5LBFA

Hif prolyl hydroxylase 2 (phd2/egln1) k293k/g294e variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
226
structure length
224
Chain Sequence
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKIKERTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLEKGVRVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Egl nine homolog 1
total genus 64
structure length 224
sequence length 226
ec nomenclature ec 1.14.11.29: Hypoxia-inducible factor-proline dioxygenase.
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 5lbfA00
4NAOA 3NNLA 2HBUA 5DAQA 2FCUA 4XCAA 5DAXA 2FCVA 5L9VA 4BQWA 3PL0A 2HBTA 5LBBA 4MHRA 5IATA 3DKQA 4NHKA 5EP9A 3GJAA 5LBCA 4IW3A 3W21A 3KT4A 5C5UA 4ZONA 2JIGA 4XAAA 2RDRA 5L9BA 2OPWA 4XCBA 4KBZA 2FCTA 3HQRA 5EPAA 5ERLA 3NNFA 5DAVA 3OBZA 4ZPIA 4NHLA 3OUIA 2RDNA 4UWDA 4BQXA 4NHMA 4JZRA 2RG4A 4NHXA 4J25A 2Y34A 5L9RA 5HV4A 2Y33A 5LA9A 5DAPA 4XACA 5C5TA 3OUJA 3KT1A 4Y5TA 5HV0A 3KT7A 2A1XA 4MHUA 5A3UA 3HQUA 4Y5SA 5LBFA 3W20A 5IAXA 3GZEA 2V4AA 5LATA 3BVCA 5DAWA 5IAVA 4NMIA 2G1MA 5LBEA 2G19A 5LB6A 3NNJA 3OUHA 4NHYA 3GJBA 3MGUA 2RDSA 4XC9A 5LASA 4XABA 2JIJA 3ITQA 3NNMA 2RDQA 3EMRA 5M0TA 4BQYA 4Q5OA 5EQUA
chains in the Genus database with same CATH superfamily
3ZYRA 2YBKA 3TB0A 1OF3A 2W52A 2ZX0A 3M1HA 5DAQA 2B7YA 2E7TA 1Q8QA 4FAGA 4XCAA 1UY1A 3D3AA 3WQ7A 3GM8A 1UN1A 1VMHA 3AZYA 3OPTA 3WP3A 4GZ9A 4YM3A 4KU8A 2Q5TA 1S1AA 1QH6A 2A3XA 2R0HA 1RUD2 1UZYA 4QAWA 4TYSA 3VHRA 3WF0A 2DCJA 1BVP1 3KZ4C 2MEV1 5FYUA 1MS3A 4UF0A 4COVA 2GN3A 4GD4A 5F7UA 3LEMA 2OXBA 5FZEA 4BM8A 3PJQA 1V9U3 3LDBA 1NQDA 2BVVA 4XIKA 4NHKA 5LEKA 1N3OA 4Q4Y1 3CIHA 5JZGC 2V5YA 3AYCA 5T50A 1D4M2 4QX2A 1PIV1 2WFPA 2VVDA 2XPJA 1QEXA 1PGW1 2VXRA 1LGNA 1S2EA 1W8NA 2ERFA 1X9PA 3DECA 2BOJA 1WMFA 4XMIA 5CA6A 3PMSA 1AJKA 1TQ5A 3FBMA 2OW4A 3N35A 1RUJ1 4QXHA 2H6CA 1B35A 2R30A 2P17A 3NNGA 3JD73 4COUA 4AEDA 4Z1VA 4NRQA 1GZ9A 4GIQA 2ZX4A 3UGHA 2JG8C 1F31A 2KA3A 4IV3A 1NXMA 1CPNA 1R093 2VE1A 3SC7X 5DUXA 1AXZA 2DVBA 1XE7A 1YI7A 4LO6B 1UOGA 2H6BA 3B93A 3D82A 3RPQA 4KGQA 1L3JA 4LHNA 3ME2A 2WS93 3VD9A 3KQ4B 3TBDA 5FXXA 3AFGA 2P3YA 1H2MA 2ZA9A 5FPAA 1K5MA 5LA9A 4I0WB 3TAYA 3USUA 2WNVA 3ZPOA 3WG2A 4JGYA 2YBPA 3RYPA 4YLZA 3J7LA 3VKOA 5SV8A 2VZ1A 4LA2A 4K8FA 4LKDA 1C5IA 2DFCA 2DVFA 3C8XA 1Z0HA 3IDEA 4PJYA 4D94A 1K5MB 1SG3A 4Q4V3 1MVEA 4ASMB 5ABJC 1GZCA 1XOYA 5FOBB 1Y9QA 3D6EA 3OEBA 1OQ1A 3LZZA 2AC1A 4FPEA 2X5IC 4YG0A 2QQOA 3MHZA 2B8MA 5LATA 1BVVA 4NRMA 4COYA 5A33A 5T5OA 1STMA 2X09A 1ASJ1 4YGDA 3ZSMA 2D97A 5FXWA 3LDRA 5CU1A 4P9WA 1POV3 3GHNA 3WQ1A 5AFBA 4NPLA 3SH3A 1GNYA 4QMAA 3KV4A 4D6RA 3AKQA 1YFXA 2WJSA 4FFFA 1GANA 1LOCA 1W03A 3POGA 1X36A 3PVEA 4Y1ZA 3Q9OA 2UY8A 1XE8A 3DYOA 5LZ6A 4IV3B 5FMDA 2DF7A 1XXNA 3H1MA 2ZJCA 3VBHA 5C9AB 5T5JA 5A7PA 3ALQA 1N1TA 3GYDA 3H50A 4YVSB 5FZ7A 3AYEA 2XUMA 3OYWB 1JBCA 4FPKA 1JYCA 1POQA 2JDNA 2DTWA 2V09A 4LPLA 3M3IA 5FY5A 3MPBA 4E8CA 5FP8A 3VDCA 4EWDA 4DMIA 1H6YA 3RZMA 3ZKYA 3ZLIA 2FCVA 2ZEXA 1MR5A 2B9UA 1ENSA 1VLNA 1JYXA 3THTA 3HT2A 1KXGA 2JG8B 4HLTA 3R05A 4PF1A 3WDVA 3ABZA 4BCUA 3JZVA 2DYCA 4BQ1A 5FY7A 3ZKUA 1PM4A 1H2NA 4GH4A 3MFCA 4V1PA 3IBMA 4MHRA 4B1LA 1H8VA 3USSA 1QF3A 2B39A 5ANNA 2FZ2A 1D4M1 1Q56A 4LHSA 2F6BA 1FPN2 4OVEA 5ANQA 4DINB 1FYUA 3ZXJA 1RJ7A 1ENXA 1ND2B 2A3WA 4DZGA 5L9BA 5G05L 4HT1T 4YGBA 5A3PA 1K5JA 5JWPA 2YU2A 2E31A 5BXXA 3LOIA 1G9DA 2CWSA 3HQRA 1ZRIA 4YG3A 4BPZA 2QCSB 2YMZA 5IJRA 5F3GA 4MX3A 5D8AA 2VMIA 5J37A 5BPXA 3ZN6A 2WNVC 4FPFA 3GXUA 1Q8SA 4WM7C 1IS4A 2QTWB 5FPVA 1JTZX 3D8CA 3POYA 3X29B 4YZ1A 1RUD3 5A7WA 1WCSA 3RI8A 3L9JT 2WRAA 4A3XA 4CDXA 5HXVA 4QX5A 3ZIXA 4FXGB 1AR63 3ZN6B 1R1ZA 1GZTA 3DYMA 2QQIA 3MW3A 4UBGA 5GZFA 4C0HA 4BQ4A 3UGGA 1IQDC 2JB8A 4YZ4A 3GNEA 3FC0A 4PBPA 2A3YA 2E9QA 5CFCC 3VD7A 4EN8B 1UMZA 2DCTA 4CUBA 3KT1A 2SBAA 1NA1C 3HN1A 5FZIA 3VDDA 3AMPA 4HXCA 1W9YA 3KLSA 4IV3C 5DQ0A 1MACA 1JW6A 4PI2A 1RINA 2ZGKA 1COV2 2PHWA 1ZBA2 5I8SA 5CISA 1UXZA 5AVAA 3IZOA 2CNAA 1QNWA 5GJ6A 4MGQA 4LKSA 4WM8C 4Y4YA 1WGPA 4LULA 2ZXQA 1AYN3 2Z4FA 3N9OA 5C9AA 5F39A 4EZ4A 1UQXA 4KBBA 5EWSA 1EAH2 4OI4A 3TOJA 1E5SA 4A6SA 3LEKA 4FSJA 4NR1A 2NM1A 3F2ZA 4LTAA 3EBRA 1I5ZA 1IG0A 4UW3A 2DVAA 1O5UA 3OUHA 4AVAA 3B69A 3D5OA 3H0OA 3H1YA 1VAKA 4MADA 5A7SA 2P3IA 1SMVA 2ZMKA 4DNYA 4QKBA 1GNZA 4DY3A 1D0GA 1COV1 2RV9A 4DUVA 1JZ5A 1W6NB 4Q26A 1FX5A 2RDQA 4I09A 5EQUA 5BNPC 3LPFA 1IKPA 2JEMA 4RR3A 3HPNA 1NY71 1W9SA 2ARAA 1V9U2 2YYOA 3MDPA 2FDKA 1LOEA 2AH2A 2NN8A 2XQXA 4Q4V2 4K20A 3PVBB 1LCLA 4AQSA 4GWMA 2R043 4RS5A 4CCMA 2VMHA 3E5QA 5FCCA 2PAEA 1AVBA 3TEWA 3JXSA 4UYBA 3ROUA 4K1ZA 2IZWA 1EYBA 5T5PA 1SPPA 1O8PA 2VVEA 3H42B 2ZMLA 1QXJA 2ARBA 3DKWA 3HOBA 3OGRA 4I0BA 4KWLA 4B8EA 1AL0G 4RS5B 1KS4A 2CL2A 3B02A 4IW3A 3VZNA 4CCNA 3N4MA 1DLCA 3W21A 1H4GA 3HNMA 2XBO2 1YJKA 4JGZC 4DXTA 4QD2A 1UKRA 5A7OA 1JZ4A 2D3SA 3LB9A 4HPKB 4CXYA 4BLIA 1JYVA 4MO3M 2J1RA 3BPZA 3H9AA 4M3CE 3QOPA 2A6VA 2WZR2 1KEXA 3NKTA 4QWNA 1O3SA 4AEMA 2GNDA 3LFMA 4CPBD 3OBZA 4UI9L 1AR83 2IUWA 3MF9A 3MIEA 4RD7A 4RQPA 3I2OA 1XNAA 5FYTA 4AEDB 1YYNA 2VW1A 3ZXAC 1WZXA 2VOTA 2JE9A 4GA9A 3SISA 2EXHA 1FXZA 2JB4A 4Y24A 2PAKA 2ILMA 2Y64A 1F15A 2WFF1 4XXAA 4BWOA 4WVMB 2QUOA 2MHFA 3B9CA 4Q2FA 4CEWC 2YZ4A 5FTTC 5KHIA 3QH6A 4E9KA 1QJU3 5IT6A 4RN5A 1U5IA 4KQ7A 3VBHB 2YPDA 2ZGSA 4UFJA 4N90A 3T2QA 3LPGA 4IEZA 1R092 4H7LA 1AYM1 4MGSA 3ZFFB 3VD4A 1PIV2 4PIYA 4LBOA 1C8M1 4MHUA 1NE6A 3ATGA 3W59A 1QJU2 3T0DA 4Y20B 4W8JA 3VBOB 1JI6A 2K46A 1DCSA 4N43B 4XUNA 5F6KA 5FY4A 2XJQA 4KI5M 4RQPC 1FV2A 5JIAA 3ZFFC 4P5HA 1DFQA 1GP5A 5FZ9A 1E5IA 1HLCA 1V6MA 1MZ5A 2BYVE 2WR9A 3MICA 5LRRA 3ST7A 2Y6HA 1W6OB 3VBOA 4AI8A 4AOCA 4X8NA 3AC0A 4D7SA 2QQMA 3GBWA 1DBNA 1VMFA 4Q8KA 4GH4B 1ZRCA 3BCWA 5A33B 3T2OA 1CJDA 2TUNA 3C3VA 4M00A 4XFCA 3G6JB 3ZFGB 2XWBB 4N53A 2W87A 2Y38A 3GJBA 3MGUA 4OMCA 5DMYA 3POBA 1DQ4A 4C90A 2W0XA 3UK9A 1TMF2 2D5FA 2JG9C 3AP9A 2XJTA 1WBLA 1EP0A 3H7JA 1AL22 1VAVA 1VRH2 3POEA 5KC6A 5BNOC 4JKMA 4H3WA 3URFA 5A7NA 1GP6A 1US2A 3NQHA 4F7ZA 1DHKB 3FFZA 4CU9A 1OHFA 5A3TA 2PA7A 4CDQA 1JZ3A 5BNOB 2JICA 2UWBA 5T55A 4AHXA 2ZHLA 4Q4V1 2C5DA 1OOPA 3KHCA 2R6QA 3VUOA 4P08A 3BU7A 4ISQA 5I0TA 5IVJA 4XQ4A 1EV13 3PL0A 1KFXL 1LEMA 1W6QB 3PMEA 4MXVA 3WSOA 2A6XA 5FZOA 2A73B 3O1OA 1DF0A 5L7OB 4HANA 3IDBB 3M2MA 1NXD1 2PHLA 1UZWA 5IATA 1VBC1 4XFHA 1ND3A 3V56A 1OFNA 1A34A 2UYBA 2B5HA 4L0PA 5JPNB 3BALA 4A7ZA 2WZR3 3ES4A 2JE7A 1QXPA 4INDA 4CU8A 1NCRC 5FYCA 1L7QA 3SKVA 1SLIA 4XDQA 2VD7A 4K7JA 2PXJA 2WFF3 3ZX7A 3I2DA 2VCMA 2VMFA 3WDXA 3VKNA 1S4CA 4IV1B 1W0OA 4QB2A 1SLTA 2BJSA 2XONA 1NY72 2VY0A 2BVBA 1LOBA 2OQ7A 1MPXA 1OVSA 1PK6A 2WZ8A 2RJ2A 4GKYA 5DAVA 2R7EB 4QPYA 5L73A 3NO8A 4XFFA 3U10A 3MV01 4IV1C 1YQ8A 3N3HA 4OQ8A 3KM5A 2B46X 1GOFA 3LQCA 1AYN2 1UCXA 1AX1A 2RJLA 3AXEA 3T4HB 3ILFA 2RG4A 4MVTA 4AVBA 5FYVA 1W28A 4EN6B 1ONAA 1XJAA 4ZU4A 2PMWB 3AJYA 1JUIA 2UU8A 5EIYB 3J8F2 3VHOA 3K46A 1ZBA3 1NQJA 1WMDA 3AK0A 4LORA 5JOXA 3D0JA 2WABA 3I97A 5C33A 4DB5A 2R062 3NVCA 4YW5A 3M7AA 2VUAA 3TN91 2IXLA 4FO9A 2VQ0A 4H7MA 1JMUB 3CMGA 4P02B 2DCZA 2VTXJ 2VH9A 3I2FA 4YM2A 1O4ZA 4YRDA 4B4RA 1PVC3 3WLUA 2AZ5A 3IPVA 1ND3B 3KWVA 2OZ6A 4XIOA 3OB8A 5LBFA 4BMBA 4EROA 4XFIA 1ACCA 4HVOA 2WO2A 5HCAA 3O1PA 4TLFA 3U78A 1ZBE3 2RS12 5CAZA 4IEWA 4FXKB 5C8CB 1I6XA 4RHV2 4D7TA 4QHZA 5EZWA 4FPGA 4NJ4A 1TME2 2D6KA 3WV6A 1UYZA 3J7NA 5JXHA 5DN2A 3HWJA 2ZGPA 4UAPA 1W6MB 4HZFA 3TYJA 3LA3A 1MZEA 3M4FA 2GN7A 1VBE3 4JHTA 5EJZB 4OHZA 2QNKA 1XYPA 1YQ5A 2R49A 4NUBA 2ZEYA 1XU1A 4IEYA 3MF6A 4L97A 5HCFA 4E27A 4FPLA 3RWKX 3N36A 3L2HA 4BMEA 1URXA 1XPWA 5JAXA 2EALA 5KR7A 3ILNA 2RS53 2EIEA 1VBA3 2IFRA 1MQTC 4NIHA 5F5AA 1W8OA 1S0CA 4PDWC 3K77A 1Y9GA 2F17A 4YGEA 4YW4A 5K0UA 4OI1A 4LUKA 3T3YA 2XUEA 4FFHA 1VALA 3A7QA 4NRPA 1I9RA 3AMNA 1JHNA 3ZXLA 2EXJA 1PVXA 1U5ZA 4BJ0A 2ZEWA 4E2GA 3LF7A 1PIV3 1VBD1 3OBTA 3K4AA 1NCQC 1RUE1 2OT7A 5LY2A 5A6QA 5FLIA 2W1SA 4M01A 3AL6A 3WG1A 1UIKA 2EIBA 1CONA 4LBMA 3WT3A 5I0SA 4ZS3A 1OQEA 1KRIA 1HRI1 2JG9A 1JHJA 3GZTB 4LOTA 4MGKE 2YC2A 1BZWA 4ZY9A 5T54A 1AZDA 1GOGA 3CL1A 3WD5A 1DGLA 3H3ZA 1JN2P 3O5SA 1GZWA 2F4PA 2A71A 4JTOA 4GALA 1D4VB 2JIGA 4UW6A 2R32A 2RDRA 1T6BX 3BOWA 4NWWA 4RR3C 2OPWA 4BOWA 1RUI3 4YVSC 2GSYA 4Q27A 5CYYA 2R1BA 1VE0A 5ERLA 1S0FA 2WNUB 1FNZA 1H30A 2FD8A 1YJLA 1A8DA 4JX0A 5FZ4A 5BNPB 3RGBA 2VCAA 1ZVFA 3OUIA 2BEOA 4AVVA 4DEQA 4BA6A 1GICA 4AI3A 3BI3A 1OVPA 2QFEA 3WHUA 4NHMA 3U1XA 4QX3A 1JYTA 1QHDA 4M4PA 3N7MA 4DRVA 3O0WA 4CCKA 1D2SA 3BUCA 1PVC1 4Q0PA 4XPVA 2VNOA 5FLHA 4LUMA 4XFGA 3UKTA 5BYNA 3OYWA 1CAXA 3OGSA 4EN7B 1U5YA 5FZ0A 1C4RA 2X53S 1TEIA 1RUF2 1PHMA 4WM7B 1FT9A 3WDTA 4YZ5A 4OUEA 1TZOA 1CAVB 1KJLA 3F95A 4UFMA 4EN0A 3LA2A 2DU0A 1UO9A 2WLQA 5F37A 4Q0VA 4BK4A 5FLJA 5IVYA 4Z8BA 4IQPA 4YYOA 3T1MA 3DXUA 2BBVA 1QQP2 5CG9A 5G04L 4QDRA 1R081 1POV1 2JDPA 5FR3A 1AR81 3UL2A 4XJAA 2CSGA 3ZYJB 1OKOA 2IXKA 2W47A 4M3CB 1JZ6A 4LO7A 4QQLA 1PNGA 2VPVA 2YGLA 3BVCA 1PO12 3ENRA 3NJZA 4XFBA 1BBT1 3VKLA 2D43A 1W8WA 5IAVA 5JVVA 5A80A 1SEFA 3V0AA 1OURA 3JBG2 2ET7A 4R52A 4ATEA 2VCBA 3Q8CA 2D40A 4OUSA 4XBLA 3VKFC 2QQKA 3S7EA 4XF4A 5KHGA 2AR6A 2LALA 2HWC1 1H1MA 4LQRA 4XEZA 4NIAA 4YZ2A 5CB7A 3ITQA 4COWA 1W2AX 2NLRA 1GQPA 2DCKA 1O5LA 1KS5A 1WMXA 2EXKA 5DUVA 4P9JA 3H1WA 4XJ8A 3UETA 4JQRA 2HBUA 1AR93 1F35A 1VAMA 1HRI3 2D6OX 5C9AC 4QQPA 1NKGA 3BTAA 1HB3A 2JDHA 5JSOA 3ZXFA 1CESA 5CFDC 4FPOB 5FP3A 4XAEA 4BQWA 2NP0A 3WHTA 2QQPA 4FTEA 3MIDA 1SBFA 4DIQA 1H4HA 2AEYA 4FVVA 5FWEA 5GALA 2ZKNA 3OSDA 3NJVA 3I54A 1VB4A 1RXGA 1B35B 1VMJA 2X5IA 4K8RB 3ZN4A 5HCHA 3FLPA 3H3LA 3BOPA 4LBQA 2V73A 2WT0A 3MZHA 3WUDA 2F4LA 1SDDB 4BQ3A 5A3NA 5ISLA 1Q5OA 4FOYA 5C5UA 3SXWA 4E4ZA 5E6HA 3VL8A 3OPZA 1V6LA 4HN1A 4XAAA 4CUCA 4XUTA 3VZOA 4DFSA 3R6SA 3AZVA 3WQ0A 5FP9A 2VOKA 1F5JA 3J7MA 1JZ7A 4MV2A 3B9IA 2CU5A 4OHVA 4FFIA 2WNVB 3ZYGA 1KQRA 1K5MC 5T3NA 3NNFA 5FY1A 2Z69A 3BTYA 4CSWA 3BGAA 4RS5C 3KV5A 3SMHA 2E32A 2WLPA 4NHLA 1WCUA 4WM7A 5DDJ2 4AEJA 1CX1A 2DBIA 3Q8EA 1E5RA 3HNBM 4IEUA 3POSA 1XBFA 3A0NA 4ITCA 4QHBA 2MEV3 3VV1A 2E53A 4P5YA 1BEV3 2PHTA 4EWAA 2OX0A 2VUCA 1V9U1 4KWUA 3ON7A 1CAWA 1ZZCA 2VULA 3MUZ1 4J1XA 4XW3A 3OBAA 5T52A 4KG0A 2ZBJA 3BB6A 5DPNA 3VBFB 2VUJA 4QKFA 3ZSEA 2D98A 1DYPA 1EUTA 1Y9MA 2WZR1 3AP4A 3BIWE 1QOSA 1Z7S2 3FWEA 4H2AA 5JR2A 2JE8A 4AFDA 1NYWA 1VB2A 2B4KA 3QLQA 5AFEA 5J36A 4QX0A 1QDOA 3IM0A 4LO4B 4UFKA 2WS92 4CP1A 1DQ2A 3SCFA 5F3EA 5K7PA 5FZ6A 2DUQA 2VC9A 3K3NA 1OLQA 2ZGNA 1SCRA 4DXRA 2J7MA 4PLNA 4OLLA 1RUJ3 4V2VA 3HR9A 4QPIB 2DUPA 1HN1A 4LE3A 4XZUG 5JDBA 5LEJA 2Z79A 5A1LA 1RUC3 1PGW2 2GNBA 3ZMOA 4CDUA 5C7GA 1UZZA 5FDBA 1JYWA 1DZTA 1OT5A 1W8FA 2YY1A 4QPIC 4AGGA 5F5QA 2WO1A 2BDRA 4AGRA 2ZHMA 1AR91 3ZXDA 1IGOA 1H8TC 2XHKA 4XC9A 3VLBB 4C91A 2HKXA 2J1SA 3T0AA 4E4SA 2WS91 4XDOA 3P6BA 1IPJA 1QJX2 2WN2A 1D0HA 1DU3D 4XTMA 1YQ2A 4F83A 5A6ZA 2JG8A 3WW3A 5CZKA 1ULCA 1O6UA 4IERA 4XBNA 2WQZC 4R9AA 4P9XA 1REFA 3T08A 2BV4A 4IGQA 1V6NA 3E5XA 3VBRC 3CDZB 3ZO0B 3NNLA 4FQZA 4CYDA 2WYFA 1RUG1 1UYPA 4Q0SA 1WA6X 3ZXKA 2OS2A 1WBFA 4B4PA 1NE4A 1MZ6A 2JDYA 2PHUA 3K4ZA 3I3BA 3OJBA 4EYUA 3D4KA 3POFA 1UX6A 2HEWF 4LOSA 5FZFA 3WR0A 3ZFGA 2LM3A 1W99A 1LGCA 1SACA 1LU1A 1RC6A 2C4XA 2WNEA 3AYDA 3PVNA 3ZR6A 3NAPC 5B2GB 3U37A 4XF0A 4ZXEA 1ULEA 4O9GA 5C8CC 4QKNA 3VBSB 2QDNA 2UY9A 3LIHA 4UXAA 1YLLA 2R072 4HFSA 3LE0A 1AXKA 5H9SA 3SCGA 1GWLA 5C3RA 1J1LA 3FUOA 2BGPA 4H55A 2WWJA 4OMDA 4QM9A 1L7RA 3AZZA 4ZONA 3BPSA 4CDQC 1WD4A 1MS8A 3WP4A 5I0RA 3OCPA 4D8MA 4CE8A 4E8DA 4P14A 3HNYM 1ZYBA 2VNRA 4MGTA 2WWSA 2ZKLA 1QOOA 1MQTB 2B42B 2NQYA 3ACHA 4CP0A 3VDDC 3WXPA 5FZAA 2WT1A 1S2BA 2C9AA 3HT1A 4GWNA 1VBD3 2D93A 1YRZA 2ETEA 3B5LB 2LS6A 4XF1A 3NRUA 2JJ6A 4FCAA 4WBBA 2EAKA 4J25A 2XH6A 1FMD2 2ZGLA 3K75B 1C8M3 2ZAHA 3M3QA 3QH7A 3ZOIA 4DY5A 5A32B 3MI8A 2ZGUA 3HVDA 3ZR5A 1H8TB 3A21A 3I8TA 4HONA 2I74A 1SBDA 2RE9A 2Y6LA 3CZJA 3N9MA 5JCTA 3I2GA 2O8QA 3N9PA 4LBLA 5FP7A 1X33A 1W2OA 3LFIA 3RZJA 1SQ4A 3GF6A 3ZXEA 5FYIA 3JQWA 4FI9A 1JOPA 4X8PA 3SHRA 4QU1A 3VBHC 4JCKA 1XE0A 1XRUA 1Z78A 1ZZ6A 1QKQA 3UV9A 3VBSA 4Y33A 4IEOA 4PQQA 1FV3A 1RUI1 4XJ9A 5KBFA 2XJPA 3J9SA 4XUOA 1JYNA 1H1IA 1RUF1 1XSQA 5BY5A 1ZRDA 4DOUA 5J96B 1REEA 4RGAA 1TNRA 2V4AA 2RM22 2VGDA 3GZEA 2BWAA 2VL4A 3DGTA 4PQ9A 5E16A 5FZBA 1O8SA 1DDLA 3GZAA 5F2SA 3NV3A 4D0QA 5IK5A 2C6SA 1C28A 3M8LA 3VB9A 4UT5A 3WW1A 3PUSA 2XWJB 3ZMNA 4NVPA 5LBEA 1XQNA 4CDWB 1AR82 2VECA 3WDYA 1X82A 3E6DA 5BNNA 1AR61 1RUG3 3WNXA 1UL9A 2VO5A 3VZLA 2JDZA 1ZRFA 5LASA 3WDWA 5ACA2 1FMD1 1QJY2 2Q30A 3ZFGC 2OIIA 3BN6A 2W5FA 1G9CA 4K9SA 1V6JA 1OOPB 3EHKA 1M06G 2OPKA 4FP2A 4Q5OA 5C4WB 1HB4A 4QHOA 5IYYA 1WLTA 4HKLA 4W6YA 2HWF2 2XLGA 3U75A 1W05A 2WC2A 2WAOA 2DBNA 4I30A 3DXTA 1W0PA 5IK8A 3ZIWA 1VBC3 3GGLA 4GWJA 4JGZA 5FQ0B 2WL1A 4UW5A 4GB31 1LENA 2JDKA 1UU6A 1HW5A 1TNFA 2J1TA 3H8RA 3HMYA 5A1FA 3KHBA 4PF5A 4NN0A 4JKKA 1YO8A 3KV6A 4Q8LA 4HOOA 4N43A 1RL3A 2VM9A 4ZS2A 5EYXA 4CEYB 5FMBA 1QU0A 2PFWA 1SLLA 4LBQB 4BK5A 2IXCA 3O14A 5FZLA 1ZM1A 2R071 4GAZA 5LBBA 1X9TA 4XHBA 4FT8A 3AFKA 2GC0A 3DEMA 3SQOA 5FREA 1OXCA 1C8NA 4JVAA 5IUQA 1GMMA 5LA2A 1QNYA 1ND2A 5HBAA 5BNNB 2YG0A 3RYKA 1LOFC 3IWZA 3NMBA 1X8EA 4K6BA 5JOYA 5LK7B 4MYEA 4NIIA 4CDWA 3NV2A 2HWD2 2WNOA 4XCBA 1Y3TA 4N53B 3RQ0A 3NV4A 2MNGA 4QGMA 2O0OA 5C3QA 3KSCA 1S0BA 4I0AA 1UY0A 1XNDA 4ZU5A 4DRRA 4YWAA 5GZDA 4IE7A 2CY6A 4EV0A 2XKPA 1ZNPA 2H0VA 2RDNA 4YARA 5EXOA 2QVSB 1GQGA 3MFAA 4FPJA 5FBZA 4XYXA 2Z42A 1VBB3 1UMIA 2AYHA 4Y26A 3G7DA 2VXJA 2DWRA 3WCRA 3AKPA 2DVDA 1LU2A 1H2KA 4Y20A 5FZKA 3IIAA 4DUXA 3BODA 4WVWA 3KV9A 4CRQA 3ZFEA 5HV4A 4QB1A 3H8XA 5DZFA 1RUF3 2D44A 4P9GA 4HG6B 1Q43A 1XNBA 3C7GA 2XG3A 1TE1B 1ZBE1 3VBRB 2W92A 5K0UB 4A44A 3ZYHA 5K9YA 4L92A 3ZYPA 1FOD3 5I91A 2FDJA 3VN4A 2VW2A 1UAIA 5HV0A 1JZ8A 1NOVA 1H2LA 1X50A 4RR3B 2A6YA 2A1XA 1UY4A 1SFYA 1OPMA 2YGMA 4Q4Y2 1L7LA 2HWB2 2WBKA 3MEPA 1VBE1 4P9YA 3RS6A 5C6CA 3BTZA 4QPGB 2DUOA 5EYYA 2Y6KA 1OQDA 1RHI3 4RSUA 2RJKA 2XJSA 2AACA 2BUKA 4I01A 3MIHA 1OA4A 1W6PA 4TWTA 5DAWA 4I02A 1PO23 1VBA1 2BOIA 2XJUA 3M70A 5FXVA 4W50A 3CU7A 3N9NA 4Y1VA 1SPPB 1PGL1 3S0MA 2XHNA 3ACGA 2FMYA 4X6QB 3P3PA 4GJYA 4LE4A 3ACLA 5IFTA 2GALA 2Y0OA 1AHSA 5H9QA 4CDXC 5KXCA 3FE5A 4PDWB 4LBJA 1OA3A 2DTYA 3VL9A 2BFUL 1OMIA 5FYHA 3WY6A 2VR4A 5JSPA 2AENA 2K9ZA 2GNMA 2BFUS 4ISRA 1AYM3 1APNA 4MZUA 1G9FA 1VIWB 5T5LA 3U07A 1JOJA 1DYKA 2P37A 3EB7A 3FUQA 4XDPA 1ZRRA 3VDBA 2VZPA 1NCRA 1JH5A 2WYSA 5GM0A 4JRLA 2ZPXA 3PURA 4MLOA 2QQWA 1S0JA 1SFPA 4NROA 1LECA 2QJVA 4KGGA 2BBAA 4YFZA 1LOFA 1GOHA 2D6PA 3T2TA 1RB8G 3SITA 5FZMA 4AHWA 1BQPA 1HQWA 1W2UA 2FDHA 4AF9A 2EAAA 1WLDA 5CG8A 4E2SA 1LGBA 3OTFA 2YHJA 5K8SA 1F4AA 5F3IA 3ACIA 1IQAA 2HYKA 5FMOS 5A3WA 2D5HA 2RR12 3DF0A 3PTRB 3QBQA 4CCEA 5JI9A 2D6MA 1IKQA 1AR72 3VKMA 3GBFA 5LWBA 4TTGA 2VZRA 2B45X 4AG4A 3Q8AA 1BXHA 1R1A2 4N43C 4JDOA 2C26A 2HWE1 4K1YA 4LLFA 3T1LA 1VBB1 3AMQA 1O3RA 2QQUA 4LK7A 4XE9A 1IS6A 2IXHA 5C3SA 5F5CA 3CJXA 2A6ZA 1D7PM 5EPAA 5A7WB 4QX1A 3WF3A 4E4HA 1GZWB 2P5BA 5F3CA 4ONUA 2WDBA 4L9BA 5DDJ1 4CVUA 1BKZA 1TMF1 4CP9B 2PLV2 3J7HA 3SEPA 1F9KA 2XJRA 1RUH1 3O1VA 1Y43B 1TME1 2PHRA 2PHXA 2WNUA 4QU2A 4S2DA 3PDQA 4JKLA 1H1AA 1ULOA 3Q8BA 4IE4A 2P34A 4YW7A 4ZZ8A 1UZVA 1GYKA 4RGGA 1OD3A 4MGYE 4J6GA 3O1SA 2X8KA 1CZSA 4LIVA 1JU3A 4M3CF 5DG1A 4YVWC 1R083 4AFMA 5AC91 5E88A 2O8OA 5DUWA 3JBG1 2WT2A 1ZZ8A 2Y33A 3N7KA 3WF2A 3LD8A 1RVF1 1YXWA 5D8AB 4AFBA 1HRV3 1LAJA 2AUYA 3WVJA 1ZZBA 4A2UA 2OUHA 4Z2AA 2XLAA 1PMIA 2XR4A 3ZFFA 2VW0A 1ODNA 1EPZA 1OF4A 3HIFA 3JQXA 1O7FA 2ZMNA 3LDKA 4IE5A 1IG3A 1KITA 1KDKA 2X10A 1IHMA 2IXIA 1FNYA 5GKAC 1CD3G 5FZDA 5EJ3A 2R16A 4LNVA 3VDAA 4JTNA 1KJRA 1W6OA 4P9LA 3V64A 4MGIE 1CAWB 4GB32 4RL7A 5GLTA 5AC92 2BERA 1CGPA 3N7JA 1J84A 2WFF2 5LY1A 1DGRA 5A1AA 2P4EA 1NCRB 3GZUC 3M3OA 1YIPA 1LULA 5IHRA 4LO5B 4W65A 1EPWA 5A32A 3N9LA 1HDKA 3ZVXA 3WINE 2HWC2 3AP5A 1OH3A 1ULGA 3KQRA 2GMEA 2JDUA 1OD5A 4CEWA 3LEIA 3A0KA 3TN93 3GBGA 2XLFA 4CUGA 2AREA 2JDAA 3JB8A 4ZZ5A 3NNMA 2BGOA 2BQPA 2Y8KA 1OLRA 4Y1XA 4PT6A 1CZVA 3I2HA 2YROA 2Q1FA 2E51A 2VMCA 3VD5A 3N7LA 4ZU7A 4NAOA 2I07B 3WW4A 3VHNA 5FPUA 4AQ2A 2G4IA 1DGRN 4FOQA 1OH4A 3K4DA 4CDUC 1Y7BA 3PU3A 3RSJA 4P9IA 1Q8OA 3HJRA 4L2NA 4D3WA 3IAQA 5DAXA 4GMP1 1V00A 3ETPA 3SLIA 1OC1A 1UZ0A 4D7YA 1YUDA 2O1QA 1DIWA 5FO9B 3R4SA 5CNAA 3FLTA 2KR2A 4IDZA 3MW4A 1AXYA 1W6NA 3M3CA 5D21A 5EP9A 3RDIA 4YVWB 1MEC3 2KXLA 5JOWA 1S0IA 2VZ3A 1ASJ2 1GQHA 1O4TA 3NKGA 1TMF3 2PQQA 1RJ8A 2B9VA 1FMD3 2A75A 3J26N 4AWDA 4Q1PA 1RUG2 2J42A 1G8WA 1CIWA 1RUH3 2ZZJA 4Y22A 5GLUA 2SLIA 4JAAA 5FUPA 4CTEA 3BTXA 2LUWA 3RZGA 2P6HA 2RS51 5H9PA 1W04A 1W39A 2JX9A 1OA2A 4R4XA 2JD9A 4D69A 3MLLA 5C3OA 2PYTA 2FDFA 1BEV1 4AVCA 4QGNA 3I3DA 3PNAA 4PBOA 4QT6A 3FFQA 5BNOA 2QE3A 3GALA 4OHXA 3I3QA 3ZSJA 3DN7A 1BCXA 1GV9A 4GB33 3JCIA 4XJZA 3I2IA 1SCSA 3OY8B 2CDOA 3AL5A 1RVF3 1W8ZA 3K3OA 1UWWA 2EA7A 1RUE3 4JZRA 4NHXA 2GP5A 4ET7A 4YPJA 2ENRA 2QQNA 2Y34A 3KCXA 4HETA 1TVGA 2RM21 3FBYA 4M3CA 4DXZA 5L9RA 1H0BA 4BLJA 1OPOA 3GDBA 5CFCA 1ALYA 2FQPA 1QWRA 4Y1YA 1MEC2 4MGZE 4C8DA 2HLEA 2ZGMA 2G9ZA 4NPRA 4IL7A 1SLCA 4FAHA 5L7OC 4OYUA 1F8VA 3ZPYA 2E7AA 4AVTA 4XACA 1UX7A 5C5TA 3CKHA 4QDSA 3PTYA 1RUC1 2W3JA 5GZGA 1DZRA 2QKDA 2VOWA 3AP7A 3VBFC 2D3PA 4RHV1 1PX4A 4CEWB 3KMHA 2G9GA 4QGLA 4U36A 1NCQB 1SBEA 1VBD2 1NA1A 3I7DA 3O12A 3GCWA 3MUY1 5IVFA 4HVRA 1J83A 2RVAA 4Q4X2 5JSRA 4AE2A 3A4UA 5I0UA 5LCWL 2WO3A 1A3KA 3MLJA 2HEVF 1LHOA 1WW5A 3HBZA 1UF2C 2ZOEB 3INAA 1ZREA 5JZGA 2EVXA 5ABJA 3PUIA 3IDCB 4YW2A 1UY2A 3DV8A 1AJOA 1W8UA 1IOAA 4I3GA 3TN92 1U5XA 1GSLA 2R061 5LA0A 4DXSA 1O3TA 5FJKA 2OVUA 4RA0A 4Q1RA 4I3PA 3KGLA 2WUHA 2GZWA 3ZYFA 4AFCA 4C1XA 2VZSA 4XABA 1OSGA 3AP6A 3KVAA 4IEVA 3TEZA 4XUQA 4AFAA 1LKNA 2GC3A 3AXDA 3OGGA 4PLOA 5LRSA 2CHHA 1T6GC 3JUUA 1FOD1 4Y3OA 5M0TA 1NZIA 1PM7A 5JUVA 4DO0A 2JD4A 2BZDA 2RS11 3K2OA 3KGZA 1XU2A 4AHZA 2VZUA 5C70A 5J7MA 3H7YA 1WLWA 2YFUA 5FV3A 5BNPA 3NAPB 1Y4WA 3CO2A 2CTVA 4PI0A 4PLMA 3I59B 1GWKA 4HBNA 2X05A 1WCQA 1OLMA 1RHI1 1ND3C 2V5DA 4IGOA 1A8MA 1A6CA 4FOWA 5KHKA 2WSUA 1BBT3 1PO21 3IIIA 4KWKA 4FFGA 2W9XA 5C3PA 1Z7S3 4Z82A 2P1BA 1JZ2A 3V0AB 2GC1A 3NL1A 3U14A 1W9WA 2XJVA 1R082 4UFLA 2QQLA 4HK8A 3O1RA 2J1UA 2RMU2 2JG9B 3DL3A 2HWC3 1JS9A 2XDVA 4HK9A 3E5UA 4G4FA 4C1WA 5JMOA 3WUCA 5JXIA 5ABJB 1YHFA 3RZLA 4K21A 4CU7A 5HI0A 1R1A3 4LA3A 4TSVA 3FHQA 4KG8A 1RVF2 3PVOA 4LO8A 2JKXA 3UESA 1W2TA 4QKDA 1R64A 2FCTA 3THCA 2WKKA 1UD1A 1TG7A 2RR13 2W94A 2WQ8A 3CNAA 2CAVA 4B29A 3E97A 2Y6GA 4XQDA 4MH0E 4YG6A 4JHZA 3THDA 2ZX2A 2Q8CA 4ZKTB 4O9EA 3RMXA 3KF3A 3I2KA 1W3XA 5HPOA 4CP9A 1EAH1 1E5HA 2CGOA 3FHAA 2ZS6B 1CN1A 2DCYA 2GNTA 3THPA 2FDGA 5GLVA 4J1WA 3PIGA 4BZ4A 2HEYF 5IVBA 1V6IA 2HWB3 5FFOC 2Q4SA 2ES3A 3AKTA 4HMZA 4N7IA 1MS4A 4HN0A 4UW4A 5FJHA 2GMPA 4OZOA 4KMQA 4LKEA 2OA2A 3GHMA 4XXPA 4YGCA 1QH7A 2DFBA 2YDEA 3AMMA 4FPCA 1WW4A 1CVNA 1SLAA 4AQTA 1OI6A 4ARYA 1ST8A 1WW6A 3AKSA 2ZGTA 1M4WA 4XUPA 4XMAA 4OUMA 1BEV2 2GP3A 4MOAA 4AI0A 3DYPA 1NUKA 2HWE3 2VQTA 3P5BA 4HKWA 5BUVA 3C2UA 4I2OA 1UOBA 4AHYA 1ZX5A 2NYYA 1VBE2 3U4SA 3FJSA 2RS32 1H9PA 5A6YA 2HWF1 5FYZA 5L7OA 4A3ZA 1NT0A 4GH4C 3K48A 1AYM2 1PGSA 4Z07A 4CZSA 3BYWA 2VTFA 1RMU3 1C1LA 3MLKA 1AL21 3OD4A 4M0NA 4RQPB 4AEKA 1K42A 1HB1A 4FPYA 1CR7A 4GMP0 2NPIA 1ZBE2 2RS13 4NHYA 4W6XA 1LRHA 2WQ4A 3N9QA 1MQTA 2RS33 4YVWA 4FBFA 4OI0A 1PK6B 5FY0A 2ORZA 4L11A 2X29A 1VP6A 3MYXA 4AR2A 1CX4A 1E57A 5FPXA 4QXCA 4TZDA 5C8CA 1HRV1 1NLSA 2YV8A 5FO7B 5FO8B 1GR3A 4BQYA 3O1UA 4NOTA 5FZ8A 4GKXA 1AX2A 1YFUA 4IE6A 4OHWA 5EFUA 3WDUA 4Q29A 4QPWA 4B1MA 1W6QA 5FY8A 3UYJA 1YQCA 3CJIC 2J1EA 1S0EA 1W6PB 5GZEA 3VBUB 3V0BB 5F2WA 1BBT2 4XTPA 5HCBA 1C8M2 3HEIA 5J09A 1PGL2 1HV0A 1N3QA 3M3EA 4F3JA 4MG2A 3KS7A 2VBPA 3ES1A 3SEEA 1YWKA 3WEZA 5IFPA 2MPFA 2Q8OA 2XOMA 1HXS3 3MV11 4KWJA 5CKQA 2VG9A 2CV6A 2UURA 3WZ1A 4CDQB 4MXWA 1R091 5A3MA 3OPWA 5E89A 3SKJE 4NO4A 1YQ6A 1NX9A 3CZUA 3OD0A 4O7XA 1WCDJ 5FYBA 3T09A 4A6OA 1POV0 1QIQA 2C1FA 2VOVA 4GXLA 4CEYC 1N1YA 2GAUA 4YSFA 1REDA 1UU4A 4XOGA 4N53C 1PZ7A 3IAPA 5EV7A 1I3HA 1MS1A 3W9AA 5IVCA 4IEPA 1YI9A 1OLME 2IVJA 1HV1A 1YFYA 1O59A 3B00A 4QX8A 1NZCA 1FI2A 4SBVA 4TN7A 3RVHA 4DEVA 1H9WA 1N3PA 2VJXA 3CLPA 4GWIA 4AQ6A 2QQJA 2Y0IA 5IVVA 4LT5A 4L8QA 4D6SA 1KD7A 2ZGQA 2NMNA 1PNFA 4UOJA 1MS9A 1WUVA 4ZPIA 2QBXA 2XL7A 3RNSA 4G3YC 3ZFEB 3PUHA 1WMEA 1QQP3 4GMP3 3AM2A 2W95A 3VZMA 3WCSA 1RYYA 2NZ9A 2H0BA 2C9KA 3FZ3A 3I49A 3ZFEC 1HX6A 1GWMA 3AVRA 1F5FA 4A45A 3VGIA 1UPIA 1QOTA 3U11A 1XNKA 5FIXA 1MEC1 2VBBA 2VTXA 2HWE2 5FZ3A 3WNOA 4PIXA 3A22A 3TNPB 3WF1A 1GUIA 2WWUA 5DAPA 3PJYA 5HXMA 1QDCA 4FP3A 4R9BA 3S5AA 4NIGA 3EQEA 3IKWA 4G9SB 4XJUA 4XVHA 4Y5TA 1ENRA 2E7QA 1QY4A 1RMU1 2Y60A 1VBB2 4JQTA 4NWVA 1ENQA 1QJY3 1RITA 1LJ7A 3CJIB 2CWMA 2ARXA 3MW2A 3E6CC 3W20A 2N7GA 4YW1A 4KL1A 3WW2A 5FZ1A 2Q1MA 1RTVA 2ID4A 3HN3A 3J8F1 4AAPA 2Y6FA 5C4WA 2WZPP 4QDQA 4DS0A 5LW9A 1FATA 2RS52 5SV5A 4A41A 1AUYA 2G1MA 2Z5WA 3RYRA 4Q0QA 2RM23 3C7HA 5LB6A 4URAA 1LHNA 2VOXA 5FYSA 4Q4X3 5FMOL 4DPNA 5IWFA 3VBUC 2P3JA 1NAEA 2CYFA 1VR3A 3UT0A 4XETA 2R0FA 1LTEA 3O0VA 2WA4A 1XB9A 4OULA 3POIA 4HL0A 3OGVA 5IVEA 2VUDA 1SDWA 4EE2A 2IXJA 1GP4A 5FZGA 1HXS1 2GMMA 5L36A 4AEDC 4XF3A 5E8AA 3POJA 2Y6JA 4IEXA 1AF9A 2DURA 1HQNA 3RFRA 3EJKA 1EV12 1V6OA 2XGXA 4TLGA 4EN9B 3H8UA 4AI9A 2PN5A 2FCUA 2PTMA 3OGJA 1ZZ7A 2X5IB 3PLQA 3R4UA 3UGFA 3I3MA 1LB2A 1VBC2 4OQ9A 4AAXA 3H8OA 2R1DA 5L9VA 2MEV2 3IDAA 3J4UH 1S55A 2FDIA 1RUD1 2A6WA 2WO7A 2WSVA 5JZGB 1FPN1 3LCPA 3HAGA 2ZHNA 3CHXA 3HQXA 3HD8B 3USUB 1VBA2 1J3PA 2R063 4Y4RA 2YU1A 4BYYA 3QCWA 4D6QA 3GJAA 2YPJA 5KC5A 4ORFA 1HIXA 3S5QA 5DG2A 4XILA 4BIFA 5FZOB 1DQ6A 1LOAA 2VZQA 2DDUA 5JR7B 2FBEA 4W6WA 2PELA 4IEQA 4XURA 1LOGA 2ADEA 2W91A 2D3RA 5CKNA 2ET1A 2Z2SB 4OFGA 4TXWA 5D1IA 3AB0A 1K12A 3DCQA 3ZDSA 2VVFA 1K3IA 4JC1A 1U0AA 2JXAA 1WKYA 3T2PA 4DQAA 2RHPA 5AC93 4PDWA 5J98B 4CXWA 5K0UC 1K45A 2ZABA 2VZTA 3IT8A 3LGRA 3S57A 3ZYIB 4BQXA 2ZTNA 4PCRA 1WCKA 1O4YA 1PK6C 1UY3A 1PZ8A 2ORXA 1MS5A 3ZXGA 1YFWA 2PAMA 5FPLA 4L99A 3QACA 3I3EA 2ZAAA 3TNQA 5A3OA 4FTBA 2VZOA 4R8HA 2R073 4IUGA 4WVZA 2PQSA 3T30A 3P1IA 2BW8A 1IPSA 1DG6A 3OG2A 4XJWA 1HRV2 3ZSLA 1YEWA 1W8TA 1OFSA 4YNIA 1PMJX 3J8F3 1N1SA 2XB6C 2IFWA 5FKCA 3ELNA 4CCCA 4HVQA 2BNNA 3ACFA 4AW7A 4BE3A 2YC0A 2Q1ZB 4BDVB 3S7IA 1GBGA 3PHMA 1GLHA 1ULFA 4Q4X1 1FAYA 2L9LA 4Q0UA 4Z2WA 3ECQA 1IS5A 2HH9A 1G7YA 1XNCA 2QQVA 1J59A 1S0DA 3APBA 3OOXA 4CCLA 1LHWA 2W39A 2V4VA 3TEYA 2R041 4FOVA 4Z92B 4Y1UA 2ZX1A 4CCJA 5FYYA 4ASLA 3RZHA 3B7MA 4V2WA 3VDDB 2EIGA 4QQOA 3AJZA 1UIJA 2BWCA 1QJX3 2JENA 1OUSA 2AGSA 3PIJA 2RDSA 4KU7A 2E6VA 1UOFA 3LKJA 2VBDA 1BLZA 1LEDA 1OUXA 3NV1A 1DQ5A 1QGLA 3WNPA 5C71A 1LHVA 3TRSB 1RUH2 3I59A 1IPKA 1V0AA 1NA1B 2XMLA 2GDFA 4JRAA 2J1VA 3B3QE 3FMGA 1AR73 1US3A 1WD3A 4CDUB 1SHWB 3KCCA 3H3UA 4QX7A 1QMJA 5KXBA 2R042 2XBO1 5CFDA 1G86A 3WP6A 4U2AA 4DUWA 3I4IA 3D0SA 5FUNA 3RG0A 4B4QA 1VRBA 1YIFA 2TBVA 5I8YA 1MVQA 1W9TA 1CZTA 4P00B 5A6XA 2KM2A 4HSJA 1UYYA 2BPA2 5CVRA 2A5ZA 3V0BA 1W90A 2WINB 3U0ZA 3E1F1 4BISA 1B35C 2KD7A 4MXWB 4XHXA 4LR4A 4B7EA 3W5NA 2LRPA 2E63A 4LHKA 1HN0A 5FUIA 2OYZA 3VHPA 5JXJA 2YFZA 5KXEA 2EICA 4RGKA 3RI9A 2ZEZA 2PLV3 2IWGB 1Q8VA 1QJU1 2LW8A 1NCQA 2WIIB 4CCDA 2RS31 4GJZA 5FAXA 1ND2C 2YUEA 4GQ7A 4Q4W1 1AX0A 1GKBA 2ZCWA 3MIGA 3WNNA 3W58A 3IN9A 1W8HA 4UFHA 1G9AA 3QD6A 1CAUB 4WM8A 5LK5A 1DZQA 1V70A 1W3VA 3AX4A 4BQ2A 4AK3A 4KBZA 5FPZA 2W46A 3EO6A 3SNMA 4WVMA 4EZHA 3DPRB 1ZA7A 2E33A 2JKBA 3E6BA 3CF6E 4C0BA 3ZN5A 4LXLA 4M0HA 1RUJ2 2W1UA 4AGVA 4HSLA 2JWPA 2WN3A 5FOJB 3O1TA 1YCIA 1Q3EA 4LHLA 5D8AC 1CPMA 2PHFA 1RHI2 3L2YA 3ZSKA 5C8WA 4HKOA 2W08A 4W4ZA 5DABA 3LWCA 3Q8FA 3PUQA 1BJQA 2BGCA 3UJOA 3KCYA 1UYXA 3RZZA 1C3HA 1S2KA 5CBLA 2GH8A 4YZ3A 2OQ6A 1C1FA 4HPKA 3EXUA 2HYXA 1JOBA 3AZWA 5JPMB 4JDNA 1FOD2 4BB3A 4Y5Z0 3OUJA 1UMHA 4PHZA 2D6NA 2VAUA 5KHHA 3ZM8A 1NLRA 4OCTA 2EF6A 5GZCA 4S2FA 2BNOA 1N1VA 3AKRA 2XXZA 5JOZA 2ARCA 2NMOA 2TNFA 4WVVA 3SH5A 4JGYB 4K40A 2V72A 5DDJ3 4R9DA 3WP5A 5KHJA 4A4AA 2K2SA 2UYAA 2VQUA 4IETA 1EV11 1WWYA 1VJ2A 4QPGA 4QXKA 4BHPA 1PO22 2UWCA 5IW0A 3CBNA 1TME3 4N9IA 4X6RB 5CIRA 4JGYC 3AMHA 1F4HA 1LNSA 2W1QA 2ZZQA 3LEGA 1AR71 3UJQA 2GH2A 1KDMA 1LR5A 4YW3A 5J48A 1LHUA 1P8JA 3U4XA 1W6MA 2XBO3 3R0RA 4Q4Y3 2HWD3 4N7UA 4A7KA 4XF9A 2VNGA 4XFAA 1PMHX 5E1RA 3JBG3 1RGSA 3VBRA 2JIJA 1AYN1 4JV4A 1XSRA 2E26A 2WNUC 3NW4A 1UPSA 2FHRA 4K3UA 4LBQD 4QQ2A 4COZA 3VZJA 4AL9A 4ZHNA 1PO13 1ODMA 3RJRA 5JMCA 1ZA4A 1HQLA 1RUC2 4META 2ADDA 2BP6A 4WZFA 3VD3A 2P2KA 4FTSA 1CWPA 4EJRA 1Z7S1 3OF1A 3HBKA 1IS3A 4CEYA 2IC1A 1BYHA 3JU9A 2I2SA 3GCXA 2C0ZA 2ZX3A 2P6CA 4RFT0 3VBOC 2CGPA 4ASKA 1C5HA 1JUHA 2VCCA 5K4LA 1COV3 5LA1A 1HXS2 1T2XA 2W68A 4LLOA 3TEXA 5I0DA 2JDMA 1KFUL 1ULDA 1AR92 4UF0B 4LBNA 2BTVC 4LBKA 1W06A 1OBNA 3OBRA 1WA4A 1J3RA 3T4VA 2HBTA 2XVKA 2Q0AA 1ZBA1 3KD4A 3DPRC 3DKQA 1CAXB 3WNLA 1CIYA 4BXFA 1W9FA 4CCOA 5LBCA 1S0GA 3T0BA 1C57A 2XVGA 2ZACA 4R9CA 4AI2A 3WF4A 4QQHA 1DQ1A 2OKXA 3LIGA 1J1TA 3WNKA 1OKQA 4KH9A 4WV8A 5FBJA 1G9BA 2FZ1A 3NSTA 3RRDA 2GC2A 5I93A 2VMGA 1GU3A 1SLBA 2OZJA 3C7OA 4O61A 4QM8A 1KGYA 4NE9A 1BHGA 3I2JA 4OI2A 5H9RA 1J58A 1SZBA 4BU2A 5JIUA 2UWAA 3PU8A 3CQOA 3LOBA 2W2IA 1RMU2 3LSDA 4H14A 1CAUA 4R4ZA 1N47A 4WM8B 4F8AA 1DGWA 1RUNA 3S30A 1LODA 1VRH1 5APAA 5FK8A 5FMCA 1MZFA 2Q8EA 2AEZA 1QJEA 5TSWA 5BNNC 1DQ0A 1CQ9A 4OZXA 1FPN3 4CA9A 5FXZA 3UKVA 3ZDVA 1EY2A 3IMNA 4MUVA 2DU1A 3O7OA 3PUAA 2A7AA 4N9HA 4SLIA 2ATFA 3JB4C 1SFNA 4A7YA 3LA7A 2Q8DA 2HWF3 5KXDA 4O65A 3MO4A 1RUOA 2WAAA 1AR62 4EQVA 5F1RA 4S2HA 4XZPA 5CKMA 5FZCA 1YC61 4YM0A 4BH9A 3KT7A 3VZKA 1AL23 2TEPA 4LMFA 2BU9A 5A3UA 1GFF2 5CFDB 4Y5SA 5AVPA 5ACA3 4ZXKA 4AYUA 1HRI2 5EJ1B 3MIFA 5CADA 2HWD1 5IAXA 2VQAA 4LEJA 4CP2A 2J22A 3P3NA 2W1WA 3B01A 4WZCA 1G6NA 4M4RA 1W0NA 1RUI2 2K0GA 4XQWA 4NPMA 3W5MA 1PO11 3UNPA 1RXFA 5BV6A 3WQBA 2G19A 3NJXA 3RJ2X 1JYIA 1J3QA 2FMDA 5F8PA 4AZZA 4LK6A 5JI7A 4LIUA 1D4M3 1UU5A 3K51A 3WG4A 3WNMA 4CDWC 1DP0A 5DZEA 1RIRA 1U12A 3FL7A 4IESA 2O14A 1HKDA 4URTA 3DUIA 5FY9A 3EMRA 5CEHA 5FWJA 1H8TA 5FRAA 2JECA 2OUJA 3TWIA 2RMU3 3MPPG 1X7NA 4RHV3 3ZYBA 4Q4W2 4CU6A 1D2QA 1F2NA 2G9FA 3ETQA 3DPRA 5F6LB 5F5IA 2VMEA 1XYNA 4IGPA 2CDPA 5C4WC 4YFWA 4A42A 4QPGC 2XL9A 1W2NA 1A78A 1WW7A 2D6LX 3OY8A 4IXLA 4PIZA 3BIEA 3MBWA 1PVC2 5KWRA 3WG3A 2VU9A 1VPHA 3UKNA 2I45A 4JDMA 5D2AA 3SH4A 3OEAA 4S2GA 1H6XA 3VBUA 5DZGA 4LJHA 5I8TA 4GULA 5DUUA 3IB3A 1O91A 5CFCB 4UBHA 3C7EA 5A7QA 1QJX1 5A3LA 5B4XA 2D7FA 1QJZA 2XQRA 4AVSA 4RYDA 3RZKA 3BKZA 1JU4A 1ZZ9A 4NAMA 1MS0A 4UFIA 3IPVB 5F9TA 3KT4A 1BK0A 2EXIA 4RFRB 1XC6A 1VRH3 4YW6A 1QQP1 1BMV1 2BRTA 4ATFA 5DXDA 2HJIA 1B09A 2ZGOA 3POWA 1QXRA 1XYOA 2QZ2A 4Y22B 1QJFA 2DV9A 3S6PA 2CGNA 4IE0A 4QXBA 3JD72 1NG0A 3FX3A 1UXXX 2EIDA 3WX5A 3A23A 1Q8PA 5FZHA 4ES9A 1V6KA 5L19A 1UKGA 3MIBA 3C7FA 3ILRA 3NWKA 4QB6A 4QPIA 3LSEA 2YB7A 5FYMA 4IV1A 3FHIB 4UWDA 4ARXA 3AYAA 3O1MA 2GU9A 4AXOA 2VNVA 1YNAA 2PHDA 3IMMA 5A70A 2VMDA 1QJY1 1PZ9A 2PLV1 5GLZA 2DVGA 3LAGA 1IZ3A 1EUUA 5ACA1 2YBSA 1UNBA 3AZXA 4B7KA 2LTNA 1DYOA 1HJFA 1DGWX 2WZEA 3CEWA 3R4DB 5FP4A 3JD71 1JXNA 1UW8A 3VBFA 4Q4W3 5FK7A 5FPBA 5IK4A 3V65A 2XKOA 2BNMA 3WOGA 2VZVA 4MSVA 4FPHA 2J1AA 4ES8A 4EWEA 4NIDA 3RWNA 1BMV2 1DLLA 5GLWA 5F32A 4BQ5A 2ZGRA 1R1A1 4BIOA 4CUAA 3KB5A 4E2QA 5B4NA 4LITA 1I1EA 4FQ4A 1ULPA 1HB2A 3ORJA 1NLQA 3FLRA 3HQUA 5JLVA 2Y26A 4N8MA 5JXGA 4KNCA 1CJPA 1GNHA 3NAPA 2RR11 4YM1A 2WA3A 1PX3A 4AI1A 2ZHKA 1RUE2 3FN9A 3VBSC 3BU0A 3KF5A 5FKBA 4B3NA 1OOPC 1EAH3 2YC4A 4XBQA 1XNTA 4CXXA 3CJIA 3ASIA 5IK7A 4NMIA 4CPBA 1CAVA 2RMU1 5J1XA 2A70A 4LKFA 2HWB1 5J3UA 4CDXB 4JGZB 4E4DX 5FQ0A 1LESA 3NNJA 3RMYA 2YXSA 5BNQA 1WLCA 3KVBA 4BXSV 3B94A 2C24A 1UOJA 4YVSA 2CAUA 2QZ3A 3AVSA 3EYPA 2QDRA 1HJGA 5EHDA 1O3QA 1I5PA 2P3KA 2XVLA 4OHYA 1BK1A 2LROA 1JODA 1X8MA 2IVIB 1ASJ3 3NJYA 3SCHA 3O0XA
chains in the Genus database with same CATH topology
4NAOA 3NNLA 2HBUA 5DAQA 2FCUA 4XCAA 5DAXA 2FCVA 5L9VA 4BQWA 3PL0A 2HBTA 5LBBA 4MHRA 5IATA 3DKQA 4NHKA 5EP9A 3GJAA 5LBCA 4IW3A 3W21A 3KT4A 5C5UA 4ZONA 2JIGA 4XAAA 2RDRA 5L9BA 2OPWA 4XCBA 4KBZA 2FCTA 3HQRA 5EPAA 5ERLA 3NNFA 5DAVA 3OBZA 4ZPIA 4NHLA 3OUIA 2RDNA 4UWDA 4BQXA 4NHMA 4JZRA 2RG4A 4NHXA 4J25A 2Y34A 5L9RA 5HV4A 2Y33A 5LA9A 5DAPA 4XACA 5C5TA 3OUJA 3KT1A 4Y5TA 5HV0A 3KT7A 2A1XA 4MHUA 5A3UA 3HQUA 4Y5SA 5LBFA 3W20A 5IAXA 3GZEA 2V4AA 5LATA 3BVCA 5DAWA 5IAVA 4NMIA 2G1MA 5LBEA 2G19A 5LB6A 3NNJA 3OUHA 4NHYA 3GJBA 3MGUA 2RDSA 4XC9A 5LASA 4XABA 2JIJA 3ITQA 3NNMA 2RDQA 3EMRA 5M0TA 4BQYA 4Q5OA 5EQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAO A;  3NNL A;  2HBU A;  5DAQ A;  2FCU A;  4XCA A;  5DAX A;  2FCV A;  5L9V A;  4BQW A;  3PL0 A;  2HBT A;  5LBB A;  4MHR A;  5IAT A;  3DKQ A;  4NHK A;  5EP9 A;  3GJA A;  5LBC A;  4IW3 A;  3W21 A;  3KT4 A;  5C5U A;  4ZON A;  2JIG A;  4XAA A;  2RDR A;  5L9B A;  2OPW A;  4XCB A;  4KBZ A;  2FCT A;  3HQR A;  5EPA A;  5ERL A;  3NNF A;  5DAV A;  3OBZ A;  4ZPI A;  4NHL A;  3OUI A;  2RDN A;  4UWD A;  4BQX A;  4NHM A;  4JZR A;  2RG4 A;  4NHX A;  4J25 A;  2Y34 A;  5L9R A;  5HV4 A;  2Y33 A;  5LA9 A;  5DAP A;  4XAC A;  5C5T A;  3OUJ A;  3KT1 A;  4Y5T A;  5HV0 A;  3KT7 A;  2A1X A;  4MHU A;  5A3U A;  3HQU A;  4Y5S A;  5LBF A;  3W20 A;  5IAX A;  3GZE A;  2V4A A;  5LAT A;  3BVC A;  5DAW A;  5IAV A;  4NMI A;  2G1M A;  5LBE A;  2G19 A;  5LB6 A;  3NNJ A;  3OUH A;  4NHY A;  3GJB A;  3MGU A;  2RDS A;  4XC9 A;  5LAS A;  4XAB A;  2JIJ A;  3ITQ A;  3NNM A;  2RDQ A;  3EMR A;  5M0T A;  4BQY A;  4Q5O A;  5EQU A; 
#chains in the Genus database with same CATH topology
 3ZYR A;  2YBK A;  3TB0 A;  1OF3 A;  2W52 A;  2ZX0 A;  3M1H A;  5DAQ A;  2B7Y A;  2E7T A;  1Q8Q A;  4FAG A;  4XCA A;  1UY1 A;  3D3A A;  3WQ7 A;  3GM8 A;  1UN1 A;  1VMH A;  3AZY A;  3OPT A;  3WP3 A;  4GZ9 A;  4YM3 A;  4KU8 A;  2Q5T A;  1S1A A;  1QH6 A;  2A3X A;  2R0H A;  1RUD 2;  1UZY A;  4QAW A;  4TYS A;  3VHR A;  3WF0 A;  2DCJ A;  1BVP 1;  3KZ4 C;  2MEV 1;  5FYU A;  1MS3 A;  4UF0 A;  4COV A;  2GN3 A;  4GD4 A;  5F7U A;  3LEM A;  2OXB A;  5FZE A;  4BM8 A;  3PJQ A;  1V9U 3;  3LDB A;  1NQD A;  2BVV A;  4XIK A;  4NHK A;  5LEK A;  1N3O A;  4Q4Y 1;  3CIH A;  5JZG C;  2V5Y A;  3AYC A;  5T50 A;  1D4M 2;  4QX2 A;  1PIV 1;  2WFP A;  2VVD A;  2XPJ A;  1QEX A;  1PGW 1;  2VXR A;  1LGN A;  1S2E A;  1W8N A;  2ERF A;  1X9P A;  3DEC A;  2BOJ A;  1WMF A;  4XMI A;  5CA6 A;  3PMS A;  1AJK A;  1TQ5 A;  3FBM A;  2OW4 A;  3N35 A;  1RUJ 1;  4QXH A;  2H6C A;  1B35 A;  2R30 A;  2P17 A;  3NNG A;  3JD7 3;  4COU A;  4AED A;  4Z1V A;  4NRQ A;  1GZ9 A;  4GIQ A;  2ZX4 A;  3UGH A;  2JG8 C;  1F31 A;  2KA3 A;  4IV3 A;  1NXM A;  1CPN A;  1R09 3;  2VE1 A;  3SC7 X;  5DUX A;  1AXZ A;  2DVB A;  1XE7 A;  1YI7 A;  4LO6 B;  1UOG A;  2H6B A;  3B93 A;  3D82 A;  3RPQ A;  4KGQ A;  1L3J A;  4LHN A;  3ME2 A;  2WS9 3;  3VD9 A;  3KQ4 B;  3TBD A;  5FXX A;  3AFG A;  2P3Y A;  1H2M A;  2ZA9 A;  5FPA A;  1K5M A;  5LA9 A;  4I0W B;  3TAY A;  3USU A;  2WNV A;  3ZPO A;  3WG2 A;  4JGY A;  2YBP A;  3RYP A;  4YLZ A;  3J7L A;  3VKO A;  5SV8 A;  2VZ1 A;  4LA2 A;  4K8F A;  4LKD A;  1C5I A;  2DFC A;  2DVF A;  3C8X A;  1Z0H A;  3IDE A;  4PJY A;  4D94 A;  1K5M B;  1SG3 A;  4Q4V 3;  1MVE A;  4ASM B;  5ABJ C;  1GZC A;  1XOY A;  5FOB B;  1Y9Q A;  3D6E A;  3OEB A;  1OQ1 A;  3LZZ A;  2AC1 A;  4FPE A;  2X5I C;  4YG0 A;  2QQO A;  3MHZ A;  2B8M A;  5LAT A;  1BVV A;  4NRM A;  4COY A;  5A33 A;  5T5O A;  1STM A;  2X09 A;  1ASJ 1;  4YGD A;  3ZSM A;  2D97 A;  5FXW A;  3LDR A;  5CU1 A;  4P9W A;  1POV 3;  3GHN A;  3WQ1 A;  5AFB A;  4NPL A;  3SH3 A;  1GNY A;  4QMA A;  3KV4 A;  4D6R A;  3AKQ A;  1YFX A;  2WJS A;  4FFF A;  1GAN A;  1LOC A;  1W03 A;  3POG A;  1X36 A;  3PVE A;  4Y1Z A;  3Q9O A;  2UY8 A;  1XE8 A;  3DYO A;  5LZ6 A;  4IV3 B;  5FMD A;  2DF7 A;  1XXN A;  3H1M A;  2ZJC A;  3VBH A;  5C9A B;  5T5J A;  5A7P A;  3ALQ A;  1N1T A;  3GYD A;  3H50 A;  4YVS B;  5FZ7 A;  3AYE A;  2XUM A;  3OYW B;  1JBC A;  4FPK A;  1JYC A;  1POQ A;  2JDN A;  2DTW A;  2V09 A;  4LPL A;  3M3I A;  5FY5 A;  3MPB A;  4E8C A;  5FP8 A;  3VDC A;  4EWD A;  4DMI A;  1H6Y A;  3RZM A;  3ZKY A;  3ZLI A;  2FCV A;  2ZEX A;  1MR5 A;  2B9U A;  1ENS A;  1VLN A;  1JYX A;  3THT A;  3HT2 A;  1KXG A;  2JG8 B;  4HLT A;  3R05 A;  4PF1 A;  3WDV A;  3ABZ A;  4BCU A;  3JZV A;  2DYC A;  4BQ1 A;  5FY7 A;  3ZKU A;  1PM4 A;  1H2N A;  4GH4 A;  3MFC A;  4V1P A;  3IBM A;  4MHR A;  4B1L A;  1H8V A;  3USS A;  1QF3 A;  2B39 A;  5ANN A;  2FZ2 A;  1D4M 1;  1Q56 A;  4LHS A;  2F6B A;  1FPN 2;  4OVE A;  5ANQ A;  4DIN B;  1FYU A;  3ZXJ A;  1RJ7 A;  1ENX A;  1ND2 B;  2A3W A;  4DZG A;  5L9B A;  5G05 L;  4HT1 T;  4YGB A;  5A3P A;  1K5J A;  5JWP A;  2YU2 A;  2E31 A;  5BXX A;  3LOI A;  1G9D A;  2CWS A;  3HQR A;  1ZRI A;  4YG3 A;  4BPZ A;  2QCS B;  2YMZ A;  5IJR A;  5F3G A;  4MX3 A;  5D8A A;  2VMI A;  5J37 A;  5BPX A;  3ZN6 A;  2WNV C;  4FPF A;  3GXU A;  1Q8S A;  4WM7 C;  1IS4 A;  2QTW B;  5FPV A;  1JTZ X;  3D8C A;  3POY A;  3X29 B;  4YZ1 A;  1RUD 3;  5A7W A;  1WCS A;  3RI8 A;  3L9J T;  2WRA A;  4A3X A;  4CDX A;  5HXV A;  4QX5 A;  3ZIX A;  4FXG B;  1AR6 3;  3ZN6 B;  1R1Z A;  1GZT A;  3DYM A;  2QQI A;  3MW3 A;  4UBG A;  5GZF A;  4C0H A;  4BQ4 A;  3UGG A;  1IQD C;  2JB8 A;  4YZ4 A;  3GNE A;  3FC0 A;  4PBP A;  2A3Y A;  2E9Q A;  5CFC C;  3VD7 A;  4EN8 B;  1UMZ A;  2DCT A;  4CUB A;  3KT1 A;  2SBA A;  1NA1 C;  3HN1 A;  5FZI A;  3VDD A;  3AMP A;  4HXC A;  1W9Y A;  3KLS A;  4IV3 C;  5DQ0 A;  1MAC A;  1JW6 A;  4PI2 A;  1RIN A;  2ZGK A;  1COV 2;  2PHW A;  1ZBA 2;  5I8S A;  5CIS A;  1UXZ A;  5AVA A;  3IZO A;  2CNA A;  1QNW A;  5GJ6 A;  4MGQ A;  4LKS A;  4WM8 C;  4Y4Y A;  1WGP A;  4LUL A;  2ZXQ A;  1AYN 3;  2Z4F A;  3N9O A;  5C9A A;  5F39 A;  4EZ4 A;  1UQX A;  4KBB A;  5EWS A;  1EAH 2;  4OI4 A;  3TOJ A;  1E5S A;  4A6S A;  3LEK A;  4FSJ A;  4NR1 A;  2NM1 A;  3F2Z A;  4LTA A;  3EBR A;  1I5Z A;  1IG0 A;  4UW3 A;  2DVA A;  1O5U A;  3OUH A;  4AVA A;  3B69 A;  3D5O A;  3H0O A;  3H1Y A;  1VAK A;  4MAD A;  5A7S A;  2P3I A;  1SMV A;  2ZMK A;  4DNY A;  4QKB A;  1GNZ A;  4DY3 A;  1D0G A;  1COV 1;  2RV9 A;  4DUV A;  1JZ5 A;  1W6N B;  4Q26 A;  1FX5 A;  2RDQ A;  4I09 A;  5EQU A;  5BNP C;  3LPF A;  1IKP A;  2JEM A;  4RR3 A;  3HPN A;  1NY7 1;  1W9S A;  2ARA A;  1V9U 2;  2YYO A;  3MDP A;  2FDK A;  1LOE A;  2AH2 A;  2NN8 A;  2XQX A;  4Q4V 2;  4K20 A;  3PVB B;  1LCL A;  4AQS A;  4GWM A;  2R04 3;  4RS5 A;  4CCM A;  2VMH A;  3E5Q A;  5FCC A;  2PAE A;  1AVB A;  3TEW A;  3JXS A;  4UYB A;  3ROU A;  4K1Z A;  2IZW A;  1EYB A;  5T5P A;  1SPP A;  1O8P A;  2VVE A;  3H42 B;  2ZML A;  1QXJ A;  2ARB A;  3DKW A;  3HOB A;  3OGR A;  4I0B A;  4KWL A;  4B8E A;  1AL0 G;  4RS5 B;  1KS4 A;  2CL2 A;  3B02 A;  4IW3 A;  3VZN A;  4CCN A;  3N4M A;  1DLC A;  3W21 A;  1H4G A;  3HNM A;  2XBO 2;  1YJK A;  4JGZ C;  4DXT A;  4QD2 A;  1UKR A;  5A7O A;  1JZ4 A;  2D3S A;  3LB9 A;  4HPK B;  4CXY A;  4BLI A;  1JYV A;  4MO3 M;  2J1R A;  3BPZ A;  3H9A A;  4M3C E;  3QOP A;  2A6V A;  2WZR 2;  1KEX A;  3NKT A;  4QWN A;  1O3S A;  4AEM A;  2GND A;  3LFM A;  4CPB D;  3OBZ A;  4UI9 L;  1AR8 3;  2IUW A;  3MF9 A;  3MIE A;  4RD7 A;  4RQP A;  3I2O A;  1XNA A;  5FYT A;  4AED B;  1YYN A;  2VW1 A;  3ZXA C;  1WZX A;  2VOT A;  2JE9 A;  4GA9 A;  3SIS A;  2EXH A;  1FXZ A;  2JB4 A;  4Y24 A;  2PAK A;  2ILM A;  2Y64 A;  1F15 A;  2WFF 1;  4XXA A;  4BWO A;  4WVM B;  2QUO A;  2MHF A;  3B9C A;  4Q2F A;  4CEW C;  2YZ4 A;  5FTT C;  5KHI A;  3QH6 A;  4E9K A;  1QJU 3;  5IT6 A;  4RN5 A;  1U5I A;  4KQ7 A;  3VBH B;  2YPD A;  2ZGS A;  4UFJ A;  4N90 A;  3T2Q A;  3LPG A;  4IEZ A;  1R09 2;  4H7L A;  1AYM 1;  4MGS A;  3ZFF B;  3VD4 A;  1PIV 2;  4PIY A;  4LBO A;  1C8M 1;  4MHU A;  1NE6 A;  3ATG A;  3W59 A;  1QJU 2;  3T0D A;  4Y20 B;  4W8J A;  3VBO B;  1JI6 A;  2K46 A;  1DCS A;  4N43 B;  4XUN A;  5F6K A;  5FY4 A;  2XJQ A;  4KI5 M;  4RQP C;  1FV2 A;  5JIA A;  3ZFF C;  4P5H A;  1DFQ A;  1GP5 A;  5FZ9 A;  1E5I A;  1HLC A;  1V6M A;  1MZ5 A;  2BYV E;  2WR9 A;  3MIC A;  5LRR A;  3ST7 A;  2Y6H A;  1W6O B;  3VBO A;  4AI8 A;  4AOC A;  4X8N A;  3AC0 A;  4D7S A;  2QQM A;  3GBW A;  1DBN A;  1VMF A;  4Q8K A;  4GH4 B;  1ZRC A;  3BCW A;  5A33 B;  3T2O A;  1CJD A;  2TUN A;  3C3V A;  4M00 A;  4XFC A;  3G6J B;  3ZFG B;  2XWB B;  4N53 A;  2W87 A;  2Y38 A;  3GJB A;  3MGU A;  4OMC A;  5DMY A;  3POB A;  1DQ4 A;  4C90 A;  2W0X A;  3UK9 A;  1TMF 2;  2D5F A;  2JG9 C;  3AP9 A;  2XJT A;  1WBL A;  1EP0 A;  3H7J A;  1AL2 2;  1VAV A;  1VRH 2;  3POE A;  5KC6 A;  5BNO C;  4JKM A;  4H3W A;  3URF A;  5A7N A;  1GP6 A;  1US2 A;  3NQH A;  4F7Z A;  1DHK B;  3FFZ A;  4CU9 A;  1OHF A;  5A3T A;  2PA7 A;  4CDQ A;  1JZ3 A;  5BNO B;  2JIC A;  2UWB A;  5T55 A;  4AHX A;  2ZHL A;  4Q4V 1;  2C5D A;  1OOP A;  3KHC A;  2R6Q A;  3VUO A;  4P08 A;  3BU7 A;  4ISQ A;  5I0T A;  5IVJ A;  4XQ4 A;  1EV1 3;  3PL0 A;  1KFX L;  1LEM A;  1W6Q B;  3PME A;  4MXV A;  3WSO A;  2A6X A;  5FZO A;  2A73 B;  3O1O A;  1DF0 A;  5L7O B;  4HAN A;  3IDB B;  3M2M A;  1NXD 1;  2PHL A;  1UZW A;  5IAT A;  1VBC 1;  4XFH A;  1ND3 A;  3V56 A;  1OFN A;  1A34 A;  2UYB A;  2B5H A;  4L0P A;  5JPN B;  3BAL A;  4A7Z A;  2WZR 3;  3ES4 A;  2JE7 A;  1QXP A;  4IND A;  4CU8 A;  1NCR C;  5FYC A;  1L7Q A;  3SKV A;  1SLI A;  4XDQ A;  2VD7 A;  4K7J A;  2PXJ A;  2WFF 3;  3ZX7 A;  3I2D A;  2VCM A;  2VMF A;  3WDX A;  3VKN A;  1S4C A;  4IV1 B;  1W0O A;  4QB2 A;  1SLT A;  2BJS A;  2XON A;  1NY7 2;  2VY0 A;  2BVB A;  1LOB A;  2OQ7 A;  1MPX A;  1OVS A;  1PK6 A;  2WZ8 A;  2RJ2 A;  4GKY A;  5DAV A;  2R7E B;  4QPY A;  5L73 A;  3NO8 A;  4XFF A;  3U10 A;  3MV0 1;  4IV1 C;  1YQ8 A;  3N3H A;  4OQ8 A;  3KM5 A;  2B46 X;  1GOF A;  3LQC A;  1AYN 2;  1UCX A;  1AX1 A;  2RJL A;  3AXE A;  3T4H B;  3ILF A;  2RG4 A;  4MVT A;  4AVB A;  5FYV A;  1W28 A;  4EN6 B;  1ONA A;  1XJA A;  4ZU4 A;  2PMW B;  3AJY A;  1JUI A;  2UU8 A;  5EIY B;  3J8F 2;  3VHO A;  3K46 A;  1ZBA 3;  1NQJ A;  1WMD A;  3AK0 A;  4LOR A;  5JOX A;  3D0J A;  2WAB A;  3I97 A;  5C33 A;  4DB5 A;  2R06 2;  3NVC A;  4YW5 A;  3M7A A;  2VUA A;  3TN9 1;  2IXL A;  4FO9 A;  2VQ0 A;  4H7M A;  1JMU B;  3CMG A;  4P02 B;  2DCZ A;  2VTX J;  2VH9 A;  3I2F A;  4YM2 A;  1O4Z A;  4YRD A;  4B4R A;  1PVC 3;  3WLU A;  2AZ5 A;  3IPV A;  1ND3 B;  3KWV A;  2OZ6 A;  4XIO A;  3OB8 A;  5LBF A;  4BMB A;  4ERO A;  4XFI A;  1ACC A;  4HVO A;  2WO2 A;  5HCA A;  3O1P A;  4TLF A;  3U78 A;  1ZBE 3;  2RS1 2;  5CAZ A;  4IEW A;  4FXK B;  5C8C B;  1I6X A;  4RHV 2;  4D7T A;  4QHZ A;  5EZW A;  4FPG A;  4NJ4 A;  1TME 2;  2D6K A;  3WV6 A;  1UYZ A;  3J7N A;  5JXH A;  5DN2 A;  3HWJ A;  2ZGP A;  4UAP A;  1W6M B;  4HZF A;  3TYJ A;  3LA3 A;  1MZE A;  3M4F A;  2GN7 A;  1VBE 3;  4JHT A;  5EJZ B;  4OHZ A;  2QNK A;  1XYP A;  1YQ5 A;  2R49 A;  4NUB A;  2ZEY A;  1XU1 A;  4IEY A;  3MF6 A;  4L97 A;  5HCF A;  4E27 A;  4FPL A;  3RWK X;  3N36 A;  3L2H A;  4BME A;  1URX A;  1XPW A;  5JAX A;  2EAL A;  5KR7 A;  3ILN A;  2RS5 3;  2EIE A;  1VBA 3;  2IFR A;  1MQT C;  4NIH A;  5F5A A;  1W8O A;  1S0C A;  4PDW C;  3K77 A;  1Y9G A;  2F17 A;  4YGE A;  4YW4 A;  5K0U A;  4OI1 A;  4LUK A;  3T3Y A;  2XUE A;  4FFH A;  1VAL A;  3A7Q A;  4NRP A;  1I9R A;  3AMN A;  1JHN A;  3ZXL A;  2EXJ A;  1PVX A;  1U5Z A;  4BJ0 A;  2ZEW A;  4E2G A;  3LF7 A;  1PIV 3;  1VBD 1;  3OBT A;  3K4A A;  1NCQ C;  1RUE 1;  2OT7 A;  5LY2 A;  5A6Q A;  5FLI A;  2W1S A;  4M01 A;  3AL6 A;  3WG1 A;  1UIK A;  2EIB A;  1CON A;  4LBM A;  3WT3 A;  5I0S A;  4ZS3 A;  1OQE A;  1KRI A;  1HRI 1;  2JG9 A;  1JHJ A;  3GZT B;  4LOT A;  4MGK E;  2YC2 A;  1BZW A;  4ZY9 A;  5T54 A;  1AZD A;  1GOG A;  3CL1 A;  3WD5 A;  1DGL A;  3H3Z A;  1JN2 P;  3O5S A;  1GZW A;  2F4P A;  2A71 A;  4JTO A;  4GAL A;  1D4V B;  2JIG A;  4UW6 A;  2R32 A;  2RDR A;  1T6B X;  3BOW A;  4NWW A;  4RR3 C;  2OPW A;  4BOW A;  1RUI 3;  4YVS C;  2GSY A;  4Q27 A;  5CYY A;  2R1B A;  1VE0 A;  5ERL A;  1S0F A;  2WNU B;  1FNZ A;  1H30 A;  2FD8 A;  1YJL A;  1A8D A;  4JX0 A;  5FZ4 A;  5BNP B;  3RGB A;  2VCA A;  1ZVF A;  3OUI A;  2BEO A;  4AVV A;  4DEQ A;  4BA6 A;  1GIC A;  4AI3 A;  3BI3 A;  1OVP A;  2QFE A;  3WHU A;  4NHM A;  3U1X A;  4QX3 A;  1JYT A;  1QHD A;  4M4P A;  3N7M A;  4DRV A;  3O0W A;  4CCK A;  1D2S A;  3BUC A;  1PVC 1;  4Q0P A;  4XPV A;  2VNO A;  5FLH A;  4LUM A;  4XFG A;  3UKT A;  5BYN A;  3OYW A;  1CAX A;  3OGS A;  4EN7 B;  1U5Y A;  5FZ0 A;  1C4R A;  2X53 S;  1TEI A;  1RUF 2;  1PHM A;  4WM7 B;  1FT9 A;  3WDT A;  4YZ5 A;  4OUE A;  1TZO A;  1CAV B;  1KJL A;  3F95 A;  4UFM A;  4EN0 A;  3LA2 A;  2DU0 A;  1UO9 A;  2WLQ A;  5F37 A;  4Q0V A;  4BK4 A;  5FLJ A;  5IVY A;  4Z8B A;  4IQP A;  4YYO A;  3T1M A;  3DXU A;  2BBV A;  1QQP 2;  5CG9 A;  5G04 L;  4QDR A;  1R08 1;  1POV 1;  2JDP A;  5FR3 A;  1AR8 1;  3UL2 A;  4XJA A;  2CSG A;  3ZYJ B;  1OKO A;  2IXK A;  2W47 A;  4M3C B;  1JZ6 A;  4LO7 A;  4QQL A;  1PNG A;  2VPV A;  2YGL A;  3BVC A;  1PO1 2;  3ENR A;  3NJZ A;  4XFB A;  1BBT 1;  3VKL A;  2D43 A;  1W8W A;  5IAV A;  5JVV A;  5A80 A;  1SEF A;  3V0A A;  1OUR A;  3JBG 2;  2ET7 A;  4R52 A;  4ATE A;  2VCB A;  3Q8C A;  2D40 A;  4OUS A;  4XBL A;  3VKF C;  2QQK A;  3S7E A;  4XF4 A;  5KHG A;  2AR6 A;  2LAL A;  2HWC 1;  1H1M A;  4LQR A;  4XEZ A;  4NIA A;  4YZ2 A;  5CB7 A;  3ITQ A;  4COW A;  1W2A X;  2NLR A;  1GQP A;  2DCK A;  1O5L A;  1KS5 A;  1WMX A;  2EXK A;  5DUV A;  4P9J A;  3H1W A;  4XJ8 A;  3UET A;  4JQR A;  2HBU A;  1AR9 3;  1F35 A;  1VAM A;  1HRI 3;  2D6O X;  5C9A C;  4QQP A;  1NKG A;  3BTA A;  1HB3 A;  2JDH A;  5JSO A;  3ZXF A;  1CES A;  5CFD C;  4FPO B;  5FP3 A;  4XAE A;  4BQW A;  2NP0 A;  3WHT A;  2QQP A;  4FTE A;  3MID A;  1SBF A;  4DIQ A;  1H4H A;  2AEY A;  4FVV A;  5FWE A;  5GAL A;  2ZKN A;  3OSD A;  3NJV A;  3I54 A;  1VB4 A;  1RXG A;  1B35 B;  1VMJ A;  2X5I A;  4K8R B;  3ZN4 A;  5HCH A;  3FLP A;  3H3L A;  3BOP A;  4LBQ A;  2V73 A;  2WT0 A;  3MZH A;  3WUD A;  2F4L A;  1SDD B;  4BQ3 A;  5A3N A;  5ISL A;  1Q5O A;  4FOY A;  5C5U A;  3SXW A;  4E4Z A;  5E6H A;  3VL8 A;  3OPZ A;  1V6L A;  4HN1 A;  4XAA A;  4CUC A;  4XUT A;  3VZO A;  4DFS A;  3R6S A;  3AZV A;  3WQ0 A;  5FP9 A;  2VOK A;  1F5J A;  3J7M A;  1JZ7 A;  4MV2 A;  3B9I A;  2CU5 A;  4OHV A;  4FFI A;  2WNV B;  3ZYG A;  1KQR A;  1K5M C;  5T3N A;  3NNF A;  5FY1 A;  2Z69 A;  3BTY A;  4CSW A;  3BGA A;  4RS5 C;  3KV5 A;  3SMH A;  2E32 A;  2WLP A;  4NHL A;  1WCU A;  4WM7 A;  5DDJ 2;  4AEJ A;  1CX1 A;  2DBI A;  3Q8E A;  1E5R A;  3HNB M;  4IEU A;  3POS A;  1XBF A;  3A0N A;  4ITC A;  4QHB A;  2MEV 3;  3VV1 A;  2E53 A;  4P5Y A;  1BEV 3;  2PHT A;  4EWA A;  2OX0 A;  2VUC A;  1V9U 1;  4KWU A;  3ON7 A;  1CAW A;  1ZZC A;  2VUL A;  3MUZ 1;  4J1X A;  4XW3 A;  3OBA A;  5T52 A;  4KG0 A;  2ZBJ A;  3BB6 A;  5DPN A;  3VBF B;  2VUJ A;  4QKF A;  3ZSE A;  2D98 A;  1DYP A;  1EUT A;  1Y9M A;  2WZR 1;  3AP4 A;  3BIW E;  1QOS A;  1Z7S 2;  3FWE A;  4H2A A;  5JR2 A;  2JE8 A;  4AFD A;  1NYW A;  1VB2 A;  2B4K A;  3QLQ A;  5AFE A;  5J36 A;  4QX0 A;  1QDO A;  3IM0 A;  4LO4 B;  4UFK A;  2WS9 2;  4CP1 A;  1DQ2 A;  3SCF A;  5F3E A;  5K7P A;  5FZ6 A;  2DUQ A;  2VC9 A;  3K3N A;  1OLQ A;  2ZGN A;  1SCR A;  4DXR A;  2J7M A;  4PLN A;  4OLL A;  1RUJ 3;  4V2V A;  3HR9 A;  4QPI B;  2DUP A;  1HN1 A;  4LE3 A;  4XZU G;  5JDB A;  5LEJ A;  2Z79 A;  5A1L A;  1RUC 3;  1PGW 2;  2GNB A;  3ZMO A;  4CDU A;  5C7G A;  1UZZ A;  5FDB A;  1JYW A;  1DZT A;  1OT5 A;  1W8F A;  2YY1 A;  4QPI C;  4AGG A;  5F5Q A;  2WO1 A;  2BDR A;  4AGR A;  2ZHM A;  1AR9 1;  3ZXD A;  1IGO A;  1H8T C;  2XHK A;  4XC9 A;  3VLB B;  4C91 A;  2HKX A;  2J1S A;  3T0A A;  4E4S A;  2WS9 1;  4XDO A;  3P6B A;  1IPJ A;  1QJX 2;  2WN2 A;  1D0H A;  1DU3 D;  4XTM A;  1YQ2 A;  4F83 A;  5A6Z A;  2JG8 A;  3WW3 A;  5CZK A;  1ULC A;  1O6U A;  4IER A;  4XBN A;  2WQZ C;  4R9A A;  4P9X A;  1REF A;  3T08 A;  2BV4 A;  4IGQ A;  1V6N A;  3E5X A;  3VBR C;  3CDZ B;  3ZO0 B;  3NNL A;  4FQZ A;  4CYD A;  2WYF A;  1RUG 1;  1UYP A;  4Q0S A;  1WA6 X;  3ZXK A;  2OS2 A;  1WBF A;  4B4P A;  1NE4 A;  1MZ6 A;  2JDY A;  2PHU A;  3K4Z A;  3I3B A;  3OJB A;  4EYU A;  3D4K A;  3POF A;  1UX6 A;  2HEW F;  4LOS A;  5FZF A;  3WR0 A;  3ZFG A;  2LM3 A;  1W99 A;  1LGC A;  1SAC A;  1LU1 A;  1RC6 A;  2C4X A;  2WNE A;  3AYD A;  3PVN A;  3ZR6 A;  3NAP C;  5B2G B;  3U37 A;  4XF0 A;  4ZXE A;  1ULE A;  4O9G A;  5C8C C;  4QKN A;  3VBS B;  2QDN A;  2UY9 A;  3LIH A;  4UXA A;  1YLL A;  2R07 2;  4HFS A;  3LE0 A;  1AXK A;  5H9S A;  3SCG A;  1GWL A;  5C3R A;  1J1L A;  3FUO A;  2BGP A;  4H55 A;  2WWJ A;  4OMD A;  4QM9 A;  1L7R A;  3AZZ A;  4ZON A;  3BPS A;  4CDQ C;  1WD4 A;  1MS8 A;  3WP4 A;  5I0R A;  3OCP A;  4D8M A;  4CE8 A;  4E8D A;  4P14 A;  3HNY M;  1ZYB A;  2VNR A;  4MGT A;  2WWS A;  2ZKL A;  1QOO A;  1MQT B;  2B42 B;  2NQY A;  3ACH A;  4CP0 A;  3VDD C;  3WXP A;  5FZA A;  2WT1 A;  1S2B A;  2C9A A;  3HT1 A;  4GWN A;  1VBD 3;  2D93 A;  1YRZ A;  2ETE A;  3B5L B;  2LS6 A;  4XF1 A;  3NRU A;  2JJ6 A;  4FCA A;  4WBB A;  2EAK A;  4J25 A;  2XH6 A;  1FMD 2;  2ZGL A;  3K75 B;  1C8M 3;  2ZAH A;  3M3Q A;  3QH7 A;  3ZOI A;  4DY5 A;  5A32 B;  3MI8 A;  2ZGU A;  3HVD A;  3ZR5 A;  1H8T B;  3A21 A;  3I8T A;  4HON A;  2I74 A;  1SBD A;  2RE9 A;  2Y6L A;  3CZJ A;  3N9M A;  5JCT A;  3I2G A;  2O8Q A;  3N9P A;  4LBL A;  5FP7 A;  1X33 A;  1W2O A;  3LFI A;  3RZJ A;  1SQ4 A;  3GF6 A;  3ZXE A;  5FYI A;  3JQW A;  4FI9 A;  1JOP A;  4X8P A;  3SHR A;  4QU1 A;  3VBH C;  4JCK A;  1XE0 A;  1XRU A;  1Z78 A;  1ZZ6 A;  1QKQ A;  3UV9 A;  3VBS A;  4Y33 A;  4IEO A;  4PQQ A;  1FV3 A;  1RUI 1;  4XJ9 A;  5KBF A;  2XJP A;  3J9S A;  4XUO A;  1JYN A;  1H1I A;  1RUF 1;  1XSQ A;  5BY5 A;  1ZRD A;  4DOU A;  5J96 B;  1REE A;  4RGA A;  1TNR A;  2V4A A;  2RM2 2;  2VGD A;  3GZE A;  2BWA A;  2VL4 A;  3DGT A;  4PQ9 A;  5E16 A;  5FZB A;  1O8S A;  1DDL A;  3GZA A;  5F2S A;  3NV3 A;  4D0Q A;  5IK5 A;  2C6S A;  1C28 A;  3M8L A;  3VB9 A;  4UT5 A;  3WW1 A;  3PUS A;  2XWJ B;  3ZMN A;  4NVP A;  5LBE A;  1XQN A;  4CDW B;  1AR8 2;  2VEC A;  3WDY A;  1X82 A;  3E6D A;  5BNN A;  1AR6 1;  1RUG 3;  3WNX A;  1UL9 A;  2VO5 A;  3VZL A;  2JDZ A;  1ZRF A;  5LAS A;  3WDW A;  5ACA 2;  1FMD 1;  1QJY 2;  2Q30 A;  3ZFG C;  2OII A;  3BN6 A;  2W5F A;  1G9C A;  4K9S A;  1V6J A;  1OOP B;  3EHK A;  1M06 G;  2OPK A;  4FP2 A;  4Q5O A;  5C4W B;  1HB4 A;  4QHO A;  5IYY A;  1WLT A;  4HKL A;  4W6Y A;  2HWF 2;  2XLG A;  3U75 A;  1W05 A;  2WC2 A;  2WAO A;  2DBN A;  4I30 A;  3DXT A;  1W0P A;  5IK8 A;  3ZIW A;  1VBC 3;  3GGL A;  4GWJ A;  4JGZ A;  5FQ0 B;  2WL1 A;  4UW5 A;  4GB3 1;  1LEN A;  2JDK A;  1UU6 A;  1HW5 A;  1TNF A;  2J1T A;  3H8R A;  3HMY A;  5A1F A;  3KHB A;  4PF5 A;  4NN0 A;  4JKK A;  1YO8 A;  3KV6 A;  4Q8L A;  4HOO A;  4N43 A;  1RL3 A;  2VM9 A;  4ZS2 A;  5EYX A;  4CEY B;  5FMB A;  1QU0 A;  2PFW A;  1SLL A;  4LBQ B;  4BK5 A;  2IXC A;  3O14 A;  5FZL A;  1ZM1 A;  2R07 1;  4GAZ A;  5LBB A;  1X9T A;  4XHB A;  4FT8 A;  3AFK A;  2GC0 A;  3DEM A;  3SQO A;  5FRE A;  1OXC A;  1C8N A;  4JVA A;  5IUQ A;  1GMM A;  5LA2 A;  1QNY A;  1ND2 A;  5HBA A;  5BNN B;  2YG0 A;  3RYK A;  1LOF C;  3IWZ A;  3NMB A;  1X8E A;  4K6B A;  5JOY A;  5LK7 B;  4MYE A;  4NII A;  4CDW A;  3NV2 A;  2HWD 2;  2WNO A;  4XCB A;  1Y3T A;  4N53 B;  3RQ0 A;  3NV4 A;  2MNG A;  4QGM A;  2O0O A;  5C3Q A;  3KSC A;  1S0B A;  4I0A A;  1UY0 A;  1XND A;  4ZU5 A;  4DRR A;  4YWA A;  5GZD A;  4IE7 A;  2CY6 A;  4EV0 A;  2XKP A;  1ZNP A;  2H0V A;  2RDN A;  4YAR A;  5EXO A;  2QVS B;  1GQG A;  3MFA A;  4FPJ A;  5FBZ A;  4XYX A;  2Z42 A;  1VBB 3;  1UMI A;  2AYH A;  4Y26 A;  3G7D A;  2VXJ A;  2DWR A;  3WCR A;  3AKP A;  2DVD A;  1LU2 A;  1H2K A;  4Y20 A;  5FZK A;  3IIA A;  4DUX A;  3BOD A;  4WVW A;  3KV9 A;  4CRQ A;  3ZFE A;  5HV4 A;  4QB1 A;  3H8X A;  5DZF A;  1RUF 3;  2D44 A;  4P9G A;  4HG6 B;  1Q43 A;  1XNB A;  3C7G A;  2XG3 A;  1TE1 B;  1ZBE 1;  3VBR B;  2W92 A;  5K0U B;  4A44 A;  3ZYH A;  5K9Y A;  4L92 A;  3ZYP A;  1FOD 3;  5I91 A;  2FDJ A;  3VN4 A;  2VW2 A;  1UAI A;  5HV0 A;  1JZ8 A;  1NOV A;  1H2L A;  1X50 A;  4RR3 B;  2A6Y A;  2A1X A;  1UY4 A;  1SFY A;  1OPM A;  2YGM A;  4Q4Y 2;  1L7L A;  2HWB 2;  2WBK A;  3MEP A;  1VBE 1;  4P9Y A;  3RS6 A;  5C6C A;  3BTZ A;  4QPG B;  2DUO A;  5EYY A;  2Y6K A;  1OQD A;  1RHI 3;  4RSU A;  2RJK A;  2XJS A;  2AAC A;  2BUK A;  4I01 A;  3MIH A;  1OA4 A;  1W6P A;  4TWT A;  5DAW A;  4I02 A;  1PO2 3;  1VBA 1;  2BOI A;  2XJU A;  3M70 A;  5FXV A;  4W50 A;  3CU7 A;  3N9N A;  4Y1V A;  1SPP B;  1PGL 1;  3S0M A;  2XHN A;  3ACG A;  2FMY A;  4X6Q B;  3P3P A;  4GJY A;  4LE4 A;  3ACL A;  5IFT A;  2GAL A;  2Y0O A;  1AHS A;  5H9Q A;  4CDX C;  5KXC A;  3FE5 A;  4PDW B;  4LBJ A;  1OA3 A;  2DTY A;  3VL9 A;  2BFU L;  1OMI A;  5FYH A;  3WY6 A;  2VR4 A;  5JSP A;  2AEN A;  2K9Z A;  2GNM A;  2BFU S;  4ISR A;  1AYM 3;  1APN A;  4MZU A;  1G9F A;  1VIW B;  5T5L A;  3U07 A;  1JOJ A;  1DYK A;  2P37 A;  3EB7 A;  3FUQ A;  4XDP A;  1ZRR A;  3VDB A;  2VZP A;  1NCR A;  1JH5 A;  2WYS A;  5GM0 A;  4JRL A;  2ZPX A;  3PUR A;  4MLO A;  2QQW A;  1S0J A;  1SFP A;  4NRO A;  1LEC A;  2QJV A;  4KGG A;  2BBA A;  4YFZ A;  1LOF A;  1GOH A;  2D6P A;  3T2T A;  1RB8 G;  3SIT A;  5FZM A;  4AHW A;  1BQP A;  1HQW A;  1W2U A;  2FDH A;  4AF9 A;  2EAA A;  1WLD A;  5CG8 A;  4E2S A;  1LGB A;  3OTF A;  2YHJ A;  5K8S A;  1F4A A;  5F3I A;  3ACI A;  1IQA A;  2HYK A;  5FMO S;  5A3W A;  2D5H A;  2RR1 2;  3DF0 A;  3PTR B;  3QBQ A;  4CCE A;  5JI9 A;  2D6M A;  1IKQ A;  1AR7 2;  3VKM A;  3GBF A;  5LWB A;  4TTG A;  2VZR A;  2B45 X;  4AG4 A;  3Q8A A;  1BXH A;  1R1A 2;  4N43 C;  4JDO A;  2C26 A;  2HWE 1;  4K1Y A;  4LLF A;  3T1L A;  1VBB 1;  3AMQ A;  1O3R A;  2QQU A;  4LK7 A;  4XE9 A;  1IS6 A;  2IXH A;  5C3S A;  5F5C A;  3CJX A;  2A6Z A;  1D7P M;  5EPA A;  5A7W B;  4QX1 A;  3WF3 A;  4E4H A;  1GZW B;  2P5B A;  5F3C A;  4ONU A;  2WDB A;  4L9B A;  5DDJ 1;  4CVU A;  1BKZ A;  1TMF 1;  4CP9 B;  2PLV 2;  3J7H A;  3SEP A;  1F9K A;  2XJR A;  1RUH 1;  3O1V A;  1Y43 B;  1TME 1;  2PHR A;  2PHX A;  2WNU A;  4QU2 A;  4S2D A;  3PDQ A;  4JKL A;  1H1A A;  1ULO A;  3Q8B A;  4IE4 A;  2P34 A;  4YW7 A;  4ZZ8 A;  1UZV A;  1GYK A;  4RGG A;  1OD3 A;  4MGY E;  4J6G A;  3O1S A;  2X8K A;  1CZS A;  4LIV A;  1JU3 A;  4M3C F;  5DG1 A;  4YVW C;  1R08 3;  4AFM A;  5AC9 1;  5E88 A;  2O8O A;  5DUW A;  3JBG 1;  2WT2 A;  1ZZ8 A;  2Y33 A;  3N7K A;  3WF2 A;  3LD8 A;  1RVF 1;  1YXW A;  5D8A B;  4AFB A;  1HRV 3;  1LAJ A;  2AUY A;  3WVJ A;  1ZZB A;  4A2U A;  2OUH A;  4Z2A A;  2XLA A;  1PMI A;  2XR4 A;  3ZFF A;  2VW0 A;  1ODN A;  1EPZ A;  1OF4 A;  3HIF A;  3JQX A;  1O7F A;  2ZMN A;  3LDK A;  4IE5 A;  1IG3 A;  1KIT A;  1KDK A;  2X10 A;  1IHM A;  2IXI A;  1FNY A;  5GKA C;  1CD3 G;  5FZD A;  5EJ3 A;  2R16 A;  4LNV A;  3VDA A;  4JTN A;  1KJR A;  1W6O A;  4P9L A;  3V64 A;  4MGI E;  1CAW B;  4GB3 2;  4RL7 A;  5GLT A;  5AC9 2;  2BER A;  1CGP A;  3N7J A;  1J84 A;  2WFF 2;  5LY1 A;  1DGR A;  5A1A A;  2P4E A;  1NCR B;  3GZU C;  3M3O A;  1YIP A;  1LUL A;  5IHR A;  4LO5 B;  4W65 A;  1EPW A;  5A32 A;  3N9L A;  1HDK A;  3ZVX A;  3WIN E;  2HWC 2;  3AP5 A;  1OH3 A;  1ULG A;  3KQR A;  2GME A;  2JDU A;  1OD5 A;  4CEW A;  3LEI A;  3A0K A;  3TN9 3;  3GBG A;  2XLF A;  4CUG A;  2ARE A;  2JDA A;  3JB8 A;  4ZZ5 A;  3NNM A;  2BGO A;  2BQP A;  2Y8K A;  1OLR A;  4Y1X A;  4PT6 A;  1CZV A;  3I2H A;  2YRO A;  2Q1F A;  2E51 A;  2VMC A;  3VD5 A;  3N7L A;  4ZU7 A;  4NAO A;  2I07 B;  3WW4 A;  3VHN A;  5FPU A;  4AQ2 A;  2G4I A;  1DGR N;  4FOQ A;  1OH4 A;  3K4D A;  4CDU C;  1Y7B A;  3PU3 A;  3RSJ A;  4P9I A;  1Q8O A;  3HJR A;  4L2N A;  4D3W A;  3IAQ A;  5DAX A;  4GMP 1;  1V00 A;  3ETP A;  3SLI A;  1OC1 A;  1UZ0 A;  4D7Y A;  1YUD A;  2O1Q A;  1DIW A;  5FO9 B;  3R4S A;  5CNA A;  3FLT A;  2KR2 A;  4IDZ A;  3MW4 A;  1AXY A;  1W6N A;  3M3C A;  5D21 A;  5EP9 A;  3RDI A;  4YVW B;  1MEC 3;  2KXL A;  5JOW A;  1S0I A;  2VZ3 A;  1ASJ 2;  1GQH A;  1O4T A;  3NKG A;  1TMF 3;  2PQQ A;  1RJ8 A;  2B9V A;  1FMD 3;  2A75 A;  3J26 N;  4AWD A;  4Q1P A;  1RUG 2;  2J42 A;  1G8W A;  1CIW A;  1RUH 3;  2ZZJ A;  4Y22 A;  5GLU A;  2SLI A;  4JAA A;  5FUP A;  4CTE A;  3BTX A;  2LUW A;  3RZG A;  2P6H A;  2RS5 1;  5H9P A;  1W04 A;  1W39 A;  2JX9 A;  1OA2 A;  4R4X A;  2JD9 A;  4D69 A;  3MLL A;  5C3O A;  2PYT A;  2FDF A;  1BEV 1;  4AVC A;  4QGN A;  3I3D A;  3PNA A;  4PBO A;  4QT6 A;  3FFQ A;  5BNO A;  2QE3 A;  3GAL A;  4OHX A;  3I3Q A;  3ZSJ A;  3DN7 A;  1BCX A;  1GV9 A;  4GB3 3;  3JCI A;  4XJZ A;  3I2I A;  1SCS A;  3OY8 B;  2CDO A;  3AL5 A;  1RVF 3;  1W8Z A;  3K3O A;  1UWW A;  2EA7 A;  1RUE 3;  4JZR A;  4NHX A;  2GP5 A;  4ET7 A;  4YPJ A;  2ENR A;  2QQN A;  2Y34 A;  3KCX A;  4HET A;  1TVG A;  2RM2 1;  3FBY A;  4M3C A;  4DXZ A;  5L9R A;  1H0B A;  4BLJ A;  1OPO A;  3GDB A;  5CFC A;  1ALY A;  2FQP A;  1QWR A;  4Y1Y A;  1MEC 2;  4MGZ E;  4C8D A;  2HLE A;  2ZGM A;  2G9Z A;  4NPR A;  4IL7 A;  1SLC A;  4FAH A;  5L7O C;  4OYU A;  1F8V A;  3ZPY A;  2E7A A;  4AVT A;  4XAC A;  1UX7 A;  5C5T A;  3CKH A;  4QDS A;  3PTY A;  1RUC 1;  2W3J A;  5GZG A;  1DZR A;  2QKD A;  2VOW A;  3AP7 A;  3VBF C;  2D3P A;  4RHV 1;  1PX4 A;  4CEW B;  3KMH A;  2G9G A;  4QGL A;  4U36 A;  1NCQ B;  1SBE A;  1VBD 2;  1NA1 A;  3I7D A;  3O12 A;  3GCW A;  3MUY 1;  5IVF A;  4HVR A;  1J83 A;  2RVA A;  4Q4X 2;  5JSR A;  4AE2 A;  3A4U A;  5I0U A;  5LCW L;  2WO3 A;  1A3K A;  3MLJ A;  2HEV F;  1LHO A;  1WW5 A;  3HBZ A;  1UF2 C;  2ZOE B;  3INA A;  1ZRE A;  5JZG A;  2EVX A;  5ABJ A;  3PUI A;  3IDC B;  4YW2 A;  1UY2 A;  3DV8 A;  1AJO A;  1W8U A;  1IOA A;  4I3G A;  3TN9 2;  1U5X A;  1GSL A;  2R06 1;  5LA0 A;  4DXS A;  1O3T A;  5FJK A;  2OVU A;  4RA0 A;  4Q1R A;  4I3P A;  3KGL A;  2WUH A;  2GZW A;  3ZYF A;  4AFC A;  4C1X A;  2VZS A;  4XAB A;  1OSG A;  3AP6 A;  3KVA A;  4IEV A;  3TEZ A;  4XUQ A;  4AFA A;  1LKN A;  2GC3 A;  3AXD A;  3OGG A;  4PLO A;  5LRS A;  2CHH A;  1T6G C;  3JUU A;  1FOD 1;  4Y3O A;  5M0T A;  1NZI A;  1PM7 A;  5JUV A;  4DO0 A;  2JD4 A;  2BZD A;  2RS1 1;  3K2O A;  3KGZ A;  1XU2 A;  4AHZ A;  2VZU A;  5C70 A;  5J7M A;  3H7Y A;  1WLW A;  2YFU A;  5FV3 A;  5BNP A;  3NAP B;  1Y4W A;  3CO2 A;  2CTV A;  4PI0 A;  4PLM A;  3I59 B;  1GWK A;  4HBN A;  2X05 A;  1WCQ A;  1OLM A;  1RHI 1;  1ND3 C;  2V5D A;  4IGO A;  1A8M A;  1A6C A;  4FOW A;  5KHK A;  2WSU A;  1BBT 3;  1PO2 1;  3III A;  4KWK A;  4FFG A;  2W9X A;  5C3P A;  1Z7S 3;  4Z82 A;  2P1B A;  1JZ2 A;  3V0A B;  2GC1 A;  3NL1 A;  3U14 A;  1W9W A;  2XJV A;  1R08 2;  4UFL A;  2QQL A;  4HK8 A;  3O1R A;  2J1U A;  2RMU 2;  2JG9 B;  3DL3 A;  2HWC 3;  1JS9 A;  2XDV A;  4HK9 A;  3E5U A;  4G4F A;  4C1W A;  5JMO A;  3WUC A;  5JXI A;  5ABJ B;  1YHF A;  3RZL A;  4K21 A;  4CU7 A;  5HI0 A;  1R1A 3;  4LA3 A;  4TSV A;  3FHQ A;  4KG8 A;  1RVF 2;  3PVO A;  4LO8 A;  2JKX A;  3UES A;  1W2T A;  4QKD A;  1R64 A;  2FCT A;  3THC A;  2WKK A;  1UD1 A;  1TG7 A;  2RR1 3;  2W94 A;  2WQ8 A;  3CNA A;  2CAV A;  4B29 A;  3E97 A;  2Y6G A;  4XQD A;  4MH0 E;  4YG6 A;  4JHZ A;  3THD A;  2ZX2 A;  2Q8C A;  4ZKT B;  4O9E A;  3RMX A;  3KF3 A;  3I2K A;  1W3X A;  5HPO A;  4CP9 A;  1EAH 1;  1E5H A;  2CGO A;  3FHA A;  2ZS6 B;  1CN1 A;  2DCY A;  2GNT A;  3THP A;  2FDG A;  5GLV A;  4J1W A;  3PIG A;  4BZ4 A;  2HEY F;  5IVB A;  1V6I A;  2HWB 3;  5FFO C;  2Q4S A;  2ES3 A;  3AKT A;  4HMZ A;  4N7I A;  1MS4 A;  4HN0 A;  4UW4 A;  5FJH A;  2GMP A;  4OZO A;  4KMQ A;  4LKE A;  2OA2 A;  3GHM A;  4XXP A;  4YGC A;  1QH7 A;  2DFB A;  2YDE A;  3AMM A;  4FPC A;  1WW4 A;  1CVN A;  1SLA A;  4AQT A;  1OI6 A;  4ARY A;  1ST8 A;  1WW6 A;  3AKS A;  2ZGT A;  1M4W A;  4XUP A;  4XMA A;  4OUM A;  1BEV 2;  2GP3 A;  4MOA A;  4AI0 A;  3DYP A;  1NUK A;  2HWE 3;  2VQT A;  3P5B A;  4HKW A;  5BUV A;  3C2U A;  4I2O A;  1UOB A;  4AHY A;  1ZX5 A;  2NYY A;  1VBE 2;  3U4S A;  3FJS A;  2RS3 2;  1H9P A;  5A6Y A;  2HWF 1;  5FYZ A;  5L7O A;  4A3Z A;  1NT0 A;  4GH4 C;  3K48 A;  1AYM 2;  1PGS A;  4Z07 A;  4CZS A;  3BYW A;  2VTF A;  1RMU 3;  1C1L A;  3MLK A;  1AL2 1;  3OD4 A;  4M0N A;  4RQP B;  4AEK A;  1K42 A;  1HB1 A;  4FPY A;  1CR7 A;  4GMP 0;  2NPI A;  1ZBE 2;  2RS1 3;  4NHY A;  4W6X A;  1LRH A;  2WQ4 A;  3N9Q A;  1MQT A;  2RS3 3;  4YVW A;  4FBF A;  4OI0 A;  1PK6 B;  5FY0 A;  2ORZ A;  4L11 A;  2X29 A;  1VP6 A;  3MYX A;  4AR2 A;  1CX4 A;  1E57 A;  5FPX A;  4QXC A;  4TZD A;  5C8C A;  1HRV 1;  1NLS A;  2YV8 A;  5FO7 B;  5FO8 B;  1GR3 A;  4BQY A;  3O1U A;  4NOT A;  5FZ8 A;  4GKX A;  1AX2 A;  1YFU A;  4IE6 A;  4OHW A;  5EFU A;  3WDU A;  4Q29 A;  4QPW A;  4B1M A;  1W6Q A;  5FY8 A;  3UYJ A;  1YQC A;  3CJI C;  2J1E A;  1S0E A;  1W6P B;  5GZE A;  3VBU B;  3V0B B;  5F2W A;  1BBT 2;  4XTP A;  5HCB A;  1C8M 2;  3HEI A;  5J09 A;  1PGL 2;  1HV0 A;  1N3Q A;  3M3E A;  4F3J A;  4MG2 A;  3KS7 A;  2VBP A;  3ES1 A;  3SEE A;  1YWK A;  3WEZ A;  5IFP A;  2MPF A;  2Q8O A;  2XOM A;  1HXS 3;  3MV1 1;  4KWJ A;  5CKQ A;  2VG9 A;  2CV6 A;  2UUR A;  3WZ1 A;  4CDQ B;  4MXW A;  1R09 1;  5A3M A;  3OPW A;  5E89 A;  3SKJ E;  4NO4 A;  1YQ6 A;  1NX9 A;  3CZU A;  3OD0 A;  4O7X A;  1WCD J;  5FYB A;  3T09 A;  4A6O A;  1POV 0;  1QIQ A;  2C1F A;  2VOV A;  4GXL A;  4CEY C;  1N1Y A;  2GAU A;  4YSF A;  1RED A;  1UU4 A;  4XOG A;  4N53 C;  1PZ7 A;  3IAP A;  5EV7 A;  1I3H A;  1MS1 A;  3W9A A;  5IVC A;  4IEP A;  1YI9 A;  1OLM E;  2IVJ A;  1HV1 A;  1YFY A;  1O59 A;  3B00 A;  4QX8 A;  1NZC A;  1FI2 A;  4SBV A;  4TN7 A;  3RVH A;  4DEV A;  1H9W A;  1N3P A;  2VJX A;  3CLP A;  4GWI A;  4AQ6 A;  2QQJ A;  2Y0I A;  5IVV A;  4LT5 A;  4L8Q A;  4D6S A;  1KD7 A;  2ZGQ A;  2NMN A;  1PNF A;  4UOJ A;  1MS9 A;  1WUV A;  4ZPI A;  2QBX A;  2XL7 A;  3RNS A;  4G3Y C;  3ZFE B;  3PUH A;  1WME A;  1QQP 3;  4GMP 3;  3AM2 A;  2W95 A;  3VZM A;  3WCS A;  1RYY A;  2NZ9 A;  2H0B A;  2C9K A;  3FZ3 A;  3I49 A;  3ZFE C;  1HX6 A;  1GWM A;  3AVR A;  1F5F A;  4A45 A;  3VGI A;  1UPI A;  1QOT A;  3U11 A;  1XNK A;  5FIX A;  1MEC 1;  2VBB A;  2VTX A;  2HWE 2;  5FZ3 A;  3WNO A;  4PIX A;  3A22 A;  3TNP B;  3WF1 A;  1GUI A;  2WWU A;  5DAP A;  3PJY A;  5HXM A;  1QDC A;  4FP3 A;  4R9B A;  3S5A A;  4NIG A;  3EQE A;  3IKW A;  4G9S B;  4XJU A;  4XVH A;  4Y5T A;  1ENR A;  2E7Q A;  1QY4 A;  1RMU 1;  2Y60 A;  1VBB 2;  4JQT A;  4NWV A;  1ENQ A;  1QJY 3;  1RIT A;  1LJ7 A;  3CJI B;  2CWM A;  2ARX A;  3MW2 A;  3E6C C;  3W20 A;  2N7G A;  4YW1 A;  4KL1 A;  3WW2 A;  5FZ1 A;  2Q1M A;  1RTV A;  2ID4 A;  3HN3 A;  3J8F 1;  4AAP A;  2Y6F A;  5C4W A;  2WZP P;  4QDQ A;  4DS0 A;  5LW9 A;  1FAT A;  2RS5 2;  5SV5 A;  4A41 A;  1AUY A;  2G1M A;  2Z5W A;  3RYR A;  4Q0Q A;  2RM2 3;  3C7H A;  5LB6 A;  4URA A;  1LHN A;  2VOX A;  5FYS A;  4Q4X 3;  5FMO L;  4DPN A;  5IWF A;  3VBU C;  2P3J A;  1NAE A;  2CYF A;  1VR3 A;  3UT0 A;  4XET A;  2R0F A;  1LTE A;  3O0V A;  2WA4 A;  1XB9 A;  4OUL A;  3POI A;  4HL0 A;  3OGV A;  5IVE A;  2VUD A;  1SDW A;  4EE2 A;  2IXJ A;  1GP4 A;  5FZG A;  1HXS 1;  2GMM A;  5L36 A;  4AED C;  4XF3 A;  5E8A A;  3POJ A;  2Y6J A;  4IEX A;  1AF9 A;  2DUR A;  1HQN A;  3RFR A;  3EJK A;  1EV1 2;  1V6O A;  2XGX A;  4TLG A;  4EN9 B;  3H8U A;  4AI9 A;  2PN5 A;  2FCU A;  2PTM A;  3OGJ A;  1ZZ7 A;  2X5I B;  3PLQ A;  3R4U A;  3UGF A;  3I3M A;  1LB2 A;  1VBC 2;  4OQ9 A;  4AAX A;  3H8O A;  2R1D A;  5L9V A;  2MEV 2;  3IDA A;  3J4U H;  1S55 A;  2FDI A;  1RUD 1;  2A6W A;  2WO7 A;  2WSV A;  5JZG B;  1FPN 1;  3LCP A;  3HAG A;  2ZHN A;  3CHX A;  3HQX A;  3HD8 B;  3USU B;  1VBA 2;  1J3P A;  2R06 3;  4Y4R A;  2YU1 A;  4BYY A;  3QCW A;  4D6Q A;  3GJA A;  2YPJ A;  5KC5 A;  4ORF A;  1HIX A;  3S5Q A;  5DG2 A;  4XIL A;  4BIF A;  5FZO B;  1DQ6 A;  1LOA A;  2VZQ A;  2DDU A;  5JR7 B;  2FBE A;  4W6W A;  2PEL A;  4IEQ A;  4XUR A;  1LOG A;  2ADE A;  2W91 A;  2D3R A;  5CKN A;  2ET1 A;  2Z2S B;  4OFG A;  4TXW A;  5D1I A;  3AB0 A;  1K12 A;  3DCQ A;  3ZDS A;  2VVF A;  1K3I A;  4JC1 A;  1U0A A;  2JXA A;  1WKY A;  3T2P A;  4DQA A;  2RHP A;  5AC9 3;  4PDW A;  5J98 B;  4CXW A;  5K0U C;  1K45 A;  2ZAB A;  2VZT A;  3IT8 A;  3LGR A;  3S57 A;  3ZYI B;  4BQX A;  2ZTN A;  4PCR A;  1WCK A;  1O4Y A;  1PK6 C;  1UY3 A;  1PZ8 A;  2ORX A;  1MS5 A;  3ZXG A;  1YFW A;  2PAM A;  5FPL A;  4L99 A;  3QAC A;  3I3E A;  2ZAA A;  3TNQ A;  5A3O A;  4FTB A;  2VZO A;  4R8H A;  2R07 3;  4IUG A;  4WVZ A;  2PQS A;  3T30 A;  3P1I A;  2BW8 A;  1IPS A;  1DG6 A;  3OG2 A;  4XJW A;  1HRV 2;  3ZSL A;  1YEW A;  1W8T A;  1OFS A;  4YNI A;  1PMJ X;  3J8F 3;  1N1S A;  2XB6 C;  2IFW A;  5FKC A;  3ELN A;  4CCC A;  4HVQ A;  2BNN A;  3ACF A;  4AW7 A;  4BE3 A;  2YC0 A;  2Q1Z B;  4BDV B;  3S7I A;  1GBG A;  3PHM A;  1GLH A;  1ULF A;  4Q4X 1;  1FAY A;  2L9L A;  4Q0U A;  4Z2W A;  3ECQ A;  1IS5 A;  2HH9 A;  1G7Y A;  1XNC A;  2QQV A;  1J59 A;  1S0D A;  3APB A;  3OOX A;  4CCL A;  1LHW A;  2W39 A;  2V4V A;  3TEY A;  2R04 1;  4FOV A;  4Z92 B;  4Y1U A;  2ZX1 A;  4CCJ A;  5FYY A;  4ASL A;  3RZH A;  3B7M A;  4V2W A;  3VDD B;  2EIG A;  4QQO A;  3AJZ A;  1UIJ A;  2BWC A;  1QJX 3;  2JEN A;  1OUS A;  2AGS A;  3PIJ A;  2RDS A;  4KU7 A;  2E6V A;  1UOF A;  3LKJ A;  2VBD A;  1BLZ A;  1LED A;  1OUX A;  3NV1 A;  1DQ5 A;  1QGL A;  3WNP A;  5C71 A;  1LHV A;  3TRS B;  1RUH 2;  3I59 A;  1IPK A;  1V0A A;  1NA1 B;  2XML A;  2GDF A;  4JRA A;  2J1V A;  3B3Q E;  3FMG A;  1AR7 3;  1US3 A;  1WD3 A;  4CDU B;  1SHW B;  3KCC A;  3H3U A;  4QX7 A;  1QMJ A;  5KXB A;  2R04 2;  2XBO 1;  5CFD A;  1G86 A;  3WP6 A;  4U2A A;  4DUW A;  3I4I A;  3D0S A;  5FUN A;  3RG0 A;  4B4Q A;  1VRB A;  1YIF A;  2TBV A;  5I8Y A;  1MVQ A;  1W9T A;  1CZT A;  4P00 B;  5A6X A;  2KM2 A;  4HSJ A;  1UYY A;  2BPA 2;  5CVR A;  2A5Z A;  3V0B A;  1W90 A;  2WIN B;  3U0Z A;  3E1F 1;  4BIS A;  1B35 C;  2KD7 A;  4MXW B;  4XHX A;  4LR4 A;  4B7E A;  3W5N A;  2LRP A;  2E63 A;  4LHK A;  1HN0 A;  5FUI A;  2OYZ A;  3VHP A;  5JXJ A;  2YFZ A;  5KXE A;  2EIC A;  4RGK A;  3RI9 A;  2ZEZ A;  2PLV 3;  2IWG B;  1Q8V A;  1QJU 1;  2LW8 A;  1NCQ A;  2WII B;  4CCD A;  2RS3 1;  4GJZ A;  5FAX A;  1ND2 C;  2YUE A;  4GQ7 A;  4Q4W 1;  1AX0 A;  1GKB A;  2ZCW A;  3MIG A;  3WNN A;  3W58 A;  3IN9 A;  1W8H A;  4UFH A;  1G9A A;  3QD6 A;  1CAU B;  4WM8 A;  5LK5 A;  1DZQ A;  1V70 A;  1W3V A;  3AX4 A;  4BQ2 A;  4AK3 A;  4KBZ A;  5FPZ A;  2W46 A;  3EO6 A;  3SNM A;  4WVM A;  4EZH A;  3DPR B;  1ZA7 A;  2E33 A;  2JKB A;  3E6B A;  3CF6 E;  4C0B A;  3ZN5 A;  4LXL A;  4M0H A;  1RUJ 2;  2W1U A;  4AGV A;  4HSL A;  2JWP A;  2WN3 A;  5FOJ B;  3O1T A;  1YCI A;  1Q3E A;  4LHL A;  5D8A C;  1CPM A;  2PHF A;  1RHI 2;  3L2Y A;  3ZSK A;  5C8W A;  4HKO A;  2W08 A;  4W4Z A;  5DAB A;  3LWC A;  3Q8F A;  3PUQ A;  1BJQ A;  2BGC A;  3UJO A;  3KCY A;  1UYX A;  3RZZ A;  1C3H A;  1S2K A;  5CBL A;  2GH8 A;  4YZ3 A;  2OQ6 A;  1C1F A;  4HPK A;  3EXU A;  2HYX A;  1JOB A;  3AZW A;  5JPM B;  4JDN A;  1FOD 2;  4BB3 A;  4Y5Z 0;  3OUJ A;  1UMH A;  4PHZ A;  2D6N A;  2VAU A;  5KHH A;  3ZM8 A;  1NLR A;  4OCT A;  2EF6 A;  5GZC A;  4S2F A;  2BNO A;  1N1V A;  3AKR A;  2XXZ A;  5JOZ A;  2ARC A;  2NMO A;  2TNF A;  4WVV A;  3SH5 A;  4JGY B;  4K40 A;  2V72 A;  5DDJ 3;  4R9D A;  3WP5 A;  5KHJ A;  4A4A A;  2K2S A;  2UYA A;  2VQU A;  4IET A;  1EV1 1;  1WWY A;  1VJ2 A;  4QPG A;  4QXK A;  4BHP A;  1PO2 2;  2UWC A;  5IW0 A;  3CBN A;  1TME 3;  4N9I A;  4X6R B;  5CIR A;  4JGY C;  3AMH A;  1F4H A;  1LNS A;  2W1Q A;  2ZZQ A;  3LEG A;  1AR7 1;  3UJQ A;  2GH2 A;  1KDM A;  1LR5 A;  4YW3 A;  5J48 A;  1LHU A;  1P8J A;  3U4X A;  1W6M A;  2XBO 3;  3R0R A;  4Q4Y 3;  2HWD 3;  4N7U A;  4A7K A;  4XF9 A;  2VNG A;  4XFA A;  1PMH X;  5E1R A;  3JBG 3;  1RGS A;  3VBR A;  2JIJ A;  1AYN 1;  4JV4 A;  1XSR A;  2E26 A;  2WNU C;  3NW4 A;  1UPS A;  2FHR A;  4K3U A;  4LBQ D;  4QQ2 A;  4COZ A;  3VZJ A;  4AL9 A;  4ZHN A;  1PO1 3;  1ODM A;  3RJR A;  5JMC A;  1ZA4 A;  1HQL A;  1RUC 2;  4MET A;  2ADD A;  2BP6 A;  4WZF A;  3VD3 A;  2P2K A;  4FTS A;  1CWP A;  4EJR A;  1Z7S 1;  3OF1 A;  3HBK A;  1IS3 A;  4CEY A;  2IC1 A;  1BYH A;  3JU9 A;  2I2S A;  3GCX A;  2C0Z A;  2ZX3 A;  2P6C A;  4RFT 0;  3VBO C;  2CGP A;  4ASK A;  1C5H A;  1JUH A;  2VCC A;  5K4L A;  1COV 3;  5LA1 A;  1HXS 2;  1T2X A;  2W68 A;  4LLO A;  3TEX A;  5I0D A;  2JDM A;  1KFU L;  1ULD A;  1AR9 2;  4UF0 B;  4LBN A;  2BTV C;  4LBK A;  1W06 A;  1OBN A;  3OBR A;  1WA4 A;  1J3R A;  3T4V A;  2HBT A;  2XVK A;  2Q0A A;  1ZBA 1;  3KD4 A;  3DPR C;  3DKQ A;  1CAX B;  3WNL A;  1CIY A;  4BXF A;  1W9F A;  4CCO A;  5LBC A;  1S0G A;  3T0B A;  1C57 A;  2XVG A;  2ZAC A;  4R9C A;  4AI2 A;  3WF4 A;  4QQH A;  1DQ1 A;  2OKX A;  3LIG A;  1J1T A;  3WNK A;  1OKQ A;  4KH9 A;  4WV8 A;  5FBJ A;  1G9B A;  2FZ1 A;  3NST A;  3RRD A;  2GC2 A;  5I93 A;  2VMG A;  1GU3 A;  1SLB A;  2OZJ A;  3C7O A;  4O61 A;  4QM8 A;  1KGY A;  4NE9 A;  1BHG A;  3I2J A;  4OI2 A;  5H9R A;  1J58 A;  1SZB A;  4BU2 A;  5JIU A;  2UWA A;  3PU8 A;  3CQO A;  3LOB A;  2W2I A;  1RMU 2;  3LSD A;  4H14 A;  1CAU A;  4R4Z A;  1N47 A;  4WM8 B;  4F8A A;  1DGW A;  1RUN A;  3S30 A;  1LOD A;  1VRH 1;  5APA A;  5FK8 A;  5FMC A;  1MZF A;  2Q8E A;  2AEZ A;  1QJE A;  5TSW A;  5BNN C;  1DQ0 A;  1CQ9 A;  4OZX A;  1FPN 3;  4CA9 A;  5FXZ A;  3UKV A;  3ZDV A;  1EY2 A;  3IMN A;  4MUV A;  2DU1 A;  3O7O A;  3PUA A;  2A7A A;  4N9H A;  4SLI A;  2ATF A;  3JB4 C;  1SFN A;  4A7Y A;  3LA7 A;  2Q8D A;  2HWF 3;  5KXD A;  4O65 A;  3MO4 A;  1RUO A;  2WAA A;  1AR6 2;  4EQV A;  5F1R A;  4S2H A;  4XZP A;  5CKM A;  5FZC A;  1YC6 1;  4YM0 A;  4BH9 A;  3KT7 A;  3VZK A;  1AL2 3;  2TEP A;  4LMF A;  2BU9 A;  5A3U A;  1GFF 2;  5CFD B;  4Y5S A;  5AVP A;  5ACA 3;  4ZXK A;  4AYU A;  1HRI 2;  5EJ1 B;  3MIF A;  5CAD A;  2HWD 1;  5IAX A;  2VQA A;  4LEJ A;  4CP2 A;  2J22 A;  3P3N A;  2W1W A;  3B01 A;  4WZC A;  1G6N A;  4M4R A;  1W0N A;  1RUI 2;  2K0G A;  4XQW A;  4NPM A;  3W5M A;  1PO1 1;  3UNP A;  1RXF A;  5BV6 A;  3WQB A;  2G19 A;  3NJX A;  3RJ2 X;  1JYI A;  1J3Q A;  2FMD A;  5F8P A;  4AZZ A;  4LK6 A;  5JI7 A;  4LIU A;  1D4M 3;  1UU5 A;  3K51 A;  3WG4 A;  3WNM A;  4CDW C;  1DP0 A;  5DZE A;  1RIR A;  1U12 A;  3FL7 A;  4IES A;  2O14 A;  1HKD A;  4URT A;  3DUI A;  5FY9 A;  3EMR A;  5CEH A;  5FWJ A;  1H8T A;  5FRA A;  2JEC A;  2OUJ A;  3TWI A;  2RMU 3;  3MPP G;  1X7N A;  4RHV 3;  3ZYB A;  4Q4W 2;  4CU6 A;  1D2Q A;  1F2N A;  2G9F A;  3ETQ A;  3DPR A;  5F6L B;  5F5I A;  2VME A;  1XYN A;  4IGP A;  2CDP A;  5C4W C;  4YFW A;  4A42 A;  4QPG C;  2XL9 A;  1W2N A;  1A78 A;  1WW7 A;  2D6L X;  3OY8 A;  4IXL A;  4PIZ A;  3BIE A;  3MBW A;  1PVC 2;  5KWR A;  3WG3 A;  2VU9 A;  1VPH A;  3UKN A;  2I45 A;  4JDM A;  5D2A A;  3SH4 A;  3OEA A;  4S2G A;  1H6X A;  3VBU A;  5DZG A;  4LJH A;  5I8T A;  4GUL A;  5DUU A;  3IB3 A;  1O91 A;  5CFC B;  4UBH A;  3C7E A;  5A7Q A;  1QJX 1;  5A3L A;  5B4X A;  2D7F A;  1QJZ A;  2XQR A;  4AVS A;  4RYD A;  3RZK A;  3BKZ A;  1JU4 A;  1ZZ9 A;  4NAM A;  1MS0 A;  4UFI A;  3IPV B;  5F9T A;  3KT4 A;  1BK0 A;  2EXI A;  4RFR B;  1XC6 A;  1VRH 3;  4YW6 A;  1QQP 1;  1BMV 1;  2BRT A;  4ATF A;  5DXD A;  2HJI A;  1B09 A;  2ZGO A;  3POW A;  1QXR A;  1XYO A;  2QZ2 A;  4Y22 B;  1QJF A;  2DV9 A;  3S6P A;  2CGN A;  4IE0 A;  4QXB A;  3JD7 2;  1NG0 A;  3FX3 A;  1UXX X;  2EID A;  3WX5 A;  3A23 A;  1Q8P A;  5FZH A;  4ES9 A;  1V6K A;  5L19 A;  1UKG A;  3MIB A;  3C7F A;  3ILR A;  3NWK A;  4QB6 A;  4QPI A;  3LSE A;  2YB7 A;  5FYM A;  4IV1 A;  3FHI B;  4UWD A;  4ARX A;  3AYA A;  3O1M A;  2GU9 A;  4AXO A;  2VNV A;  1YNA A;  2PHD A;  3IMM A;  5A70 A;  2VMD A;  1QJY 1;  1PZ9 A;  2PLV 1;  5GLZ A;  2DVG A;  3LAG A;  1IZ3 A;  1EUU A;  5ACA 1;  2YBS A;  1UNB A;  3AZX A;  4B7K A;  2LTN A;  1DYO A;  1HJF A;  1DGW X;  2WZE A;  3CEW A;  3R4D B;  5FP4 A;  3JD7 1;  1JXN A;  1UW8 A;  3VBF A;  4Q4W 3;  5FK7 A;  5FPB A;  5IK4 A;  3V65 A;  2XKO A;  2BNM A;  3WOG A;  2VZV A;  4MSV A;  4FPH A;  2J1A A;  4ES8 A;  4EWE A;  4NID A;  3RWN A;  1BMV 2;  1DLL A;  5GLW A;  5F32 A;  4BQ5 A;  2ZGR A;  1R1A 1;  4BIO A;  4CUA A;  3KB5 A;  4E2Q A;  5B4N A;  4LIT A;  1I1E A;  4FQ4 A;  1ULP A;  1HB2 A;  3ORJ A;  1NLQ A;  3FLR A;  3HQU A;  5JLV A;  2Y26 A;  4N8M A;  5JXG A;  4KNC A;  1CJP A;  1GNH A;  3NAP A;  2RR1 1;  4YM1 A;  2WA3 A;  1PX3 A;  4AI1 A;  2ZHK A;  1RUE 2;  3FN9 A;  3VBS C;  3BU0 A;  3KF5 A;  5FKB A;  4B3N A;  1OOP C;  1EAH 3;  2YC4 A;  4XBQ A;  1XNT A;  4CXX A;  3CJI A;  3ASI A;  5IK7 A;  4NMI A;  4CPB A;  1CAV A;  2RMU 1;  5J1X A;  2A70 A;  4LKF A;  2HWB 1;  5J3U A;  4CDX B;  4JGZ B;  4E4D X;  5FQ0 A;  1LES A;  3NNJ A;  3RMY A;  2YXS A;  5BNQ A;  1WLC A;  3KVB A;  4BXS V;  3B94 A;  2C24 A;  1UOJ A;  4YVS A;  2CAU A;  2QZ3 A;  3AVS A;  3EYP A;  2QDR A;  1HJG A;  5EHD A;  1O3Q A;  1I5P A;  2P3K A;  2XVL A;  4OHY A;  1BK1 A;  2LRO A;  1JOD A;  1X8M A;  2IVI B;  1ASJ 3;  3NJY A;  3SCH A;  3O0X A; 
#chains in the Genus database with same CATH homology
 4NAO A;  3NNL A;  2HBU A;  5DAQ A;  2FCU A;  4XCA A;  5DAX A;  2FCV A;  5L9V A;  4BQW A;  3PL0 A;  2HBT A;  5LBB A;  4MHR A;  5IAT A;  3DKQ A;  4NHK A;  5EP9 A;  3GJA A;  5LBC A;  4IW3 A;  3W21 A;  3KT4 A;  5C5U A;  4ZON A;  2JIG A;  4XAA A;  2RDR A;  5L9B A;  2OPW A;  4XCB A;  4KBZ A;  2FCT A;  3HQR A;  5EPA A;  5ERL A;  3NNF A;  5DAV A;  3OBZ A;  4ZPI A;  4NHL A;  3OUI A;  2RDN A;  4UWD A;  4BQX A;  4NHM A;  4JZR A;  2RG4 A;  4NHX A;  4J25 A;  2Y34 A;  5L9R A;  5HV4 A;  2Y33 A;  5LA9 A;  5DAP A;  4XAC A;  5C5T A;  3OUJ A;  3KT1 A;  4Y5T A;  5HV0 A;  3KT7 A;  2A1X A;  4MHU A;  5A3U A;  3HQU A;  4Y5S A;  5LBF A;  3W20 A;  5IAX A;  3GZE A;  2V4A A;  5LAT A;  3BVC A;  5DAW A;  5IAV A;  4NMI A;  2G1M A;  5LBE A;  2G19 A;  5LB6 A;  3NNJ A;  3OUH A;  4NHY A;  3GJB A;  3MGU A;  2RDS A;  4XC9 A;  5LAS A;  4XAB A;  2JIJ A;  3ITQ A;  3NNM A;  2RDQ A;  3EMR A;  5M0T A;  4BQY A;  4Q5O A;  5EQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...