5LBEA

Hif prolyl hydroxylase 2 (phd2/egln1) g294e variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
220
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINERTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLGVRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 64
structure length 220
sequence length 226
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbeA00
5DAPA 4XABA 3DKQA 3GJBA 5L9RA 5A3UA 2G1MA 2A1XA 4XCAA 4IW3A 5DAQA 2RDSA 4Y5TA 4NAOA 3BVCA 5IATA 3OBZA 3PL0A 5EQUA 5M0TA 3EMRA 5IAXA 2Y34A 5C5UA 3NNJA 2FCUA 5L9BA 4UWDA 4BQYA 4XCBA 5DAWA 4MHUA 4NHXA 5ERLA 4Y5SA 5LBBA 2RG4A 4BQXA 4XAAA 3NNMA 3KT4A 5EPAA 3OUJA 4MHRA 4NHYA 3W21A 5LBEA 4JZRA 4NMIA 5HV0A 2V4AA 4Q5OA 4XACA 3MGUA 3OUIA 3OUHA 2RDQA 3NNLA 4ZPIA 4NHKA 5DAXA 2OPWA 4KBZA 2G19A 2JIGA 3GJAA 2RDNA 5HV4A 3HQUA 5LASA 2FCVA 3NNFA 5DAVA 2RDRA 3ITQA 2HBUA 5IAVA 4NHLA 3GZEA 5LBCA 5LATA 2JIJA 2FCTA 2Y33A 5LBFA 4BQWA 3KT7A 5L9VA 5LA9A 3W20A 3KT1A 2HBTA 4ZONA 3HQRA 4J25A 5C5TA 4XC9A 5LB6A 4NHMA 5EP9A
chains in the Genus database with same CATH superfamily
2V5DA 3GJBA 4COZA 5CYYA 1WBFA 4ZZ5A 1KD7A 2HWD2 3ZFFC 4RL7A 5FY1A 3MW3A 4IW3A 2RR12 1SG3A 1A6CA 4K1ZA 1DHKB 4XJ9A 2FDJA 1YFYA 1MZ6A 2Q0AA 3H3ZA 2Q8CA 1EAH3 2Q5TA 4Q1RA 3PUIA 4N43A 4N53C 2FDHA 1RVF1 3VZMA 1B35C 1GNZA 2X8KA 3UL2A 1GUIA 1W6NA 4XF9A 3DYMA 2ZGOA 5ACA2 4B4QA 1IG3A 2VZ3A 1PZ8A 2EALA 3AZVA 4M0NA 1X7NA 1W6OA 4FQZA 1RTVA 5C71A 3CU7A 1W28A 4G4FA 2HLEA 1J1LA 3DPRA 4GKYA 1CWPA 2YMZA 3OY8B 4AEJA 3KS7A 2BJSA 3AYAA 3CJIC 3CF6E 5CBLA 4FPHA 1QKQA 4BWOA 4MV2A 2DU0A 1AZDA 4F8AA 2QQPA 1XC6A 2EIDA 3IDCB 2ZOEB 2YC4A 1ASJ3 1OUSA 3H50A 2R041 3KT4A 2WYSA 1LOCA 4MHRA 1HRV3 1RUI3 4AEDA 3NJZA 5LRRA 5B4NA 3H0OA 2EF6A 3NAPB 5FZDA 2WFF2 1CAXB 4BQ2A 1W6NB 3AFGA 4RR3A 4QDRA 2VO5A 2TNFA 3LGRA 2RMU2 2VZRA 1QH7A 5CFCC 1V6KA 3WF2A 4I2OA 2VD7A 5AVPA 1F15A 4D7YA 3A0NA 5F6LB 3C3VA 5BNPA 1RC6A 1YHFA 1UZ0A 3BKZA 1RXGA 2XJUA 2B4KA 4LO5B 1OVSA 1JYWA 2G4IA 3KCXA 4R52A 2R32A 3KB5A 5FY0A 1GP6A 2CYFA 4ORFA 4Q0PA 4Z92B 4IV1A 4LHNA 1GLHA 4CEYB 3E5UA 1RXFA 3ILNA 1FPN2 4A4AA 1WW5A 3I2GA 2YGLA 4ATEA 1NCQB 2BVVA 3LA7A 5LASA 5T5LA 3GZTB 4LR4A 3NV3A 4DUXA 3ES4A 2JG9B 1VE0A 5IAVA 3LOBA 3R4DB 4XZPA 4IE7A 3OJBA 1EAH1 4DNYA 1PX3A 2A70A 3H8OA 1XJAA 5LATA 5GZCA 3BIEA 3WP3A 4KWJA 4LK7A 2HWF1 5I0UA 3X29B 2TBVA 1UZVA 2H0VA 5ABJA 2CY6A 4XFFA 4E8CA 4XFBA 1HDKA 3WUCA 1RUG1 2D6MA 2A6YA 4LA3A 5JMCA 4CEWA 3J7HA 2W47A 5KBFA 2GC1A 2YC0A 4GULA 3MYXA 4HN0A 4KQ7A 1GOFA 1PK6B 1QDOA 2NZ9A 3K77A 3HN1A 4MX3A 2WKKA 3D82A 4RN5A 3VB9A 2PAKA 1W0PA 4AW7A 4KWUA 4JV4A 2BEOA 1HLCA 1KS5A 2YDEA 3PUSA 5EP9A 2B42B 4YVSB 4IEXA 1CZVA 3WLUA 3FHAA 4QQOA 3MIBA 4FFGA 5A6ZA 3DEMA 5A7OA 4A3ZA 3U4XA 2IUWA 1RHI3 4XJUA 4LE4A 1YCIA 4AFAA 2ZZQA 1OFSA 1W2TA 1SBDA 1AL23 5C70A 4NAOA 4AZZA 1KGYA 3I3BA 3PIGA 3O1TA 2E26A 1SPPA 2UWAA 2Y34A 2ORXA 1UPSA 2VZVA 1AXZA 2C5DA 4GWNA 2PA7A 3ZPOA 4DFSA 1UY0A 3WF3A 3FZ3A 2LALA 4LULA 4FFIA 1PO21 2B9VA 4LO4B 1FOD1 1FOD3 1XE0A 2WBKA 3VBHB 1WMFA 1DYOA 2BGOA 3LD8A 2V09A 1CR7A 1NKGA 1SHWB 4IETA 3Q8BA 4O9GA 4URTA 4YVWA 3RS6A 4B7KA 1E5SA 3RJRA 3RYPA 4B7EA 4Z2AA 3POEA 2YC2A 1NCRA 1TQ5A 3AMMA 1JS9A 2HWB2 2WDBA 1IQAA 4NHXA 4P5HA 3ABZA 1AR82 2DUPA 5EPAA 2HH9A 5AC91 1F5FA 4YM1A 4Q8KA 5CFDC 2WWUA 4CRQA 4C91A 4YZ5A 2D6KA 5FPBA 3VBSA 3ZKYA 5K8SA 2DCJA 4Y20A 3T2OA 1O59A 1H30A 2ZGSA 4QX5A 4O61A 3SQOA 1BKZA 1ZRFA 3MIHA 1FMD3 3CQOA 2F6BA 1RUD1 4XJ8A 4TSVA 2GN3A 5FP3A 1MS0A 1W9SA 2DCKA 1FI2A 4GZ9A 4L8QA 3RYKA 4JHZA 3K3OA 4XBLA 5C6CA 5IVJA 4FO9A 4AQSA 2XLAA 5HCBA 2QCSB 4AF9A 4A2UA 2C9KA 1VAVA 4TTGA 1WCKA 4L11A 4CDQC 2WQZC 4OCTA 2XUMA 2G19A 3WG4A 4RQPB 4JGYC 3ON7A 1LULA 2JB8A 4Q4W3 5DG2A 4YM3A 4BIOA 5JXGA 3HQUA 1LR5A 2JE8A 1OSGA 1MS3A 2FMYA 2E33A 2XMLA 4HK9A 5FCCA 2GAUA 4Q4X1 5CVRA 5FMBA 2JDYA 4FP2A 4NHLA 1CESA 4E4ZA 3JU9A 5F2WA 4CPBD 3B93A 4EYUA 3WHUA 5IK5A 1VBA1 2ETEA 3LQCA 4CPBA 3CO2A 4Y24A 4GWJA 2FQPA 1V6MA 1NY72 1ZBA3 2RJ2A 3AMHA 3SITA 4OMCA 4CDXC 4LTAA 1LJ7A 5DQ0A 4CUBA 3POFA 1W8OA 1PVC3 3CKHA 3USUB 2Q1MA 2VMDA 4AXOA 3KT7A 5E89A 1G9AA 4NRMA 1UPIA 1JU4A 5FBJA 3V65A 5FJHA 5ACA3 3N7KA 4IGQA 3O1SA 2I07B 2PELA 4I0BA 1NCRC 3IPVB 2GH8A 2VGDA 4JRAA 4QXBA 3RFRA 1X8EA 3O7OA 4YW5A 1OA4A 2WAAA 3JXSA 2BBVA 5JIAA 5LWBA 4XABA 5FZIA 3M4FA 1DQ1A 3MV11 3M7AA 2QZ3A 1OD5A 5JWPA 2ADDA 2VXRA 1K12A 1OVPA 2VCCA 3ST7A 1QJEA 1EP0A 5C3PA 3LDKA 3B7MA 3OOXA 1GKBA 2RS11 4E2SA 3QD6A 4W65A 3SISA 4QHZA 1BCXA 4KI5M 5A7QA 4YYOA 4COWA 2A6WA 1S0FA 1ZZ8A 1FXZA 1HJFA 3VDBA 1PMHX 1SQ4A 4OUMA 2YBPA 4G3YC 4LUMA 5EZWA 1AUYA 4IEPA 4ONUA 5GM0A 1AYN3 4V1PA 4WVMB 1K5MA 5FP9A 4D69A 4UWDA 5IVCA 1RUH2 4BQYA 3FWEA 3BCWA 3P3NA 5FZ8A 1JHJA 1RUG3 4BYYA 1VBD3 1ULEA 4C0HA 1QMJA 1ZYBA 1YFUA 4IEOA 4LIVA 2WQ4A 5DG1A 3V0AB 1UF2C 3B00A 3OGRA 3R4UA 2DVFA 4YW4A 4LUKA 5FK8A 3SH5A 3R6SA 4FPLA 3GZUC 3K2OA 2XLFA 4OI1A 1V6LA 4Q0SA 1X8MA 1JBCA 1VRH2 4B29A 1AYM3 1UL9A 3GHMA 3IMNA 2D6NA 4CZSA 4OI0A 2ZX1A 3GCWA 3T08A 2WNUB 2DTYA 1QXJA 2RHPA 1R082 3KHBA 5BPXA 3THCA 1AR72 1UZYA 2XBO1 1RIRA 2XJTA 1DYKA 2EXIA 1MZEA 1HXS1 3HIFA 3IDBB 4KWLA 3HPNA 5LEJA 1NA1B 1MEC3 2WN2A 4WVVA 2FHRA 1XPWA 1L7QA 2ZX2A 5FZ3A 4XPVA 5H9RA 1CD3G 2DCZA 3AP4A 4XTMA 4LLOA 3KMHA 3APBA 3JD73 2PHFA 4FTSA 1O91A 5GLTA 4YFZA 4MVTA 1DQ6A 4E9KA 3NMBA 1K5JA 4JGZA 2C0ZA 3THDA 3RZZA 2W1UA 3NQHA 1JZ7A 3ZFEC 4B4RA 1BZWA 2PLV1 3BALA 2ZEXA 1ZRIA 3MLJA 2JDZA 3EHKA 4FSJA 3IM0A 2VCMA 1IS3A 4ZY9A 4Q4X2 2RM22 4NPMA 2Z79A 2C24A 2YB7A 4TLFA 4Q4Y2 4BXFA 3AKQA 5LBCA 1Y9GA 1PZ9A 1OLMA 1SMVA 2Y38A 3FN9A 5C3OA 4GA9A 3J8F3 1BEV3 2GN7A 2CSGA 3THTA 4EZHA 1LHVA 1KDKA 2HEYF 3HNBM 4Y22A 2DU1A 2Y33A 4CXWA 4P02B 4CDWA 1G9CA 5LA9A 1AX2A 1JYNA 2A3XA 3GM8A 4CCOA 2ZGRA 3HNMA 1PGW2 3UKVA 2GNDA 1S4CA 2E53A 1J3PA 1ODNA 1VBC3 4FAGA 2XOMA 4UT5A 4XFHA 3BYWA 5I8YA 1ACCA 4M4PA 5LB6A 4AYUA 4X6QB 2BGPA 3OD4A 2D43A 3VDDA 1M06G 2HWE2 2E6VA 2WO3A 2YHJA 5FZ0A 1GQGA 2Y6JA 3KGZA 4AHWA 1PM7A 2EXKA 4IQPA 4LT5A 4RHV2 2FDFA 4XCAA 2CAVA 4PF5A 4ZZ8A 1BLZA 1W03A 3JQXA 5DDJ3 1Y43B 1UCXA 5EJ1B 3VD3A 3GDBA 2D3RA 1VRH1 2PLV3 4KG0A 5IATA 3OBZA 1RJ7A 3G7DA 2W92A 5CISA 5CA6A 4TZDA 3SMHA 1VBE2 2ZGMA 1XSRA 4PJYA 1O5UA 1KJRA 2WWSA 3ASIA 1YYNA 3ZMOA 3HBKA 3OG2A 4HONA 4Y20B 5T3NA 2H0BA 1LESA 5FZ7A 1J84A 2BW8A 5F39A 1XYPA 3KV5A 1MEC1 4LKDA 4K6BA 1B09A 1CPMA 3TN92 3MPPG 4GD4A 4BXSV 5HXMA 2BERA 2P6CA 2WNVB 5A80A 3TEWA 2D6OX 3WUDA 4FI9A 1UD1A 2WYFA 5LBBA 4Y5SA 2VM9A 2RG4A 4MGKE 2VMGA 3IAPA 2JEMA 5C3QA 4XDPA 1O3SA 2PAMA 3HJRA 5EYXA 1H2MA 2YFZA 3RG0A 3VKOA 1CX1A 1F5JA 5FLJA 1DIWA 2P34A 1CVNA 1XYNA 1YQ5A 2JD4A 4S2DA 4CCDA 3ALQA 4WVZA 4PLOA 1MS8A 1S0GA 1YFWA 3ZVXA 3BU7A 4Y1YA 4JZRA 2MHFA 1UIJA 4P9GA 4B4PA 1PVXA 2RS53 1DQ5A 4L0PA 4DXRA 3HT2A 3FHIB 4AR2A 4LOTA 1VBD1 3VDCA 1C8M1 1X9PA 1UY2A 2WWJA 1NE4A 3HWJA 4MGTA 5A33B 4PF1A 4JVAA 3PDQA 3VHNA 1PNGA 2HEVF 1QJY3 5F3IA 1WD4A 4D0QA 1LHUA 4QDQA 1RINA 4PQQA 4NRQA 5FPAA 1J58A 3PVBB 1S0CA 1HV1A 3ZYHA 3JBG2 4LBOA 4WM8C 3E6DA 1JHNA 1ZZ6A 4FQ4A 1W6QA 1NY71 4QPIB 1SFYA 4CU8A 4QX8A 4DEQA 1S2BA 2RDRA 5JCTA 4UW4A 1JN2P 3AP9A 3LB9A 3U37A 5I0DA 1BXHA 1N1TA 4HPKA 1IOAA 1I5PA 2G9FA 1VALA 2DDUA 3VHPA 4C0BA 3ZMNA 4ASMB 5EFUA 3ZXEA 4AFDA 3O0XA 3SLIA 1W9TA 3WNKA 2CGOA 1SACA 5ABJB 5I0RA 4AVTA 4QKFA 5BNNC 1DP0A 2A5ZA 3A4UA 3VLBB 2A71A 4GIQA 2R063 2CDOA 1C4RA 3O1RA 5A6QA 4CP2A 5CKMA 1TME1 3VUOA 1QNYA 5EYYA 3KGLA 3TN93 1QGLA 3HEIA 2QQLA 2Q1ZB 4WM8A 4BQ5A 1SFNA 4KU8A 2VH9A 3E6CC 2WT1A 5J3UA 5DAPA 4BK5A 1TZOA 1Y9QA 2WIIB 4NWWA 1A78A 5IUQA 3LFIA 4AVCA 4F3JA 2VUAA 2AUYA 4XFCA 3U07A 4CCKA 5EWSA 1X50A 4AK3A 1C8NA 2XWBB 3MZHA 3PTYA 3UGHA 3IWZA 3M70A 5AC92 2OZ6A 4HVRA 2D93A 4IEWA 4ISQA 1W39A 2BRTA 1IS4A 2VCAA 3CZJA 3PL0A 2ZBJA 3PUHA 3ENRA 4LBKA 2K46A 1W6PB 1R1A1 3H1YA 3POGA 4NPRA 3VBUC 5M0TA 2XBO2 1GOGA 3VD5A 2ZCWA 1UOFA 1XB9A 1TMF2 1FX5A 1R081 2EAAA 3SCGA 1XE7A 2WN3A 5CU1A 4UFLA 5FYTA 1XNDA 3NJXA 2VQAA 4TN7A 4CDUB 2W87A 1NE6A 2P3IA 3LA2A 3GBWA 2KD7A 5FZGA 4SLIA 4QQLA 4YVSC 1RYYA 4LBQD 1ENSA 2FD8A 5ISLA 3PVOA 4BJ0A 1FMD1 1W9YA 2ZX0A 3I7DA 5DUWA 4FPKA 1VRH3 3RI9A 1OOPA 1D0GA 1DFQA 4YRDA 3I49A 4WBBA 3OEBA 2XVKA 2D5HA 2R073 5FYYA 5H9PA 1SEFA 1NX9A 5KXBA 1W8NA 3PJYA 3NJYA 1VJ2A 3HD8B 4K9SA 3UETA 4IERA 1N3QA 5CEHA 5E16A 4ET7A 4YSFA 1UY4A 1WWYA 1OPOA 1YLLA 3FBYA 4OYUA 1FT9A 3FMGA 3IIIA 2Z42A 2AEYA 2BZDA 3CJIB 4IEUA 4IE0A 4CEYC 5F1RA 3BN6A 3VL8A 2VMFA 4Y4RA 5DN2A 5FZ1A 1T2XA 3J7NA 3ZFEA 3OUHA 3ROUA 1JUHA 4GH4C 4XBNA 4J1XA 5IK4A 4LIUA 2VAUA 4K3UA 3WINE 1RGSA 5FKBA 3NV4A 2KR2A 4TYSA 1B35A 4LHLA 1AX1A 2VZTA 1HKDA 1K5MB 1VMFA 1HRI1 3WP5A 1HXS2 3RZMA 4PBOA 3VBFC 2CTVA 1W0OA 4GMP0 4UW3A 5APAA 2RDNA 1OHFA 1U5IA 1W90A 4F83A 2OQ7A 3K46A 2A6VA 4OHYA 3EXUA 5BNPB 4YG6A 3ZN6A 2GC3A 4A41A 4DRRA 1WLWA 3WQ1A 1OKQA 1AR62 4DXSA 2YY1A 3MLKA 2YU1A 3ACLA 3WSOA 5AC93 3KZ4C 1VAKA 4XQ4A 2OA2A 4NR1A 2PHDA 2PLV2 4N90A 1CAVB 2VG9A 3I3EA 4M3CF 5A3PA 3RWKX 3MUZ1 4HMZA 3NAPA 3CNAA 3CLPA 1DF0A 1IPKA 3N9NA 2X29A 2DUOA 5JXHA 4MADA 3DPRC 5F2SA 5DZGA 1Q56A 1OI6A 1V6NA 1YJLA 3DXTA 4A7YA 2XHNA 4QT6A 4COVA 1URXA 1W8HA 5EJ3A 3FUOA 3O12A 3EO6A 4AI3A 4XFGA 4N7IA 2ET7A 2VTXA 3D8CA 2VMEA 2GU9A 1QQP2 4K21A 4E8DA 2QKDA 5LY1A 1HRI2 3UJOA 1NYWA 1QXRA 2CWSA 3DKQA 3KSCA 1PGL2 3JQWA 1R64A 3HQXA 1G6NA 4AG4A 4Q26A 1Q5OA 3WG3A 1X36A 5A1FA 1W99A 3SEEA 4YG0A 1XNCA 4P9LA 1CAVA 5D1IA 5DUUA 3VBOC 1YNAA 2R042 3ZXJA 4JKMA 4NUBA 2IFWA 1VRBA 4IGPA 2O8QA 2JDUA 4JHTA 5FXWA 3C8XA 1YI7A 5DZFA 3ZX7A 4B1MA 3VBRB 2RS52 5IAXA 2NQYA 3M3IA 3N7LA 1HQNA 3R05A 4LLFA 3V56A 3VD7A 4BK4A 4QU2A 2HWC2 4OQ9A 4HVQA 5LCWL 4CCNA 3O1UA 4QQPA 5C9AA 2QBXA 3MPBA 1MS9A 5FYIA 1UY1A 4ITCA 2VQUA 3M2MA 3RI8A 1FYUA 2GNTA 3AP5A 3WNPA 3RJ2X 3GHNA 3WXPA 4AFCA 3I59B 3J8F1 3EQEA 1W8UA 3ZR6A 5J09A 2K0GA 4N9IA 3T4HB 1LTEA 4IEYA 1LCLA 3E5QA 1LGNA 4CCEA 1GP4A 4MHUA 1MZ5A 2R062 1KQRA 2DVDA 1OUXA 2XDVA 3JB8A 4IEZA 4K40A 1W3XA 4LBJA 4E4HA 1PMJX 2VW0A 2R7EB 4CUGA 4D7TA 1S0EA 3NL1A 1QWRA 2J1AA 2WLQA 4QX2A 1AJKA 3PVEA 5G04L 5A3LA 5LA2A 1PX4A 2AGSA 4XDOA 4AGRA 1J3RA 1TVGA 1UMIA 3MF9A 3PUQA 1GYKA 1V0AA 2X09A 2Y8KA 4LHKA 5J98B 2V4AA 4UFMA 5L73A 2GMPA 1RUC1 3DYPA 1ZREA 1EUTA 1RUJ1 1L3JA 3ECQA 1X82A 2ZJCA 3RZGA 5A7SA 4BMBA 1OC1A 3N7MA 5CFCB 3VBOA 2JICA 4QM9A 4DQAA 1DBNA 1UZWA 5FMOL 1RUD2 4YZ1A 3SEPA 4QPYA 2XL7A 5DAXA 5GALA 1VMHA 2NYYA 3EYPA 4J1WA 1C5IA 3T0BA 1S55A 3NRUA 1LODA 4AOCA 4KBZA 1UU6A 4V2WA 5CNAA 4ZXKA 2JIGA 2RE9A 3HR9A 4FPEA 1MZFA 4PI2A 4PIXA 1V6IA 3MUY1 4HSJA 4YM2A 1TNRA 4UF0B 3BUCA 3N35A 3PTRB 4FVVA 4E2QA 1RUJ2 5I93A 1KJLA 4QB6A 2JENA 3KV6A 2W68A 2NN8A 4L92A 3PVNA 4XF1A 5A7PA 1EV13 5CAZA 5FR3A 1O3QA 4U2AA 3KQRA 2R043 4MYEA 5EHDA 1R092 4RQPC 2W0XA 4AQ6A 1BVP1 1JOJA 2BOJA 3NO8A 4S2HA 1W0NA 3J26N 4HKWA 4QHBA 3UYJA 4CEWB 4HBNA 1DG6A 3VKNA 1LU1A 1Z7S2 2Y6LA 3HBZA 5FZFA 1JYTA 2JXAA 4BA6A 5A70A 3D4KA 3ACFA 3UKTA 4Q0VA 5FYVA 3Q8FA 1REFA 2XONA 2XJRA 4OMDA 4OHZA 4BCUA 4HFSA 4ZONA 2VVFA 3HQRA 5FQ0A 2CGNA 2ZEZA 4FT8A 1TMF1 1WKYA 2J1VA 1NZCA 2YFUA 1R091 4Y33A 2K9ZA 3ZXKA 2RS13 3O14A 5I8SA 5J7MA 3ZFFA 2VZ1A 1W8ZA 3JBG1 1GU3A 3ZYBA 4BM8A 1LOGA 2JECA 1VBC1 5F5QA 3VBFA 4IV1C 3PLQA 3N7JA 2YPDA 2YUEA 2Y6KA 2VTFA 4IV3A 1Z0HA 4YG3A 2AZ5A 4MGIE 2MPFA 3IN9A 3OPTA 1W05A 4L97A 3SXWA 1OPMA 1AR81 4QXCA 2ZPXA 4BDVB 4LBQA 3VHRA 4FOVA 3S7EA 1JMUB 4HVOA 5A32B 2B9UA 2ZGNA 3VZKA 1N1SA 5K0UA 1E5HA 1NCQA 3I54A 3W5NA 5F7UA 5A3TA 1QEXA 1ENXA 3QH6A 3WNMA 5JZGA 3H8UA 5I0SA 2ZMKA 4WZFA 2D5FA 1MACA 1ALYA 1H2NA 1WCUA 2JX9A 4QB1A 2BU9A 1S2EA 2JE7A 5JOYA 3K3NA 5JAXA 2W1SA 4CSWA 5H9SA 1RUC3 4PI0A 3WW1A 3S0MA 3ZSJA 3KHCA 2BPA2 1PM4A 4IEVA 3V0BB 3JCIA 1HXS3 2IWGB 3VGIA 1O7FA 1Q8PA 4QGMA 1LHOA 1GWLA 1NLRA 4CVUA 5A33A 4WM7C 3ZFGA 5C8CB 4JDOA 1OT5A 2DCYA 1RUOA 3D5OA 3NW4A 2R0FA 4HZFA 3PURA 2WS93 4QPIC 4QX3A 3AM2A 3J4UH 2XR4A 2OZJA 5FWJA 5E88A 4META 1S2KA 5IW0A 5F3GA 5FYUA 2PHRA 4AEDB 2Z69A 2JKBA 2VZOA 3WW4A 4D94A 1MS1A 1QDCA 2WZEA 4WM7A 1JOBA 1VBB1 5FAXA 3ZFGC 4CCJA 4W6WA 3IT8A 1Z78A 1MQTA 5FK7A 4ARYA 4GB32 5A3MA 2UWBA 3AZXA 1Q8QA 2QQNA 4AVAA 1OA3A 2YZ4A 2XB6C 2E7QA 4D6RA 2R072 3RZJA 3T1MA 4N9HA 1UOBA 2WO2A 5FZOB 3DPRB 1CN1A 1CAWA 1FNZA 4NHKA 5C4WB 4MXWA 4A6OA 5C9AC 3ZXFA 2JDPA 5K0UC 2OPWA 5FY4A 2RJLA 1YXWA 3ZDSA 3ZR5A 5CZKA 2XLGA 1T6GC 1DGWA 1H1IA 1S0JA 5JOZA 1TNFA 2RVAA 5J37A 2XGXA 4XJZA 2F4LA 2E7AA 1DQ0A 3G6JB 2Y6GA 2ZGLA 4YM0A 1D0HA 1C8M3 1J3QA 1OH3A 2QFEA 4DIQA 1DYPA 2IVIB 4PDWA 1Q8SA 5JI7A 4FOYA 1S1AA 5CFDA 3AMQA 2JIJA 3OB8A 5BNOA 5D21A 1HX6A 2XUEA 5FOJB 1J59A 1EV11 2ARAA 1JZ8A 2VOKA 4Y3OA 1V9U1 2DURA 2E63A 3CEWA 4I02A 5LBFA 5KHGA 4YW3A 1UYPA 1SLBA 1DGRN 2EVXA 3AFKA 1CZTA 5KHHA 2CAUA 3ZSMA 3UGGA 3GCXA 4MH0E 4Y1VA 4NE9A 4YGCA 5D2AA 2WZR2 2DTWA 3U0ZA 1AR63 3DKWA 4J25A 1SFPA 4LJHA 2UY9A 2ZHNA 2WSUA 1OQ1A 4OUEA 2PTMA 4QQ2A 4XC9A 4XEZA 1OQDA 5JZGC 3H7JA 2VCBA 2AREA 2QVSB 4PT6A 3AYEA 2PHTA 2WR9A 2OVUA 3N3HA 3TOJA 4D3WA 5JXJA 2VXJA 4W50A 2GALA 3EBRA 1UWWA 4OHWA 3E5XA 3SH4A 2BTVC 3AB0A 2ZAAA 4UFKA 3PHMA 3K4DA 4ASKA 2MEV3 3A22A 3OGJA 4IXLA 1ZZCA 4YNIA 2Q8DA 3BVCA 2Q30A 2WQ8A 4AHXA 3O1MA 4A7KA 4DO0A 2P17A 2KA3A 1H9WA 1QJX2 3WDYA 1I1EA 3WNOA 4M3CE 1RUNA 4Q4V3 3BIWE 4MO3M 3MLLA 3U75A 2BQPA 3C2UA 4QX7A 4FPYA 1W8TA 3MBWA 4JGZB 3M8LA 1LGCA 2MNGA 2HWF3 4DUWA 1DGRA 2BOIA 4INDA 3VKLA 4AI8A 4LBNA 2AC1A 2P3JA 2ES3A 4ZKTB 5GZEA 2XJVA 5A3OA 5L7OB 4AEKA 5ABJC 1ZZBA 5F5CA 4FAHA 4AI2A 3B9CA 3VHOA 3BPZA 2RR11 3NKGA 2DFBA 2XKPA 4K1YA 5A7WB 4RS5C 3E6BA 4NHYA 5CG9A 2D3SA 1VBB2 3MI8A 3W21A 4HN1A 4MGQA 4JDMA 2ZGTA 4AGGA 5LBEA 1JZ4A 3HAGA 3T2TA 2QQUA 1Y7BA 1XNAA 3I2FA 4WM8B 1UX6A 4NROA 4CUAA 4DMIA 1HB1A 1UYZA 4N43C 3KV4A 4GH4B 4CDQA 5T5PA 4BHPA 4AEMA 4XQWA 4XQDA 1XNKA 1RL3A 2Q1FA 3FFQA 3MGUA 3OUIA 3OGSA 4LOSA 3TRSB 5IVBA 2VNOA 3NNLA 1PO13 3EB7A 1A8DA 5DZEA 5BYNA 4Q8LA 4Y26A 4MGZE 1YC61 4COUA 5CADA 4NPLA 2Y0OA 1PIV3 5GKAC 3PMSA 4CCLA 5DMYA 4DXTA 1FAYA 2HYKA 1SDDB 4TXWA 4CTEA 1WD3A 2ZMLA 5HPOA 1MPXA 2GSYA 1QJFA 4HPKB 2P5BA 2HBUA 2PQQA 4HG6B 4A6SA 3RPQA 5JSRA 2UWCA 4OI2A 4UOJA 2ENRA 1D4M1 1EY2A 2LTNA 1SCRA 2UU8A 3WNLA 1WCSA 3ZN4A 3W5MA 3DYOA 3GZEA 1OD3A 3HT1A 4CP9B 4QPIA 3N9PA 2OT7A 4OZXA 1W8FA 2FDIA 3USSA 2DCTA 4K7JA 5A1AA 3AJYA 4R8HA 2UYBA 3C7EA 1W04A 5IVVA 1Y4WA 3WW2A 2AACA 3DF0A 4EN0A 2XHKA 3WOGA 3T0AA 1SLCA 2P3YA 1C5HA 3JD72 3M1HA 4MXWB 1GWMA 1XQNA 1BMV1 2PYTA 2J42A 4OVEA 3T09A 1UAIA 1XE8A 2JDHA 3K4AA 1CAUB 1HJGA 2W2IA 4OLLA 1YQCA 3L9JT 4LQRA 5BNNA 5FBZA 3IDAA 3TAYA 4J6GA 4HKOA 4AL9A 2A3YA 3P1IA 1XU2A 3NVCA 1CX4A 1QU0A 4E4SA 2WFPA 2RR13 1MQTB 1AYN2 4JRLA 4M01A 4EN8B 1YIFA 4CCMA 2B7YA 3AXDA 4QMAA 3WP6A 1UMZA 2YXSA 1IG0A 4EN6B 3MW2A 5B4XA 5E6HA 3HNYM 1BEV2 3OPWA 1BYHA 3ZYRA 3GNEA 4R4XA 3TYJA 5KHIA 3H7YA 4IESA 1ZBE1 3W58A 3ZSEA 1CONA 4LORA 4YW7A 3WY6A 4AQ2A 1RMU1 2ATFA 5FXZA 5E8AA 1C8M2 4BZ4A 5CIRA 4MUVA 3BI3A 3WDXA 5C5UA 1ULGA 4ZS2A 4YARA 2IXIA 1U12A 2EXJA 2HWE1 1O4YA 4KG8A 4XFIA 4EWDA 5L19A 4JGYB 4KMQA 5LA1A 3MIDA 5GJ6A 2W1WA 2WO7A 4CDXA 4OHVA 2RS32 3LPGA 2VUDA 2I45A 2MEV1 1OF4A 4M00A 4ASLA 4HSLA 1D2SA 2VZQA 3U14A 3LFMA 2HEWF 2JDKA 2YYOA 1O4TA 2YU2A 4Q4Y3 2IXCA 5IWFA 3SHRA 3TWIA 3NAPC 2VW2A 3H9AA 4HXCA 2E9QA 1ASJ1 3FX3A 4P9IA 1H1AA 1WW4A 1UNBA 1UQXA 1W2AX 2ARCA 2IC1A 3OUJA 4XMAA 5I0TA 4YGEA 4QKBA 4JCKA 4BISA 1GICA 3WW3A 4UW6A 5C33A 2DYCA 3N9MA 5FPZA 3VDDB 2O0OA 1LEMA 3ZDVA 3MW4A 2ADEA 4V2VA 1RUF2 1BBT3 2QQWA 3SCHA 1V6OA 3FBMA 4DEVA 5JSOA 2CDPA 1WMEA 1L7LA 2ZGPA 3I3MA 3ZKUA 4AGVA 1XBFA 4GMP1 4XACA 2JDMA 4AI9A 2SLIA 1QJU3 4RA0A 1GSLA 4JKKA 4YVWB 4BQ4A 5A7NA 2XXZA 3CHXA 3LDRA 3LF7A 3LEIA 3J8F2 5AFBA 1PVC2 2HJIA 2VVEA 5GZGA 1MS5A 2F17A 3JUUA 5T5JA 3SNMA 4MOAA 4N53B 1KEXA 1SLAA 1BHGA 1ZM1A 2XVLA 3WNXA 1ULPA 2FCVA 4K8RB 1L7RA 3J7LA 5DAVA 5T54A 3VDDC 4RGGA 3GBGA 2VOTA 5HCHA 2YGMA 5F37A 3IDEA 5LEKA 3AYCA 1RJ8A 2B8MA 5FREA 1VBE3 1GZWA 3MIGA 3AVRA 4RS5A 4NIAA 1RVF3 2NM1A 3WDTA 4EZ4A 4YZ3A 1CJPA 3ZM8A 2ZEYA 2K2SA 1A8MA 3O0WA 5IFPA 4DB5A 3GALA 2WNUC 3F95A 1IPSA 1AYN1 2DWRA 3MF6A 5FZBA 4JQTA 4FXGB 4YVSA 3H8XA 1T6BX 4CP9A 3UJQA 3TEYA 1V00A 3PJQA 4W4ZA 1F2NA 1G9FA 1O8SA 1NA1C 3AMNA 2Q8OA 4JGZC 5ANQA 4Q4Y1 2RS33 2IZWA 2YROA 5SV8A 1FPN1 5JXIA 3UV9A 4R9BA 4EWEA 4LO7A 2X53S 4P00B 3ZO0B 4BU2A 4EQVA 3O1PA 5FYBA 1CQ9A 1RUH1 3J9SA 2ILMA 4AAXA 2ZX3A 3DXUA 2VVDA 1IHMA 1WCQA 3H42B 1Q43A 4P14A 3ZXGA 4JQRA 3VD9A 4UBGA 1YIPA 3CJXA 5A3UA 5K7PA 2A1XA 4HKLA 4P9XA 2XQRA 1COV1 5LRSA 4XBQA 2QDNA 4PLMA 3IKWA 1PO11 4H14A 4KU7A 3S5AA 5KHJA 4JDNA 5D8AB 1HRV1 1RUI1 1BBT2 5FMCA 2WS91 2BNNA 4UFIA 1LRHA 3VKFC 4C1WA 2XQXA 3TEZA 1RUC2 3CIHA 3ZXDA 2O14A 3H8RA 1AR73 1WBLA 1STMA 3IZOA 3QCWA 1QQP3 1QQP1 2B46X 5FP7A 1H6XA 1KRIA 1PIV2 5C9AB 4BIFA 2X5IB 3H3UA 2R071 2OW4A 4XDQA 1DQ2A 1ONAA 1U0AA 3C7FA 2WS92 3POIA 3AX4A 1I5ZA 4RFT0 4XE9A 3DGTA 5K4LA 2WABA 3WNNA 4LK6A 5FUPA 3UT0A 1FNYA 4O9EA 5FZ6A 2I74A 2AYHA 3MIFA 5D8AC 1BVVA 4BQ3A 2R49A 2W52A 2P37A 4WVWA 3WG1A 3S5QA 2W3JA 1H6YA 3FFZA 3T1LA 3U1XA 3QH7A 1N1YA 4GB33 4Y5Z0 3UESA 3L2HA 4DY5A 1EYBA 1VBA2 1TMF3 3OEAA 4RSUA 5C4WA 3SKVA 5HV0A 2CGPA 1UOGA 5LW9A 4YLZA 5ANNA 3INAA 1ZA7A 4XF4A 4EN7B 1CZSA 2WRAA 3LWCA 5IT6A 1CIYA 2HWC1 4DRVA 3URFA 4XUPA 1MR5A 5FYMA 2VBBA 2XG3A 2HWD1 3VBUA 1D4M3 3ACIA 1ENRA 1US2A 2NLRA 1FPN3 5FZAA 2XJQA 2IXHA 2WJSA 5IYYA 5JOXA 3WR0A 4RHV3 1W6OB 5GLUA 1LNSA 2QE3A 3KVBA 5CKQA 3TEXA 3ZYIB 2ZS6B 4Y4YA 4DS0A 3KF3A 4P9WA 1JZ6A 2CHHA 1TE1B 4R9AA 4YW6A 1BBT1 4N7UA 1ZX5A 4AQTA 1OOPC 2OS2A 1SZBA 3ZPYA 3WF1A 1COV3 1LHWA 1I9RA 1CPNA 1LOFA 2VR4A 5KXDA 3WDVA 3E97A 3KCYA 3N36A 4XETA 1UXXX 2QNKA 3I2KA 5F8PA 5FPVA 4Q29A 2GNMA 2EIEA 4AFBA 1CGPA 3N9QA 5FYHA 1UU5A 2H6CA 4RGAA 5FOBB 2WZPP 3MO4A 5KR7A 1GZCA 2DVAA 1F9KA 4BQWA 1JU3A 1XSQA 3RMYA 3R4SA 5C8CC 1Q8OA 2VBPA 4FOQA 5ACA1 2HBTA 1B35B 4W6XA 4QDSA 2WC2A 2RMU3 3WF0A 4NIGA 3N4MA 1OURA 5FV3A 2WT2A 5FWEA 1GZTA 2P2KA 1PNFA 4QPGB 5KXCA 2Z4FA 2WA3A 3HVDA 3CJIA 1RHI1 2ZKNA 3ILRA 4I09A 4XIKA 4JKLA 1K45A 4EN9B 1LECA 2VW1A 3B02A 1HB3A 5FMDA 1LOBA 1YJKA 5JVVA 4AE2A 1QOOA 4CP0A 1YWKA 3MICA 1SLIA 4ZU7A 2WL1A 2GMEA 3D0JA 4LO8A 3PU3A 1LOEA 4MXVA 5BNPC 5FY9A 3ZYGA 5FZOA 4Q4W1 1MVQA 5IVEA 3ZFFB 3MFCA 3LEMA 1NCRB 2WA4A 5EXOA 5L7OC 2NP0A 3OGGA 3I2DA 2GC0A 3VZNA 4IV3C 3I3DA 2ZAHA 3VBHC 4A7ZA 3NV1A 4RR3C 4XMIA 1IKQA 1UYXA 2WAOA 2XVGA 2RS31 3D3AA 3K75B 4LMFA 4ES8A 3PIJA 4UAPA 5FZLA 2OUHA 3S57A 4XCBA 1HW5A 5F5AA 3OSDA 1VP6A 1WW6A 2E7TA 4XF3A 1GFF2 4ZU5A 5JDBA 4IE5A 1X9TA 3ZIWA 3VD4A 5KHKA 1HIXA 5C8CA 1Y9MA 4LPLA 5BNOC 2OUJA 1HN1A 1OBNA 2BP6A 4AVSA 5H9QA 2R30A 4UW5A 1RUF1 1GQPA 2I2SA 5KC6A 1NQJA 2R1DA 4UF0A 1VAMA 4FFHA 3S30A 4PLNA 4QQHA 1FMD2 2JG9C 1N3OA 3NSTA 2HWF2 5BY5A 4P9YA 2BV4A 1OQEA 1VPHA 3PU8A 1POV3 1ND2B 1QH6A 5JZGB 1RUE1 1PO22 2WZ8A 1UOJA 3THPA 1ZNPA 2LM3A 4YW1A 2IVJA 2G9GA 3DL3A 4GJZA 3A21A 1DCSA 1U5XA 1RITA 1OXCA 4LBQB 2MEV2 2ZZJA 1XOYA 3WDWA 2GZWA 3AZYA 1AVBA 4ISRA 1I3HA 2D6PA 2D7FA 4RD7A 3U4SA 1LGBA 1O3RA 1RMU3 4CCCA 3PNAA 1ZRRA 2QQVA 4X8PA 3RQ0A 2NPIA 3B9IA 1AL21 5EV7A 2ZA9A 1PHMA 4WZCA 4XUTA 5J36A 1QOTA 1W2UA 3VL9A 2PN5A 3NNFA 2Y0IA 3NWKA 3I2HA 3ITQA 4EWAA 3W9AA 2QJVA 3TNPB 3ZYJB 1QF3A 3RRDA 5FLHA 1J1TA 3DN7A 1JYXA 2FZ1A 3UK9A 1V6JA 1NOVA 2WFF1 2X10A 1UKRA 2VC9A 3KQ4B 4RFRB 4XXPA 5C3SA 4HK8A 4DUVA 1DGLA 4CEYA 1H2KA 1ND2C 1QNWA 1NT0A 4Z2WA 1NUKA 5FLIA 3BTZA 1PGL1 1WCDJ 4QXKA 1F31A 3AMPA 1RUD3 1S0BA 2PMWB 3KT1A 4KWKA 4GAZA 2BUKA 2OIIA 3TNQA 3VBRA 2ZGUA 5FP8A 5IHRA 1BMV2 4OFGA 2VOXA 1BK0A 3KCCA 2DBIA 4UI9L 1NLQA 1ST8A 3ELNA 1G7YA 4H3WA 4RR3B 2WSVA 4O65A 1F4AA 2R1BA 5JMOA 3P5BA 5BNQA 2XWJB 5FZ9A 1HB4A 1H9PA 4O7XA 4XJAA 2OX0A 3I3QA 5JIUA 2BFUL 4LE3A 3RWNA 3ORJA 1UZZA 4M3CB 2V5YA 3HMYA 4W8JA 5JLVA 1C1LA 2D98A 5DAQA 5T50A 4DZGA 3KV9A 1QY4A 4PQ9A 2J1EA 2WNOA 4CU6A 1IGOA 2RM21 4QB2A 4QKDA 4FPCA 4XOGA 5EQUA 2LS6A 2V4VA 5JR7B 2P1BA 3LOIA 3OY8A 1PIV1 2YBKA 2OXBA 2VL4A 1LU2A 3DV8A 4NN0A 3S7IA 1VBD2 4LBLA 1O6UA 5FUIA 4AFMA 3GGLA 1NXMA 4FTBA 4FBFA 5K9YA 5C3RA 4HLTA 4A44A 2VE1A 5DUXA 4ARXA 5L9BA 3M3EA 1E5RA 1FV2A 3B94A 3B69A 2W5FA 3FJSA 4JX0A 1XYOA 5BXXA 5G05L 4KH9A 4XAEA 5JPMB 4GALA 1US3A 4XIOA 4QGLA 4N43B 3T2QA 3K51A 1QJX1 2OYZA 4PHZA 4KNCA 3ZSLA 3LSEA 1O4ZA 3WD5A 3NNMA 4Q0QA 5FY5A 1COV2 4P9JA 3D6EA 4SBVA 5IJRA 1Z7S3 3QBQA 1AR71 4F7ZA 3GBFA 1RUF3 3LZZA 2KXLA 4NJ4A 1RUH3 4IE6A 4NOTA 2WLPA 2PHWA 1ULDA 2C26A 4MSVA 1J83A 1DDLA 2W9XA 4Z07A 4OUSA 1QJU1 4ZU4A 3OGVA 2Y64A 5E1RA 1RUJ3 1O5LA 3ZFEB 1WMXA 2HWB3 1H4HA 2R0HA 3HOBA 3VZOA 3H1WA 1VBE1 3KF5A 1ZZ9A 3ETPA 1UYYA 2WZR1 3SCFA 1GV9A 1PK6C 4ZPIA 1NXD1 2LUWA 3JZVA 1W9WA 3E1F1 1WW7A 4XUQA 3ETQA 1SLTA 1AJOA 1S0DA 3OTFA 1OLQA 3LCPA 4IDZA 1NQDA 4CDWB 4QX0A 1VLNA 4D8MA 1KFXL 3KLSA 1NG0A 3MDPA 3WDUA 5LK7B 3WZ1A 1V70A 4GQ7A 3FC0A 5HV4A 5FZHA 5BV6A 3AZWA 1YO8A 1DGWX 1AR93 1YQ6A 2XPJA 4CYDA 1A34A 1SLLA 4AI1A 2EIBA 4PIZA 2FZ2A 1OOPB 1C3HA 2RS12 1YQ8A 1W2NA 2D3PA 3MEPA 3CDZB 2J1TA 3WT3A 1JZ5A 2ZXQA 5FXXA 1KFUL 5FKCA 2IFRA 2J1UA 5FYSA 4MLOA 5CKNA 1GNHA 1PVC1 3TB0A 1QIQA 2V73A 3RYRA 4NVPA 3RNSA 1K42A 2ZEWA 3SH3A 2CL2A 4KGGA 3RSJA 4HETA 4BH9A 3RZLA 3LSDA 2Y6FA 2VQTA 2QQJA 2XL9A 5L36A 2Q4SA 4QWNA 1GZWB 1WA4A 1I6XA 2W08A 3I97A 4QX1A 1Q8VA 3PUAA 5I8TA 3EJKA 1OLME 1POV0 4BB3A 3AP6A 2X5IC 4AAPA 4C8DA 1V9U2 5DDJ2 4B1LA 1HQWA 2A3WA 5KXEA 4GKXA 3O5SA 1Q3EA 2E32A 1KDMA 4E27A 1GQHA 4ZS3A 1ASJ2 2VUJA 2ARBA 1AR83 3I2IA 3WF4A 5F3CA 4LKFA 4R4ZA 5HI0A 4AEDC 4GWMA 2W39A 4D7SA 2Y6HA 3WEZA 4L99A 1WLCA 1GR3A 2VY0A 5FXVA 3BODA 3TBDA 4Q4X3 5F32A 2JD9A 4LKSA 5A3NA 5FIXA 3ZXLA 4AI0A 4CDXB 3OBRA 2HWE3 2PQSA 2A7AA 3AVSA 2FCUA 2J1RA 3VBSC 3GF6A 2PHLA 3T0DA 4UFHA 1EPWA 4JTOA 2DUQA 4WVMA 2HWC3 3AL6A 3ZOIA 5F3EA 3VBRC 2CWMA 1RMU2 2W46A 3OYWA 1H4GA 4K8FA 1LENA 3I2JA 3T3YA 2O1QA 4BQXA 3LKJA 5AFEA 2VMCA 1BEV1 3NNGA 4GB31 3N9LA 2CNAA 3CBNA 3OD0A 4I0AA 1ND2A 3O1OA 2PAEA 2WO1A 4XHXA 1LOFC 4YWAA 2Q8EA 3ZIXA 4IE4A 4AHYA 4D6SA 1UKGA 1ND3C 1WA6X 2JG8C 3H1MA 3Q8AA 4CDUA 5JUVA 1H0BA 4GJYA 4H55A 3CMGA 1PO23 3IIAA 1OMIA 2OPKA 5J96B 4N8MA 4X8NA 3LIHA 1G8WA 4CU9A 4ZXEA 4A3XA 1IS5A 1SCSA 2H6BA 2XJSA 2VPVA 4Q4V2 4RS5B 2WZR3 4FFFA 5DXDA 2AEZA 1W6PA 5FY7A 2B39A 4BLIA 1JYVA 1JYCA 1TEIA 3AKSA 1IZ3A 5DPNA 3SC7X 3OBAA 3JBG3 1GBGA 1QHDA 3VN4A 3BU0A 2PHXA 3JD71 4UXAA 5F6KA 1FV3A 1UW8A 4QU1A 4HANA 3VZLA 3WQ7A 3A23A 2HWD3 2UURA 1IKPA 4N53A 1RUE2 2D6LX 5HXVA 2VTXJ 2ZTNA 3Q8CA 4XXAA 1Z7S1 2D44A 1SBEA 2B45X 2LW8A 4XYXA 1JZ3A 4YVWC 2WT0A 2JG8A 2QTWB 5GLVA 1KXGA 1TME3 2VULA 4MGSA 2PHUA 2UYAA 2WNVA 4NIIA 5IK8A 1MQTC 1QOSA 2E31A 3BOWA 4LITA 1F8VA 3QOPA 1K3IA 5FY8A 3ZYFA 1AL22 4C1XA 4CUCA 1RB8G 1LEDA 4MG2A 2A75A 1N3PA 1R093 2VZUA 3D0SA 3NV2A 3BB6A 2WNVC 4QKNA 1R1A3 1LHNA 4FPJA 1H8TB 4BMEA 5LZ6A 3H3LA 4CXXA 2TUNA 1UY3A 2RM23 5FZEA 2BWCA 2CU5A 2G9ZA 3HN3A 4IGOA 4K20A 2A6XA 1GOHA 1RUG2 1W6QB 1O8PA 1NZIA 2RJKA 4CEWC 3MHZA 4FP3A 1AYM1 4Q2FA 3LPFA 4TLGA 1JOPA 1WUVA 4JGYA 1JYIA 4YZ2A 3OCPA 3AZZA 3BTXA 2LRPA 2V72A 1S0IA 2XBO3 3LIGA 5EJZB 1AYM2 3POWA 1LB2A 1BK1A 3BGAA 3CZUA 1UX7A 2FBEA 2NMNA 2BNOA 1DQ4A 4Y5TA 3ZXAC 3LEGA 3AL5A 1DLCA 4FPFA 4CP1A 1UXZA 2C6SA 1H8TC 4NAMA 2R061 3EMRA 4UYBA 5CB7A 4FXKB 4RGKA 2JDNA 3KWVA 4IL7A 3POYA 4QPWA 5GLWA 4CDQB 5FPUA 1CJDA 1G9DA 1FATA 2VZPA 3T2PA 1POV1 2ZACA 4MZUA 5C7GA 1F4HA 3B01A 5JOWA 2AH2A 3NNJA 3LA3A 3T30A 5GZFA 4R9DA 4XUOA 4OQ8A 4HOOA 1QJZA 1ZRCA 4ES9A 3IBMA 3ZYPA 2XH6A 3VBUB 2XJPA 3T4VA 2DVBA 5BNNB 1ODMA 1UIKA 2W94A 2VQ0A 2X05A 4B3NA 1OFNA 4H2AA 4KL1A 1CAUA 1UN1A 1SPPB 2ZX4A 3B5LB 5JI9A 1REEA 1XRUA 3P6BA 1XNBA 3DCQA 1WLTA 1HB2A 1ZBE2 4Y1XA 5FZKA 5EIYB 1E5IA 2IXLA 2C1FA 3AC0A 3N9OA 4A42A 1ZZ7A 1TG7A 3RZHA 5IVYA 4AVBA 2ZGQA 5A6YA 4YW2A 2J1SA 2IXJA 4YZ4A 5LY2A 3I2OA 2FDGA 1V9U3 5IFTA 1HRV2 1AXKA 1RUI2 4I3GA 4LBMA 5FTTC 1DU3D 4MGYE 2W91A 4PIYA 3NJVA 2D40A 4XHBA 4NIHA 4CXYA 2PFWA 4L2NA 5AVAA 2VZSA 1OKOA 3UKNA 2X5IA 2QQOA 2DFCA 1N47A 1DZQA 1HV0A 2JDAA 2TEPA 4UFJA 4WV8A 4PBPA 2D97A 1G86A 2EICA 5I91A 1YEWA 1YUDA 2Y26A 2JJ6A 1AX0A 3NKTA 2QUOA 3GJAA 4UBHA 4BOWA 2GNBA 1E57A 1JW6A 5D8AA 1ZA4A 2QQMA 2WUHA 4FPOB 3BTAA 4LNVA 1AR61 2RMU1 2VMHA 3JB4C 4GH4A 3MV01 2JG9A 1VBA3 2DVGA 4LXLA 2A6ZA 4ZHNA 1SDWA 5IK7A 1ENQA 3O1VA 3BTYA 4XF0A 4Y22B 5KC5A 4P5YA 4RHV1 4NIDA 1UMHA 1W3VA 3A7QA 5FZ4A 5A1LA 2EA7A 3WVJA 2P6HA 3PMEA 2VNGA 5A7WA 2DF7A 4OULA 1AR91 2VMIA 2ZHMA 3VDAA 1ZRDA 4XJWA 1A3KA 3W59A 1MVEA 1K5MC 2ZHLA 5FO7B 4KGQA 5C5TA 1EAH2 2VOWA 1GNYA 3DUIA 4EROA 4P08A 4Q1PA 3GZAA 1JODA 1VBB3 2BGCA 2LROA 2R16A 4OZOA 4XVHA 1O3TA 2BFUS 1LAJA 2QQIA 3RMXA 3A0KA 2VJXA 5L9RA 4AVVA 2YBSA 1OF3A 1UO9A 4GWIA 5LK5A 1RVF2 1CAWB 4BLJA 2JWPA 1POQA 2L9LA 3OBTA 2AR6A 4CE8A 4QD2A 4G9SB 3C7OA 3POSA 4FCAA 1AL0G 1QJU2 1GWKA 1JXNA 5TSWA 1NA1A 1H8VA 3WQBA 3FLTA 1MS4A 3AK0A 3CL1A 4H7MA 3S6PA 2QQKA 1DZTA 4XILA 4W6YA 4BE3A 1NLSA 2SBAA 1X33A 2WNUA 3WCSA 3USUA 2CV6A 5HCAA 2FDKA 2EXHA 1QJX3 1QXPA 3LE0A 4CDWC 1JH5A 5DAWA 3WV6A 4QAWA 1RUE3 3U11A 4CDUC 4DOUA 4RYDA 3RGBA 1M4WA 5T52A 4EV0A 2GMMA 3IMMA 2ET1A 3FLRA 5FYZA 3OF1A 5FPXA 4L9BA 1R1A2 3AP7A 5DUVA 1PO12 2XKOA 3ZFGB 3V0AA 4I0WB 2A73B 2W1QA 5C8WA 5DABA 3V64A 4RQPA 1HQLA 3FL7A 2P3KA 5F9TA 1N1VA 5A6XA 3AKTA 5BNOB 1VIWB 4NMIA 5T5OA 1P8JA 4NWVA 1C1FA 5CFDB 3GYDA 3Q9OA 4Q5OA 4Y1UA 1GP5A 2ARXA 1YQ2A 1IPJA 2WNEA 4PDWB 3FE5A 4DY3A 3O0VA 3RVHA 5K0UB 1H8TA 2C4XA 2EIGA 3LEKA 4IUGA 2WINB 5FMOS 2ZHKA 5BUVA 4HT1T 2GP3A 2O8OA 1YFXA 4S2FA 1IQDC 5B2GB 1D7PM 1LOAA 4JC1A 2HYXA 3VKMA 4BPZA 1GANA 4IV3B 3ES1A 3WG2A 3WX5A 1EV12 3FHQA 2BWAA 3M3OA 5C4WC 3AKPA 3QACA 4COYA 1ULOA 3R0RA 1W9FA 1WGPA 4XW3A 3P3PA 3IPVA 3K48A 3DECA 5J1XA 2JG8B 2QDRA 4Q4V1 4XFAA 1OLRA 2OQ6A 4AWDA 5FQ0B 1AXYA 2WFF3 3AKRA 4EE2A 5HBAA 1ULFA 4EJRA 4AHZA 4M3CA 4OHXA 4Y1ZA 1BQPA 4WM7B 5FFOC 3GXUA 2NMOA 1U5YA 1ND3A 3LAGA 3ATGA 1ZBA1 4LHSA 3W20A 1VMJA 3RZKA 1C28A 4DINB 3WHTA 1DZRA 1XU1A 1TME2 3ZSKA 1AHSA 4JAAA 1R1ZA 4I30A 2VU9A 4PCRA 4X6RB 5JR2A 4C90A 1QJY1 5FYCA 3UGFA 4E4DX 2VNRA 1D4VB 1W6MB 1R083 4XURA 4U36A 4CA9A 3V0BA 1YI9A 4FTEA 5FZMA 1XNTA 2Z2SB 2DBNA 1AF9A 2ORZA 1XXNA 2JKXA 2ZGKA 3ACGA 1JI6A 1JZ2A 1YRZA 3QLQA 2G1MA 3OPZA 5HCFA 2VECA 1WLDA 3KM5A 5FP4A 2RDSA 3I4IA 3WP4A 4D6QA 4NRPA 2ZMNA 4QGNA 1PK6A 3BOPA 5CFCA 4GMP3 3Q8EA 5A32A 1VB4A 4ATFA 3OYWB 1IS6A 5A3WA 1C57A 2J7MA 3VV1A 4B8EA 2ID4A 1SBFA 1H1MA 3VBSB 4BQ1A 1H2LA 2YG0A 3TN91 5JSPA 1REDA 5FPLA 2F4PA 2YPJA 1KS4A 3MFAA 5FRAA 4FOWA 1LKNA 2RV9A 4Z82A 4A45A 2E51A 1JUIA 3M3QA 3VBFB 3KD4A 2VNVA 3ILFA 1QJY2 2ZABA 3POBA 5SV5A 2HKXA 4QPGC 2RS51 2VOVA 2ERFA 3U78A 5ERLA 4LA2A 1D2QA 2GC2A 3AYDA 4JTNA 4OI4A 3C7HA 4XAAA 1D4M2 1BJQA 5JPNB 5KWRA 5LA0A 5F5IA 1OH4A 3SKJE 3VBHA 4XZUG 4PDWC 3IB3A 4HL0A 1APNA 2UY8A 4XTPA 3ACHA 3I8TA 1HRI3 2J22A 2P4EA 2GP5A 3I59A 4IV1B 5IVFA 2ZKLA 4Z1VA 2GH2A 1W2OA 4I3PA 4YGDA 2PXJA 1NAEA 2W95A 4S2GA 4Z8BA 3F2ZA 1VBC2 1OA2A 4M0HA 1U5ZA 1GMMA 1CIWA 1W6MA 3L2YA 4YFWA 1ZBE3 3ME2A 5L7OA 2HWB1 3RDIA 2RDQA 5FO8B 3VZJA 2BVBA 3K4ZA 3FLPA 5FZCA 2BYVE 1PGW1 5GZDA 1JTZX 1MEC2 1G9BA 1WMDA 1FOD2 1PMIA 4XUNA 2QZ2A 3KVAA 1CAXA 1RHI2 3MIEA 2BDRA 1ND3B 1PZ7A 4M4RA 3U10A 2JB4A 1HN0A 2BNMA 5FO9B 4R9CA 3ZLIA 2C9AA 1PGSA 3C7GA 3FUQA 4NO4A 1EUUA 4KBBA 2R6QA 5J48A 5DDJ1 4E2GA 4CU7A 3VBOB 4H7LA 5GLZA 4DPNA 4URAA 5FJKA 3J7MA 3LDBA 4LEJA 4DXZA 1ULCA 4TWTA 1ZVFA 2Z5WA 4YPJA 1VB2A 2FMDA 3IAQA 2B5HA 3B3QE 5FUNA 2EAKA 4QM8A 3M3CA 2FCTA 2N7GA 2VBDA 1EPZA 2YV8A 1WZXA 1W06A 1KITA 5FDBA 1DLLA 1ZBA2 2VUCA 3POJA 2KM2A 1GZ9A 4LKEA 5T55A 1NCQC 3WCRA 3WQ0A 4YGBA 2AENA 5L9VA 2OKXA 1VR3A 1W8WA 4FPGA 4QPGA 3UNPA 4LO6B 1Y3TA 2BBAA 5CG8A 3AJZA 4QHOA 2Y60A 4QXHA 4Q27A 1F35A 1UU4A 2DV9A 4I01A 4GXLA 4IEQA 3ZN5A 2GDFA 2IXKA 4Q0UA 3ZN6B 3AXEA 2JE9A 4NHMA 4Q4W2 3BPSA 1AR92
chains in the Genus database with same CATH topology
5DAPA 4XABA 3DKQA 3GJBA 5L9RA 5A3UA 2G1MA 2A1XA 4XCAA 4IW3A 5DAQA 2RDSA 4Y5TA 4NAOA 3BVCA 5IATA 3OBZA 3PL0A 5EQUA 5M0TA 3EMRA 5IAXA 2Y34A 5C5UA 3NNJA 2FCUA 5L9BA 4UWDA 4BQYA 4XCBA 5DAWA 4MHUA 4NHXA 5ERLA 4Y5SA 5LBBA 2RG4A 4BQXA 4XAAA 3NNMA 3KT4A 5EPAA 3OUJA 4MHRA 4NHYA 3W21A 5LBEA 4JZRA 4NMIA 5HV0A 2V4AA 4Q5OA 4XACA 3MGUA 3OUIA 3OUHA 2RDQA 3NNLA 4ZPIA 4NHKA 5DAXA 2OPWA 4KBZA 2G19A 2JIGA 3GJAA 2RDNA 5HV4A 3HQUA 5LASA 2FCVA 3NNFA 5DAVA 2RDRA 3ITQA 2HBUA 5IAVA 4NHLA 3GZEA 5LBCA 5LATA 2JIJA 2FCTA 2Y33A 5LBFA 4BQWA 3KT7A 5L9VA 5LA9A 3W20A 3KT1A 2HBTA 4ZONA 3HQRA 4J25A 5C5TA 4XC9A 5LB6A 4NHMA 5EP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAP A;  4XAB A;  3DKQ A;  3GJB A;  5L9R A;  5A3U A;  2G1M A;  2A1X A;  4XCA A;  4IW3 A;  5DAQ A;  2RDS A;  4Y5T A;  4NAO A;  3BVC A;  5IAT A;  3OBZ A;  3PL0 A;  5EQU A;  5M0T A;  3EMR A;  5IAX A;  2Y34 A;  5C5U A;  3NNJ A;  2FCU A;  5L9B A;  4UWD A;  4BQY A;  4XCB A;  5DAW A;  4MHU A;  4NHX A;  5ERL A;  4Y5S A;  5LBB A;  2RG4 A;  4BQX A;  4XAA A;  3NNM A;  3KT4 A;  5EPA A;  3OUJ A;  4MHR A;  4NHY A;  3W21 A;  5LBE A;  4JZR A;  4NMI A;  5HV0 A;  2V4A A;  4Q5O A;  4XAC A;  3MGU A;  3OUI A;  3OUH A;  2RDQ A;  3NNL A;  4ZPI A;  4NHK A;  5DAX A;  2OPW A;  4KBZ A;  2G19 A;  2JIG A;  3GJA A;  2RDN A;  5HV4 A;  3HQU A;  5LAS A;  2FCV A;  3NNF A;  5DAV A;  2RDR A;  3ITQ A;  2HBU A;  5IAV A;  4NHL A;  3GZE A;  5LBC A;  5LAT A;  2JIJ A;  2FCT A;  2Y33 A;  5LBF A;  4BQW A;  3KT7 A;  5L9V A;  5LA9 A;  3W20 A;  3KT1 A;  2HBT A;  4ZON A;  3HQR A;  4J25 A;  5C5T A;  4XC9 A;  5LB6 A;  4NHM A;  5EP9 A; 
#chains in the Genus database with same CATH topology
 2V5D A;  3GJB A;  4COZ A;  5CYY A;  1WBF A;  4ZZ5 A;  1KD7 A;  2HWD 2;  3ZFF C;  4RL7 A;  5FY1 A;  3MW3 A;  4IW3 A;  2RR1 2;  1SG3 A;  1A6C A;  4K1Z A;  1DHK B;  4XJ9 A;  2FDJ A;  1YFY A;  1MZ6 A;  2Q0A A;  3H3Z A;  2Q8C A;  1EAH 3;  2Q5T A;  4Q1R A;  3PUI A;  4N43 A;  4N53 C;  2FDH A;  1RVF 1;  3VZM A;  1B35 C;  1GNZ A;  2X8K A;  3UL2 A;  1GUI A;  1W6N A;  4XF9 A;  3DYM A;  2ZGO A;  5ACA 2;  4B4Q A;  1IG3 A;  2VZ3 A;  1PZ8 A;  2EAL A;  3AZV A;  4M0N A;  1X7N A;  1W6O A;  4FQZ A;  1RTV A;  5C71 A;  3CU7 A;  1W28 A;  4G4F A;  2HLE A;  1J1L A;  3DPR A;  4GKY A;  1CWP A;  2YMZ A;  3OY8 B;  4AEJ A;  3KS7 A;  2BJS A;  3AYA A;  3CJI C;  3CF6 E;  5CBL A;  4FPH A;  1QKQ A;  4BWO A;  4MV2 A;  2DU0 A;  1AZD A;  4F8A A;  2QQP A;  1XC6 A;  2EID A;  3IDC B;  2ZOE B;  2YC4 A;  1ASJ 3;  1OUS A;  3H50 A;  2R04 1;  3KT4 A;  2WYS A;  1LOC A;  4MHR A;  1HRV 3;  1RUI 3;  4AED A;  3NJZ A;  5LRR A;  5B4N A;  3H0O A;  2EF6 A;  3NAP B;  5FZD A;  2WFF 2;  1CAX B;  4BQ2 A;  1W6N B;  3AFG A;  4RR3 A;  4QDR A;  2VO5 A;  2TNF A;  3LGR A;  2RMU 2;  2VZR A;  1QH7 A;  5CFC C;  1V6K A;  3WF2 A;  4I2O A;  2VD7 A;  5AVP A;  1F15 A;  4D7Y A;  3A0N A;  5F6L B;  3C3V A;  5BNP A;  1RC6 A;  1YHF A;  1UZ0 A;  3BKZ A;  1RXG A;  2XJU A;  2B4K A;  4LO5 B;  1OVS A;  1JYW A;  2G4I A;  3KCX A;  4R52 A;  2R32 A;  3KB5 A;  5FY0 A;  1GP6 A;  2CYF A;  4ORF A;  4Q0P A;  4Z92 B;  4IV1 A;  4LHN A;  1GLH A;  4CEY B;  3E5U A;  1RXF A;  3ILN A;  1FPN 2;  4A4A A;  1WW5 A;  3I2G A;  2YGL A;  4ATE A;  1NCQ B;  2BVV A;  3LA7 A;  5LAS A;  5T5L A;  3GZT B;  4LR4 A;  3NV3 A;  4DUX A;  3ES4 A;  2JG9 B;  1VE0 A;  5IAV A;  3LOB A;  3R4D B;  4XZP A;  4IE7 A;  3OJB A;  1EAH 1;  4DNY A;  1PX3 A;  2A70 A;  3H8O A;  1XJA A;  5LAT A;  5GZC A;  3BIE A;  3WP3 A;  4KWJ A;  4LK7 A;  2HWF 1;  5I0U A;  3X29 B;  2TBV A;  1UZV A;  2H0V A;  5ABJ A;  2CY6 A;  4XFF A;  4E8C A;  4XFB A;  1HDK A;  3WUC A;  1RUG 1;  2D6M A;  2A6Y A;  4LA3 A;  5JMC A;  4CEW A;  3J7H A;  2W47 A;  5KBF A;  2GC1 A;  2YC0 A;  4GUL A;  3MYX A;  4HN0 A;  4KQ7 A;  1GOF A;  1PK6 B;  1QDO A;  2NZ9 A;  3K77 A;  3HN1 A;  4MX3 A;  2WKK A;  3D82 A;  4RN5 A;  3VB9 A;  2PAK A;  1W0P A;  4AW7 A;  4KWU A;  4JV4 A;  2BEO A;  1HLC A;  1KS5 A;  2YDE A;  3PUS A;  5EP9 A;  2B42 B;  4YVS B;  4IEX A;  1CZV A;  3WLU A;  3FHA A;  4QQO A;  3MIB A;  4FFG A;  5A6Z A;  3DEM A;  5A7O A;  4A3Z A;  3U4X A;  2IUW A;  1RHI 3;  4XJU A;  4LE4 A;  1YCI A;  4AFA A;  2ZZQ A;  1OFS A;  1W2T A;  1SBD A;  1AL2 3;  5C70 A;  4NAO A;  4AZZ A;  1KGY A;  3I3B A;  3PIG A;  3O1T A;  2E26 A;  1SPP A;  2UWA A;  2Y34 A;  2ORX A;  1UPS A;  2VZV A;  1AXZ A;  2C5D A;  4GWN A;  2PA7 A;  3ZPO A;  4DFS A;  1UY0 A;  3WF3 A;  3FZ3 A;  2LAL A;  4LUL A;  4FFI A;  1PO2 1;  2B9V A;  4LO4 B;  1FOD 1;  1FOD 3;  1XE0 A;  2WBK A;  3VBH B;  1WMF A;  1DYO A;  2BGO A;  3LD8 A;  2V09 A;  1CR7 A;  1NKG A;  1SHW B;  4IET A;  3Q8B A;  4O9G A;  4URT A;  4YVW A;  3RS6 A;  4B7K A;  1E5S A;  3RJR A;  3RYP A;  4B7E A;  4Z2A A;  3POE A;  2YC2 A;  1NCR A;  1TQ5 A;  3AMM A;  1JS9 A;  2HWB 2;  2WDB A;  1IQA A;  4NHX A;  4P5H A;  3ABZ A;  1AR8 2;  2DUP A;  5EPA A;  2HH9 A;  5AC9 1;  1F5F A;  4YM1 A;  4Q8K A;  5CFD C;  2WWU A;  4CRQ A;  4C91 A;  4YZ5 A;  2D6K A;  5FPB A;  3VBS A;  3ZKY A;  5K8S A;  2DCJ A;  4Y20 A;  3T2O A;  1O59 A;  1H30 A;  2ZGS A;  4QX5 A;  4O61 A;  3SQO A;  1BKZ A;  1ZRF A;  3MIH A;  1FMD 3;  3CQO A;  2F6B A;  1RUD 1;  4XJ8 A;  4TSV A;  2GN3 A;  5FP3 A;  1MS0 A;  1W9S A;  2DCK A;  1FI2 A;  4GZ9 A;  4L8Q A;  3RYK A;  4JHZ A;  3K3O A;  4XBL A;  5C6C A;  5IVJ A;  4FO9 A;  4AQS A;  2XLA A;  5HCB A;  2QCS B;  4AF9 A;  4A2U A;  2C9K A;  1VAV A;  4TTG A;  1WCK A;  4L11 A;  4CDQ C;  2WQZ C;  4OCT A;  2XUM A;  2G19 A;  3WG4 A;  4RQP B;  4JGY C;  3ON7 A;  1LUL A;  2JB8 A;  4Q4W 3;  5DG2 A;  4YM3 A;  4BIO A;  5JXG A;  3HQU A;  1LR5 A;  2JE8 A;  1OSG A;  1MS3 A;  2FMY A;  2E33 A;  2XML A;  4HK9 A;  5FCC A;  2GAU A;  4Q4X 1;  5CVR A;  5FMB A;  2JDY A;  4FP2 A;  4NHL A;  1CES A;  4E4Z A;  3JU9 A;  5F2W A;  4CPB D;  3B93 A;  4EYU A;  3WHU A;  5IK5 A;  1VBA 1;  2ETE A;  3LQC A;  4CPB A;  3CO2 A;  4Y24 A;  4GWJ A;  2FQP A;  1V6M A;  1NY7 2;  1ZBA 3;  2RJ2 A;  3AMH A;  3SIT A;  4OMC A;  4CDX C;  4LTA A;  1LJ7 A;  5DQ0 A;  4CUB A;  3POF A;  1W8O A;  1PVC 3;  3CKH A;  3USU B;  2Q1M A;  2VMD A;  4AXO A;  3KT7 A;  5E89 A;  1G9A A;  4NRM A;  1UPI A;  1JU4 A;  5FBJ A;  3V65 A;  5FJH A;  5ACA 3;  3N7K A;  4IGQ A;  3O1S A;  2I07 B;  2PEL A;  4I0B A;  1NCR C;  3IPV B;  2GH8 A;  2VGD A;  4JRA A;  4QXB A;  3RFR A;  1X8E A;  3O7O A;  4YW5 A;  1OA4 A;  2WAA A;  3JXS A;  2BBV A;  5JIA A;  5LWB A;  4XAB A;  5FZI A;  3M4F A;  1DQ1 A;  3MV1 1;  3M7A A;  2QZ3 A;  1OD5 A;  5JWP A;  2ADD A;  2VXR A;  1K12 A;  1OVP A;  2VCC A;  3ST7 A;  1QJE A;  1EP0 A;  5C3P A;  3LDK A;  3B7M A;  3OOX A;  1GKB A;  2RS1 1;  4E2S A;  3QD6 A;  4W65 A;  3SIS A;  4QHZ A;  1BCX A;  4KI5 M;  5A7Q A;  4YYO A;  4COW A;  2A6W A;  1S0F A;  1ZZ8 A;  1FXZ A;  1HJF A;  3VDB A;  1PMH X;  1SQ4 A;  4OUM A;  2YBP A;  4G3Y C;  4LUM A;  5EZW A;  1AUY A;  4IEP A;  4ONU A;  5GM0 A;  1AYN 3;  4V1P A;  4WVM B;  1K5M A;  5FP9 A;  4D69 A;  4UWD A;  5IVC A;  1RUH 2;  4BQY A;  3FWE A;  3BCW A;  3P3N A;  5FZ8 A;  1JHJ A;  1RUG 3;  4BYY A;  1VBD 3;  1ULE A;  4C0H A;  1QMJ A;  1ZYB A;  1YFU A;  4IEO A;  4LIV A;  2WQ4 A;  5DG1 A;  3V0A B;  1UF2 C;  3B00 A;  3OGR A;  3R4U A;  2DVF A;  4YW4 A;  4LUK A;  5FK8 A;  3SH5 A;  3R6S A;  4FPL A;  3GZU C;  3K2O A;  2XLF A;  4OI1 A;  1V6L A;  4Q0S A;  1X8M A;  1JBC A;  1VRH 2;  4B29 A;  1AYM 3;  1UL9 A;  3GHM A;  3IMN A;  2D6N A;  4CZS A;  4OI0 A;  2ZX1 A;  3GCW A;  3T08 A;  2WNU B;  2DTY A;  1QXJ A;  2RHP A;  1R08 2;  3KHB A;  5BPX A;  3THC A;  1AR7 2;  1UZY A;  2XBO 1;  1RIR A;  2XJT A;  1DYK A;  2EXI A;  1MZE A;  1HXS 1;  3HIF A;  3IDB B;  4KWL A;  3HPN A;  5LEJ A;  1NA1 B;  1MEC 3;  2WN2 A;  4WVV A;  2FHR A;  1XPW A;  1L7Q A;  2ZX2 A;  5FZ3 A;  4XPV A;  5H9R A;  1CD3 G;  2DCZ A;  3AP4 A;  4XTM A;  4LLO A;  3KMH A;  3APB A;  3JD7 3;  2PHF A;  4FTS A;  1O91 A;  5GLT A;  4YFZ A;  4MVT A;  1DQ6 A;  4E9K A;  3NMB A;  1K5J A;  4JGZ A;  2C0Z A;  3THD A;  3RZZ A;  2W1U A;  3NQH A;  1JZ7 A;  3ZFE C;  4B4R A;  1BZW A;  2PLV 1;  3BAL A;  2ZEX A;  1ZRI A;  3MLJ A;  2JDZ A;  3EHK A;  4FSJ A;  3IM0 A;  2VCM A;  1IS3 A;  4ZY9 A;  4Q4X 2;  2RM2 2;  4NPM A;  2Z79 A;  2C24 A;  2YB7 A;  4TLF A;  4Q4Y 2;  4BXF A;  3AKQ A;  5LBC A;  1Y9G A;  1PZ9 A;  1OLM A;  1SMV A;  2Y38 A;  3FN9 A;  5C3O A;  4GA9 A;  3J8F 3;  1BEV 3;  2GN7 A;  2CSG A;  3THT A;  4EZH A;  1LHV A;  1KDK A;  2HEY F;  3HNB M;  4Y22 A;  2DU1 A;  2Y33 A;  4CXW A;  4P02 B;  4CDW A;  1G9C A;  5LA9 A;  1AX2 A;  1JYN A;  2A3X A;  3GM8 A;  4CCO A;  2ZGR A;  3HNM A;  1PGW 2;  3UKV A;  2GND A;  1S4C A;  2E53 A;  1J3P A;  1ODN A;  1VBC 3;  4FAG A;  2XOM A;  4UT5 A;  4XFH A;  3BYW A;  5I8Y A;  1ACC A;  4M4P A;  5LB6 A;  4AYU A;  4X6Q B;  2BGP A;  3OD4 A;  2D43 A;  3VDD A;  1M06 G;  2HWE 2;  2E6V A;  2WO3 A;  2YHJ A;  5FZ0 A;  1GQG A;  2Y6J A;  3KGZ A;  4AHW A;  1PM7 A;  2EXK A;  4IQP A;  4LT5 A;  4RHV 2;  2FDF A;  4XCA A;  2CAV A;  4PF5 A;  4ZZ8 A;  1BLZ A;  1W03 A;  3JQX A;  5DDJ 3;  1Y43 B;  1UCX A;  5EJ1 B;  3VD3 A;  3GDB A;  2D3R A;  1VRH 1;  2PLV 3;  4KG0 A;  5IAT A;  3OBZ A;  1RJ7 A;  3G7D A;  2W92 A;  5CIS A;  5CA6 A;  4TZD A;  3SMH A;  1VBE 2;  2ZGM A;  1XSR A;  4PJY A;  1O5U A;  1KJR A;  2WWS A;  3ASI A;  1YYN A;  3ZMO A;  3HBK A;  3OG2 A;  4HON A;  4Y20 B;  5T3N A;  2H0B A;  1LES A;  5FZ7 A;  1J84 A;  2BW8 A;  5F39 A;  1XYP A;  3KV5 A;  1MEC 1;  4LKD A;  4K6B A;  1B09 A;  1CPM A;  3TN9 2;  3MPP G;  4GD4 A;  4BXS V;  5HXM A;  2BER A;  2P6C A;  2WNV B;  5A80 A;  3TEW A;  2D6O X;  3WUD A;  4FI9 A;  1UD1 A;  2WYF A;  5LBB A;  4Y5S A;  2VM9 A;  2RG4 A;  4MGK E;  2VMG A;  3IAP A;  2JEM A;  5C3Q A;  4XDP A;  1O3S A;  2PAM A;  3HJR A;  5EYX A;  1H2M A;  2YFZ A;  3RG0 A;  3VKO A;  1CX1 A;  1F5J A;  5FLJ A;  1DIW A;  2P34 A;  1CVN A;  1XYN A;  1YQ5 A;  2JD4 A;  4S2D A;  4CCD A;  3ALQ A;  4WVZ A;  4PLO A;  1MS8 A;  1S0G A;  1YFW A;  3ZVX A;  3BU7 A;  4Y1Y A;  4JZR A;  2MHF A;  1UIJ A;  4P9G A;  4B4P A;  1PVX A;  2RS5 3;  1DQ5 A;  4L0P A;  4DXR A;  3HT2 A;  3FHI B;  4AR2 A;  4LOT A;  1VBD 1;  3VDC A;  1C8M 1;  1X9P A;  1UY2 A;  2WWJ A;  1NE4 A;  3HWJ A;  4MGT A;  5A33 B;  4PF1 A;  4JVA A;  3PDQ A;  3VHN A;  1PNG A;  2HEV F;  1QJY 3;  5F3I A;  1WD4 A;  4D0Q A;  1LHU A;  4QDQ A;  1RIN A;  4PQQ A;  4NRQ A;  5FPA A;  1J58 A;  3PVB B;  1S0C A;  1HV1 A;  3ZYH A;  3JBG 2;  4LBO A;  4WM8 C;  3E6D A;  1JHN A;  1ZZ6 A;  4FQ4 A;  1W6Q A;  1NY7 1;  4QPI B;  1SFY A;  4CU8 A;  4QX8 A;  4DEQ A;  1S2B A;  2RDR A;  5JCT A;  4UW4 A;  1JN2 P;  3AP9 A;  3LB9 A;  3U37 A;  5I0D A;  1BXH A;  1N1T A;  4HPK A;  1IOA A;  1I5P A;  2G9F A;  1VAL A;  2DDU A;  3VHP A;  4C0B A;  3ZMN A;  4ASM B;  5EFU A;  3ZXE A;  4AFD A;  3O0X A;  3SLI A;  1W9T A;  3WNK A;  2CGO A;  1SAC A;  5ABJ B;  5I0R A;  4AVT A;  4QKF A;  5BNN C;  1DP0 A;  2A5Z A;  3A4U A;  3VLB B;  2A71 A;  4GIQ A;  2R06 3;  2CDO A;  1C4R A;  3O1R A;  5A6Q A;  4CP2 A;  5CKM A;  1TME 1;  3VUO A;  1QNY A;  5EYY A;  3KGL A;  3TN9 3;  1QGL A;  3HEI A;  2QQL A;  2Q1Z B;  4WM8 A;  4BQ5 A;  1SFN A;  4KU8 A;  2VH9 A;  3E6C C;  2WT1 A;  5J3U A;  5DAP A;  4BK5 A;  1TZO A;  1Y9Q A;  2WII B;  4NWW A;  1A78 A;  5IUQ A;  3LFI A;  4AVC A;  4F3J A;  2VUA A;  2AUY A;  4XFC A;  3U07 A;  4CCK A;  5EWS A;  1X50 A;  4AK3 A;  1C8N A;  2XWB B;  3MZH A;  3PTY A;  3UGH A;  3IWZ A;  3M70 A;  5AC9 2;  2OZ6 A;  4HVR A;  2D93 A;  4IEW A;  4ISQ A;  1W39 A;  2BRT A;  1IS4 A;  2VCA A;  3CZJ A;  3PL0 A;  2ZBJ A;  3PUH A;  3ENR A;  4LBK A;  2K46 A;  1W6P B;  1R1A 1;  3H1Y A;  3POG A;  4NPR A;  3VBU C;  5M0T A;  2XBO 2;  1GOG A;  3VD5 A;  2ZCW A;  1UOF A;  1XB9 A;  1TMF 2;  1FX5 A;  1R08 1;  2EAA A;  3SCG A;  1XE7 A;  2WN3 A;  5CU1 A;  4UFL A;  5FYT A;  1XND A;  3NJX A;  2VQA A;  4TN7 A;  4CDU B;  2W87 A;  1NE6 A;  2P3I A;  3LA2 A;  3GBW A;  2KD7 A;  5FZG A;  4SLI A;  4QQL A;  4YVS C;  1RYY A;  4LBQ D;  1ENS A;  2FD8 A;  5ISL A;  3PVO A;  4BJ0 A;  1FMD 1;  1W9Y A;  2ZX0 A;  3I7D A;  5DUW A;  4FPK A;  1VRH 3;  3RI9 A;  1OOP A;  1D0G A;  1DFQ A;  4YRD A;  3I49 A;  4WBB A;  3OEB A;  2XVK A;  2D5H A;  2R07 3;  5FYY A;  5H9P A;  1SEF A;  1NX9 A;  5KXB A;  1W8N A;  3PJY A;  3NJY A;  1VJ2 A;  3HD8 B;  4K9S A;  3UET A;  4IER A;  1N3Q A;  5CEH A;  5E16 A;  4ET7 A;  4YSF A;  1UY4 A;  1WWY A;  1OPO A;  1YLL A;  3FBY A;  4OYU A;  1FT9 A;  3FMG A;  3III A;  2Z42 A;  2AEY A;  2BZD A;  3CJI B;  4IEU A;  4IE0 A;  4CEY C;  5F1R A;  3BN6 A;  3VL8 A;  2VMF A;  4Y4R A;  5DN2 A;  5FZ1 A;  1T2X A;  3J7N A;  3ZFE A;  3OUH A;  3ROU A;  1JUH A;  4GH4 C;  4XBN A;  4J1X A;  5IK4 A;  4LIU A;  2VAU A;  4K3U A;  3WIN E;  1RGS A;  5FKB A;  3NV4 A;  2KR2 A;  4TYS A;  1B35 A;  4LHL A;  1AX1 A;  2VZT A;  1HKD A;  1K5M B;  1VMF A;  1HRI 1;  3WP5 A;  1HXS 2;  3RZM A;  4PBO A;  3VBF C;  2CTV A;  1W0O A;  4GMP 0;  4UW3 A;  5APA A;  2RDN A;  1OHF A;  1U5I A;  1W90 A;  4F83 A;  2OQ7 A;  3K46 A;  2A6V A;  4OHY A;  3EXU A;  5BNP B;  4YG6 A;  3ZN6 A;  2GC3 A;  4A41 A;  4DRR A;  1WLW A;  3WQ1 A;  1OKQ A;  1AR6 2;  4DXS A;  2YY1 A;  3MLK A;  2YU1 A;  3ACL A;  3WSO A;  5AC9 3;  3KZ4 C;  1VAK A;  4XQ4 A;  2OA2 A;  4NR1 A;  2PHD A;  2PLV 2;  4N90 A;  1CAV B;  2VG9 A;  3I3E A;  4M3C F;  5A3P A;  3RWK X;  3MUZ 1;  4HMZ A;  3NAP A;  3CNA A;  3CLP A;  1DF0 A;  1IPK A;  3N9N A;  2X29 A;  2DUO A;  5JXH A;  4MAD A;  3DPR C;  5F2S A;  5DZG A;  1Q56 A;  1OI6 A;  1V6N A;  1YJL A;  3DXT A;  4A7Y A;  2XHN A;  4QT6 A;  4COV A;  1URX A;  1W8H A;  5EJ3 A;  3FUO A;  3O12 A;  3EO6 A;  4AI3 A;  4XFG A;  4N7I A;  2ET7 A;  2VTX A;  3D8C A;  2VME A;  2GU9 A;  1QQP 2;  4K21 A;  4E8D A;  2QKD A;  5LY1 A;  1HRI 2;  3UJO A;  1NYW A;  1QXR A;  2CWS A;  3DKQ A;  3KSC A;  1PGL 2;  3JQW A;  1R64 A;  3HQX A;  1G6N A;  4AG4 A;  4Q26 A;  1Q5O A;  3WG3 A;  1X36 A;  5A1F A;  1W99 A;  3SEE A;  4YG0 A;  1XNC A;  4P9L A;  1CAV A;  5D1I A;  5DUU A;  3VBO C;  1YNA A;  2R04 2;  3ZXJ A;  4JKM A;  4NUB A;  2IFW A;  1VRB A;  4IGP A;  2O8Q A;  2JDU A;  4JHT A;  5FXW A;  3C8X A;  1YI7 A;  5DZF A;  3ZX7 A;  4B1M A;  3VBR B;  2RS5 2;  5IAX A;  2NQY A;  3M3I A;  3N7L A;  1HQN A;  3R05 A;  4LLF A;  3V56 A;  3VD7 A;  4BK4 A;  4QU2 A;  2HWC 2;  4OQ9 A;  4HVQ A;  5LCW L;  4CCN A;  3O1U A;  4QQP A;  5C9A A;  2QBX A;  3MPB A;  1MS9 A;  5FYI A;  1UY1 A;  4ITC A;  2VQU A;  3M2M A;  3RI8 A;  1FYU A;  2GNT A;  3AP5 A;  3WNP A;  3RJ2 X;  3GHN A;  3WXP A;  4AFC A;  3I59 B;  3J8F 1;  3EQE A;  1W8U A;  3ZR6 A;  5J09 A;  2K0G A;  4N9I A;  3T4H B;  1LTE A;  4IEY A;  1LCL A;  3E5Q A;  1LGN A;  4CCE A;  1GP4 A;  4MHU A;  1MZ5 A;  2R06 2;  1KQR A;  2DVD A;  1OUX A;  2XDV A;  3JB8 A;  4IEZ A;  4K40 A;  1W3X A;  4LBJ A;  4E4H A;  1PMJ X;  2VW0 A;  2R7E B;  4CUG A;  4D7T A;  1S0E A;  3NL1 A;  1QWR A;  2J1A A;  2WLQ A;  4QX2 A;  1AJK A;  3PVE A;  5G04 L;  5A3L A;  5LA2 A;  1PX4 A;  2AGS A;  4XDO A;  4AGR A;  1J3R A;  1TVG A;  1UMI A;  3MF9 A;  3PUQ A;  1GYK A;  1V0A A;  2X09 A;  2Y8K A;  4LHK A;  5J98 B;  2V4A A;  4UFM A;  5L73 A;  2GMP A;  1RUC 1;  3DYP A;  1ZRE A;  1EUT A;  1RUJ 1;  1L3J A;  3ECQ A;  1X82 A;  2ZJC A;  3RZG A;  5A7S A;  4BMB A;  1OC1 A;  3N7M A;  5CFC B;  3VBO A;  2JIC A;  4QM9 A;  4DQA A;  1DBN A;  1UZW A;  5FMO L;  1RUD 2;  4YZ1 A;  3SEP A;  4QPY A;  2XL7 A;  5DAX A;  5GAL A;  1VMH A;  2NYY A;  3EYP A;  4J1W A;  1C5I A;  3T0B A;  1S55 A;  3NRU A;  1LOD A;  4AOC A;  4KBZ A;  1UU6 A;  4V2W A;  5CNA A;  4ZXK A;  2JIG A;  2RE9 A;  3HR9 A;  4FPE A;  1MZF A;  4PI2 A;  4PIX A;  1V6I A;  3MUY 1;  4HSJ A;  4YM2 A;  1TNR A;  4UF0 B;  3BUC A;  3N35 A;  3PTR B;  4FVV A;  4E2Q A;  1RUJ 2;  5I93 A;  1KJL A;  4QB6 A;  2JEN A;  3KV6 A;  2W68 A;  2NN8 A;  4L92 A;  3PVN A;  4XF1 A;  5A7P A;  1EV1 3;  5CAZ A;  5FR3 A;  1O3Q A;  4U2A A;  3KQR A;  2R04 3;  4MYE A;  5EHD A;  1R09 2;  4RQP C;  2W0X A;  4AQ6 A;  1BVP 1;  1JOJ A;  2BOJ A;  3NO8 A;  4S2H A;  1W0N A;  3J26 N;  4HKW A;  4QHB A;  3UYJ A;  4CEW B;  4HBN A;  1DG6 A;  3VKN A;  1LU1 A;  1Z7S 2;  2Y6L A;  3HBZ A;  5FZF A;  1JYT A;  2JXA A;  4BA6 A;  5A70 A;  3D4K A;  3ACF A;  3UKT A;  4Q0V A;  5FYV A;  3Q8F A;  1REF A;  2XON A;  2XJR A;  4OMD A;  4OHZ A;  4BCU A;  4HFS A;  4ZON A;  2VVF A;  3HQR A;  5FQ0 A;  2CGN A;  2ZEZ A;  4FT8 A;  1TMF 1;  1WKY A;  2J1V A;  1NZC A;  2YFU A;  1R09 1;  4Y33 A;  2K9Z A;  3ZXK A;  2RS1 3;  3O14 A;  5I8S A;  5J7M A;  3ZFF A;  2VZ1 A;  1W8Z A;  3JBG 1;  1GU3 A;  3ZYB A;  4BM8 A;  1LOG A;  2JEC A;  1VBC 1;  5F5Q A;  3VBF A;  4IV1 C;  3PLQ A;  3N7J A;  2YPD A;  2YUE A;  2Y6K A;  2VTF A;  4IV3 A;  1Z0H A;  4YG3 A;  2AZ5 A;  4MGI E;  2MPF A;  3IN9 A;  3OPT A;  1W05 A;  4L97 A;  3SXW A;  1OPM A;  1AR8 1;  4QXC A;  2ZPX A;  4BDV B;  4LBQ A;  3VHR A;  4FOV A;  3S7E A;  1JMU B;  4HVO A;  5A32 B;  2B9U A;  2ZGN A;  3VZK A;  1N1S A;  5K0U A;  1E5H A;  1NCQ A;  3I54 A;  3W5N A;  5F7U A;  5A3T A;  1QEX A;  1ENX A;  3QH6 A;  3WNM A;  5JZG A;  3H8U A;  5I0S A;  2ZMK A;  4WZF A;  2D5F A;  1MAC A;  1ALY A;  1H2N A;  1WCU A;  2JX9 A;  4QB1 A;  2BU9 A;  1S2E A;  2JE7 A;  5JOY A;  3K3N A;  5JAX A;  2W1S A;  4CSW A;  5H9S A;  1RUC 3;  4PI0 A;  3WW1 A;  3S0M A;  3ZSJ A;  3KHC A;  2BPA 2;  1PM4 A;  4IEV A;  3V0B B;  3JCI A;  1HXS 3;  2IWG B;  3VGI A;  1O7F A;  1Q8P A;  4QGM A;  1LHO A;  1GWL A;  1NLR A;  4CVU A;  5A33 A;  4WM7 C;  3ZFG A;  5C8C B;  4JDO A;  1OT5 A;  2DCY A;  1RUO A;  3D5O A;  3NW4 A;  2R0F A;  4HZF A;  3PUR A;  2WS9 3;  4QPI C;  4QX3 A;  3AM2 A;  3J4U H;  2XR4 A;  2OZJ A;  5FWJ A;  5E88 A;  4MET A;  1S2K A;  5IW0 A;  5F3G A;  5FYU A;  2PHR A;  4AED B;  2Z69 A;  2JKB A;  2VZO A;  3WW4 A;  4D94 A;  1MS1 A;  1QDC A;  2WZE A;  4WM7 A;  1JOB A;  1VBB 1;  5FAX A;  3ZFG C;  4CCJ A;  4W6W A;  3IT8 A;  1Z78 A;  1MQT A;  5FK7 A;  4ARY A;  4GB3 2;  5A3M A;  2UWB A;  3AZX A;  1Q8Q A;  2QQN A;  4AVA A;  1OA3 A;  2YZ4 A;  2XB6 C;  2E7Q A;  4D6R A;  2R07 2;  3RZJ A;  3T1M A;  4N9H A;  1UOB A;  2WO2 A;  5FZO B;  3DPR B;  1CN1 A;  1CAW A;  1FNZ A;  4NHK A;  5C4W B;  4MXW A;  4A6O A;  5C9A C;  3ZXF A;  2JDP A;  5K0U C;  2OPW A;  5FY4 A;  2RJL A;  1YXW A;  3ZDS A;  3ZR5 A;  5CZK A;  2XLG A;  1T6G C;  1DGW A;  1H1I A;  1S0J A;  5JOZ A;  1TNF A;  2RVA A;  5J37 A;  2XGX A;  4XJZ A;  2F4L A;  2E7A A;  1DQ0 A;  3G6J B;  2Y6G A;  2ZGL A;  4YM0 A;  1D0H A;  1C8M 3;  1J3Q A;  1OH3 A;  2QFE A;  4DIQ A;  1DYP A;  2IVI B;  4PDW A;  1Q8S A;  5JI7 A;  4FOY A;  1S1A A;  5CFD A;  3AMQ A;  2JIJ A;  3OB8 A;  5BNO A;  5D21 A;  1HX6 A;  2XUE A;  5FOJ B;  1J59 A;  1EV1 1;  2ARA A;  1JZ8 A;  2VOK A;  4Y3O A;  1V9U 1;  2DUR A;  2E63 A;  3CEW A;  4I02 A;  5LBF A;  5KHG A;  4YW3 A;  1UYP A;  1SLB A;  1DGR N;  2EVX A;  3AFK A;  1CZT A;  5KHH A;  2CAU A;  3ZSM A;  3UGG A;  3GCX A;  4MH0 E;  4Y1V A;  4NE9 A;  4YGC A;  5D2A A;  2WZR 2;  2DTW A;  3U0Z A;  1AR6 3;  3DKW A;  4J25 A;  1SFP A;  4LJH A;  2UY9 A;  2ZHN A;  2WSU A;  1OQ1 A;  4OUE A;  2PTM A;  4QQ2 A;  4XC9 A;  4XEZ A;  1OQD A;  5JZG C;  3H7J A;  2VCB A;  2ARE A;  2QVS B;  4PT6 A;  3AYE A;  2PHT A;  2WR9 A;  2OVU A;  3N3H A;  3TOJ A;  4D3W A;  5JXJ A;  2VXJ A;  4W50 A;  2GAL A;  3EBR A;  1UWW A;  4OHW A;  3E5X A;  3SH4 A;  2BTV C;  3AB0 A;  2ZAA A;  4UFK A;  3PHM A;  3K4D A;  4ASK A;  2MEV 3;  3A22 A;  3OGJ A;  4IXL A;  1ZZC A;  4YNI A;  2Q8D A;  3BVC A;  2Q30 A;  2WQ8 A;  4AHX A;  3O1M A;  4A7K A;  4DO0 A;  2P17 A;  2KA3 A;  1H9W A;  1QJX 2;  3WDY A;  1I1E A;  3WNO A;  4M3C E;  1RUN A;  4Q4V 3;  3BIW E;  4MO3 M;  3MLL A;  3U75 A;  2BQP A;  3C2U A;  4QX7 A;  4FPY A;  1W8T A;  3MBW A;  4JGZ B;  3M8L A;  1LGC A;  2MNG A;  2HWF 3;  4DUW A;  1DGR A;  2BOI A;  4IND A;  3VKL A;  4AI8 A;  4LBN A;  2AC1 A;  2P3J A;  2ES3 A;  4ZKT B;  5GZE A;  2XJV A;  5A3O A;  5L7O B;  4AEK A;  5ABJ C;  1ZZB A;  5F5C A;  4FAH A;  4AI2 A;  3B9C A;  3VHO A;  3BPZ A;  2RR1 1;  3NKG A;  2DFB A;  2XKP A;  4K1Y A;  5A7W B;  4RS5 C;  3E6B A;  4NHY A;  5CG9 A;  2D3S A;  1VBB 2;  3MI8 A;  3W21 A;  4HN1 A;  4MGQ A;  4JDM A;  2ZGT A;  4AGG A;  5LBE A;  1JZ4 A;  3HAG A;  3T2T A;  2QQU A;  1Y7B A;  1XNA A;  3I2F A;  4WM8 B;  1UX6 A;  4NRO A;  4CUA A;  4DMI A;  1HB1 A;  1UYZ A;  4N43 C;  3KV4 A;  4GH4 B;  4CDQ A;  5T5P A;  4BHP A;  4AEM A;  4XQW A;  4XQD A;  1XNK A;  1RL3 A;  2Q1F A;  3FFQ A;  3MGU A;  3OUI A;  3OGS A;  4LOS A;  3TRS B;  5IVB A;  2VNO A;  3NNL A;  1PO1 3;  3EB7 A;  1A8D A;  5DZE A;  5BYN A;  4Q8L A;  4Y26 A;  4MGZ E;  1YC6 1;  4COU A;  5CAD A;  4NPL A;  2Y0O A;  1PIV 3;  5GKA C;  3PMS A;  4CCL A;  5DMY A;  4DXT A;  1FAY A;  2HYK A;  1SDD B;  4TXW A;  4CTE A;  1WD3 A;  2ZML A;  5HPO A;  1MPX A;  2GSY A;  1QJF A;  4HPK B;  2P5B A;  2HBU A;  2PQQ A;  4HG6 B;  4A6S A;  3RPQ A;  5JSR A;  2UWC A;  4OI2 A;  4UOJ A;  2ENR A;  1D4M 1;  1EY2 A;  2LTN A;  1SCR A;  2UU8 A;  3WNL A;  1WCS A;  3ZN4 A;  3W5M A;  3DYO A;  3GZE A;  1OD3 A;  3HT1 A;  4CP9 B;  4QPI A;  3N9P A;  2OT7 A;  4OZX A;  1W8F A;  2FDI A;  3USS A;  2DCT A;  4K7J A;  5A1A A;  3AJY A;  4R8H A;  2UYB A;  3C7E A;  1W04 A;  5IVV A;  1Y4W A;  3WW2 A;  2AAC A;  3DF0 A;  4EN0 A;  2XHK A;  3WOG A;  3T0A A;  1SLC A;  2P3Y A;  1C5H A;  3JD7 2;  3M1H A;  4MXW B;  1GWM A;  1XQN A;  1BMV 1;  2PYT A;  2J42 A;  4OVE A;  3T09 A;  1UAI A;  1XE8 A;  2JDH A;  3K4A A;  1CAU B;  1HJG A;  2W2I A;  4OLL A;  1YQC A;  3L9J T;  4LQR A;  5BNN A;  5FBZ A;  3IDA A;  3TAY A;  4J6G A;  4HKO A;  4AL9 A;  2A3Y A;  3P1I A;  1XU2 A;  3NVC A;  1CX4 A;  1QU0 A;  4E4S A;  2WFP A;  2RR1 3;  1MQT B;  1AYN 2;  4JRL A;  4M01 A;  4EN8 B;  1YIF A;  4CCM A;  2B7Y A;  3AXD A;  4QMA A;  3WP6 A;  1UMZ A;  2YXS A;  1IG0 A;  4EN6 B;  3MW2 A;  5B4X A;  5E6H A;  3HNY M;  1BEV 2;  3OPW A;  1BYH A;  3ZYR A;  3GNE A;  4R4X A;  3TYJ A;  5KHI A;  3H7Y A;  4IES A;  1ZBE 1;  3W58 A;  3ZSE A;  1CON A;  4LOR A;  4YW7 A;  3WY6 A;  4AQ2 A;  1RMU 1;  2ATF A;  5FXZ A;  5E8A A;  1C8M 2;  4BZ4 A;  5CIR A;  4MUV A;  3BI3 A;  3WDX A;  5C5U A;  1ULG A;  4ZS2 A;  4YAR A;  2IXI A;  1U12 A;  2EXJ A;  2HWE 1;  1O4Y A;  4KG8 A;  4XFI A;  4EWD A;  5L19 A;  4JGY B;  4KMQ A;  5LA1 A;  3MID A;  5GJ6 A;  2W1W A;  2WO7 A;  4CDX A;  4OHV A;  2RS3 2;  3LPG A;  2VUD A;  2I45 A;  2MEV 1;  1OF4 A;  4M00 A;  4ASL A;  4HSL A;  1D2S A;  2VZQ A;  3U14 A;  3LFM A;  2HEW F;  2JDK A;  2YYO A;  1O4T A;  2YU2 A;  4Q4Y 3;  2IXC A;  5IWF A;  3SHR A;  3TWI A;  3NAP C;  2VW2 A;  3H9A A;  4HXC A;  2E9Q A;  1ASJ 1;  3FX3 A;  4P9I A;  1H1A A;  1WW4 A;  1UNB A;  1UQX A;  1W2A X;  2ARC A;  2IC1 A;  3OUJ A;  4XMA A;  5I0T A;  4YGE A;  4QKB A;  4JCK A;  4BIS A;  1GIC A;  3WW3 A;  4UW6 A;  5C33 A;  2DYC A;  3N9M A;  5FPZ A;  3VDD B;  2O0O A;  1LEM A;  3ZDV A;  3MW4 A;  2ADE A;  4V2V A;  1RUF 2;  1BBT 3;  2QQW A;  3SCH A;  1V6O A;  3FBM A;  4DEV A;  5JSO A;  2CDP A;  1WME A;  1L7L A;  2ZGP A;  3I3M A;  3ZKU A;  4AGV A;  1XBF A;  4GMP 1;  4XAC A;  2JDM A;  4AI9 A;  2SLI A;  1QJU 3;  4RA0 A;  1GSL A;  4JKK A;  4YVW B;  4BQ4 A;  5A7N A;  2XXZ A;  3CHX A;  3LDR A;  3LF7 A;  3LEI A;  3J8F 2;  5AFB A;  1PVC 2;  2HJI A;  2VVE A;  5GZG A;  1MS5 A;  2F17 A;  3JUU A;  5T5J A;  3SNM A;  4MOA A;  4N53 B;  1KEX A;  1SLA A;  1BHG A;  1ZM1 A;  2XVL A;  3WNX A;  1ULP A;  2FCV A;  4K8R B;  1L7R A;  3J7L A;  5DAV A;  5T54 A;  3VDD C;  4RGG A;  3GBG A;  2VOT A;  5HCH A;  2YGM A;  5F37 A;  3IDE A;  5LEK A;  3AYC A;  1RJ8 A;  2B8M A;  5FRE A;  1VBE 3;  1GZW A;  3MIG A;  3AVR A;  4RS5 A;  4NIA A;  1RVF 3;  2NM1 A;  3WDT A;  4EZ4 A;  4YZ3 A;  1CJP A;  3ZM8 A;  2ZEY A;  2K2S A;  1A8M A;  3O0W A;  5IFP A;  4DB5 A;  3GAL A;  2WNU C;  3F95 A;  1IPS A;  1AYN 1;  2DWR A;  3MF6 A;  5FZB A;  4JQT A;  4FXG B;  4YVS A;  3H8X A;  1T6B X;  4CP9 A;  3UJQ A;  3TEY A;  1V00 A;  3PJQ A;  4W4Z A;  1F2N A;  1G9F A;  1O8S A;  1NA1 C;  3AMN A;  2Q8O A;  4JGZ C;  5ANQ A;  4Q4Y 1;  2RS3 3;  2IZW A;  2YRO A;  5SV8 A;  1FPN 1;  5JXI A;  3UV9 A;  4R9B A;  4EWE A;  4LO7 A;  2X53 S;  4P00 B;  3ZO0 B;  4BU2 A;  4EQV A;  3O1P A;  5FYB A;  1CQ9 A;  1RUH 1;  3J9S A;  2ILM A;  4AAX A;  2ZX3 A;  3DXU A;  2VVD A;  1IHM A;  1WCQ A;  3H42 B;  1Q43 A;  4P14 A;  3ZXG A;  4JQR A;  3VD9 A;  4UBG A;  1YIP A;  3CJX A;  5A3U A;  5K7P A;  2A1X A;  4HKL A;  4P9X A;  2XQR A;  1COV 1;  5LRS A;  4XBQ A;  2QDN A;  4PLM A;  3IKW A;  1PO1 1;  4H14 A;  4KU7 A;  3S5A A;  5KHJ A;  4JDN A;  5D8A B;  1HRV 1;  1RUI 1;  1BBT 2;  5FMC A;  2WS9 1;  2BNN A;  4UFI A;  1LRH A;  3VKF C;  4C1W A;  2XQX A;  3TEZ A;  1RUC 2;  3CIH A;  3ZXD A;  2O14 A;  3H8R A;  1AR7 3;  1WBL A;  1STM A;  3IZO A;  3QCW A;  1QQP 3;  1QQP 1;  2B46 X;  5FP7 A;  1H6X A;  1KRI A;  1PIV 2;  5C9A B;  4BIF A;  2X5I B;  3H3U A;  2R07 1;  2OW4 A;  4XDQ A;  1DQ2 A;  1ONA A;  1U0A A;  3C7F A;  2WS9 2;  3POI A;  3AX4 A;  1I5Z A;  4RFT 0;  4XE9 A;  3DGT A;  5K4L A;  2WAB A;  3WNN A;  4LK6 A;  5FUP A;  3UT0 A;  1FNY A;  4O9E A;  5FZ6 A;  2I74 A;  2AYH A;  3MIF A;  5D8A C;  1BVV A;  4BQ3 A;  2R49 A;  2W52 A;  2P37 A;  4WVW A;  3WG1 A;  3S5Q A;  2W3J A;  1H6Y A;  3FFZ A;  3T1L A;  3U1X A;  3QH7 A;  1N1Y A;  4GB3 3;  4Y5Z 0;  3UES A;  3L2H A;  4DY5 A;  1EYB A;  1VBA 2;  1TMF 3;  3OEA A;  4RSU A;  5C4W A;  3SKV A;  5HV0 A;  2CGP A;  1UOG A;  5LW9 A;  4YLZ A;  5ANN A;  3INA A;  1ZA7 A;  4XF4 A;  4EN7 B;  1CZS A;  2WRA A;  3LWC A;  5IT6 A;  1CIY A;  2HWC 1;  4DRV A;  3URF A;  4XUP A;  1MR5 A;  5FYM A;  2VBB A;  2XG3 A;  2HWD 1;  3VBU A;  1D4M 3;  3ACI A;  1ENR A;  1US2 A;  2NLR A;  1FPN 3;  5FZA A;  2XJQ A;  2IXH A;  2WJS A;  5IYY A;  5JOX A;  3WR0 A;  4RHV 3;  1W6O B;  5GLU A;  1LNS A;  2QE3 A;  3KVB A;  5CKQ A;  3TEX A;  3ZYI B;  2ZS6 B;  4Y4Y A;  4DS0 A;  3KF3 A;  4P9W A;  1JZ6 A;  2CHH A;  1TE1 B;  4R9A A;  4YW6 A;  1BBT 1;  4N7U A;  1ZX5 A;  4AQT A;  1OOP C;  2OS2 A;  1SZB A;  3ZPY A;  3WF1 A;  1COV 3;  1LHW A;  1I9R A;  1CPN A;  1LOF A;  2VR4 A;  5KXD A;  3WDV A;  3E97 A;  3KCY A;  3N36 A;  4XET A;  1UXX X;  2QNK A;  3I2K A;  5F8P A;  5FPV A;  4Q29 A;  2GNM A;  2EIE A;  4AFB A;  1CGP A;  3N9Q A;  5FYH A;  1UU5 A;  2H6C A;  4RGA A;  5FOB B;  2WZP P;  3MO4 A;  5KR7 A;  1GZC A;  2DVA A;  1F9K A;  4BQW A;  1JU3 A;  1XSQ A;  3RMY A;  3R4S A;  5C8C C;  1Q8O A;  2VBP A;  4FOQ A;  5ACA 1;  2HBT A;  1B35 B;  4W6X A;  4QDS A;  2WC2 A;  2RMU 3;  3WF0 A;  4NIG A;  3N4M A;  1OUR A;  5FV3 A;  2WT2 A;  5FWE A;  1GZT A;  2P2K A;  1PNF A;  4QPG B;  5KXC A;  2Z4F A;  2WA3 A;  3HVD A;  3CJI A;  1RHI 1;  2ZKN A;  3ILR A;  4I09 A;  4XIK A;  4JKL A;  1K45 A;  4EN9 B;  1LEC A;  2VW1 A;  3B02 A;  1HB3 A;  5FMD A;  1LOB A;  1YJK A;  5JVV A;  4AE2 A;  1QOO A;  4CP0 A;  1YWK A;  3MIC A;  1SLI A;  4ZU7 A;  2WL1 A;  2GME A;  3D0J A;  4LO8 A;  3PU3 A;  1LOE A;  4MXV A;  5BNP C;  5FY9 A;  3ZYG A;  5FZO A;  4Q4W 1;  1MVQ A;  5IVE A;  3ZFF B;  3MFC A;  3LEM A;  1NCR B;  2WA4 A;  5EXO A;  5L7O C;  2NP0 A;  3OGG A;  3I2D A;  2GC0 A;  3VZN A;  4IV3 C;  3I3D A;  2ZAH A;  3VBH C;  4A7Z A;  3NV1 A;  4RR3 C;  4XMI A;  1IKQ A;  1UYX A;  2WAO A;  2XVG A;  2RS3 1;  3D3A A;  3K75 B;  4LMF A;  4ES8 A;  3PIJ A;  4UAP A;  5FZL A;  2OUH A;  3S57 A;  4XCB A;  1HW5 A;  5F5A A;  3OSD A;  1VP6 A;  1WW6 A;  2E7T A;  4XF3 A;  1GFF 2;  4ZU5 A;  5JDB A;  4IE5 A;  1X9T A;  3ZIW A;  3VD4 A;  5KHK A;  1HIX A;  5C8C A;  1Y9M A;  4LPL A;  5BNO C;  2OUJ A;  1HN1 A;  1OBN A;  2BP6 A;  4AVS A;  5H9Q A;  2R30 A;  4UW5 A;  1RUF 1;  1GQP A;  2I2S A;  5KC6 A;  1NQJ A;  2R1D A;  4UF0 A;  1VAM A;  4FFH A;  3S30 A;  4PLN A;  4QQH A;  1FMD 2;  2JG9 C;  1N3O A;  3NST A;  2HWF 2;  5BY5 A;  4P9Y A;  2BV4 A;  1OQE A;  1VPH A;  3PU8 A;  1POV 3;  1ND2 B;  1QH6 A;  5JZG B;  1RUE 1;  1PO2 2;  2WZ8 A;  1UOJ A;  3THP A;  1ZNP A;  2LM3 A;  4YW1 A;  2IVJ A;  2G9G A;  3DL3 A;  4GJZ A;  3A21 A;  1DCS A;  1U5X A;  1RIT A;  1OXC A;  4LBQ B;  2MEV 2;  2ZZJ A;  1XOY A;  3WDW A;  2GZW A;  3AZY A;  1AVB A;  4ISR A;  1I3H A;  2D6P A;  2D7F A;  4RD7 A;  3U4S A;  1LGB A;  1O3R A;  1RMU 3;  4CCC A;  3PNA A;  1ZRR A;  2QQV A;  4X8P A;  3RQ0 A;  2NPI A;  3B9I A;  1AL2 1;  5EV7 A;  2ZA9 A;  1PHM A;  4WZC A;  4XUT A;  5J36 A;  1QOT A;  1W2U A;  3VL9 A;  2PN5 A;  3NNF A;  2Y0I A;  3NWK A;  3I2H A;  3ITQ A;  4EWA A;  3W9A A;  2QJV A;  3TNP B;  3ZYJ B;  1QF3 A;  3RRD A;  5FLH A;  1J1T A;  3DN7 A;  1JYX A;  2FZ1 A;  3UK9 A;  1V6J A;  1NOV A;  2WFF 1;  2X10 A;  1UKR A;  2VC9 A;  3KQ4 B;  4RFR B;  4XXP A;  5C3S A;  4HK8 A;  4DUV A;  1DGL A;  4CEY A;  1H2K A;  1ND2 C;  1QNW A;  1NT0 A;  4Z2W A;  1NUK A;  5FLI A;  3BTZ A;  1PGL 1;  1WCD J;  4QXK A;  1F31 A;  3AMP A;  1RUD 3;  1S0B A;  2PMW B;  3KT1 A;  4KWK A;  4GAZ A;  2BUK A;  2OII A;  3TNQ A;  3VBR A;  2ZGU A;  5FP8 A;  5IHR A;  1BMV 2;  4OFG A;  2VOX A;  1BK0 A;  3KCC A;  2DBI A;  4UI9 L;  1NLQ A;  1ST8 A;  3ELN A;  1G7Y A;  4H3W A;  4RR3 B;  2WSV A;  4O65 A;  1F4A A;  2R1B A;  5JMO A;  3P5B A;  5BNQ A;  2XWJ B;  5FZ9 A;  1HB4 A;  1H9P A;  4O7X A;  4XJA A;  2OX0 A;  3I3Q A;  5JIU A;  2BFU L;  4LE3 A;  3RWN A;  3ORJ A;  1UZZ A;  4M3C B;  2V5Y A;  3HMY A;  4W8J A;  5JLV A;  1C1L A;  2D98 A;  5DAQ A;  5T50 A;  4DZG A;  3KV9 A;  1QY4 A;  4PQ9 A;  2J1E A;  2WNO A;  4CU6 A;  1IGO A;  2RM2 1;  4QB2 A;  4QKD A;  4FPC A;  4XOG A;  5EQU A;  2LS6 A;  2V4V A;  5JR7 B;  2P1B A;  3LOI A;  3OY8 A;  1PIV 1;  2YBK A;  2OXB A;  2VL4 A;  1LU2 A;  3DV8 A;  4NN0 A;  3S7I A;  1VBD 2;  4LBL A;  1O6U A;  5FUI A;  4AFM A;  3GGL A;  1NXM A;  4FTB A;  4FBF A;  5K9Y A;  5C3R A;  4HLT A;  4A44 A;  2VE1 A;  5DUX A;  4ARX A;  5L9B A;  3M3E A;  1E5R A;  1FV2 A;  3B94 A;  3B69 A;  2W5F A;  3FJS A;  4JX0 A;  1XYO A;  5BXX A;  5G05 L;  4KH9 A;  4XAE A;  5JPM B;  4GAL A;  1US3 A;  4XIO A;  4QGL A;  4N43 B;  3T2Q A;  3K51 A;  1QJX 1;  2OYZ A;  4PHZ A;  4KNC A;  3ZSL A;  3LSE A;  1O4Z A;  3WD5 A;  3NNM A;  4Q0Q A;  5FY5 A;  1COV 2;  4P9J A;  3D6E A;  4SBV A;  5IJR A;  1Z7S 3;  3QBQ A;  1AR7 1;  4F7Z A;  3GBF A;  1RUF 3;  3LZZ A;  2KXL A;  4NJ4 A;  1RUH 3;  4IE6 A;  4NOT A;  2WLP A;  2PHW A;  1ULD A;  2C26 A;  4MSV A;  1J83 A;  1DDL A;  2W9X A;  4Z07 A;  4OUS A;  1QJU 1;  4ZU4 A;  3OGV A;  2Y64 A;  5E1R A;  1RUJ 3;  1O5L A;  3ZFE B;  1WMX A;  2HWB 3;  1H4H A;  2R0H A;  3HOB A;  3VZO A;  3H1W A;  1VBE 1;  3KF5 A;  1ZZ9 A;  3ETP A;  1UYY A;  2WZR 1;  3SCF A;  1GV9 A;  1PK6 C;  4ZPI A;  1NXD 1;  2LUW A;  3JZV A;  1W9W A;  3E1F 1;  1WW7 A;  4XUQ A;  3ETQ A;  1SLT A;  1AJO A;  1S0D A;  3OTF A;  1OLQ A;  3LCP A;  4IDZ A;  1NQD A;  4CDW B;  4QX0 A;  1VLN A;  4D8M A;  1KFX L;  3KLS A;  1NG0 A;  3MDP A;  3WDU A;  5LK7 B;  3WZ1 A;  1V70 A;  4GQ7 A;  3FC0 A;  5HV4 A;  5FZH A;  5BV6 A;  3AZW A;  1YO8 A;  1DGW X;  1AR9 3;  1YQ6 A;  2XPJ A;  4CYD A;  1A34 A;  1SLL A;  4AI1 A;  2EIB A;  4PIZ A;  2FZ2 A;  1OOP B;  1C3H A;  2RS1 2;  1YQ8 A;  1W2N A;  2D3P A;  3MEP A;  3CDZ B;  2J1T A;  3WT3 A;  1JZ5 A;  2ZXQ A;  5FXX A;  1KFU L;  5FKC A;  2IFR A;  2J1U A;  5FYS A;  4MLO A;  5CKN A;  1GNH A;  1PVC 1;  3TB0 A;  1QIQ A;  2V73 A;  3RYR A;  4NVP A;  3RNS A;  1K42 A;  2ZEW A;  3SH3 A;  2CL2 A;  4KGG A;  3RSJ A;  4HET A;  4BH9 A;  3RZL A;  3LSD A;  2Y6F A;  2VQT A;  2QQJ A;  2XL9 A;  5L36 A;  2Q4S A;  4QWN A;  1GZW B;  1WA4 A;  1I6X A;  2W08 A;  3I97 A;  4QX1 A;  1Q8V A;  3PUA A;  5I8T A;  3EJK A;  1OLM E;  1POV 0;  4BB3 A;  3AP6 A;  2X5I C;  4AAP A;  4C8D A;  1V9U 2;  5DDJ 2;  4B1L A;  1HQW A;  2A3W A;  5KXE A;  4GKX A;  3O5S A;  1Q3E A;  2E32 A;  1KDM A;  4E27 A;  1GQH A;  4ZS3 A;  1ASJ 2;  2VUJ A;  2ARB A;  1AR8 3;  3I2I A;  3WF4 A;  5F3C A;  4LKF A;  4R4Z A;  5HI0 A;  4AED C;  4GWM A;  2W39 A;  4D7S A;  2Y6H A;  3WEZ A;  4L99 A;  1WLC A;  1GR3 A;  2VY0 A;  5FXV A;  3BOD A;  3TBD A;  4Q4X 3;  5F32 A;  2JD9 A;  4LKS A;  5A3N A;  5FIX A;  3ZXL A;  4AI0 A;  4CDX B;  3OBR A;  2HWE 3;  2PQS A;  2A7A A;  3AVS A;  2FCU A;  2J1R A;  3VBS C;  3GF6 A;  2PHL A;  3T0D A;  4UFH A;  1EPW A;  4JTO A;  2DUQ A;  4WVM A;  2HWC 3;  3AL6 A;  3ZOI A;  5F3E A;  3VBR C;  2CWM A;  1RMU 2;  2W46 A;  3OYW A;  1H4G A;  4K8F A;  1LEN A;  3I2J A;  3T3Y A;  2O1Q A;  4BQX A;  3LKJ A;  5AFE A;  2VMC A;  1BEV 1;  3NNG A;  4GB3 1;  3N9L A;  2CNA A;  3CBN A;  3OD0 A;  4I0A A;  1ND2 A;  3O1O A;  2PAE A;  2WO1 A;  4XHX A;  1LOF C;  4YWA A;  2Q8E A;  3ZIX A;  4IE4 A;  4AHY A;  4D6S A;  1UKG A;  1ND3 C;  1WA6 X;  2JG8 C;  3H1M A;  3Q8A A;  4CDU A;  5JUV A;  1H0B A;  4GJY A;  4H55 A;  3CMG A;  1PO2 3;  3IIA A;  1OMI A;  2OPK A;  5J96 B;  4N8M A;  4X8N A;  3LIH A;  1G8W A;  4CU9 A;  4ZXE A;  4A3X A;  1IS5 A;  1SCS A;  2H6B A;  2XJS A;  2VPV A;  4Q4V 2;  4RS5 B;  2WZR 3;  4FFF A;  5DXD A;  2AEZ A;  1W6P A;  5FY7 A;  2B39 A;  4BLI A;  1JYV A;  1JYC A;  1TEI A;  3AKS A;  1IZ3 A;  5DPN A;  3SC7 X;  3OBA A;  3JBG 3;  1GBG A;  1QHD A;  3VN4 A;  3BU0 A;  2PHX A;  3JD7 1;  4UXA A;  5F6K A;  1FV3 A;  1UW8 A;  4QU1 A;  4HAN A;  3VZL A;  3WQ7 A;  3A23 A;  2HWD 3;  2UUR A;  1IKP A;  4N53 A;  1RUE 2;  2D6L X;  5HXV A;  2VTX J;  2ZTN A;  3Q8C A;  4XXA A;  1Z7S 1;  2D44 A;  1SBE A;  2B45 X;  2LW8 A;  4XYX A;  1JZ3 A;  4YVW C;  2WT0 A;  2JG8 A;  2QTW B;  5GLV A;  1KXG A;  1TME 3;  2VUL A;  4MGS A;  2PHU A;  2UYA A;  2WNV A;  4NII A;  5IK8 A;  1MQT C;  1QOS A;  2E31 A;  3BOW A;  4LIT A;  1F8V A;  3QOP A;  1K3I A;  5FY8 A;  3ZYF A;  1AL2 2;  4C1X A;  4CUC A;  1RB8 G;  1LED A;  4MG2 A;  2A75 A;  1N3P A;  1R09 3;  2VZU A;  3D0S A;  3NV2 A;  3BB6 A;  2WNV C;  4QKN A;  1R1A 3;  1LHN A;  4FPJ A;  1H8T B;  4BME A;  5LZ6 A;  3H3L A;  4CXX A;  2TUN A;  1UY3 A;  2RM2 3;  5FZE A;  2BWC A;  2CU5 A;  2G9Z A;  3HN3 A;  4IGO A;  4K20 A;  2A6X A;  1GOH A;  1RUG 2;  1W6Q B;  1O8P A;  1NZI A;  2RJK A;  4CEW C;  3MHZ A;  4FP3 A;  1AYM 1;  4Q2F A;  3LPF A;  4TLG A;  1JOP A;  1WUV A;  4JGY A;  1JYI A;  4YZ2 A;  3OCP A;  3AZZ A;  3BTX A;  2LRP A;  2V72 A;  1S0I A;  2XBO 3;  3LIG A;  5EJZ B;  1AYM 2;  3POW A;  1LB2 A;  1BK1 A;  3BGA A;  3CZU A;  1UX7 A;  2FBE A;  2NMN A;  2BNO A;  1DQ4 A;  4Y5T A;  3ZXA C;  3LEG A;  3AL5 A;  1DLC A;  4FPF A;  4CP1 A;  1UXZ A;  2C6S A;  1H8T C;  4NAM A;  2R06 1;  3EMR A;  4UYB A;  5CB7 A;  4FXK B;  4RGK A;  2JDN A;  3KWV A;  4IL7 A;  3POY A;  4QPW A;  5GLW A;  4CDQ B;  5FPU A;  1CJD A;  1G9D A;  1FAT A;  2VZP A;  3T2P A;  1POV 1;  2ZAC A;  4MZU A;  5C7G A;  1F4H A;  3B01 A;  5JOW A;  2AH2 A;  3NNJ A;  3LA3 A;  3T30 A;  5GZF A;  4R9D A;  4XUO A;  4OQ8 A;  4HOO A;  1QJZ A;  1ZRC A;  4ES9 A;  3IBM A;  3ZYP A;  2XH6 A;  3VBU B;  2XJP A;  3T4V A;  2DVB A;  5BNN B;  1ODM A;  1UIK A;  2W94 A;  2VQ0 A;  2X05 A;  4B3N A;  1OFN A;  4H2A A;  4KL1 A;  1CAU A;  1UN1 A;  1SPP B;  2ZX4 A;  3B5L B;  5JI9 A;  1REE A;  1XRU A;  3P6B A;  1XNB A;  3DCQ A;  1WLT A;  1HB2 A;  1ZBE 2;  4Y1X A;  5FZK A;  5EIY B;  1E5I A;  2IXL A;  2C1F A;  3AC0 A;  3N9O A;  4A42 A;  1ZZ7 A;  1TG7 A;  3RZH A;  5IVY A;  4AVB A;  2ZGQ A;  5A6Y A;  4YW2 A;  2J1S A;  2IXJ A;  4YZ4 A;  5LY2 A;  3I2O A;  2FDG A;  1V9U 3;  5IFT A;  1HRV 2;  1AXK A;  1RUI 2;  4I3G A;  4LBM A;  5FTT C;  1DU3 D;  4MGY E;  2W91 A;  4PIY A;  3NJV A;  2D40 A;  4XHB A;  4NIH A;  4CXY A;  2PFW A;  4L2N A;  5AVA A;  2VZS A;  1OKO A;  3UKN A;  2X5I A;  2QQO A;  2DFC A;  1N47 A;  1DZQ A;  1HV0 A;  2JDA A;  2TEP A;  4UFJ A;  4WV8 A;  4PBP A;  2D97 A;  1G86 A;  2EIC A;  5I91 A;  1YEW A;  1YUD A;  2Y26 A;  2JJ6 A;  1AX0 A;  3NKT A;  2QUO A;  3GJA A;  4UBH A;  4BOW A;  2GNB A;  1E57 A;  1JW6 A;  5D8A A;  1ZA4 A;  2QQM A;  2WUH A;  4FPO B;  3BTA A;  4LNV A;  1AR6 1;  2RMU 1;  2VMH A;  3JB4 C;  4GH4 A;  3MV0 1;  2JG9 A;  1VBA 3;  2DVG A;  4LXL A;  2A6Z A;  4ZHN A;  1SDW A;  5IK7 A;  1ENQ A;  3O1V A;  3BTY A;  4XF0 A;  4Y22 B;  5KC5 A;  4P5Y A;  4RHV 1;  4NID A;  1UMH A;  1W3V A;  3A7Q A;  5FZ4 A;  5A1L A;  2EA7 A;  3WVJ A;  2P6H A;  3PME A;  2VNG A;  5A7W A;  2DF7 A;  4OUL A;  1AR9 1;  2VMI A;  2ZHM A;  3VDA A;  1ZRD A;  4XJW A;  1A3K A;  3W59 A;  1MVE A;  1K5M C;  2ZHL A;  5FO7 B;  4KGQ A;  5C5T A;  1EAH 2;  2VOW A;  1GNY A;  3DUI A;  4ERO A;  4P08 A;  4Q1P A;  3GZA A;  1JOD A;  1VBB 3;  2BGC A;  2LRO A;  2R16 A;  4OZO A;  4XVH A;  1O3T A;  2BFU S;  1LAJ A;  2QQI A;  3RMX A;  3A0K A;  2VJX A;  5L9R A;  4AVV A;  2YBS A;  1OF3 A;  1UO9 A;  4GWI A;  5LK5 A;  1RVF 2;  1CAW B;  4BLJ A;  2JWP A;  1POQ A;  2L9L A;  3OBT A;  2AR6 A;  4CE8 A;  4QD2 A;  4G9S B;  3C7O A;  3POS A;  4FCA A;  1AL0 G;  1QJU 2;  1GWK A;  1JXN A;  5TSW A;  1NA1 A;  1H8V A;  3WQB A;  3FLT A;  1MS4 A;  3AK0 A;  3CL1 A;  4H7M A;  3S6P A;  2QQK A;  1DZT A;  4XIL A;  4W6Y A;  4BE3 A;  1NLS A;  2SBA A;  1X33 A;  2WNU A;  3WCS A;  3USU A;  2CV6 A;  5HCA A;  2FDK A;  2EXH A;  1QJX 3;  1QXP A;  3LE0 A;  4CDW C;  1JH5 A;  5DAW A;  3WV6 A;  4QAW A;  1RUE 3;  3U11 A;  4CDU C;  4DOU A;  4RYD A;  3RGB A;  1M4W A;  5T52 A;  4EV0 A;  2GMM A;  3IMM A;  2ET1 A;  3FLR A;  5FYZ A;  3OF1 A;  5FPX A;  4L9B A;  1R1A 2;  3AP7 A;  5DUV A;  1PO1 2;  2XKO A;  3ZFG B;  3V0A A;  4I0W B;  2A73 B;  2W1Q A;  5C8W A;  5DAB A;  3V64 A;  4RQP A;  1HQL A;  3FL7 A;  2P3K A;  5F9T A;  1N1V A;  5A6X A;  3AKT A;  5BNO B;  1VIW B;  4NMI A;  5T5O A;  1P8J A;  4NWV A;  1C1F A;  5CFD B;  3GYD A;  3Q9O A;  4Q5O A;  4Y1U A;  1GP5 A;  2ARX A;  1YQ2 A;  1IPJ A;  2WNE A;  4PDW B;  3FE5 A;  4DY3 A;  3O0V A;  3RVH A;  5K0U B;  1H8T A;  2C4X A;  2EIG A;  3LEK A;  4IUG A;  2WIN B;  5FMO S;  2ZHK A;  5BUV A;  4HT1 T;  2GP3 A;  2O8O A;  1YFX A;  4S2F A;  1IQD C;  5B2G B;  1D7P M;  1LOA A;  4JC1 A;  2HYX A;  3VKM A;  4BPZ A;  1GAN A;  4IV3 B;  3ES1 A;  3WG2 A;  3WX5 A;  1EV1 2;  3FHQ A;  2BWA A;  3M3O A;  5C4W C;  3AKP A;  3QAC A;  4COY A;  1ULO A;  3R0R A;  1W9F A;  1WGP A;  4XW3 A;  3P3P A;  3IPV A;  3K48 A;  3DEC A;  5J1X A;  2JG8 B;  2QDR A;  4Q4V 1;  4XFA A;  1OLR A;  2OQ6 A;  4AWD A;  5FQ0 B;  1AXY A;  2WFF 3;  3AKR A;  4EE2 A;  5HBA A;  1ULF A;  4EJR A;  4AHZ A;  4M3C A;  4OHX A;  4Y1Z A;  1BQP A;  4WM7 B;  5FFO C;  3GXU A;  2NMO A;  1U5Y A;  1ND3 A;  3LAG A;  3ATG A;  1ZBA 1;  4LHS A;  3W20 A;  1VMJ A;  3RZK A;  1C28 A;  4DIN B;  3WHT A;  1DZR A;  1XU1 A;  1TME 2;  3ZSK A;  1AHS A;  4JAA A;  1R1Z A;  4I30 A;  2VU9 A;  4PCR A;  4X6R B;  5JR2 A;  4C90 A;  1QJY 1;  5FYC A;  3UGF A;  4E4D X;  2VNR A;  1D4V B;  1W6M B;  1R08 3;  4XUR A;  4U36 A;  4CA9 A;  3V0B A;  1YI9 A;  4FTE A;  5FZM A;  1XNT A;  2Z2S B;  2DBN A;  1AF9 A;  2ORZ A;  1XXN A;  2JKX A;  2ZGK A;  3ACG A;  1JI6 A;  1JZ2 A;  1YRZ A;  3QLQ A;  2G1M A;  3OPZ A;  5HCF A;  2VEC A;  1WLD A;  3KM5 A;  5FP4 A;  2RDS A;  3I4I A;  3WP4 A;  4D6Q A;  4NRP A;  2ZMN A;  4QGN A;  1PK6 A;  3BOP A;  5CFC A;  4GMP 3;  3Q8E A;  5A32 A;  1VB4 A;  4ATF A;  3OYW B;  1IS6 A;  5A3W A;  1C57 A;  2J7M A;  3VV1 A;  4B8E A;  2ID4 A;  1SBF A;  1H1M A;  3VBS B;  4BQ1 A;  1H2L A;  2YG0 A;  3TN9 1;  5JSP A;  1RED A;  5FPL A;  2F4P A;  2YPJ A;  1KS4 A;  3MFA A;  5FRA A;  4FOW A;  1LKN A;  2RV9 A;  4Z82 A;  4A45 A;  2E51 A;  1JUI A;  3M3Q A;  3VBF B;  3KD4 A;  2VNV A;  3ILF A;  1QJY 2;  2ZAB A;  3POB A;  5SV5 A;  2HKX A;  4QPG C;  2RS5 1;  2VOV A;  2ERF A;  3U78 A;  5ERL A;  4LA2 A;  1D2Q A;  2GC2 A;  3AYD A;  4JTN A;  4OI4 A;  3C7H A;  4XAA A;  1D4M 2;  1BJQ A;  5JPN B;  5KWR A;  5LA0 A;  5F5I A;  1OH4 A;  3SKJ E;  3VBH A;  4XZU G;  4PDW C;  3IB3 A;  4HL0 A;  1APN A;  2UY8 A;  4XTP A;  3ACH A;  3I8T A;  1HRI 3;  2J22 A;  2P4E A;  2GP5 A;  3I59 A;  4IV1 B;  5IVF A;  2ZKL A;  4Z1V A;  2GH2 A;  1W2O A;  4I3P A;  4YGD A;  2PXJ A;  1NAE A;  2W95 A;  4S2G A;  4Z8B A;  3F2Z A;  1VBC 2;  1OA2 A;  4M0H A;  1U5Z A;  1GMM A;  1CIW A;  1W6M A;  3L2Y A;  4YFW A;  1ZBE 3;  3ME2 A;  5L7O A;  2HWB 1;  3RDI A;  2RDQ A;  5FO8 B;  3VZJ A;  2BVB A;  3K4Z A;  3FLP A;  5FZC A;  2BYV E;  1PGW 1;  5GZD A;  1JTZ X;  1MEC 2;  1G9B A;  1WMD A;  1FOD 2;  1PMI A;  4XUN A;  2QZ2 A;  3KVA A;  1CAX A;  1RHI 2;  3MIE A;  2BDR A;  1ND3 B;  1PZ7 A;  4M4R A;  3U10 A;  2JB4 A;  1HN0 A;  2BNM A;  5FO9 B;  4R9C A;  3ZLI A;  2C9A A;  1PGS A;  3C7G A;  3FUQ A;  4NO4 A;  1EUU A;  4KBB A;  2R6Q A;  5J48 A;  5DDJ 1;  4E2G A;  4CU7 A;  3VBO B;  4H7L A;  5GLZ A;  4DPN A;  4URA A;  5FJK A;  3J7M A;  3LDB A;  4LEJ A;  4DXZ A;  1ULC A;  4TWT A;  1ZVF A;  2Z5W A;  4YPJ A;  1VB2 A;  2FMD A;  3IAQ A;  2B5H A;  3B3Q E;  5FUN A;  2EAK A;  4QM8 A;  3M3C A;  2FCT A;  2N7G A;  2VBD A;  1EPZ A;  2YV8 A;  1WZX A;  1W06 A;  1KIT A;  5FDB A;  1DLL A;  1ZBA 2;  2VUC A;  3POJ A;  2KM2 A;  1GZ9 A;  4LKE A;  5T55 A;  1NCQ C;  3WCR A;  3WQ0 A;  4YGB A;  2AEN A;  5L9V A;  2OKX A;  1VR3 A;  1W8W A;  4FPG A;  4QPG A;  3UNP A;  4LO6 B;  1Y3T A;  2BBA A;  5CG8 A;  3AJZ A;  4QHO A;  2Y60 A;  4QXH A;  4Q27 A;  1F35 A;  1UU4 A;  2DV9 A;  4I01 A;  4GXL A;  4IEQ A;  3ZN5 A;  2GDF A;  2IXK A;  4Q0U A;  3ZN6 B;  3AXE A;  2JE9 A;  4NHM A;  4Q4W 2;  3BPS A;  1AR9 2; 
#chains in the Genus database with same CATH homology
 5DAP A;  4XAB A;  3DKQ A;  3GJB A;  5L9R A;  5A3U A;  2G1M A;  2A1X A;  4XCA A;  4IW3 A;  5DAQ A;  2RDS A;  4Y5T A;  4NAO A;  3BVC A;  5IAT A;  3OBZ A;  3PL0 A;  5EQU A;  5M0T A;  3EMR A;  5IAX A;  2Y34 A;  5C5U A;  3NNJ A;  2FCU A;  5L9B A;  4UWD A;  4BQY A;  4XCB A;  5DAW A;  4MHU A;  4NHX A;  5ERL A;  4Y5S A;  5LBB A;  2RG4 A;  4BQX A;  4XAA A;  3NNM A;  3KT4 A;  5EPA A;  3OUJ A;  4MHR A;  4NHY A;  3W21 A;  5LBE A;  4JZR A;  4NMI A;  5HV0 A;  2V4A A;  4Q5O A;  4XAC A;  3MGU A;  3OUI A;  3OUH A;  2RDQ A;  3NNL A;  4ZPI A;  4NHK A;  5DAX A;  2OPW A;  4KBZ A;  2G19 A;  2JIG A;  3GJA A;  2RDN A;  5HV4 A;  3HQU A;  5LAS A;  2FCV A;  3NNF A;  5DAV A;  2RDR A;  3ITQ A;  2HBU A;  5IAV A;  4NHL A;  3GZE A;  5LBC A;  5LAT A;  2JIJ A;  2FCT A;  2Y33 A;  5LBF A;  4BQW A;  3KT7 A;  5L9V A;  5LA9 A;  3W20 A;  3KT1 A;  2HBT A;  4ZON A;  3HQR A;  4J25 A;  5C5T A;  4XC9 A;  5LB6 A;  4NHM A;  5EP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...