XA 1HQWA 4FCAA 3HWJA 1GP4A 4R9AA 2OZ6A 4NAOA 1R64A 3KF5A 4D6SA 1G9FA 3O0WA 4NR1A 3AYEA 3OBZA 1C8NA 1UX7A 5FZ7A 3TEYA 1UOFA 2D6KA 2IXJA 2GN3A 4ASLA 2HLEA 1AX1A 2UWBA 1Y9QA 2D43A 3VDCA 2CHHA 3NAPB 5F5CA 1RHI1 3AMQA 4AHYA 1W0NA 1HV0A 1VBC2 4H3WA 5L36A 3VKLA 4KQ7A 2ID4A 2VD7A 5KHHA 4RS5B 3U07A 1VBC3 3VDDB 4QB6A 5AVAA 5LA0A 1REFA 3G7DA 1KJLA 1BK1A 3OOXA 4IEXA 3ZSKA 3UGFA 1RUF1 4AWDA 5CNAA 1CPMA 5FPAA 5FUIA 2XVGA 4IGPA 5A7SA 4QPYA 2BDRA 4EWEA 1VBD1 1MZFA 3S30A 3WHTA 4L92A 2WNVA 4ZHNA 1XNAA 2YYOA 3C7OA 1I5PA 2A6VA 5FO7B 1I5ZA 3PVNA 4KI5M 5A1FA 4QX7A 2FBEA 4EWAA 3HAGA 1UMZA 2RG4A 2XDVA 5CYYA 3T09A 4A2UA 3FUQA 3ES1A 5BNOB 4HVOA 2EIEA 5GLTA 5FYHA 1QH6A 1W8OA 3EJKA 2A7AA 3IZOA 3N9NA 5BNNC 1KGYA 4CDQA 3GCWA 1RL3A 3ZXDA 1APNA 1CAVA 4HPKA 1WLCA 3BIEA 2RHPA 4HKOA 4D6QA 1NA1A 4CCCA 2JDHA 1YNAA 1FNZA 3QACA 3B01A 3OY8A 2O1QA 4AEKA 4JC1A 1F9KA 1O4TA 3ZN4A 4CUAA 2BGCA 2Y33A 4DY3A 2A3XA 1PK6C 4N7IA 4BQ3A 2VW2A 2RR11 4IE5A 1ODNA 4QWNA 1FATA 4XF4A 2HWE2 2FZ2A 2OUHA 5FP8A 3BU7A 4FOVA 2EXKA 5FZ6A 2HWE3 2DTWA 2A70A 2VMEA 2WN3A 3VBOB 5IVEA 1PZ7A 2G19A 3U37A 3OUJA 3POJA 1H30A 4FP2A 5FY0A 3ROUA 2ZGTA 3TAYA 2VC9A 4IV3A 4CPBD 1HJGA 2JX9A 3NV4A 4QX0A 4PBPA 3UJQA 4D7SA 1O7FA 1RUD1 4AFDA 3FC0A 3FLPA 4XFFA 3WW2A 4WM8A 2AR6A 3AC0A 5DDJ1 1BHGA 3C2UA 3GYDA 3JXSA 4YZ3A 2WFPA 3MPPG 3FBYA 1CAUA 1EUTA 4XACA 1RIRA 1ND3C 2WBKA 1K5MA 2IC1A 3FJSA 4XXPA 1KFXL 5T5LA 1TMF3 3OGSA 4JKKA 4CYDA 1XRUA 2C1FA 3LA7A 4CP9B 5KHIA 3SXWA 2CTVA 4XTMA 4WVVA 5I0UA 4CU9A 2YGLA 1DZTA 1YUDA 2EIGA 3AFGA 4JDOA 4MHRA 4QHOA 1WZXA 4A6SA 2QQKA 2WFF3 5E8AA 4NHXA 1AYM3 2PHLA 5BYNA 1N1SA 1JYVA 5HI0A 1AXYA 1GP6A 4HK9A 3LB9A 3MO4A 3MDPA 3LF7A 5JZGC 2GMMA 2WLPA 2Y6FA 2Z42A 3J4UH 4KL1A 3CF6E 1WWYA 4ZY9A 3VBRB 5HCAA 3W9AA 5IATA 5KXDA 3AP6A 2VG9A 4QDQA 1NY72 2LS6A 2OUJA 3H7JA 2OYZA 2EIBA 1W8NA 2MPFA 4IEPA 3UGHA 2XKOA 3GBGA 2ZEZA 1RUE1 5T50A 4K8RB 4TSVA 3S5AA 1J58A 2P4EA 1UZYA 2QQOA 2ZKNA 3LGRA 4YM0A 1O91A 1JZ8A 3J26N 2GNDA 1DCSA 1SLLA 2XJPA 2F4PA 3NNFA 4HETA 2BNOA 3DXTA 1YQ8A 3CKHA 4AF9A 5DAQA 2HYXA 4RN5A 3VBHB 5FK8A 4E8CA 5C3PA 1MACA 5F5IA 4LHKA 5ANQA 2DUPA 4MG2A 3D5OA 1OF4A 1OPOA 1W6OA 3VZKA 4IE4A 1VAMA 4Q2FA 5AC92 4PQ9A 4QKFA 1GNZA 4QXHA 3FL7A 4EZ4A 5AC93 5FQ0A 1RUG2 1VRH2 2PAKA 3KGZA 4NRPA 3U1XA 1DQ1A 3L2HA 3K51A 3OYWA 3I97A 4P9IA 4E2SA 4OI1A 1RXGA 1LRHA 1QJFA 1R1ZA 1V6JA 3ETPA 2P17A 1VAVA 4GMP0 2ZEXA 3RZLA 2X53S 2JJ6A 4WVZA 3MIGA 1ENSA 1JHNA 4XJ8A 5T5JA 4M4RA 2BOJA 1GUIA 1WBFA 3AKRA 3O1SA 2ORXA 3CJIB 3DKWA 3VBSA 2BWCA 3MFAA 3RMYA 1BMV2 1DHKB 1N3QA 1XC6A 1LULA 4JTNA 1VBE1 3DL3A 4CSWA 2XR4A 2BP6A 5C8WA 3KHCA 4CXXA 1UKGA 2WIIB 2PLV3 1X9TA 2R061 5JVVA 2VM9A 4BISA 1H2MA 3W59A 2RS31 3DCQA 3J9SA 1GP5A 3WINE 1EYBA 3OJBA 5APAA 2UU8A 4LULA 4BQ2A 4GJYA 4WBBA 1OSGA 5FY1A 3SQOA 1JUHA 4QXBA 2AENA 5CVRA 3W5MA 1NYWA 4B4QA 2ZOEB 1Q56A 1XE7A 4X8NA 4JX0A 3IN9A 4KWLA 1JOPA 3ZFEB 5A70A 5A3NA 1EAH2 1LB2A 1X9PA 2VCMA 4LR4A 4XURA 4AI1A 5LCWL 3UKNA 1EAH3 1W6QB 3K75B 3E6BA 1XNBA 1D2SA 4W50A 2J1UA 1ZA4A 3S7EA 1PGSA 1CIWA 3A23A 5FR3A 2ES3A 1ZVFA 1REDA 2HWF1 2E6VA 1WW6A 4W6WA 4EYUA 4ZU7A 3MF6A 4CCJA 1O5LA 1K45A 1G9BA 5F3IA 1EY2A 3AP7A 2ERFA 1TZOA 2ZX3A 2P34A 5AFEA 4W65A 5E16A 2DBNA 1O3SA 2JDAA 3O0VA 4M3CE 2LROA 5HPOA 3DPRC 1AYN1 1PGW1 5KHKA 4F7ZA 4O65A 3ZYBA 1XE8A 3NL1A 4GMP3 2X09A 4PLNA 4DMIA 5GZDA 5ABJA 1SFYA 1QJU1 5IHRA 1R082 4A4AA 2HBUA 1O6UA 2W52A 2HEVF 2WT0A 4RHV1 4Z1VA 2Y6KA 2PHDA 4HT1T 1R083 2HWB1 4AVSA 1OFSA 2Q1ZB 4E4HA 1UZWA 5EHDA 5C5UA 2JE8A 1QHDA 1RJ8A 2VVDA 2WKKA 1SDDB 3BGAA 3WNLA 2YPJA 2XH6A 4FFIA 5FZMA 3ZKUA 1ND2C 1U5IA 2XG3A 2VOTA 5IK5A 4GXLA 3A21A 1HRI1 5JR7B 3OBAA 2LTNA 2E33A 2RS52 4TLFA 4L11A 3LDKA 4CDUA 2PELA 3CL1A 3ACLA 2ETEA 4OMDA 2Y34A 1OT5A 2C6SA 4YGCA 5B2GB 2HEYF 5FYTA 3AZYA 1N1VA 4FPEA 4Q4V1 5FY8A 4ATEA 2VNRA 3I2HA 5BNNB 1CJDA 4AQTA 1SPPB 1NA1B 3CJXA 3MUY1 4PDWC 4Q4X1 4DPNA 4XQ4A 3EQEA 5FYSA 2B9UA 2GH8A 1OKQA 1X8EA 4IEWA 4RFRB 4YW4A 5F3CA 2VCCA 3PU8A 2BUKA 2CV6A 4H55A 5EJ1B 3WDUA 2J1RA 1U12A 2XJTA 3N9LA 4CRQA 3ZDVA 1W6MA 4XJZA 3JQXA 5A33B 4BZ4A 4AG4A 1IS5A 5FOJB 4FT8A 4COYA 2CNAA 4LOSA 1EP0A 2DTYA 4BMEA 2ZX4A 2WA3A 1RTVA 3U11A 2QQPA 4RQPC 4WM7C 5C9AA 3R4SA 3EO6A 3I2OA 1RUC2 2HWD2 3Q8EA 1MPXA 2WWUA 1LHVA 3O1OA 1DGRN 1FOD1 2HWD3 4FAHA 1W2NA 1MQTB 5CFDC 1CN1A 1YXWA 1GOHA 4BWOA 2HBTA 1GZWB 3SHRA 5ANNA 5EYXA 3TEXA 1TME3 2VZOA 5CU1A 1A78A 2RJ2A 2ZGOA 4UW6A 3OBRA 5EXOA 3VKOA 2XBO1 3RI9A 1ND3B 4RA0A 1AR71 1VPHA 2J22A 2W39A 5LRRA 5KXEA 1HB1A 2DU1A 1GFF2 3D0SA 2YFZA 5FXWA 3TBDA 1H2KA 2B4KA 4TWTA 4YVWC 5GZGA 4Y5TA 5L7OA 3V0BB 4XUTA 4O9GA 4JGZA 1I9RA 3H8UA 3JB4C 3NMBA 3ZXEA 4XFAA 1NLRA 1IQAA 4YW6A 4GB31 3HQXA 1O5UA 1GU3A 4UFKA 1WCQA 2QNKA 1UMIA 2MEV2 4ISRA 3RFRA 4YZ5A 2IXCA 3GJBA 5HCHA 4AGGA 5EPAA 4BLJA 4HG6B 2DVFA 1XSQA 2RS13 1DQ4A 1US2A 1JW6A 1UIKA 3LEMA 4HXCA 4JZRA 1D7PM 1UL9A 2BVBA 2OA2A 2WS92 4NPLA 4M3CA 2R0FA 3N7LA 3MV01 1WW4A 1YFXA 1T6BX 2GC3A 2WS93 1JYCA 2VQAA 4N43A 5IVCA 5FMCA 3T0DA 3ON7A 5GZCA 2R32A 3A0KA 1KS4A 1WMDA 1FXZA 2VPVA 4LBJA 2ZZJA 4NWWA 1VE0A 4P9WA 1BVP1 2B8MA 3H8OA 1ACCA 2AYHA 1QNYA 2JD9A 1OVSA 4IGOA 4WVMA 3L2YA 5IYYA 2R16A 1U5XA 4XTPA 2WUHA 5FYYA 1AR91 3HBZA 1NCQA 3IDBB 3JD72 1HJFA 2VO5A 1NXD1 2EICA 5EJZB 4XJWA 5T54A 1CQ9A 2YC0A 3PL0A 4MH0E 5H9QA 3ZYFA 3KV9A 3SEPA 5C70A 2QZ3A 4OUMA 4S2HA 4XFHA 3MW3A 3ZXGA 1RXFA 3RYPA 4D8MA 4YGBA 2VBDA 1YIFA 3POEA 2NPIA 1SLCA 4XMAA 3VUOA 3AP9A 3BOPA 3GM8A 2P3JA 2R042 3DYMA 5D8AC 2HEWF 4CUGA 4A7KA 5FZOA 2IVJA 4E2QA 4NN0A 1OLME 1Q3EA 5J7MA 5BPXA 1H1MA 1XQNA 4LKEA 4CDXC 3JUUA 3BIWE 1S0GA 3HEIA 4BU2A 3EB7A 4N53A 1A8MA 4PIXA 5EP9A 3VZOA 4KU8A 5FMOL 4NIAA 1PGL1 2F4LA 3VD5A 3ZYJB 4LEJA 4D3WA 4QXKA 4ZXEA 3V65A 1U0AA 2ZEWA 2J1AA 2BBVA 3SITA 2UURA 2GC1A 2BTVC 5A32B 3WZ1A 4Y22B 3P3PA 3WNXA 1LODA 4E27A 4YSFA 3SCGA 3WDTA 3I49A 2VNGA 4V1PA 4ZONA 1DQ6A 2RM21 2QDRA 3AX4A 1S0EA 3GF6A 1W2TA 5HCFA 3VGIA 4OI4A 4LO7A 1LOAA 1X8MA 1NZCA 3NAPA 5IAXA 3PLQA 5IT6A 2JECA 4IE0A 3NJXA 4CUCA 3FX3A 1VJ2A 4CP2A 5FREA 1VBB2 1HN1A 3PUSA 1Q8VA 2P3YA 4HVRA 1FPN3 2VAUA 5DN2A 2YB7A 1VLNA 2WLQA 5IVYA 5JIAA 4FQ4A 4NPMA 5BNQA 1BBT2 1QY4A 1V6KA 4XILA 5C4WC 2EA7A 4YM2A 2I07B 3GDBA 1KDKA 5FWEA 5KR7A 3RJ2X 3POSA 4BYYA 1H9PA 4HSLA 3OEBA 4YNIA 2WN2A 1Y9GA 4KBBA 5FP4A 3QD6A 2E26A 1WLDA 4XCAA 1RB8G 1HRV1 5K7PA 2BPA2 4BHPA 1TVGA 3PJQA 3BKZA 1UY1A 3HNBM 3POBA 1O3QA 4BQWA 1UO9A 2R7EB 2VECA 1G9AA 3DPRB 1ZRDA 5ABJB 2DVAA 1GZCA 5BNOA 4UBHA 1W8WA 1GV9A 1U5YA 2CAUA 1WLTA 1WCDJ 1NE6A 1ST8A 2OS2A 4G4FA 4FXGB 3UETA 4AK3A 4FAGA 3N36A 2VUCA 5ACA1 3VHRA 5IK4A 1PZ8A 1BVVA 5IK7A 4YW7A 2ZMLA 3M8LA 2VULA 2ZAAA 3EHKA 1QJY2 2Y0OA 1JI6A 3VHOA 4BE3A 2LM3A 2JDZA 3HQUA 3KLSA 1QJY3 4P9XA 2Q8EA 2IXIA 1ND2B 2Y64A 5DAXA 1OA4A 3SKJE 4CDUB 1W8UA 3X29B 2B39A 3MHZA 2J42A 3NW4A 4P9GA 2RMU2 3VBOA 2Q30A 1H4HA 1UYYA 4YGEA 3O14A 1JYTA 2H6BA 1GOGA 2WWSA 1RMU2 3ZPOA 2B5HA 3NNJA 4Y5SA 2RJLA 3B69A 4AFBA 5F39A 2QQUA 4GWMA 1LNSA
chains in the Genus database with same CATH topology
2A1XA 3OUIA 4XABA 3BVCA 3NNFA 3KT7A 5DAQA 2Y34A 5LBFA 3W20A 3GJAA 4NMIA 4NHLA 4BQYA 5ERLA 5IAVA 5EP9A 2RDRA 4IW3A 2JIGA 2RG4A 5LB6A 2G1MA 4NHMA 5HV4A 4Q5OA 5M0TA 3EMRA 5LASA 4ZONA 2RDSA 5LBEA 2FCTA 5IAXA 3DKQA 5LBCA 2Y33A 5DAVA 2HBTA 4NHKA 2JIJA 2G19A 4XCBA 3OUJA 3GZEA 4XC9A 5A3UA 3NNLA 3MGUA 4UWDA 5LBBA 4Y5TA 3OUHA 4MHUA 4ZPIA 5DAPA 4NHYA 4XCAA 4XAAA 5L9VA 2V4AA 4XACA 5HV0A 5DAWA 4BQWA 3GJBA 5C5TA 2OPWA 5EPAA 2RDNA 4JZRA 3W21A 4MHRA 5LATA 4KBZA 3KT4A 5L9BA 4NHXA 5L9RA 3KT1A 4BQXA 4J25A 4NAOA 3HQUA 5DAXA 3OBZA 2HBUA 3ITQA 5IATA 3NNMA 2FCUA 5LA9A 5C5UA 2FCVA 3HQRA 2RDQA 4Y5SA 3NNJA 3PL0A 5EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1X A;  3OUI A;  4XAB A;  3BVC A;  3NNF A;  3KT7 A;  5DAQ A;  2Y34 A;  5LBF A;  3W20 A;  3GJA A;  4NMI A;  4NHL A;  4BQY A;  5ERL A;  5IAV A;  5EP9 A;  2RDR A;  4IW3 A;  2JIG A;  2RG4 A;  5LB6 A;  2G1M A;  4NHM A;  5HV4 A;  4Q5O A;  5M0T A;  3EMR A;  5LAS A;  4ZON A;  2RDS A;  5LBE A;  2FCT A;  5IAX A;  3DKQ A;  5LBC A;  2Y33 A;  5DAV A;  2HBT A;  4NHK A;  2JIJ A;  2G19 A;  4XCB A;  3OUJ A;  3GZE A;  4XC9 A;  5A3U A;  3NNL A;  3MGU A;  4UWD A;  5LBB A;  4Y5T A;  3OUH A;  4MHU A;  4ZPI A;  5DAP A;  4NHY A;  4XCA A;  4XAA A;  5L9V A;  2V4A A;  4XAC A;  5HV0 A;  5DAW A;  4BQW A;  3GJB A;  5C5T A;  2OPW A;  5EPA A;  2RDN A;  4JZR A;  3W21 A;  4MHR A;  5LAT A;  4KBZ A;  3KT4 A;  5L9B A;  4NHX A;  5L9R A;  3KT1 A;  4BQX A;  4J25 A;  4NAO A;  3HQU A;  5DAX A;  3OBZ A;  2HBU A;  3ITQ A;  5IAT A;  3NNM A;  2FCU A;  5LA9 A;  5C5U A;  2FCV A;  3HQR A;  2RDQ A;  4Y5S A;  3NNJ A;  3PL0 A;  5EQU A; 
#chains in the Genus database with same CATH topology
 3S57 A;  1A3K A;  2GP5 A;  4IDZ A;  1YI7 A;  4DQA A;  1DGW A;  1D4M 1;  3VBF C;  4XAB A;  1VB2 A;  3IB3 A;  5FXV A;  1RVF 2;  1OLM A;  2AH2 A;  1OF3 A;  2FDK A;  1V6L A;  1AXZ A;  3UNP A;  1K42 A;  2NN8 A;  2IFR A;  3QBQ A;  1PO2 2;  3M3O A;  3MIF A;  2ZZQ A;  2W2I A;  3AP4 A;  3SH3 A;  3HN1 A;  4HKW A;  4LA3 A;  4QDS A;  2IXK A;  3U0Z A;  3IMN A;  4CP9 A;  5CFC A;  1W2A X;  1AX2 A;  4QKN A;  4LT5 A;  1SBF A;  4P02 B;  2QQV A;  4MGK E;  5DUW A;  1ZBA 2;  5I0S A;  5DUX A;  1AXK A;  4MZU A;  4Q0U A;  4RQP B;  2C5D A;  3BPZ A;  4YW5 A;  1R09 1;  1R1A 2;  1CD3 G;  5L73 A;  4A45 A;  4AEM A;  3PUA A;  3WP5 A;  3E1F 1;  1YEW A;  3RJR A;  1R1A 3;  5FV3 A;  2AGS A;  3QCW A;  2B7Y A;  2J7M A;  3A22 A;  1VBA 1;  2GP3 A;  1QQP 1;  2YHJ A;  3LDB A;  5DMY A;  1OMI A;  2WAO A;  1AL2 2;  1J84 A;  1N47 A;  2YV8 A;  2Q4S A;  4P08 A;  3I59 B;  1DQ2 A;  2ORZ A;  3ZYI B;  5JUV A;  3LPF A;  4CCO A;  4XDQ A;  3VBR A;  5CIR A;  4P9J A;  3Q9O A;  4NIG A;  3UV9 A;  3KV4 A;  1MZE A;  2A6Y A;  4GAZ A;  3GZA A;  3VDA A;  3WG1 A;  2W46 A;  1V9U 1;  1W06 A;  5JR2 A;  1PIV 1;  4YVW B;  1E5S A;  1HXS 2;  2WZE A;  2YU1 A;  1S55 A;  3FE5 A;  4LKS A;  4XUN A;  3WF3 A;  1HXS 3;  3GBF A;  1CZS A;  1VMF A;  4AHW A;  3U4X A;  3HT1 A;  3HNY M;  3T30 A;  4CU8 A;  4EWD A;  1JYI A;  3GGL A;  3KV5 A;  1VAL A;  4LHS A;  2Q1M A;  3FZ3 A;  3VBH A;  4CA9 A;  2XVL A;  4FPG A;  4HOO A;  5T5P A;  1SBE A;  3WX5 A;  4URA A;  1XNC A;  2CWS A;  4FPC A;  4ZPI A;  1MS9 A;  2JKB A;  5JPN B;  1QJZ A;  1C8M 2;  5GLV A;  5EYY A;  5FY5 A;  1REE A;  2PQS A;  3D4K A;  3RQ0 A;  1A34 A;  5FPX A;  4LKD A;  2XQR A;  1POV 3;  3ENR A;  1YWK A;  5GKA C;  5A7P A;  5K0U C;  3GXU A;  3K77 A;  4YLZ A;  2GAL A;  2WZR 1;  1PVC 1;  3RZM A;  4Y1V A;  3USU B;  3GZT B;  2FDI A;  4PHZ A;  3H1Y A;  3DXU A;  3SC7 X;  1EV1 1;  1LGC A;  2PAM A;  2XQX A;  2ARB A;  1JH5 A;  1RUJ 2;  4N90 A;  1RJ7 A;  3RSJ A;  2A6X A;  1YFW A;  1RUJ 3;  3J8F 2;  4KGQ A;  3AZX A;  1C1F A;  1O8S A;  4R4Z A;  3CJI A;  2RE9 A;  4ERO A;  4CXY A;  1ASJ 1;  5LZ6 A;  1UY4 A;  1RUI 1;  5FUN A;  4TZD A;  2WL1 A;  1G6N A;  3NJV A;  5T3N A;  2XON A;  3B93 A;  4XFG A;  4Q4Y 2;  2D5F A;  1FMD 1;  2JG9 C;  1W39 A;  3NNM A;  1SCR A;  3POG A;  5A3T A;  1WBL A;  1RUN A;  3I3E A;  1PO1 1;  3S7I A;  2XPJ A;  4K21 A;  5D8A B;  1QMJ A;  4OI0 A;  3WQ7 A;  3H0O A;  5DZG A;  4QX2 A;  1XE0 A;  1L7Q A;  1NT0 A;  3I3B A;  5LY1 A;  2VVE A;  1CR7 A;  4URT A;  3KQ4 B;  1LGB A;  4CDX B;  1NUK A;  1XU2 A;  2X8K A;  1YYN A;  2DCY A;  4LLF A;  2WRA A;  1VMJ A;  3O7O A;  1QXP A;  1DYP A;  2WAA A;  2FMD A;  5A80 A;  3ZFE A;  1W9S A;  1ZX5 A;  4LPL A;  1QXJ A;  4J6G A;  4NJ4 A;  1JUI A;  1Y3T A;  2VY0 A;  2R0H A;  1W6Q A;  5FFO C;  1POQ A;  1IPK A;  2BVV A;  2JDY A;  4JCK A;  1F35 A;  4OCT A;  3WP3 A;  3D8C A;  3ZFG C;  1F4A A;  4DXR A;  4B1M A;  3AZW A;  5KWR A;  2F17 A;  2E51 A;  2YC2 A;  5KXB A;  1QWR A;  1RHI 2;  4C1X A;  3AXD A;  4E2G A;  1ZYB A;  1SBD A;  3VBU C;  1JTZ X;  5GJ6 A;  1QOT A;  4ARX A;  4S2F A;  5G04 L;  4M3C F;  2A71 A;  1OH4 A;  1Q8Q A;  4FI9 A;  4DUV A;  1D0G A;  2VW1 A;  2ZHN A;  4HKL A;  2D6O X;  3AL5 A;  1JOD A;  1IS6 A;  2XLA A;  4J1W A;  5JPM B;  4ZU4 A;  3U14 A;  5FKB A;  1LGN A;  1OOP C;  5CKN A;  1VBD 2;  3DF0 A;  1ZRF A;  2C24 A;  5FAX A;  2VCA A;  2A5Z A;  1VBD 3;  4JAA A;  5C4W B;  3UJO A;  2ZTN A;  1NX9 A;  1ZZ8 A;  5GLZ A;  4J1X A;  4NHK A;  2XHN A;  1VBC 1;  1ULD A;  1GNY A;  3IBM A;  2ZPX A;  3ES4 A;  3POY A;  3VN4 A;  5FLI A;  1X7N A;  1WA6 X;  2ARA A;  4KWJ A;  1LHO A;  4AVB A;  4A3X A;  3WXP A;  3PUI A;  4NRO A;  1WA4 A;  4PJY A;  1M4W A;  2D98 A;  1PM4 A;  3O1U A;  1N3P A;  1C3H A;  2QUO A;  1C5I A;  3G6J B;  3LOI A;  3MUZ 1;  4NHY A;  4NO4 A;  5BNN A;  3T2O A;  2JIC A;  1SPP A;  4QHB A;  4AE2 A;  4YZ2 A;  4F83 A;  4XUQ A;  5L9V A;  3C3V A;  1STM A;  4P9Y A;  2UY8 A;  5J1X A;  4YVS C;  5I8S A;  2FD8 A;  2Z79 A;  3OPW A;  4XEZ A;  3ZYH A;  3FFZ A;  3N9M A;  1KQR A;  3CNA A;  2RR1 2;  3IAQ A;  2JKX A;  4DIN B;  2P3K A;  1VP6 A;  2ZGS A;  3LFM A;  2RR1 3;  1IS3 A;  1CES A;  1DLL A;  4AZZ A;  4BCU A;  1PK6 A;  4PI2 A;  4CDQ C;  3A7Q A;  4FXK B;  5FYM A;  5A33 A;  4WZC A;  5IW0 A;  4QGL A;  2C9K A;  4QPI B;  4A3Z A;  1AX0 A;  3FHQ A;  4FOW A;  5E89 A;  3TB0 A;  3TWI A;  2E63 A;  4JTO A;  1RUD 2;  1N3O A;  4MGQ A;  1RUD 3;  3E5X A;  1W03 A;  5DDJ 2;  2K0G A;  5DDJ 3;  1MQT A;  2ZGM A;  2TUN A;  4OHZ A;  1YO8 A;  2JG8 C;  3LSD A;  4YGD A;  2XJU A;  1GZW A;  1HLC A;  1W8Z A;  3VBF B;  5KHG A;  4PIY A;  1VRB A;  1ZNP A;  3I3Q A;  3TN9 1;  2NP0 A;  3SMH A;  5E1R A;  4JV4 A;  3UGG A;  4E4S A;  1IZ3 A;  1ND3 A;  4BQ4 A;  1UU4 A;  1X50 A;  5CFC B;  2BYV E;  3HR9 A;  2PHX A;  3AL6 A;  1UNB A;  4WM8 C;  3IDE A;  1CJP A;  4HN1 A;  3NVC A;  3ATG A;  4H7L A;  3V0B A;  5FRA A;  1J1L A;  3LCP A;  4YWA A;  3VV1 A;  4QKD A;  4NOT A;  2JB8 A;  4IV1 C;  2XWB B;  2X05 A;  2BV4 A;  4A41 A;  2XVK A;  3QH6 A;  2Q8C A;  2O0O A;  5JCT A;  4GWI A;  1CZV A;  1OKO A;  1WW5 A;  4ATF A;  3OF1 A;  1CAX B;  3WCR A;  3AMH A;  1NE4 A;  3C8X A;  3I2J A;  4AAP A;  1C5H A;  1TMF 1;  1FNY A;  4NMI A;  1AVB A;  2N7G A;  4FPL A;  3U78 A;  4L2N A;  1QJX 1;  4UW5 A;  5GLU A;  3CQO A;  5A6Y A;  4FOY A;  1T6G C;  4H2A A;  4AHX A;  5JZG A;  1F8V A;  4FP3 A;  3WDW A;  3F95 A;  1K5J A;  3R0R A;  1LJ7 A;  2WFF 1;  1RUE 2;  1AYM 1;  1LOF C;  3WNP A;  5F2W A;  4IUG A;  4O9E A;  1RUE 3;  2P6C A;  4QX3 A;  3ST7 A;  3NKT A;  5F6L B;  5JI9 A;  4MGY E;  3K2O A;  1TG7 A;  4DEQ A;  2JD4 A;  2W92 A;  5K8S A;  3SH4 A;  5KXC A;  2OKX A;  3E5Q A;  4I3G A;  4OFG A;  4IEY A;  3ZSJ A;  5DUU A;  4P00 B;  4LNV A;  2G4I A;  4Y3O A;  3MLJ A;  5FPZ A;  2GC0 A;  4B1L A;  1JYN A;  2P1B A;  4C0B A;  1H6X A;  2WO7 A;  1UYX A;  5GLW A;  4XHX A;  2JIJ A;  3FLR A;  5EFU A;  3CU7 A;  4UFJ A;  5A7W B;  1W6P A;  3CEW A;  3OGR A;  3MV1 1;  4FPK A;  4XCB A;  1RUG 3;  2EAA A;  1VRH 3;  4ZS2 A;  3B7M A;  2ARX A;  4QGM A;  3V0A B;  3JBG 2;  4P5Y A;  2EVX A;  2XOM A;  3JBG 3;  4UWD A;  3THT A;  5K0U B;  5FZD A;  1F4H A;  1GMM A;  1ULG A;  2WJS A;  4EN9 B;  5A3W A;  2FDF A;  3B9C A;  2KA3 A;  2CL2 A;  4Q26 A;  2W9X A;  2DFC A;  4OUS A;  3ZXF A;  3AVS A;  4FVV A;  2Z2S B;  2UY9 A;  4XUO A;  1OPM A;  1LEM A;  3NJZ A;  5AC9 1;  3N4M A;  2I2S A;  3ZO0 B;  4B8E A;  3ME2 A;  5C3Q A;  2ET1 A;  5FDB A;  4Y26 A;  1VBE 2;  3ZPY A;  5IK8 A;  3CZJ A;  1IHM A;  1VBE 3;  4XBN A;  5A32 A;  3JB8 A;  4Y22 A;  4UW4 A;  1BKZ A;  2R06 2;  4I2O A;  4OI2 A;  2XLF A;  3KCX A;  2R06 3;  3AKS A;  4RGA A;  2JG9 B;  1W3V A;  2A75 A;  2WNO A;  5L9R A;  3WT3 A;  3VD9 A;  4UW3 A;  1H1A A;  3FUO A;  4BQX A;  1JBC A;  1H2L A;  1V6M A;  2BGP A;  1SCS A;  4IE7 A;  2VOX A;  4K1Y A;  2P2K A;  1X36 A;  1VMH A;  1MZ5 A;  1H8T C;  1Z78 A;  2NMN A;  5EJ3 A;  2G9Z A;  5J48 A;  2E53 A;  4CEW C;  4FTE A;  4Y20 B;  5FZL A;  3I2F A;  3RMX A;  2PLV 1;  2WWJ A;  1J83 A;  5FZF A;  2KR2 A;  4Q8K A;  2FCV A;  5JSR A;  3JQW A;  4KG0 A;  2HWF 2;  3I2I A;  1S2K A;  2WNU C;  1URX A;  1XB9 A;  2X10 A;  2OII A;  2PTM A;  3DN7 A;  2EAK A;  2QQW A;  3LEI A;  3WW4 A;  3ZIX A;  4B7E A;  3ZFG B;  3KCC A;  2A73 B;  2W95 A;  3I2G A;  4MET A;  5DG1 A;  1S0F A;  3MLK A;  1H4G A;  3LPG A;  3OSD A;  2Q5T A;  3BVC A;  5IUQ A;  1AYN 2;  1A6C A;  3ELN A;  1PGW 2;  3P3N A;  3KHB A;  3VBU B;  3LE0 A;  4XZU G;  1AYN 3;  3ORJ A;  3H42 B;  3POI A;  1E5H A;  1OQ1 A;  2GME A;  3AKP A;  1NCR C;  2NLR A;  3DPR A;  5LBF A;  3W20 A;  4UBG A;  1QJU 2;  2BER A;  4LE3 A;  4FPF A;  2BFU L;  4RHV 2;  3BTZ A;  3M3Q A;  3AKT A;  2Z69 A;  3UES A;  1W9Y A;  2AZ5 A;  1W05 A;  2D44 A;  2HWB 2;  2W1U A;  3BCW A;  4RHV 3;  2Y0I A;  1HKD A;  2W3J A;  4CP0 A;  5IVF A;  1SMV A;  1AJK A;  5I0D A;  3O1M A;  4CDW C;  5FIX A;  2R30 A;  1TEI A;  4XFC A;  3ILR A;  1OOP B;  2IUW A;  5LB6 A;  2K46 A;  1OUR A;  1TNR A;  3RS6 A;  1IPS A;  3ZYR A;  2H6C A;  4EJR A;  4LTA A;  1CWP A;  1HRI 2;  4TLG A;  4CEY A;  2JDP A;  1AJO A;  4GD4 A;  4GMP 1;  1HRI 3;  4UF0 B;  1ND2 A;  4HSJ A;  1GQP A;  1Y9M A;  2DWR A;  3KF3 A;  3LAG A;  2OQ7 A;  2RS5 3;  4QDR A;  3ZFF C;  1AR6 1;  1J3P A;  4ASM B;  1Y7B A;  4XF0 A;  1DU3 D;  1E5R A;  2PHU A;  4Q4V 2;  3SIS A;  2PYT A;  4XJ9 A;  3CIH A;  4QQH A;  4DO0 A;  5K4L A;  2ZHM A;  2KD7 A;  4Q4X 2;  2PXJ A;  5FYV A;  3NV3 A;  1W0P A;  4BIF A;  1OUS A;  2OXB A;  2ATF A;  4PDW A;  4JGY C;  3MZH A;  1MS3 A;  2YZ4 A;  3GZE A;  2ZGL A;  2P6H A;  1S0D A;  4RSU A;  1FT9 A;  4YVS B;  2JEM A;  4PCR A;  1JXN A;  2O8O A;  2JDU A;  3LSE A;  4Y5Z 0;  2HKX A;  1PK6 B;  4YW3 A;  1H2N A;  5FKC A;  1B35 C;  2ZXQ A;  4M01 A;  1OD3 A;  4YZ4 A;  3GCX A;  4MVT A;  4Q4W 1;  4QHZ A;  3WDX A;  1QOS A;  1IS4 A;  4CU6 A;  2ZAB A;  3AXE A;  4RR3 C;  3ECQ A;  3VL9 A;  4OUL A;  2GH2 A;  5DXD A;  1XYN A;  1RUC 3;  2D6P A;  4RQP A;  4WM7 A;  3HVD A;  3UK9 A;  3KD4 A;  1GZT A;  1GIC A;  1W8H A;  4YYO A;  4NID A;  3IAP A;  3WY6 A;  4S2D A;  3KWV A;  5FYC A;  5ISL A;  1MS0 A;  2JG8 B;  5GZE A;  3T0A A;  1OXC A;  3I59 A;  3CHX A;  3OCP A;  2C4X A;  4ZS3 A;  4JHT A;  4E4Z A;  4LMF A;  2NYY A;  3M70 A;  4OHW A;  3K4A A;  1NOV A;  1H0B A;  1DZR A;  3I3D A;  3N3H A;  3K48 A;  3TYJ A;  4OMC A;  2HH9 A;  2XUM A;  2QQN A;  3EBR A;  2BU9 A;  4AW7 A;  1PNG A;  4YVW A;  3ITQ A;  2DUQ A;  1MEC 1;  4GB3 2;  4IV1 B;  3O1P A;  2DV9 A;  1LHW A;  1TME 1;  2C0Z A;  3B9I A;  1HB4 A;  3KVB A;  4ES9 A;  1UPI A;  2MEV 3;  1OQD A;  3INA A;  2IFW A;  5LBB A;  1AZD A;  4IQP A;  1S4C A;  3I2D A;  3PME A;  5JZG B;  2BNM A;  3SNM A;  3IIA A;  4BMB A;  4D94 A;  4MLO A;  3K4Z A;  1G9D A;  2VMH A;  4OHV A;  2XKP A;  4A7Y A;  4ONU A;  1OFN A;  3ZM8 A;  2LUW A;  2WAB A;  1DLC A;  4GJZ A;  2BW8 A;  5H9P A;  1GWM A;  1UY3 A;  1GOF A;  5FZ3 A;  2BWA A;  1ZZ9 A;  2PAE A;  4EN6 B;  3ZKY A;  2BRT A;  2ILM A;  4I30 A;  4WZF A;  1Q8S A;  2Y60 A;  3HOB A;  3USU A;  2RS1 1;  3AMP A;  1HV1 A;  3PJY A;  2ZKL A;  2OT7 A;  4ZXK A;  1AR9 2;  4AGV A;  1AR9 3;  2EID A;  3JD7 3;  3OTF A;  1HN0 A;  1G9C A;  2QQJ A;  1CAW B;  1HDK A;  3W58 A;  5M0T A;  4XHB A;  1NZI A;  2ADE A;  1W6P B;  3III A;  4DXZ A;  2HWC 1;  4IER A;  3WDV A;  2EXH A;  2VOW A;  2ZX1 A;  3ZXJ A;  1RYY A;  3U4S A;  2ZGN A;  3T1L A;  2RDS A;  2YBS A;  3POW A;  4UT5 A;  2R04 3;  1LED A;  2FCT A;  2VVF A;  3ZX7 A;  1XXN A;  1SG3 A;  3J7M A;  1AR8 1;  4QQ2 A;  5D8A A;  2PHT A;  4UI9 L;  4YM1 A;  3H1M A;  2DCJ A;  5F9T A;  3WNN A;  1IKP A;  3RYK A;  3AZV A;  1JN2 P;  2QZ2 A;  4NUB A;  4AQ2 A;  1PGL 2;  4RD7 A;  5G05 L;  5C3O A;  4CDX A;  2XUE A;  2YPD A;  1Y43 B;  2ZGR A;  4XET A;  1WCS A;  2JE9 A;  1UOB A;  4QX5 A;  4DRV A;  4KWU A;  3VHP A;  1D0H A;  2ZJC A;  1ZRC A;  1DGW X;  4XC9 A;  3BOD A;  3V64 A;  4EE2 A;  1BEV 1;  1W2O A;  1OHF A;  4DY5 A;  2CYF A;  4CCK A;  3RPQ A;  1SFP A;  1GWK A;  5TSW A;  3O1V A;  3VD7 A;  2RM2 2;  2KM2 A;  5DAB A;  3DEC A;  2GDF A;  1ENQ A;  2VU9 A;  3MIC A;  3SCH A;  3TRS B;  2VZQ A;  3GAL A;  2WZP P;  2Y6G A;  5DAW A;  2TNF A;  2VTX A;  4YZ1 A;  3WW3 A;  4COZ A;  2E32 A;  3FHA A;  4LE4 A;  2NZ9 A;  4BLI A;  3WF2 A;  1QH7 A;  1LCL A;  3VB9 A;  4MAD A;  2RVA A;  1NAE A;  2VH9 A;  2D93 A;  1H8T B;  4XOG A;  4BA6 A;  4BQ5 A;  1VBB 3;  2JXA A;  2RDN A;  4XZP A;  3RYR A;  4CEW B;  4JHZ A;  5BY5 A;  5CA6 A;  3BOW A;  3THP A;  4N9H A;  3MPB A;  4B29 A;  5IFT A;  2NMO A;  4KWK A;  2ZCW A;  4MXV A;  1BBT 3;  1YI9 A;  3KT1 A;  3LZZ A;  4ET7 A;  4FPJ A;  3O1T A;  5C8C C;  1OUX A;  2WNU B;  5FPB A;  1RGS A;  5C4W A;  3ZXL A;  1W28 A;  2VUJ A;  3IWZ A;  1LOB A;  4LJH A;  3HPN A;  1ZZC A;  4ARY A;  3LQC A;  2YDE A;  4RS5 C;  3VDD C;  1EPW A;  3OG2 A;  1HRV 2;  2W1W A;  3A4U A;  3CDZ B;  5CEH A;  1HRV 3;  3SH5 A;  1YFU A;  4BH9 A;  5IVJ A;  4I09 A;  1FPN 1;  1ZZ6 A;  1MR5 A;  4XF9 A;  4PT6 A;  5F2S A;  1WCU A;  4A42 A;  1ALY A;  1F2N A;  2GU9 A;  4XFB A;  5BNP C;  2CAV A;  4Q8L A;  5EZW A;  4LO8 A;  1TNF A;  3NQH A;  1QEX A;  3I4I A;  3SLI A;  5FY7 A;  4Z2W A;  5F8P A;  4W6Y A;  1ZBE 1;  1SDW A;  2DVG A;  2ZBJ A;  5ACA 2;  1JHJ A;  2XJQ A;  2VMG A;  3HNM A;  1UW8 A;  4LIT A;  2CU5 A;  2VL4 A;  4LKF A;  4CDW B;  1W90 A;  1UD1 A;  1Z7S 1;  5FJH A;  3M2M A;  4R9D A;  2YUE A;  3FMG A;  4B4R A;  1W9W A;  3C7E A;  5LA2 A;  1UOG A;  1V70 A;  3OPZ A;  5FPU A;  3P5B A;  4ES8 A;  4XF1 A;  3WF1 A;  1S1A A;  4YG3 A;  1QU0 A;  3J7L A;  2D3S A;  1OH3 A;  5EV7 A;  5IAV A;  4AFM A;  3ZN6 B;  4GH4 C;  2RMU 3;  3EXU A;  3ZFF B;  1BXH A;  4QPI A;  4FPO B;  1RMU 3;  4CXW A;  3RNS A;  1CIY A;  4PQQ A;  2ZX0 A;  3R05 A;  4UYB A;  4CCD A;  2GN7 A;  3EMR A;  4LHL A;  4KGG A;  1D4M 2;  3I7D A;  4PDW B;  4QU2 A;  3SKV A;  2D40 A;  1UPS A;  5FZB A;  1RVF 3;  3THC A;  4JGY B;  2Y6J A;  3VBF A;  1PHM A;  5FZA A;  1DGL A;  2I45 A;  5B4N A;  1POV 0;  5FY9 A;  3LWC A;  1J1T A;  4ISQ A;  3AYA A;  1PO2 3;  2W0X A;  5KBF A;  5DG2 A;  4OVE A;  1B35 B;  4NE9 A;  1X82 A;  4AQS A;  1UXX X;  4KG8 A;  5LW9 A;  1YQ2 A;  2NM1 A;  4MSV A;  5E88 A;  1N1Y A;  4MYE A;  3WG4 A;  3ACG A;  2YRO A;  1R09 2;  2RV9 A;  2ZS6 B;  1ZBA 3;  2WSU A;  4FFG A;  3POF A;  4LBQ B;  4MGZ E;  4QQO A;  4RR3 B;  4AYU A;  1NLQ A;  1R09 3;  2Y6L A;  3PVE A;  1K12 A;  5KC5 A;  3PIG A;  1VBA 2;  4U2A A;  1US3 A;  1UMH A;  2VZS A;  5CFD B;  2Q0A A;  1VBA 3;  2Q8O A;  1CAX A;  1JZ3 A;  3T4V A;  1QGL A;  3PTR B;  5I8Y A;  1AL2 3;  1W6N B;  3VZM A;  1G8W A;  4FTB A;  3NO8 A;  3KSC A;  1C4R A;  1V9U 2;  3WP6 A;  2WQ8 A;  1PIV 2;  1LOC A;  3CZU A;  3LIG A;  1IGO A;  3TNP B;  3NNG A;  3ZSM A;  4AFA A;  1RUO A;  1V9U 3;  2OPW A;  2CSG A;  3Q8C A;  4HBN A;  3AJY A;  4RYD A;  5JDB A;  1Q43 A;  4DRR A;  2VGD A;  3K3O A;  4K20 A;  3WF4 A;  3RZK A;  2FDJ A;  4Q29 A;  5I0T A;  1KD7 A;  4AVC A;  5JXG A;  3ZMN A;  1W9T A;  5LAT A;  5C6C A;  5T52 A;  1IQD C;  1W04 A;  1ZZ7 A;  1AHS A;  4L0P A;  3WSO A;  4BM8 A;  3ACH A;  4MV2 A;  4J25 A;  2XGX A;  3VHN A;  2E31 A;  1LEN A;  2DCK A;  2VQT A;  3R4U A;  1KJR A;  3WQB A;  1C1L A;  2WSV A;  1UXZ A;  3FFQ A;  3NRU A;  2GZW A;  1NG0 A;  4O7X A;  5F5Q A;  2JWP A;  2LRP A;  1HB2 A;  4W6X A;  4AED C;  4IET A;  4QMA A;  5GM0 A;  1JS9 A;  1C8M 3;  3T2P A;  4G9S B;  3BTX A;  3MF9 A;  5J36 A;  1J3Q A;  2R07 1;  1RUH 2;  3LA3 A;  5A7W A;  1GYK A;  1QIQ A;  1DG6 A;  4IEQ A;  4Y1Y A;  4UFL A;  1RUH 3;  2WT2 A;  5CB7 A;  4DOU A;  2ZEY A;  3V0A A;  2WZR 2;  4AQ6 A;  3E97 A;  4B7K A;  5K0U A;  4DB5 A;  1EV1 2;  3K46 A;  3VZL A;  2OVU A;  2ZGK A;  1Q5O A;  1D4V B;  2VXJ A;  4MUV A;  1COV 2;  1M06 G;  4AVT A;  1KRI A;  4PIZ A;  2Y26 A;  1COV 3;  1LES A;  1ULF A;  4AHZ A;  2X29 A;  5FP9 A;  2K2S A;  5FZH A;  1PMH X;  4GWN A;  3WG3 A;  4QPW A;  1EUU A;  3J8F 3;  4HLT A;  1ASJ 2;  4QPG C;  1YRZ A;  1RUI 2;  1TE1 B;  4DFS A;  1ASJ 3;  3GJA A;  2X5I C;  1RUI 3;  4NWV A;  4HZF A;  5FZ0 A;  5JOX A;  1FMD 2;  4KNC A;  5ERL A;  2UYB A;  3DV8 A;  5A6Z A;  3IDC B;  5A1A A;  4OYU A;  4Q4Y 3;  1G86 A;  3BTY A;  1PO1 2;  2JG9 A;  3Q8B A;  1PO1 3;  3JZV A;  1MS5 A;  3WOG A;  2VCB A;  1AF9 A;  1YQ5 A;  3D0J A;  4BPZ A;  4Z82 A;  3CJI C;  3PVO A;  3H8R A;  1MVQ A;  2BNN A;  5FZ1 A;  1RUJ 1;  2BOI A;  3BU0 A;  3WUD A;  1DIW A;  4BDV B;  2UYA A;  4LXL A;  2CGO A;  2WZ8 A;  3FHI B;  3IT8 A;  4NRQ A;  3RI8 A;  3VD4 A;  5LAS A;  3ZVX A;  4C1W A;  2ZGU A;  3ZMO A;  2B9V A;  4Y20 A;  5IVV A;  5LEJ A;  2PN5 A;  2VZR A;  5FP3 A;  4I01 A;  1H9W A;  2ENR A;  4MXW B;  5L19 A;  1WLW A;  4C90 A;  4IE6 A;  2R6Q A;  4JRA A;  4NRM A;  1NXM A;  3DYP A;  4FSJ A;  5FBJ A;  2DYC A;  2W94 A;  4QX8 A;  1ZZB A;  3U10 A;  3ZFG A;  5FO8 B;  1SLA A;  3E6D A;  3DYO A;  3ZFE C;  1YJK A;  4RGK A;  1RHI 3;  3ACF A;  3B3Q E;  2JDK A;  1DBN A;  3T2Q A;  1XU1 A;  1L7L A;  2DUR A;  4MX3 A;  3VBU A;  3ZLI A;  1GAN A;  3RG0 A;  1WKY A;  2RJK A;  2HJI A;  1QF3 A;  1RUF 2;  2ZA9 A;  5DAP A;  2DUO A;  1RUF 3;  4LK7 A;  2QQM A;  3HMY A;  5FBZ A;  3C7G A;  3WVJ A;  2AAC A;  3H1W A;  3KQR A;  3NST A;  2W08 A;  4CPB A;  2G9F A;  5C7G A;  4BB3 A;  5HV0 A;  4C8D A;  3I2K A;  1W0O A;  1C28 A;  2VOV A;  4L8Q A;  5LA1 A;  1O3T A;  5FZK A;  5HXV A;  1OOP A;  3ZR5 A;  4FQZ A;  3ZXK A;  4EN0 A;  1HQL A;  1UKR A;  1VR3 A;  2ZMK A;  3LD8 A;  5C8C B;  4TYS A;  4BXF A;  1DYO A;  1OA2 A;  3MI8 A;  4FPY A;  1MS4 A;  1UF2 C;  2B46 X;  3LEK A;  5FZ8 A;  2ZGP A;  4UF0 A;  4QAW A;  5FZC A;  3T3Y A;  4SBV A;  2CGP A;  2B42 B;  3ETQ A;  4L9B A;  4OQ9 A;  4EN7 B;  3BTA A;  3PUQ A;  4LO5 B;  1KS5 A;  1F5F A;  2WNV C;  4MO3 M;  4FBF A;  4U36 A;  5FK7 A;  2DDU A;  1W99 A;  5BNP B;  4IEO A;  5LWB A;  5CG9 A;  3OD0 A;  3DEM A;  5IJR A;  2VMF A;  2VMD A;  4DNY A;  4COW A;  3HD8 B;  1PMI A;  2W47 A;  3PHM A;  4ZU5 A;  4QB2 A;  1RIN A;  1GNH A;  1YIP A;  1HQN A;  2J1T A;  1DYK A;  1XBF A;  2QVS B;  2QTW B;  5JIU A;  4YG0 A;  4LOR A;  1JZ6 A;  3VKF C;  4YVS A;  3HN3 A;  2XJS A;  1UYZ A;  1CZT A;  1T2X A;  5JMC A;  3OUI A;  1RC6 A;  2QE3 A;  4R52 A;  3HIF A;  1NA1 C;  1YHF A;  5B4X A;  1JU3 A;  4K40 A;  2VTX J;  4GH4 B;  4G3Y C;  5F5A A;  2G9G A;  2ZGQ A;  2WNE A;  2IXL A;  1XOY A;  2R1D A;  1EPZ A;  4AL9 A;  5GAL A;  3RVH A;  2FQP A;  5K9Y A;  2DCZ A;  4BIO A;  3OGJ A;  1MS1 A;  1UQX A;  4NHL A;  3O1R A;  3MW2 A;  1ZA7 A;  4I3P A;  3TN9 2;  2HWE 1;  3BB6 A;  4ASK A;  2JG8 A;  5FZE A;  4FOQ A;  2FDG A;  3TN9 3;  3GZU C;  2NQY A;  1OI6 A;  3D82 A;  4IEU A;  4IV3 C;  2IVI B;  4IW3 A;  2PHF A;  3PMS A;  2TBV A;  3N9Q A;  3RZH A;  5HV4 A;  1JOB A;  1PMJ X;  4XQW A;  3SEE A;  4LUK A;  1UN1 A;  1DQ0 A;  2IWG B;  2BEO A;  1DF0 A;  1MQT C;  4UFI A;  3TOJ A;  2K9Z A;  1PNF A;  5FP7 A;  5CIS A;  1OQE A;  1SLI A;  1K5M C;  1DGR A;  2ZHK A;  1P8J A;  4IV1 A;  3ALQ A;  1S0B A;  2QFE A;  4JDN A;  1AL0 G;  5KHJ A;  1XNK A;  1TMF 2;  1H1I A;  1BLZ A;  3WUC A;  1QJX 2;  2ZAH A;  4ZKT B;  1I6X A;  5FLH A;  1QJX 3;  1BJQ A;  3T2T A;  3KMH A;  4XIK A;  3HT2 A;  2QQI A;  2VQ0 A;  2BQP A;  3MBW A;  2XB6 C;  4LBO A;  2YGM A;  2WFF 2;  3TNQ A;  3ABZ A;  1AYM 2;  2A3W A;  5JI7 A;  2W5F A;  4OQ8 A;  5A3U A;  4H7M A;  4WVW A;  2DCT A;  4XDP A;  4COV A;  4XXA A;  4QU1 A;  1L3J A;  3BN6 A;  3MGU A;  5FPV A;  3WG2 A;  1WUV A;  2VOK A;  2E7A A;  1IG3 A;  4WV8 A;  2CDO A;  1LOF A;  2D6L X;  1LHU A;  1Q8O A;  4CUB A;  5FYI A;  3B02 A;  1UZ0 A;  3MIH A;  2V72 A;  4D7Y A;  2E9Q A;  3WQ1 A;  3KS7 A;  4WM7 B;  3H7Y A;  3S5Q A;  2SLI A;  3IM0 A;  2D3R A;  4KMQ A;  4OHX A;  4HK8 A;  1NY7 1;  1ULC A;  5I8T A;  2O14 A;  4PF5 A;  1CAW A;  4LBM A;  4PF1 A;  4AI9 A;  3OPT A;  1ULO A;  1O4Y A;  3EYP A;  4HL0 A;  4HON A;  4NPR A;  3T1M A;  2W91 A;  4AED B;  4KBZ A;  3KT4 A;  3N7K A;  5L9B A;  1QNW A;  1IG0 A;  5CAD A;  2DU0 A;  1PM7 A;  1O4Z A;  1XND A;  4DS0 A;  3MFC A;  2EXI A;  2WR9 A;  3LFI A;  4QQP A;  4HVQ A;  2VJX A;  3D3A A;  2XWJ B;  5A3P A;  3E5U A;  1PX3 A;  4PBO A;  4CP1 A;  1I1E A;  1H8V A;  1ONA A;  2PA7 A;  3IPV B;  4XYX A;  4DEV A;  4GKY A;  4HN0 A;  5FY4 A;  2JDM A;  4SLI A;  3WDY A;  4TTG A;  5J96 B;  1QDC A;  3KV6 A;  5C3R A;  2ZMN A;  3B5L B;  5SV8 A;  1RUG 1;  2AC1 A;  2LAL A;  1VRH 1;  2CWM A;  4QPG B;  4BK4 A;  4Y1X A;  1VIW B;  3AMN A;  4L97 A;  3RGB A;  3JBG 1;  1LHN A;  2X5I B;  2RS3 2;  3LKJ A;  2XL9 A;  1DP0 A;  1MVE A;  3PUH A;  5EWS A;  2RS3 3;  2R49 A;  3KM5 A;  4Y4R A;  1E5I A;  4Z07 A;  1GBG A;  3VBS C;  4DUW A;  2VXR A;  4QM8 A;  4COU A;  2VE1 A;  4QKB A;  1JOJ A;  1SLB A;  4XIO A;  5FZ4 A;  3UKT A;  3R4D B;  4ORF A;  1BMV 1;  3BUC A;  4CTE A;  5JSO A;  1H8T A;  5F3G A;  2PLV 2;  2VNO A;  3RWK X;  1J3R A;  1NQJ A;  2VZ1 A;  2XXZ A;  3MYX A;  2E7T A;  4HAN A;  4YG6 A;  5FUP A;  4CEW A;  2V09 A;  3BI3 A;  2YY1 A;  4OZX A;  2C26 A;  2ZAC A;  4IGQ A;  5AVP A;  2J1S A;  2HWF 3;  5I0R A;  4K9S A;  3P6B A;  2VUA A;  2WNU A;  1UZV A;  4LHN A;  4CZS A;  2VZ3 A;  2WIN B;  1B09 A;  3MEP A;  1DFQ A;  2BJS A;  5F7U A;  4M0H A;  4M4P A;  4LBK A;  1EAH 1;  4XBQ A;  2YBK A;  5JMO A;  3J7N A;  4YFZ A;  4K3U A;  3DKQ A;  3PDQ A;  2VZV A;  2D7F A;  1UIJ A;  1XJA A;  2OPK A;  2SBA A;  1S0I A;  3CLP A;  3KB5 A;  2MHF A;  1QJU 3;  5DZF A;  1V6N A;  3PUR A;  1TQ5 A;  1NCR A;  1UY2 A;  2VZU A;  2WO1 A;  2DVB A;  5JXI A;  2HWB 3;  1BK0 A;  5BV6 A;  2ZX2 A;  1S0C A;  4UFM A;  4LBL A;  1UX6 A;  2OW4 A;  2YBP A;  5F1R A;  4CDW A;  3ZYG A;  3LOB A;  3WW1 A;  4E8D A;  3M1H A;  4KH9 A;  4R9B A;  2WO2 A;  4I02 A;  5A6Q A;  4IEZ A;  5ABJ C;  1CON A;  4AR2 A;  4FFH A;  5SV5 A;  1S0J A;  4Q0Q A;  1OVP A;  1FI2 A;  2D3P A;  2WDB A;  2V5D A;  4PLM A;  3GHM A;  5D2A A;  3O12 A;  1AR6 2;  4UXA A;  1R08 1;  1AR6 3;  1FV2 A;  1NQD A;  3RZJ A;  4P9L A;  3ZN6 A;  2CDP A;  2V4A A;  3IMM A;  2GAU A;  4Y4Y A;  3ZFF A;  2EAL A;  2AUY A;  4JQT A;  5LK5 A;  4QX1 A;  4Q4V 3;  5A7N A;  3UKV A;  2WNV B;  3FN9 A;  5LY2 A;  3BYW A;  4XPV A;  2V4V A;  4QB1 A;  5DUV A;  1W3X A;  2A6W A;  1QXR A;  2AEY A;  2CGN A;  4Q4X 3;  5GZF A;  3WNM A;  1BCX A;  1N1T A;  2WT1 A;  3D6E A;  4AOC A;  1OBN A;  4CDU C;  3WNK A;  4LQR A;  1GR3 A;  4IXL A;  3RDI A;  5A3L A;  2KXL A;  2RS5 1;  3AMM A;  3CMG A;  4JGY A;  4EN8 B;  1OLR A;  4NAM A;  1SEF A;  5HBA A;  4DUX A;  4FO9 A;  4PI0 A;  2TEP A;  2PQQ A;  4X6R B;  3K4D A;  2DF7 A;  1ENX A;  3AYD A;  3NWK A;  4IES A;  4C0H A;  3O5S A;  3I3M A;  3PU3 A;  4CDQ B;  4Q4W 2;  1U5Z A;  1B35 A;  2D6N A;  1CAV B;  1O59 A;  3I8T A;  4HPK B;  2WYF A;  4OUE A;  5FWJ A;  4Q4W 3;  5FCC A;  5KC6 A;  1E57 A;  3OY8 B;  2VW0 A;  4GAL A;  1FOD 2;  2FCU A;  3GNE A;  3MID A;  5H9R A;  4LBQ A;  1FOD 3;  2DBI A;  3HQR A;  4RR3 A;  2RDQ A;  5DPN A;  2BFU S;  4DIQ A;  4XDO A;  1W8F A;  4B4P A;  1IOA A;  1KDM A;  5CFD A;  3ASI A;  2XL7 A;  2GC2 A;  3ZSE A;  2XBO 2;  2XHK A;  5JOZ A;  1AR7 2;  5BUV A;  2XBO 3;  3AK0 A;  5C9A C;  4TXW A;  2A3Y A;  1UU6 A;  5BXX A;  1AR7 3;  3KT7 A;  1W6N A;  4IV3 B;  1JU4 A;  4ITC A;  5DZE A;  1HW5 A;  2LW8 A;  2W1S A;  4LUM A;  4A44 A;  3T0B A;  1RUC 1;  2HWD 1;  3HJR A;  4WM8 B;  5C3S A;  1O3R A;  3OGV A;  1ZRR A;  1AUY A;  1FV3 A;  1MEC 2;  4JKL A;  4A7Z A;  4CCL A;  4CU7 A;  1MEC 3;  1BYH A;  4P14 A;  3W5N A;  1TME 2;  1WD3 A;  1CAU B;  5CG8 A;  4GB3 3;  4OLL A;  4XAE A;  1K5M B;  4I0W B;  1FYU A;  1WMF A;  2W1Q A;  5J3U A;  4YFW A;  3VZJ A;  5C71 A;  2JIG A;  2VMC A;  2XLG A;  3ILN A;  3A0N A;  5CAZ A;  1LOG A;  5FXZ A;  1KXG A;  4M00 A;  1GKB A;  4NHM A;  3ZSL A;  3AFK A;  1W8T A;  5L7O C;  5CKQ A;  1J59 A;  4N9I A;  2YXS A;  1F31 A;  2H0B A;  4JGZ C;  4YPJ A;  1UYP A;  1HX6 A;  4UOJ A;  4N8M A;  3WD5 A;  2P37 A;  3URF A;  1SAC A;  2F6B A;  1OLQ A;  5FJK A;  3RWN A;  1ZRE A;  5A6X A;  4C91 A;  1W9F A;  5H9S A;  4FPH A;  3WNO A;  4QD2 A;  5LBE A;  5FMD A;  3ACI A;  5AFB A;  5LEK A;  4LBN A;  4Y24 A;  4BJ0 A;  2MEV 1;  2H0V A;  1Z0H A;  1RIT A;  4F8A A;  4MGS A;  2HYK A;  2RS1 2;  1LAJ A;  4Y33 A;  5JWP A;  2QJV A;  5FZG A;  4QM9 A;  4NII A;  1JZ2 A;  4N7U A;  3TEZ A;  4N43 C;  5IVB A;  3APB A;  4K6B A;  3Q8F A;  2WS9 1;  4E4D X;  2ZHL A;  3ZYP A;  5DQ0 A;  5FXX A;  1GQG A;  1JZ4 A;  1UZZ A;  2VQU A;  3NNL A;  3MLL A;  1X33 A;  1GZ9 A;  2HWC 2;  1UY0 A;  4Y1U A;  3E6C C;  1LOE A;  1YC6 1;  5D21 A;  2HWC 3;  1NLS A;  3QOP A;  2R1B A;  4LBQ D;  4Q1R A;  3H8X A;  3OB8 A;  2V73 A;  1DZQ A;  2E7Q A;  2Z5W A;  4YM3 A;  5A1L A;  4QT6 A;  2OZJ A;  2VMI A;  4XAA A;  3RZZ A;  2YG0 A;  5A3M A;  1NCQ C;  4JKM A;  4CEY C;  1UAI A;  4R8H A;  3C7H A;  4XW3 A;  1AR8 2;  4CCN A;  2WA4 A;  3M7A A;  4GIQ A;  3K3N A;  4LO4 B;  1AR8 3;  1F5J A;  4XFI A;  3JD7 1;  5C5T A;  4UAP A;  1LKN A;  3H50 A;  1W6O B;  5F6K A;  2L9L A;  5A3O A;  4YRD A;  5HXM A;  5FQ0 B;  1S2E A;  3FBM A;  2EXJ A;  1LU1 A;  1ENR A;  1FAY A;  1NKG A;  1V0A A;  1IKQ A;  2GSY A;  3VLB B;  4B3N A;  1BEV 2;  4X8P A;  3OYW B;  2VR4 A;  3WV6 A;  1SQ4 A;  1BEV 3;  3KVA A;  2R04 1;  1XYP A;  5JXH A;  4I0B A;  4LIU A;  2PMW B;  1UCX A;  2WQ4 A;  3AYC A;  4MXW A;  4QXC A;  2D6M A;  5FO9 B;  4N53 C;  2IZW A;  4ZZ5 A;  2RM2 3;  4DXT A;  5HCB A;  2WC2 A;  3O0X A;  1JZ7 A;  2ARC A;  1XPW A;  3OEA A;  3ZR6 A;  3WF0 A;  2OX0 A;  2C9A A;  3GBW A;  1K3I A;  3ZOI A;  4RL7 A;  3IKW A;  5LA9 A;  3VBS B;  2BZD A;  4BXS V;  4JDM A;  1G7Y A;  1ULE A;  1WW7 A;  2O8Q A;  4BOW A;  5FOB B;  2JDN A;  2YMZ A;  3MW4 A;  3N9O A;  3VDB A;  1LR5 A;  1CX1 A;  2P3I A;  4Y1Z A;  4W4Z A;  2D97 A;  2W68 A;  3KCY A;  3WCS A;  4EQV A;  3VKN A;  3PTY A;  2WQZ C;  3JCI A;  2XJR A;  3S6P A;  3B00 A;  5CKM A;  1ULP A;  4AAX A;  1C57 A;  4MGT A;  4IND A;  3M3I A;  3NAP C;  1GQH A;  2Z4F A;  5T5O A;  4R9C A;  5D1I A;  4Z92 B;  4Q27 A;  4HFS A;  1LTE A;  2Q1F A;  4XE9 A;  4CVU A;  1JYX A;  3GHN A;  5C8C A;  1WME A;  3AM2 A;  1W2U A;  4LLO A;  2XJV A;  4PLO A;  3AVR A;  3PNA A;  3ZIW A;  5A7O A;  4BQY A;  4EV0 A;  3VZN A;  3VDD A;  3N7M A;  1VBB 1;  4RS5 A;  5FZI A;  1FPN 2;  2YC4 A;  3RRD A;  3U75 A;  2JB4 A;  1CPN A;  4NIH A;  1NCR B;  4RGG A;  4K8F A;  1KIT A;  1BBT 1;  1SZB A;  3OD4 A;  4V2V A;  3DUI A;  1CX4 A;  4V2W A;  2ARE A;  1ZBE 2;  3FLT A;  4GZ9 A;  5FMO S;  5IWF A;  4D7T A;  5BNP A;  4GUL A;  4IEV A;  4AVA A;  1ZBE 3;  2VNV A;  5ACA 3;  1SLT A;  2Q8D A;  1CGP A;  3KZ4 C;  4BQ1 A;  1Z7S 2;  3OGG A;  4JVA A;  1BZW A;  1WCK A;  4RFT 0;  3BPS A;  3N7J A;  1Z7S 3;  4XJU A;  5E6H A;  4GWJ A;  4Q1P A;  2FHR A;  5I93 A;  3H3U A;  3NJY A;  5BNO C;  1DDL A;  4CE8 A;  3LIH A;  4OZO A;  4F3J A;  5LBC A;  1L7R A;  4TN7 A;  4XVH A;  4LOT A;  2P5B A;  1DQ5 A;  3DGT A;  5C33 A;  4MOA A;  1XNT A;  2EF6 A;  2VZP A;  3J7H A;  5F37 A;  4YW1 A;  1OC1 A;  3B94 A;  4GH4 A;  2BBA A;  4JQR A;  1KEX A;  4CCM A;  4O61 A;  4D6R A;  2OQ6 A;  3ZXA C;  3WQ0 A;  4KU7 A;  1QJY 1;  1MS8 A;  2W87 A;  3AZZ A;  4YAR A;  3WLU A;  1D4M 3;  2AEZ A;  1JMU B;  4Q0P A;  5J98 B;  3VBO C;  3I54 A;  1QJE A;  2VZT A;  4JRL A;  3R6S A;  5JXJ A;  2B45 X;  2RMU 1;  2UWA A;  4QPI C;  2PFW A;  3VD3 A;  2FMY A;  3F2Z A;  4AGR A;  3N35 A;  3WR0 A;  5JAX A;  1BQP A;  1UWW A;  1RMU 1;  1YJL A;  4AFC A;  3SCF A;  1JZ5 A;  1I3H A;  5FLJ A;  3LEG A;  1HIX A;  4K7J A;  3AP5 A;  4Q0S A;  4XF3 A;  1LU2 A;  1WGP A;  3ZN5 A;  2VBP A;  4P5H A;  3H9A A;  4MGI E;  4Q0V A;  1SHW B;  1UOJ A;  4BK5 A;  1RVF 1;  3LDR A;  1F15 A;  4LK6 A;  1QQP 2;  3M3C A;  2FZ1 A;  1YLL A;  3WEZ A;  4AEJ A;  2DVD A;  4E9K A;  3NKG A;  1SFN A;  4AI8 A;  3ILF A;  1QQP 3;  1W6M B;  1JYW A;  2VBB A;  3OBT A;  1PO2 1;  5CFC C;  2YU2 A;  3TEW A;  1YQ6 A;  3CO2 A;  4DXS A;  1LEC A;  4Z8B A;  4A6O A;  4XQD A;  1IPJ A;  2DFB A;  4LA2 A;  3ZDS A;  2CY6 A;  5C9A B;  2VTF A;  2GMP A;  2PHR A;  2Y38 A;  3UYJ A;  1ZBA 1;  5T55 A;  1HB3 A;  2ADD A;  1PVX A;  4XUP A;  2GNB A;  1PIV 3;  1R1A 1;  2Y6H A;  5EQU A;  4LIV A;  1OD5 A;  3L9J T;  2Y8K A;  5IFP A;  2WYS A;  2QQL A;  3H3Z A;  3NV2 A;  5CZK A;  2A1X A;  3LA2 A;  4L99 A;  5FYB A;  4H14 A;  3VBR C;  1AL2 1;  1ODM A;  3JU9 A;  3UT0 A;  4FFF A;  5J09 A;  3CBN A;  4XJA A;  4XMI A;  2J1E A;  4D0Q A;  1YCI A;  4QQL A;  4AI0 A;  3QH7 A;  5L7O B;  4AI2 A;  4NVP A;  1A8D A;  1YQC A;  1UU5 A;  3P1I A;  3Q8A A;  4JGZ B;  4QGN A;  1ZM1 A;  3FWE A;  2IXH A;  5FTT C;  5JLV A;  2R07 2;  4D69 A;  4M0N A;  1HXS 1;  5FZ9 A;  4AED A;  4GA9 A;  2R07 3;  4Z2A A;  2RDR A;  3VBH C;  3WHU A;  5JSP A;  1V6O A;  2FDH A;  2G1M A;  1PVC 2;  2QKD A;  2WZR 3;  1PVC 3;  4Q5O A;  4AI3 A;  3AJZ A;  4DZG A;  5JOY A;  2QCS B;  4XBL A;  1OA3 A;  1XSR A;  1EV1 3;  2WO3 A;  4M3C B;  3AB0 A;  2D5H A;  3IPV A;  4N43 B;  2JE7 A;  1VAK A;  2PHW A;  3PVB B;  1C8M 1;  5FYU A;  2I74 A;  5J37 A;  3UL2 A;  1POV 1;  3H3L A;  1H6Y A;  3IDA A;  3QLQ A;  4YW2 A;  3USS A;  1RUH 1;  3M3E A;  4EZH A;  4ZZ8 A;  5LK7 B;  4AVV A;  2XML A;  1S2B A;  5DAV A;  5FYZ A;  3BAL A;  2QDN A;  4QPG A;  3HBK A;  5I91 A;  1FMD 3;  4WVM B;  3VKM A;  2X5I A;  4X6Q B;  1GSL A;  1O8P A;  2MNG A;  3VL8 A;  1Q8P A;  1NCQ B;  4CEY B;  1PZ9 A;  1COV 1;  2QBX A;  4K1Z A;  3PIJ A;  4CCE A;  3WP4 A;  3S0M A;  3KGL A;  4GQ7 A;  1QDO A;  1GWL A;  1XYO A;  4FTS A;  3J8F 1;  3MIB A;  4AXO A;  4GKX A;  1D2Q A;  1WD4 A;  3OUH A;  4LO6 B;  4MHU A;  5FMB A;  3V56 A;  5A7Q A;  3AKQ A;  2UWC A;  2A6Z A;  3T4H B;  1V6I A;  1PX4 A;  5LRS A;  1FX5 A;  4Q4Y 1;  4I0A A;  5FZO B;  2VUD A;  5FPL A;  1CVN A;  4HMZ A;  5F32 A;  3THD A;  3C7F A;  3N9P A;  5F3E A;  4IL7 A;  4S2G A;  1GLH A;  1Y4W A;  2BGO A;  3MIE A;  4W8J A;  5EIY B;  1VB4 A;  2ET7 A;  2GNT A;  1KFU L;  1YFY A;  2J1V A;  1WMX A;  2V5Y A;  4UFH A;  4N53 B;  4OHY A;  1QKQ A;  3W21 A;  3NV1 A;  3T08 A;  1ZRI A;  3RZG A;  3M4F A;  2JEN A;  5JOW A;  5CBL A;  1V00 A;  1MZ6 A;  1QOO A;  2GNM A;  2YFU A;  4R4X A;  1HQW A;  4FCA A;  3HWJ A;  1GP4 A;  4R9A A;  2OZ6 A;  4NAO A;  1R64 A;  3KF5 A;  4D6S A;  1G9F A;  3O0W A;  4NR1 A;  3AYE A;  3OBZ A;  1C8N A;  1UX7 A;  5FZ7 A;  3TEY A;  1UOF A;  2D6K A;  2IXJ A;  2GN3 A;  4ASL A;  2HLE A;  1AX1 A;  2UWB A;  1Y9Q A;  2D43 A;  3VDC A;  2CHH A;  3NAP B;  5F5C A;  1RHI 1;  3AMQ A;  4AHY A;  1W0N A;  1HV0 A;  1VBC 2;  4H3W A;  5L36 A;  3VKL A;  4KQ7 A;  2ID4 A;  2VD7 A;  5KHH A;  4RS5 B;  3U07 A;  1VBC 3;  3VDD B;  4QB6 A;  5AVA A;  5LA0 A;  1REF A;  3G7D A;  1KJL A;  1BK1 A;  3OOX A;  4IEX A;  3ZSK A;  3UGF A;  1RUF 1;  4AWD A;  5CNA A;  1CPM A;  5FPA A;  5FUI A;  2XVG A;  4IGP A;  5A7S A;  4QPY A;  2BDR A;  4EWE A;  1VBD 1;  1MZF A;  3S30 A;  3WHT A;  4L92 A;  2WNV A;  4ZHN A;  1XNA A;  2YYO A;  3C7O A;  1I5P A;  2A6V A;  5FO7 B;  1I5Z A;  3PVN A;  4KI5 M;  5A1F A;  4QX7 A;  2FBE A;  4EWA A;  3HAG A;  1UMZ A;  2RG4 A;  2XDV A;  5CYY A;  3T09 A;  4A2U A;  3FUQ A;  3ES1 A;  5BNO B;  4HVO A;  2EIE A;  5GLT A;  5FYH A;  1QH6 A;  1W8O A;  3EJK A;  2A7A A;  3IZO A;  3N9N A;  5BNN C;  1KGY A;  4CDQ A;  3GCW A;  1RL3 A;  3ZXD A;  1APN A;  1CAV A;  4HPK A;  1WLC A;  3BIE A;  2RHP A;  4HKO A;  4D6Q A;  1NA1 A;  4CCC A;  2JDH A;  1YNA A;  1FNZ A;  3QAC A;  3B01 A;  3OY8 A;  2O1Q A;  4AEK A;  4JC1 A;  1F9K A;  1O4T A;  3ZN4 A;  4CUA A;  2BGC A;  2Y33 A;  4DY3 A;  2A3X A;  1PK6 C;  4N7I A;  4BQ3 A;  2VW2 A;  2RR1 1;  4IE5 A;  1ODN A;  4QWN A;  1FAT A;  4XF4 A;  2HWE 2;  2FZ2 A;  2OUH A;  5FP8 A;  3BU7 A;  4FOV A;  2EXK A;  5FZ6 A;  2HWE 3;  2DTW A;  2A70 A;  2VME A;  2WN3 A;  3VBO B;  5IVE A;  1PZ7 A;  2G19 A;  3U37 A;  3OUJ A;  3POJ A;  1H30 A;  4FP2 A;  5FY0 A;  3ROU A;  2ZGT A;  3TAY A;  2VC9 A;  4IV3 A;  4CPB D;  1HJG A;  2JX9 A;  3NV4 A;  4QX0 A;  4PBP A;  3UJQ A;  4D7S A;  1O7F A;  1RUD 1;  4AFD A;  3FC0 A;  3FLP A;  4XFF A;  3WW2 A;  4WM8 A;  2AR6 A;  3AC0 A;  5DDJ 1;  1BHG A;  3C2U A;  3GYD A;  3JXS A;  4YZ3 A;  2WFP A;  3MPP G;  3FBY A;  1CAU A;  1EUT A;  4XAC A;  1RIR A;  1ND3 C;  2WBK A;  1K5M A;  2IC1 A;  3FJS A;  4XXP A;  1KFX L;  5T5L A;  1TMF 3;  3OGS A;  4JKK A;  4CYD A;  1XRU A;  2C1F A;  3LA7 A;  4CP9 B;  5KHI A;  3SXW A;  2CTV A;  4XTM A;  4WVV A;  5I0U A;  4CU9 A;  2YGL A;  1DZT A;  1YUD A;  2EIG A;  3AFG A;  4JDO A;  4MHR A;  4QHO A;  1WZX A;  4A6S A;  2QQK A;  2WFF 3;  5E8A A;  4NHX A;  1AYM 3;  2PHL A;  5BYN A;  1N1S A;  1JYV A;  5HI0 A;  1AXY A;  1GP6 A;  4HK9 A;  3LB9 A;  3MO4 A;  3MDP A;  3LF7 A;  5JZG C;  2GMM A;  2WLP A;  2Y6F A;  2Z42 A;  3J4U H;  4KL1 A;  3CF6 E;  1WWY A;  4ZY9 A;  3VBR B;  5HCA A;  3W9A A;  5IAT A;  5KXD A;  3AP6 A;  2VG9 A;  4QDQ A;  1NY7 2;  2LS6 A;  2OUJ A;  3H7J A;  2OYZ A;  2EIB A;  1W8N A;  2MPF A;  4IEP A;  3UGH A;  2XKO A;  3GBG A;  2ZEZ A;  1RUE 1;  5T50 A;  4K8R B;  4TSV A;  3S5A A;  1J58 A;  2P4E A;  1UZY A;  2QQO A;  2ZKN A;  3LGR A;  4YM0 A;  1O91 A;  1JZ8 A;  3J26 N;  2GND A;  1DCS A;  1SLL A;  2XJP A;  2F4P A;  3NNF A;  4HET A;  2BNO A;  3DXT A;  1YQ8 A;  3CKH A;  4AF9 A;  5DAQ A;  2HYX A;  4RN5 A;  3VBH B;  5FK8 A;  4E8C A;  5C3P A;  1MAC A;  5F5I A;  4LHK A;  5ANQ A;  2DUP A;  4MG2 A;  3D5O A;  1OF4 A;  1OPO A;  1W6O A;  3VZK A;  4IE4 A;  1VAM A;  4Q2F A;  5AC9 2;  4PQ9 A;  4QKF A;  1GNZ A;  4QXH A;  3FL7 A;  4EZ4 A;  5AC9 3;  5FQ0 A;  1RUG 2;  1VRH 2;  2PAK A;  3KGZ A;  4NRP A;  3U1X A;  1DQ1 A;  3L2H A;  3K51 A;  3OYW A;  3I97 A;  4P9I A;  4E2S A;  4OI1 A;  1RXG A;  1LRH A;  1QJF A;  1R1Z A;  1V6J A;  3ETP A;  2P17 A;  1VAV A;  4GMP 0;  2ZEX A;  3RZL A;  2X53 S;  2JJ6 A;  4WVZ A;  3MIG A;  1ENS A;  1JHN A;  4XJ8 A;  5T5J A;  4M4R A;  2BOJ A;  1GUI A;  1WBF A;  3AKR A;  3O1S A;  2ORX A;  3CJI B;  3DKW A;  3VBS A;  2BWC A;  3MFA A;  3RMY A;  1BMV 2;  1DHK B;  1N3Q A;  1XC6 A;  1LUL A;  4JTN A;  1VBE 1;  3DL3 A;  4CSW A;  2XR4 A;  2BP6 A;  5C8W A;  3KHC A;  4CXX A;  1UKG A;  2WII B;  2PLV 3;  1X9T A;  2R06 1;  5JVV A;  2VM9 A;  4BIS A;  1H2M A;  3W59 A;  2RS3 1;  3DCQ A;  3J9S A;  1GP5 A;  3WIN E;  1EYB A;  3OJB A;  5APA A;  2UU8 A;  4LUL A;  4BQ2 A;  4GJY A;  4WBB A;  1OSG A;  5FY1 A;  3SQO A;  1JUH A;  4QXB A;  2AEN A;  5CVR A;  3W5M A;  1NYW A;  4B4Q A;  2ZOE B;  1Q56 A;  1XE7 A;  4X8N A;  4JX0 A;  3IN9 A;  4KWL A;  1JOP A;  3ZFE B;  5A70 A;  5A3N A;  1EAH 2;  1LB2 A;  1X9P A;  2VCM A;  4LR4 A;  4XUR A;  4AI1 A;  5LCW L;  3UKN A;  1EAH 3;  1W6Q B;  3K75 B;  3E6B A;  1XNB A;  1D2S A;  4W50 A;  2J1U A;  1ZA4 A;  3S7E A;  1PGS A;  1CIW A;  3A23 A;  5FR3 A;  2ES3 A;  1ZVF A;  1RED A;  2HWF 1;  2E6V A;  1WW6 A;  4W6W A;  4EYU A;  4ZU7 A;  3MF6 A;  4CCJ A;  1O5L A;  1K45 A;  1G9B A;  5F3I A;  1EY2 A;  3AP7 A;  2ERF A;  1TZO A;  2ZX3 A;  2P34 A;  5AFE A;  4W65 A;  5E16 A;  2DBN A;  1O3S A;  2JDA A;  3O0V A;  4M3C E;  2LRO A;  5HPO A;  3DPR C;  1AYN 1;  1PGW 1;  5KHK A;  4F7Z A;  4O65 A;  3ZYB A;  1XE8 A;  3NL1 A;  4GMP 3;  2X09 A;  4PLN A;  4DMI A;  5GZD A;  5ABJ A;  1SFY A;  1QJU 1;  5IHR A;  1R08 2;  4A4A A;  2HBU A;  1O6U A;  2W52 A;  2HEV F;  2WT0 A;  4RHV 1;  4Z1V A;  2Y6K A;  2PHD A;  4HT1 T;  1R08 3;  2HWB 1;  4AVS A;  1OFS A;  2Q1Z B;  4E4H A;  1UZW A;  5EHD A;  5C5U A;  2JE8 A;  1QHD A;  1RJ8 A;  2VVD A;  2WKK A;  1SDD B;  3BGA A;  3WNL A;  2YPJ A;  2XH6 A;  4FFI A;  5FZM A;  3ZKU A;  1ND2 C;  1U5I A;  2XG3 A;  2VOT A;  5IK5 A;  4GXL A;  3A21 A;  1HRI 1;  5JR7 B;  3OBA A;  2LTN A;  2E33 A;  2RS5 2;  4TLF A;  4L11 A;  3LDK A;  4CDU A;  2PEL A;  3CL1 A;  3ACL A;  2ETE A;  4OMD A;  2Y34 A;  1OT5 A;  2C6S A;  4YGC A;  5B2G B;  2HEY F;  5FYT A;  3AZY A;  1N1V A;  4FPE A;  4Q4V 1;  5FY8 A;  4ATE A;  2VNR A;  3I2H A;  5BNN B;  1CJD A;  4AQT A;  1SPP B;  1NA1 B;  3CJX A;  3MUY 1;  4PDW C;  4Q4X 1;  4DPN A;  4XQ4 A;  3EQE A;  5FYS A;  2B9U A;  2GH8 A;  1OKQ A;  1X8E A;  4IEW A;  4RFR B;  4YW4 A;  5F3C A;  2VCC A;  3PU8 A;  2BUK A;  2CV6 A;  4H55 A;  5EJ1 B;  3WDU A;  2J1R A;  1U12 A;  2XJT A;  3N9L A;  4CRQ A;  3ZDV A;  1W6M A;  4XJZ A;  3JQX A;  5A33 B;  4BZ4 A;  4AG4 A;  1IS5 A;  5FOJ B;  4FT8 A;  4COY A;  2CNA A;  4LOS A;  1EP0 A;  2DTY A;  4BME A;  2ZX4 A;  2WA3 A;  1RTV A;  3U11 A;  2QQP A;  4RQP C;  4WM7 C;  5C9A A;  3R4S A;  3EO6 A;  3I2O A;  1RUC 2;  2HWD 2;  3Q8E A;  1MPX A;  2WWU A;  1LHV A;  3O1O A;  1DGR N;  1FOD 1;  2HWD 3;  4FAH A;  1W2N A;  1MQT B;  5CFD C;  1CN1 A;  1YXW A;  1GOH A;  4BWO A;  2HBT A;  1GZW B;  3SHR A;  5ANN A;  5EYX A;  3TEX A;  1TME 3;  2VZO A;  5CU1 A;  1A78 A;  2RJ2 A;  2ZGO A;  4UW6 A;  3OBR A;  5EXO A;  3VKO A;  2XBO 1;  3RI9 A;  1ND3 B;  4RA0 A;  1AR7 1;  1VPH A;  2J22 A;  2W39 A;  5LRR A;  5KXE A;  1HB1 A;  2DU1 A;  1GFF 2;  3D0S A;  2YFZ A;  5FXW A;  3TBD A;  1H2K A;  2B4K A;  4TWT A;  4YVW C;  5GZG A;  4Y5T A;  5L7O A;  3V0B B;  4XUT A;  4O9G A;  4JGZ A;  1I9R A;  3H8U A;  3JB4 C;  3NMB A;  3ZXE A;  4XFA A;  1NLR A;  1IQA A;  4YW6 A;  4GB3 1;  3HQX A;  1O5U A;  1GU3 A;  4UFK A;  1WCQ A;  2QNK A;  1UMI A;  2MEV 2;  4ISR A;  3RFR A;  4YZ5 A;  2IXC A;  3GJB A;  5HCH A;  4AGG A;  5EPA A;  4BLJ A;  4HG6 B;  2DVF A;  1XSQ A;  2RS1 3;  1DQ4 A;  1US2 A;  1JW6 A;  1UIK A;  3LEM A;  4HXC A;  4JZR A;  1D7P M;  1UL9 A;  2BVB A;  2OA2 A;  2WS9 2;  4NPL A;  4M3C A;  2R0F A;  3N7L A;  3MV0 1;  1WW4 A;  1YFX A;  1T6B X;  2GC3 A;  2WS9 3;  1JYC A;  2VQA A;  4N43 A;  5IVC A;  5FMC A;  3T0D A;  3ON7 A;  5GZC A;  2R32 A;  3A0K A;  1KS4 A;  1WMD A;  1FXZ A;  2VPV A;  4LBJ A;  2ZZJ A;  4NWW A;  1VE0 A;  4P9W A;  1BVP 1;  2B8M A;  3H8O A;  1ACC A;  2AYH A;  1QNY A;  2JD9 A;  1OVS A;  4IGO A;  4WVM A;  3L2Y A;  5IYY A;  2R16 A;  1U5X A;  4XTP A;  2WUH A;  5FYY A;  1AR9 1;  3HBZ A;  1NCQ A;  3IDB B;  3JD7 2;  1HJF A;  2VO5 A;  1NXD 1;  2EIC A;  5EJZ B;  4XJW A;  5T54 A;  1CQ9 A;  2YC0 A;  3PL0 A;  4MH0 E;  5H9Q A;  3ZYF A;  3KV9 A;  3SEP A;  5C70 A;  2QZ3 A;  4OUM A;  4S2H A;  4XFH A;  3MW3 A;  3ZXG A;  1RXF A;  3RYP A;  4D8M A;  4YGB A;  2VBD A;  1YIF A;  3POE A;  2NPI A;  1SLC A;  4XMA A;  3VUO A;  3AP9 A;  3BOP A;  3GM8 A;  2P3J A;  2R04 2;  3DYM A;  5D8A C;  2HEW F;  4CUG A;  4A7K A;  5FZO A;  2IVJ A;  4E2Q A;  4NN0 A;  1OLM E;  1Q3E A;  5J7M A;  5BPX A;  1H1M A;  1XQN A;  4LKE A;  4CDX C;  3JUU A;  3BIW E;  1S0G A;  3HEI A;  4BU2 A;  3EB7 A;  4N53 A;  1A8M A;  4PIX A;  5EP9 A;  3VZO A;  4KU8 A;  5FMO L;  4NIA A;  1PGL 1;  2F4L A;  3VD5 A;  3ZYJ B;  4LEJ A;  4D3W A;  4QXK A;  4ZXE A;  3V65 A;  1U0A A;  2ZEW A;  2J1A A;  2BBV A;  3SIT A;  2UUR A;  2GC1 A;  2BTV C;  5A32 B;  3WZ1 A;  4Y22 B;  3P3P A;  3WNX A;  1LOD A;  4E27 A;  4YSF A;  3SCG A;  3WDT A;  3I49 A;  2VNG A;  4V1P A;  4ZON A;  1DQ6 A;  2RM2 1;  2QDR A;  3AX4 A;  1S0E A;  3GF6 A;  1W2T A;  5HCF A;  3VGI A;  4OI4 A;  4LO7 A;  1LOA A;  1X8M A;  1NZC A;  3NAP A;  5IAX A;  3PLQ A;  5IT6 A;  2JEC A;  4IE0 A;  3NJX A;  4CUC A;  3FX3 A;  1VJ2 A;  4CP2 A;  5FRE A;  1VBB 2;  1HN1 A;  3PUS A;  1Q8V A;  2P3Y A;  4HVR A;  1FPN 3;  2VAU A;  5DN2 A;  2YB7 A;  1VLN A;  2WLQ A;  5IVY A;  5JIA A;  4FQ4 A;  4NPM A;  5BNQ A;  1BBT 2;  1QY4 A;  1V6K A;  4XIL A;  5C4W C;  2EA7 A;  4YM2 A;  2I07 B;  3GDB A;  1KDK A;  5FWE A;  5KR7 A;  3RJ2 X;  3POS A;  4BYY A;  1H9P A;  4HSL A;  3OEB A;  4YNI A;  2WN2 A;  1Y9G A;  4KBB A;  5FP4 A;  3QD6 A;  2E26 A;  1WLD A;  4XCA A;  1RB8 G;  1HRV 1;  5K7P A;  2BPA 2;  4BHP A;  1TVG A;  3PJQ A;  3BKZ A;  1UY1 A;  3HNB M;  3POB A;  1O3Q A;  4BQW A;  1UO9 A;  2R7E B;  2VEC A;  1G9A A;  3DPR B;  1ZRD A;  5ABJ B;  2DVA A;  1GZC A;  5BNO A;  4UBH A;  1W8W A;  1GV9 A;  1U5Y A;  2CAU A;  1WLT A;  1WCD J;  1NE6 A;  1ST8 A;  2OS2 A;  4G4F A;  4FXG B;  3UET A;  4AK3 A;  4FAG A;  3N36 A;  2VUC A;  5ACA 1;  3VHR A;  5IK4 A;  1PZ8 A;  1BVV A;  5IK7 A;  4YW7 A;  2ZML A;  3M8L A;  2VUL A;  2ZAA A;  3EHK A;  1QJY 2;  2Y0O A;  1JI6 A;  3VHO A;  4BE3 A;  2LM3 A;  2JDZ A;  3HQU A;  3KLS A;  1QJY 3;  4P9X A;  2Q8E A;  2IXI A;  1ND2 B;  2Y64 A;  5DAX A;  1OA4 A;  3SKJ E;  4CDU B;  1W8U A;  3X29 B;  2B39 A;  3MHZ A;  2J42 A;  3NW4 A;  4P9G A;  2RMU 2;  3VBO A;  2Q30 A;  1H4H A;  1UYY A;  4YGE A;  3O14 A;  1JYT A;  2H6B A;  1GOG A;  2WWS A;  1RMU 2;  3ZPO A;  2B5H A;  3NNJ A;  4Y5S A;  2RJL A;  3B69 A;  4AFB A;  5F39 A;  2QQU A;  4GWM A;  1LNS A; 
#chains in the Genus database with same CATH homology
 2A1X A;  3OUI A;  4XAB A;  3BVC A;  3NNF A;  3KT7 A;  5DAQ A;  2Y34 A;  5LBF A;  3W20 A;  3GJA A;  4NMI A;  4NHL A;  4BQY A;  5ERL A;  5IAV A;  5EP9 A;  2RDR A;  4IW3 A;  2JIG A;  2RG4 A;  5LB6 A;  2G1M A;  4NHM A;  5HV4 A;  4Q5O A;  5M0T A;  3EMR A;  5LAS A;  4ZON A;  2RDS A;  5LBE A;  2FCT A;  5IAX A;  3DKQ A;  5LBC A;  2Y33 A;  5DAV A;  2HBT A;  4NHK A;  2JIJ A;  2G19 A;  4XCB A;  3OUJ A;  3GZE A;  4XC9 A;  5A3U A;  3NNL A;  3MGU A;  4UWD A;  5LBB A;  4Y5T A;  3OUH A;  4MHU A;  4ZPI A;  5DAP A;  4NHY A;  4XCA A;  4XAA A;  5L9V A;  2V4A A;  4XAC A;  5HV0 A;  5DAW A;  4BQW A;  3GJB A;  5C5T A;  2OPW A;  5EPA A;  2RDN A;  4JZR A;  3W21 A;  4MHR A;  5LAT A;  4KBZ A;  3KT4 A;  5L9B A;  4NHX A;  5L9R A;  3KT1 A;  4BQX A;  4J25 A;  4NAO A;  3HQU A;  5DAX A;  3OBZ A;  2HBU A;  3ITQ A;  5IAT A;  3NNM A;  2FCU A;  5LA9 A;  5C5U A;  2FCV A;  3HQR A;  2RDQ A;  4Y5S A;  3NNJ A;  3PL0 A;  5EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...