5LBSH

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCSASGFTFSTYSMHWVRQAPGKGLEYVSAITGEGDSAFYADSVKGRFTISRDNSKNTLYFEMNSLRPEDTAVYYCVGGYSNFYYYYTMDVWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
molecule keywords envelope protein E
molecule tags Immune system-viral protein
source organism Zika virus
total genus 25
structure length 121
sequence length 121
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lbsH00
1JF1A 1FGNL 1AGEA 2OI9B 4X6CA 4QTHA 4IMKA 3HLAA 3FFCD 5KSAB 3BHBB 4ZNEA 4BH7A 1I9IL 4ONGH 4ZXBB 2J7LA 3BMVA 4GOSA 4L29A 3V6OA 5HPMB 4FQLH 4M7LT 2CK0H 4OM1H 1HEZB 3EHBC 5FGCB 3V5KB 4MA3B 4NNYB 2D7TH 3NTCL 1F90L 5FCUH 1AJ7H 1CLZH 2IH3B 4GBXD 1CTNA 1MVFA 2W65B 3W9EB 3HNTL 4D0CB 3VWKD 1N4XH 5BS0A 1ZMYA 1ODAA 1FVCB 2M2DA 1JNLH 3U83A 4WFHD 4JRXE 4NCC1 1DBKL 2P47B 1FIGL 3L3IA 5DJDB 4JAMB 3F7QA 3TZVC 1U92A 1WZLA 3SBWA 4POUB 2NMSA 2Q7YA 4YHNB 5ID1A 3QQ9C 5F7YC 4J8RB 3EYOB 2VDML 3KPOA 3HUJF 2E7CA 2ZSVA 4L8BA 2IJ0C 3SGDH 4LFHG 4MNQB 4KJYA 4MJ2A 4OCXL 3MR9B 4YHPA 5GPRA 4PRIA 3A6CL 4GS7B 2EIZB 3UYPA 4WFED 5TH2A 2D7NA 3WO4B 4BZ2L 5JIIA 1V5JA 4PP1C 4JFDE 5JA9A 2VZ1A 2VSDA 3TN0D 3MJ9A 3OB0K 2HLFC 4IRJA 4HC1A 2VXTH 4NKQB 1BREA 2FO1A 4U6TA 1RUML 4D9QD 4YHLL 1OP5K 1CE1H 2EIDA 5J6HB 5IMKB 3VRJA 4PRBA 4OM0H 3D3VB 1YNLH 3I3DA 3VDCA 5D93C 3D39A 1F45A 4KDTC 3WLWC 4UBDC 5HYQA 1PG7W 4OT1H 4Y4HB 4DTGH 1C08B 3IKCB 4KU1A 3KPSD 3OAUH 4HIXH 1TPXC 3HPLB 3ULUC 3WEXB 3MRCB 4UNTA 1B0GB 1U8NB 4MA1B 3W0WD 4X5LA 5DVMA 3M8OH 4U3XA 3WFDH 1NDMB 3RL1A 4KV5F 1TCRB 4OF8A 2FWOA 1ND0B 2NY6B 3HTLX 1X5JA 2WP3T 3SGEH 3GSWB 3HFMH 2CKBA 1UH3A 5FKAA 1F4WL 4ZO6A 2MJWA 1YYLL 1ITCA 3MRBB 1NEZG 5BRZD 3IDJB 4TVPH 2BDNL 3FQXA 1LEGA 2BZDA 4X7SL 2YEZA 1EJOH 2VRAA 2VQTA 5DJCA 1BGXL 2PYFA 2CK2A 5I1CH 3GMOA 3SQOH 4NO5A 1OCWL 4LAQL 2P8PA 1U8PB 2VERN 5C8JA 5I73B 1I4FB 4GW5A 3VFTB 1I7RB 1N5AA 3QNZB 1MCDA 1AP2B 2NY7L 1WC7B 5F96L 5HHOB 5DJYB 2IBZY 1CFNB 3TCLB 4H0GA 4LCYB 4ELME 4H25A 1JFQH 3BP7A 5JXEA 4HGWB 4BUGA 5IM7B 2FX7L 3P3YA 1RAMA 2PTUA 5F7HA 3FN0L 4L8SC 2FEDD 3BH9B 4QTIH 5ISZA 3SDYL 2VDLL 1FZOA 2B2XH 5IFAH 4K23L 4G9FD 1L4IA 4XC3L 5C0FB 4HBCH 4XPBH 1QO3B 1CXFA 3I02A 3STLA 2VABA 3RVXC 3S34L 4HIHB 5I76B 1GGUA 5HDQL 2A9MH 1I8LA 3IXAA 4N8VB 4PLJC 4YK4C 4C56D 3I75A 3OR7A 1OARL 4PJ7E 3RWIB 3GSXB 3IF1B 3VXMB 1FGVH 4ODHH 2I9LB 1HHHA 1F8TH 2VDQL 5E99H 2AABH 3FB7B 1OAUL 1F97A 4G8EA 4F7EA 3QUXD 4EBQH 2EICA 2HG5B 2QR0B 3ZE0F 3QEQB 5ETUA 4V1DD 3L3KA 5FOBA 1CE6B 4HZLB 4ZAKB 1CU4L 1W0WA 2NX5E 3ULVC 5HYJD 4I3SL 4Y5VA 1D5ZB 3KJ4B 3DSFH 1RVFL 2MTPA 4JFQA 1H5BA 1NC2B 1PKQE 3VFPB 3V79C 2KUTA 1BPVA 4DEPC 4W68A 5IKCA 2EYTB 1CFQB 4MD4A 2EH7L 2OZ4L 1WAAF 4OD1L 4L4TE 4X6BB 3D2UB 5CSGA 4JFYA 3OAZK 4UIKH 4JANB 2XZQL 2Z92A 1OTTD 3NABH 2ZNWA 2ZKHL 2FATH 3G5XA 1JZ4A 4KJWC 1SBSH 2EE9A 5E6IA 5C71A 3ZDYE 5D9SB 4KAQH 4MNHA 4MX7A 4KC3B 5LBSH 1XGTA 4OFYD 3RI5F 3U7AA 4U1LB 5DRXA 5CMAA 3OAYH 4LKXB 4MJIB 1KFAL 3ZSTA 2GTWB 4JZJA 5KSVB 1TZGH 4J23A 3B9VA 4I4WB 4XT1C 3MNZA 3G5VB 4U4BA 4NCDA 1F4AA 3VGEA 2W60A 1KJ2L 3JVGC 4QWWD 3KXFE 5E2VL 4PJEE 5DLMH 4M5YH 5C0AD 5BMFH 4NYLA 4PJ8B 2OJEB 2X1OA 1R6VA 2I27N 2YXMA 3QPQC 5B21A 3CFDA 1JPSL 3QEHA 3WS3A 5I1JL 3N1PC 1MY7A 3WUWG 2WWMD 3D9AL 5GRVL 4MB5A 3VGHA 3ELAT 4YC2B 1QA9B 2GAZA 3MOAL 5DEGA 5ITFB 4QXUH 1T3FA 4RCAA 5GISL 3K81A 1J1XH 4ISVB 2A6IA 4PG2C 3UTTD 4YX2L 1FNGB 5CIPA 3TIEB 2H26B 2SEBB 4K7PL 4X5XA 4KKCC 3RVTD 4NQDA 2UWEF 2DI9A 1TQCB 1IGYA 4KY1L 1F2QA 1BFSA 1DUYA 1N6QL 3D5OF 3KJ6L 2VXVL 5HYSA 1MRDH 1TLKA 2AEPL 3A67H 1UWEH 1SJEA 1YA5A 4L8CA 5K9JH 3LHPL 3O3AB 3N85L 5IB5A 2VAJA 3AC0A 3RHWF 3UTSE 3V4UL 3FO0H 4L3ED 2EDTA 3TJEL 4PJXB 2WINB 4Y1AE 4N68A 5BXFB 2R1XB 3ULUL 1YQVL 4W6WB 4IRSD 1JGUH 5D2NB 5ACZA 1QYGH 1ZT4A 3FT2B 4Y2DD 1E27A 4WI4A 5I71C 3WLBA 2AVGA 5F1KC 1F5WA 4PJHA 3MJ8B 3VE0B 5C07B 2V9RA 3U7WL 35C8L 3WN5A 2HWZL 4UINH 3VFUA 4P2QD 2FBOJ 5B8CC 3T2NH 5F21B 4HUVA 3PNWB 1IEAB 1CBVH 2GJ6A 5D96C 5CGMA 2PXYA 4URTB 4F37K 5T5NG 2H9GB 3T0BA 3EFFA 4OCSL 1PAMA 3OKLA 1LP9F 3MUGB 1RZ8A 3ZZ1A 3FQRA 1T83A 2ZPKH 4MAYB 5HI5D 4V2CB 3OAYK 2XKNA 1XH3A 4FXKB 5BVPH 2IMNA 4LSVL 4F7CA 3T08A 2BNRE 5DFVD 4EI5D 1DBJL 1TXKA 1UWGH 4UAOC 5C9JA 5E08L 3MV8D 4WFGD 4OF0A 4P2OC 4P3CH 3LEVL 4PS4H 1RURL 1W0VB 2O5ZH 3WIFB 1G7HA 3QFJA 4NGHL 5D70H 5FGRA 4B7IA 5JDJA 3ARFD 2YXFA 4I18C 2W38A 4QRRB 1P2CA 1JYXA 3HAEA 4JY4B 4PJ9C 2C4XA 4JFFB 1O5DT 2BJMH 2QSTA 1BZQK 3LS4L 4MCZA 2BSRA 5FECA 2AV1A 2DKMA 4X6FA 5E2TH 5DD5H 1NCUA 2LV4A 4R26L 1EMTL 2F19H 4GRLB 2AJVL 4NWTH 1NKOA 3HNSH 4YIQB 3QCVL 3HN3A 1ZGLP 4PJ5B 5ACLA 5B38A 5M7QA 5E8DL 2ATPB 1CL7H 1WF5A 3O6KL 3OKOB 4N9OB 1BD2D 4XHJD 4BH8A 5GGUA 5K93A 1IEHA 1OAQL 3EOAA 2VLRA 2FR4A 5CBEA 4PJCF 4XP5L 4EDWL 3ULUF 3FB8B 2H1PH 2X41A 4LOUC 4X4YB 2JB6B 4QKXB 4JPIB 4GAGH 2DMBA 4FQPA 1F3JB 3LZFL 2HT4C 2NY5H 2XWJB 3MUZ1 1JPFB 3OL2A 4LRNL 4M6MH 1DVFB 3CFJA 3FONA 4LRIA 1X6LA 3D85B 4PRPE 2DQGL 3O41B 3NCJL 1F3DH 3MV7B 1N64L 3PWLB 3FQTB 3G6JB 4XCNB 1UM4H 1IC7H 2FIKA 1M4KA 3VXRE 4PJDA 1QR4A 1YNKL 4NP4H 3SE8H 4PR5B 3R8BB 5KSBF 4U1NA 4YXKL 3J7HA 4K9EH 4HV8A 4M7ZB 4FQ2H 3ROLB 2AJZB 1CFSB 4JN1L 2WANA 4LSRL 2Z35A 3WLWD 2BRRH 5ILTL 1XIWC 1IAIM 5DHVH 1ZLUK 4UT7H 3GI8L 2BX5A 4PTTB 4NT6A 1LEIA 4TVSa 1ZLSL 1REIA 3K1DA 3GJEA 1MWAL 5IMMB 1ZHNB 4LARH 1VADA 2BSSB 4BSVB 5K9QG 2MWCA 2F74A 4MQSB 3QCTL 4Z5RA 1AE6H 3SEPA 4QXTA 4P4RA 2GI7A 1FLRL 1IFHH 1MUJA 3F7VB 3VFSA 4XVTH 4PIRF 4PRAB 2A83A 4M7JH 1NLDH 3RGVC 2CJUL 3IXTB 1C1EL 1UFUA 4HGKC 1ZOXA 1CVRA 5EA0L 5I1EH 1DBAH 5FGCE 4DW2H 4X7TA 1JZ6A 1FRGL 5HYEA 1A9EB 1NGPH 3O8XD 3ORJA 5CJQL 1E6JL 3SDDA 1MFAH 2DF3A 1Y6MR 5DD0H 4NKOB 1UKTA 2F58L 3ZL4H 1CCZA 15C8H 2Q6WB 3CSPA 1P6AB 3MRLA 3BZEA 3GUTA 3MLXH 2VDKL 4K8RD 2OR8A 1ZGLA 3PL6B 3L9RA 5D5MF 3VH8A 3ULVF 3ZSSA 1OT2A 4P5TD 4GAJH 4LSPH 4PB0H 2A9NL 2OK0H 1U93B 4PJBA 3O4OB 4Z7QE 1NAMA 2V5MA 3IJSA 2NY1D 3TBWA 5SX5H 1J8HE 2F53A 1OW0A 3AXLA 1P4IH 1A7OL 1S7RB 3KLDA 4Y0GA 4JQXC 3SJVD 3VFMB 2PO6B 5C08D 3VI4E 4XCYB 1AO7E 1L0QA 2BHYA 5C0JA 1T04A 4KDVA 4M1DH 4D0DB 4XHQA 3RPIB 2XV6B 3EYUL 3BP4B 3D69A 4EUPA 2M8XA 5DMIH 4IBLT 1I8MA 4ONHB 1DN0A 1S8DA 3TNNA 4F7PB 1YEFH 2X7LB 4NC1C 3B6SB 3PIQA 3D3VE 3FO9B 4AYFA 4PGEA 4FS0A 1D5IL 1G6RB 4YQXL 3CGTA 3EDKA 3LQMA 5HHMB 4MB4A 5GGRY 2CRMA 3DUUA 4F7TA 3FFCB 5LGJA 4JM4H 2X9WA 3ULVD 1NMBH 1MFCH 5GZOD 3FB5A 4OTXH 1QBBA 4FFYH 1YN6B 5LCVH 4RBPK 1HCFX 1YMMD 1SM3L 3U6RB 1EGJH 3ARUA 1OAYH 4GAFB 4TRPH 4K3JH 2ZSWB 5MERA 3D6GA 4ERSH 4K94H 1KCUH 4GBXB 5TQ0L 4D9LH 3CCHB 3VWKB 5CD3B 3ILQD 1I3UA 4Z7VA 4YDLB 4QLRA 4G8FA 5JQ6L 1GCFA 2DI7A 4AM0A 3CLFH 2FYYB 3HHRB 3LV3A 4HWBA 3RWJB 1R3JA 2A6JB 2IBZX 3VXOB 2HMIC 4XP9H 4U6XA 1SVZA 4P46C 4KJWD 3MRQA 4HJGB 1XF5B 3B3IB 4KK9C 3IETB 4OLUH 3RZCA 3PWUB 1TJGH 1CF8H 3IFOA 1UB6A 4LCIH 3C08L 3QIUD 1JIBA 1E6OL 5HHOE 5E9DD 2ZUVA 4JY6B 1A8JH 2H32H 5E03A 3NCYS 1E4KA 3BIBX 4O9HH 4RFNC 1MY5A 2AQ2A 5F9JA 4XP4H 1C8PA 1OVZA 4KK6C 1R3HB 3VFRB 2Y9RT 3TN0B 2MOVA 3WJJA 1NGXB 3I2CL 4GMTH 2DBLL 1UZ6E 3VA6A 2ADGB 5GSRB 1ONQB 3WIHH 3BW9A 3CFBA 5IUSA 4I5BA 3QUKA 1JGDA 2WZPD 5MHSE 4HBQA 4U05A 2E9BA 4P0DA 3KPSB 1UG9A 4UUJA 1QBAA 1FC1A 1KIRA 1ACYL 3VXME 3GSNB 4M4RA 2V7HB 3HI6H 5IB2A 1QFOA 3W0WB 3L1OH 3MMEA 4U1SA 3TYFA 1B88A 3EJJX 1A9BA 2R8SH 4P5KA 3GMNB 2V6HA 4RGNC 2PN5A 3BFOA 4RAUA 1PSKH 3G5YB 5JW4N 5DJZB 5CLTA 1MI5E 1QBLL 4X4ZA 2P4AB 3RBSA 1TVBA 2GCYB 2I24N 2JTDA 2C3WA 5MI0C 2B1HH 5BRZB 1ZVHA 3NAAL 3MA7A 2RFXA 3AS2A 3LKQB 1P4LB 1UKQA 2P5ED 4HK0A 1NLBL 1I8IA 5HGBB 1L6ZA 2WBJA 5D2LF 2YK1L 4LGRB 1NFDF 3H9HB 4G6FD 2DQTH 3MRJB 4N8VG 2J5LB 2Z8VC 5DQ9A 3K2MC 5D1QA 3RWHB 1FORL 4U0RC 4XNYL 3O11A 4U6VH 1QSEA 2QKIA 3X3GL 4CNIA 4R3SA 2M26A 1A6WL 2G75B 1RUQH 1RZJH 1YC8A 5IVXE 5E2JA 3NCEB 5T3XL 1JP5A 5E95B 2HJLA 4GKSB 2Y5EA 4ODXA 3ZYJA 1MAJA 5BS0D 3LVEA 1L0XA 5T5FH 4JFZL 4HH9B 1XZ0B 3T4AA 5CKAA 3O2DH 1V3KA 4OD3L 3LOWA 3TCXA 2XWBA 3MYJA 5EWIL 2C1PA 4F9LA 4G9FB 1EEQA 5EZJA 4JKKA 4H5SA 1XR8B 3LKNB 3HCVA 5JR1H 4OV5B 4H88H 2VXQH 4X7FC 5FUZH 3ZTJG 3ARGC 1I9RH 2H3NA 2Y72A 4MQXC 4C56B 3CMGA 5KAQF 4P2OD 3WDJA 3GIVA 4WUKH 1BF8A 4LVHB 1FG9C 1KTLB 4RFEA 5JO5A 5J9PB 2IPKB 2YPLE 1GGYA 1MRCH 3QUXB 1JI2A 4JFHE 4GRWH 1HDMA 5BV7H 4CVZB 4U1IB 1UZ8B 2YD9A 1S3KH 4PJ9D 4V1DB 1MNUH 4X6DF 3O2VH 2AGJL 2EDBA 2WBWB 5DS8B 3UDWC 3RU8L 5HYJB 4HMCA 3BIKB 5DD1H 3SGJC 4UB0L 4XVUC 1HSBA 2DQIL 3RA7L 3SKOB 4FQHA 2DAVA 3O3EA 5F8RC 1INEL 3QEGH 1X5KA 5DT1H 3SOBH 4WDIB 1UB5A 3ARQA 3BWAA 5KW9H 1N2RB 3IDNB 2XA3A 4F33B 2KKQA 1G0DA 1WT5A 3NH7H 4Q58C 4CBPA 4JG0H 4CU6A 5DD3H 3G5ZB 3L95B 2C7UB 4JRXA 1EXUA 2VKWA 5FGBA 2C9AA 2ZG3A 3HI1A 2OL3L 3ZYIA 2Y6SC 5EIVA 2O5XL 3S88L 2FL5B 2AK4D 5LGHL 4M93B 4PJXE 4WW1B 1QFWI 1YZZA 3O9WC 3MLRL 1UCBL 1PX4A 5DUPL 4UNUA 1ZHKA 5GS1C 3VXPB 3ZT5A 1FPTH 3MBEC 3QNXA 3GZKA 4OJFH 2IANA 2HT4D 2IF7A 3SE3A 1OB1B 4J1UA 4JFDA 5EBWA 3WFZA 5HVHB 1LNUA 1FYTD 5AZEL 2EDHA 4WEBH 1Z5LA 3CC5A 3DUHA 4Z7UA 1C5DB 4KKLC 3QG6A 3B2VL 1NEZA 4S1SH 3DO7B 4CVWA 5SWZE 3KAAA 2AW2A 5GJSL 5GGQL 3NIFE 3ZE2E 1BJ1J 1ZHLB 2X9YA 1L7TH 5FHBH 5C0AB 5IT2L 3RWFB 2E9IA 5JXED 1UQSA 5IESH 4JPKL 2AK1H 4TPRL 5FK9A 3GNMH 4OKVB 5T1MB 5IJVA 4B0MM 1NMCB 3CZFB 4LSTH 2I07B 1Z6JT 4GKZB 3L3HB 4WRLA 2EC9U 2CQVA 4JFPB 4ZFGL 5ISZD 1KB5L 5D72H 5CBAA 4E41A 2YRLA 4LLQA 3SN6N 2Q7NA 2D4DA 3WSQH 2MMXA 2XRAL 3RAJH 3VWJD 5DRZA 3ZE1F 5BZDA 3BWUC 3UTTB 1H3XA 1Q38A 1RK0B 4ZUUB 3U79A 4S1DC 5KJRL 4DKFH 2BOBA 3NZ8A 1GGTA 2O5YL 4QT5A 4JFFE 3CSGA 3U1SH 4N0UE 5I15H 4MJ4A 4W70A 3RGVD 1DSFL 1A7PH 1QEWA 3EOYG 4R4NC 2R0KH 5T1LD 3ZHLA 5DQJB 4L3EB 2K1MA 3LQAL 4UDUB 1NPUA 3KHQA 1ZS8A 1RIUH 1S5IH 4PP2A 4KPHL 4IRSB 1XAUA 2EC9T 1K8IB 3PP4L 4P5MB 3IU4L 2IPUG 2XN9E 1CDHA 1WWCA 3CVIH 4ELMA 3BIAX 3HPJB 2B20A 1AFVL 3MOBL 4JGMA 5DJ6B 5E6ZA 5KVEH 4RIRA 2OXGA 3EOBA 1FH5L 4XVJH 5K9QI 4YDVB 1QLRB 3MZTA 1KJVB 3QCUH 4M6OL 1H15A 1YC7A 2J8UE 3IS0X 1AC0A 4HEPG 4JM2D 2VDRL 3AY4C 1Q9OA 3TVMA 1DQLL 3BXNA 1QSZA 3GO1L 3IDYC 1G9EA 2DMKA 4PJIF 1VHPA 4PY7A 3VFWA 1XEDA 4F2MA 5F89B 1A4KB 3C6SA 4DOHB 4FP8H 3O3DB 4M9OA 3VXUA 3AS0A 4JZOB 1NJ9A 3MXVH 4PJ7A 4GW4A 5ECJE 5FYKH 4LCCA 3C5ZC 3HC3H 3MV8B 2Q86A 1CD1B 2OCFD 3LKOA 3T0XA 1HCVA 4CDHA 1L7IL 4DCQB 5GRJL 3SE9L 5F6HJ 4AH2A 1DDHA 3QAZB 3T4YB 2ARJA 4F9PC 1IGFH 1H9VA 1ZXQA 3ARFB 1M6OA 2HJKA 3VXTA 5CLWA 2CXKA 1DE4B 4TSBL 5DMGC 4UOW1 1TQBB 3QXTA 4XAWL 3WDIA 4YBLB 4H8WH 5IBTH 2FBJL 3DXAA 3P11H 4GG6B 2NX5A 1KCSH 4KK5C 3TBTA 4NHUB 1V7NL 4R7NA 4NJ9L 1FZJB 1FCCA 3P9LA 5KVGL 3A6BH 5I1AB 1MRFL 1DBML 1OLLA 1JNNH 1MVUB 3BAEH 4ZDHA 1NGZB 2NY2D 3W9DA 3QISA 4GMSH 1TJHH 3IDXL 5HGHA 4P23C 4L4TA 3RX8A 2O26U 2V7NB 4PV8B 4ZPTB 5C7XH 5JPMB 4J12A 1ZV5A 4HJJL 3RTQC 1X5HA 3O3BB 4HPYH 3BESR 1BD2B 3DURA 3LSOA 4U2ZA 3MRFA 2XI9A 1CVSC 1KEGH 2W9LA 4XNXL 4ODWA 3TH3T 3X14B 3WUWA 5EC2A 4PUBL 2C5DC 1CXHA 3CFCH 2P46B 2YBRB 4QRQB 3P40A 3B9KC 4PRNB 5DEFA 5ADOL 2AJYL 3EIFA 3W82A 3W2DH 3LD8C 3MJ6A 3RGHA 5HHXL 4JQIL 5IB1B 5DSCA 1N5YL 3WDHA 5EDXA 5EU4A 1U0QA 5CHNB 2CPCA 2ESVA 4KK6D 2FJGB 2B1AL 1F6AA 1TZHB 4JKPL 3KXFA 5AG8A 4IEFB 2JCCA 4LVNC 4OGAD 4M00A 5LKNA 2FLRT 3X11A 1QKZH 2YSSB 3V6BR 1T21A 2BSED 3ES6A 2HYMA 6FABH 1CG9B 1JGLH 1BOGB 1FO0L 4JVWA 3FO2B 4R4FH 2DBJA 4Q74A 5F1NB 3H2WA 4U1HA 5JPNB 4JG1H 4AIZB 3F58L 3RKPA 1TPXB 4GT7A 4I2XE 4NSKA 1MIEH 2R56H 2UYLA 3QIBA 5F9OL 5KVFL 4PJFF 4KRMB 1CZ8L 4YWGH 1DL7L 3V52H 1IQDA 4U6HA 4I3RL 3PJSA 3KPQA 5BW7A 1J88A 5DVNA 4AEIH 5GRUL 2UZXB 3BGAA 4GKOA 5DWUH 3ZDZF 5I19H 2DS4A 3D0LA 5MEPA 3MFFA 3KYAA 5CJXA 2XWTA 2DQUH 3QHZH 4AT6A 2AEQL 3DIFB 3FFCE 4UDTA 5LWYH 4QXWA 3UTSA 5IMLB 2EEBA 1A3RL 3OKDA 5ALCL 4XP1L 1FZKB 4OLXL 5ESAA 3LS5H 5DK3A 4LKCA 2WLYA 4OZIF 1U95B 1T80A 1I1YA 1H8SA 5KSBB 2V2WB 5F7MC 3PQYA 4D3CH 1FVDB 4ZUWB 1LWRA 3FQNA 1P5UA 5JZ7C 4OF6A 1A1MA 3FB6B 3JZ7A 5DFWH 4WFHE 1WFTA 4C83A 4KMLB 1FV1A 1FDLL 3SDXF 3MJ7B 2DQFB 3BMWA 4F15C 3AREA 4NN5B 3RL2B 1T0NA 4FXGA 4DGYL 5DF0A 4OCYL 3GM0A 2A2QT 2V5TA 4P5TB 5FB8A 2LTQB 1EO5A 1B6DA 2D7TL 4CW1B 4ZTOH 2NY1B 1RK1B 3E8UH 3DTXB 5DC0A 3FRUB 3MRHB 4MSWB 4JHAH 4OLWH 3DYOA 1V8HA 5KSUA 1N4XL 4G5ZH 3SJVB 3QDJD 5C08B 1IGMH 1BQLH 1JNLL 1WWBX 3RY6A 1C12B 3E6HB 1OP9A 1MH5B 5JA8B 1FFNA 3ARGD 4YK4B 4EOWL 1UVQA 3QO0B 3MNVB 3PP3K 1GL4B 2BXYA 3P9MA 4JQVA 4S1QL 3U0TB 2NW2A 4BFBD 1CD8A 5DJXB 5TFSH 1OAZH 2F5AH 4RNRA 4JPWL 1HZHL 3VXSA 5IROA 2G60L 1K2DB 3WNLA 5EFIB 3BN9D 4PRHA 5D7JA 5IGXH 2XA8H 1KPVA 1MHPH 5E7FA 3T0EC 3FHQA 2PW1A 1H3UA 2FH8A 1ADQA 5GQBA 3FTGA 4RAHA 2XPGA 2Y25A 3PV6A 1GZQA 3KPSE 4XVUD 3KPLA 5DK0B 4I0PA 2DYPD 3S37L 2BVTA 2VXTL 1YMMB 3HUJE 5C1MB 1CE1L 4OAWA 2IPUK 4LLDA 3GB7B 3LB6C 4NZTH 4LLVA 1YNLL 4M9PA 4ZSOB 3WHXB 3MBXH 3LKRB 3CDFA 3QI9C 5I2IA 2YPKB 4CADA 2Y07H 4DTGL 1II4E 3CVHL 5J7CC 2VLJE 2B0SH 3RUGF 4APQA 4Z9KB 2RAMA 5JXAH 4ODVL 5INCA 2WWKT 5E56A 1HHGA 5B4MD 2GK2A 1SHMA 5IOPA 1JMZA 3M8OL 3OKNB 2VITB 3L5XL 4YO0A 2D3VA 4P4KA 4NFDA 3HFML 4JPVH 3QIUB 1DP0A 1KPRB 3MBED 5E9DB 3K1KC 5T1KD 1LDSA 5CEXA 4AL8L 1S7VB 2R4SH 3P0VL 4PRPA 2NW3A 2VZSA 1XF4A 2EO1A 5FAAA 4ZQKB 3TV3H 4KKLD 1OL0A 3QQ4A 3VXRA 4B41A 1T66D 3SKMB 1KBGL 5I1CL 1VGEH 5INDA 3PABB 1JVKA 3THML 1A6UH 2Z93A 4KV5E 2OQJB 1DLFH 2R2EA 2ICEB 3VFOA 2IFFL 1PG7H 3W11C 2ZJSH 3EAKA 2X4UB 2ICWI 4BSWB 3HG1D 4C56E 4PV9B 5IHUL 1I7TA 1AGCA 5GJTH 5IMOA 4X8JA 5C0BD 4KVCL 4UIMA 1NDGA 3N1FC 2NTFB 1KENH 3RWEB 2ZOLB 5TDPA 3PWNB 5IG7B 3C2AH 4BA8A 2Z8WC 3MXWH 4QTIL 1S7TA 3DHJA 4GG8B 4PGJA 2X89A 4OQTL 4GKNB 3GJFH 1RZIA 2Q76A 3DVGA 4LASL 4V1DE 4O4YL 4A6YL 3OF6A 4ZODA 4WI2A 4ZXBA 4LSQH 3MRIB 4YHYB 4XPTH 5HPMA 1ZA6A 3ETBF 5HYJE 1FSKC 3SKNB 3JV6B 5EOCJ 1NGWB 2P5EB 3DX6B 4NNXB 4R4ND 1HEZA 2YN3A 5FUOL 5BJTA 4HULB 1FGVL 3V5KA 4MA3A 4NNYA 1F8TL 3IT8D 1NBYB 3P4LA 4QTHB 4DN3L 1PFCA 1T22B 2NZ9C 2LVEA 2W65A 3TJHD 4EBQL 3W9EA 3E2HB 3FQUB 4G6FB 3T1WA 5D8JH 3O2WH 4L29B 5I71B 4HCRH 1Z3GL 1FVCA 4TTGA 4EN3A 5H35B 5DJDA 2NQCA 4JAMA 3J8F7 2P5WE 2F8XC 1F58L 1VENA 4YHNA 5B8CB 2JF1A 5I18L 4J8RA 3EYOA 1A5FL 3MGOB 3DSFL 3LH2H 4NQVA 4X9GA 5BS0B 1UA6L 4QEGA 2R9HD 1N6UA 4XWOC 3U2SA 1RPQA 3L5HA 3ZE0E 3AROA 1W72B 3LKPB 2VXUL 3MR9A 2NY5C 5JMRA 2EIZA 2Q7YB 4O2EA 4FHBD 2H8PB 1AO7A 4P9HH 4YHKH 4UIKL 2A74A 3IAPA 3OXSB 3VRLF 4WEMB 4L8BB 2X4TB 2ZSVB 3RZCD 1MREL 4P2OB 1AI1H 5CUSH 1BAFL 1NFDB 5J6HA 4J6RH 3FL7A 5IMKA 5TH2B 4K9EC 5JW4R 3D3VA 5LBSL 5IWLC 4I18B 4L9LC 5DMGD 1WAAE 4UZGA 5E4EC 4Y4HA 2NY4D 4PJ9B 1C08A 3WKNA 3IKCA 3V9FA 4XPFH 3SBWC 3HPLA 1S5HA 4HS3B 5F6HI 5EU7E 3SE4A 3WEXA 1B0GA 1U8NA 4ZMAT 3EOTL 1NDMA 4OZHF 1UYWH 2RCSL 4MWFB 1ND0A 3GSWA 5BMFL 2UZYB 5L2KD 4N1EA 3TT1L 3MRBA 1EAJA 1JPGB 4OGYL 4TVPD 1XF2B 2IG2H 3IDJA 3RTQD 5C0NC 3WNPA 5DI8B 1S7XB 1OTUC 5C0IA 3TC9A 2FWOB 5EUOF 2VNCA 3X3FH 3MLVL 1KULA 4L3EE 2AK4B 4MD5B 5EG6C 1U8PA 3R06A 1I4FA 3VFTA 1URLA 2E8YA 3QNZA 1AP2A 4RAVB 5CP7A 1WC7A 3B9KD 3P0YL 5HHOA 4XZUA 3HMXH 5DJYA 4X6DB 4LU5L 4TNWF 1CFNA 4ZO9A 2R0WH 3TCLA 4DGIH 4OQ1A 1MRDL 1WUNT 3A67L 8FABB 4H1LG 1FYTB 4HGWA 1I7UB 2NLJB 2QSCL 4NKDB 4PJGF 5IM7A 4GW5B 3ZO0A 1RJZA 1N5AB 3QDHA 1CIDA 3FO0L 2YRZA 1F4XH 1QSED 3BH9A 2CRZA 5FV1L 4KJQD 1T0PB 3UPAA 1NCBH 2UWEE 4LMQI 5C0FA 3RDTC 4NZUH 4YR6B 1QO3A 1U9KA 4DOHE 2Z31C 4HIHA 5I76A 3OR6B 4N8VA 4HUMB 2J1KA 2R0ZL 5T1DL 4UINL 3TM6A 3RWIA 5ISZB 1XIWB 3GSXA 3IF1A 1CBVL 3VXMA 3OG6B 2DWEB 4WFGE 1KG0B 2AEWA 1RFDL 3FB7A 1FGNH 3CMOH 2I26N 3VWJB 3I02B 2VABB 2W0FA 4D9RD 1S9XA 3GMMB 2HG5A 2MFNA 1PZ5A 1MI5A 4HUWB 2J6EH 1CE6A 4HZLA 1JL8A 5I1GL 2JKXA 2CRIA 4ZAKA 4BQ6A 2XG4A 5TJWK 1D6VH 2D0GA 4PTUB 3DMMA 3NTCH 1F90H 1AGBB 1OHQA 2RBLA 3RGVB 4XNQB 2ZUSA 1YPZF 3HNTH 1K9TA 4P3CL 5T1LB 1LP9E 5CEZH 1NC2A 3UAJD 4YFLI 3FO1B 4K94C 5D70L 3VFPA 4C58B 2NYYC 4LCWD 1FIGH 3G08B 1T7VA 2EYTA 2QEJA 2V5YA 3UZQA 3WV0A 1XT5A 4OBSA 1JYNA 4X6BA 5EU5B 3D2UA 2APXA 1RSFA 4JANA 1UGNA 1F4HA 3FCTA 2VDMH 3U4AA 1GZPA 2BJML 3EZ8A 5IVXA 5E2TL 3GMLB 4ZS6C 2Y36L 5DD5L 3A6CH 4MD4B 4X4XB 3HB3C 4JRXD 4JFYB 2F19L 1CK0L 4JM2B 3HNSL 3H42L 5FF6A 4O00A 5IW6B 1JRHL 3ZKMD 4LKXA 5EU3A 2C4FT 4NQCD 2GTWA 5KSVA 1RUMH 3G5XB 4YHLH 5F88B 5IHBA 1E28B 4YUEL 5JW4M 2XT1B 4IOFC 5E70A 4MX7B 1X5YA 4I4WA 1XGTB 5CILL 3N1MC 3G5VA 4BELD 5DRXB 3QJHB 3DI3B 3VU2A 5CMAB 4JFDD 2PTTB 1MCPH 3QEUB 4PJ8A 2OJEA 2OR7A 4JZJB 3I6GB 1SY6A 2Q20A 2EECA 2JELL 5FYLH 4MA7L 3G6DL 3BPNC 2ICWA 1RIVL 3T0ED 4M6ML 1EHXA 1UADC 2B4CC 1QA9A 1J11A 5ITFA 4E5XB 2DLEA 1T7ZA 2DQCL 4PJCE 1F4WH 4ISVA 1QFWH 3QJFB 1YYLH 1M05B 1IC7L 1RI8A 3CFDB 3ULUE 4HDIA 2YN5A 3Q0HA 2BDNH 4NP4L 5DFTA 2SEBA 3TIEA 2XNAA 2NY2B 4X7SH 3LB6D 1B9ZA 1HILB 4NFBA 1T3FB 1XGPA 3EJYD 1OCWH 3BPLB 5KBNC 4LAQH 2A6IB 2CDFB 3O3AA 4LDLB 2EC8A 5IF0B 2NY7H 3OMZA 5F96H 5CJBA 4PJXA 2EE3A 5T33L 4RRPA 2WINA 2BVQB 2R1XA 5BXFA 1PVHA 1U8MB 4UOJA 3GSOA 1VB9A 5KSBE 3FT2A 2HT3C 5FKPA 3STZB 1PY4A 4X9BA 1EDQA 2W0KA 3OX8A 3MJ8A 3FN0H 1RZJC 3SDCD 3PNWA 1IEAA 4HUXB 4RFNB 2VDLH 1NLDL 5ACZB 1YEHH 1U3HC 3NOIA 2H9GA 1SEQL 4K23H 1VACB 4XC3H 4LAJH 3MUGA 5LG1A 5I1EL 4PBVC 3MJ9L 3S34H 5C92A 3S97C 5HDQH 4DW2L 3AM8A 1NGPL 4I9WE 3LRHA 3WN5B 5DA0B 3VFUB 4N1HB 1INDH 1MFAL 3BRGC 3MV01 3MLZH 1EHAA 2ADJA 4ZS7H 3ZL4L 2GEEA 3MLYL 4KHTH 3W11D 15C8L 5F1IB 3ZHDA 5E8OA 4KHXL 4K3HA 3GHBH 1W0VA 3WIFA 2XKNB 4LSPL 4PB0L 1XH3B 3U30B 5L2JB 5BV7C 2OK0L 5F8QC 5IW1B 3T04D 1BVZA 4QRRA 4I3SH 5TF0A 3EDFA 4JY4A 1KTKE 5C9JB 4JFFA 2L4OA 1UJ3C 1R5WB 3CX2A 3LRGA 1RVFH 4R96B 3KYNA 2CKBL 4G8IB 4WU5A 3H8NA 5MI0B 4OCWL 5J06A 1L9NA 1BF2A 3MC0A 5D5ME 4TULH 4M1DL 2VKXA 1CDIA 3ULVE 3U7YL 2EH7H 1NCNA 4OD1H 1TNNA 1S9VA 4RZCA 5IV2A 5DYOB 1T83C 2XZQH 4YIQA 2NX5D 1YEFL 3K0WA 4NBXB 1C16B 4PJ5A 1ZVSB 4KQ4L 1MHHB 1D3CA 2XN9A 2F8OA 4RFOL 2ATPA 5IK3B 1G7JB 1D9KC 1P4BL 2GSGA 1ZLWH 4U0RB 3D48R 4GXUN 3RI5K 4JM4L 2VISA 1MFCL 4FQXC 3SY0B 2GFBB 1F00I 4I8DA 3B83A 1BMGA 4PG9A 4PJFB 2VIRA 2J8UA 1KFAH 2FECI 5JHLL 4JPIA 4LIQH 3ARBD 4PYGA 4TRPL 2APBA 3E1F1 5HGDA 1JGEB 1KLUB 1G7PA 3S96A 4UMGA 4K94L 2E5EA 3QP3A 1J7VR 2E7HA 2XWJA 5I1HL 5E9DE 2FR4B 2QADD 4R2GC 5JUEL 3QDJB 5E2VH 4H20L 1I3RB 1J0JA 1CICC 3ARGB 3CLFL 3FQTA 4U3CA 3G6JA 4XCNA 1PD6A 1IC5L 1JPSH 4OZIB 5I1JH 2NR6C 2VDPH 3VGFA 4PR5A 3TT3H 2DTMH 3D9AH 3WNNA 1MF2H 3FONB 1E4XL 2YHGA 3MOAH 1TJGL 3ROLA 3ECBB 2AJZA 2YA0A 5JOFB 5CZVL 5F72S 5GISH 2CDEB 2JIXD 4DWHA 5FYJL 1S7QA 4EZMA 3KXFD 4YX2H 1M7IB 1TZIB 3C5JB 4PJDB 4M7LL 1G84A 1S78D 4K7PH 2XKSA 1ZLVH 3BX7C 4KY1H 3D0VB 2DL2A 5BOPA 3UC0L 4Q6YA 1N6QH 4HV8B 2DYPB 4GMTL 3KJ6H 2VXVH 2AEPH 2C3HA 3JWDL 2Z35B 4HLZG 5IMMA 1ZHNA 3RHWK 3LHPH 4NWUH 2L0DA 3Q2CA 3N85H 4BSVA 2FEEL 1F4YL 3V4VH 3OZ9H 1P5VA 3U82B 5I8OH 3F7VA 3SO5A 2DB8A 1MFEH 3TJEH 3QO1B 3QIBD 3WFBL 4QOKE 2IAMC 4PRAA 3LRSB 1LEIB 1YQVH 2ZUQB 5C0ND 4LPTA 1CQYA 4GJTB 4OD2A 4NRYB 2VH5H 1EBPA 1P84J 2B4CL 2H41A 4XXDA 5E1HB 4PLOB 4QXTB 4LPWA 1A9EA 35C8H 4FG6D 2R8SL 1PX3A 2ITCB 2MCPL 2A83B 4L1HA 5GGTA 1N59B 4NKOA 5GS1B 3RVWC 1NCDL 1UH2A 3AFLA 3F7YB 3MBEB 4LPXA 2Q6WA 5T1KB 4Y1AD 3UZEA 4JFXB 3GGWB 3BI9X 4Z0XA 3PL6A 1FZMB 3SHSA 4Y4KC 3B4NA 1U93A 1WGOA 4LSVH 3HR5B 1Q0XH 2RHEA 2XFXB 6CGTA 5E08H 1S7RA 4PGBB 3LEVH 3UJJL 3L9RB 3TBVB 2PO6A 1RURH 3U46B 4U6VL 1FL5B 2DKUA 4D0DA 4J3VA 3HNVL 3RPIA 1NAMB 1RUQL 4MJ5A 3BP4A 4QHLA 3HG1B 4JJHA 1FL3B 3QUMA 5D2LE 5GRVK 5C0BB 4ONHA 1IGCL 3IDIB 1NFDE 1FNLA 5EO9A 5T5FL 4OZFB 2BNRD 1B3JA 2JJTC 2X7LA 3LS4H 5CD5C 1KN4H 4YNYB 3SDDC 3FO9A 2G9HA 1G6RA 1T04B 4H8WC 1LQSR 4R26H 3TA3D 1EMTH 3HE7C 4EUPB 4TUOB 1IKNA 3FFCA 2AJVH 1I8MB 3BKML 1S8DB 5HXMA 1MCNA 3PIQB 1I1FB 2VN4A 5E8DH 1AD9A 2XTJC 2W92A 4CMHC 3RWGB 3U6RA 5D7JD 1KXQE 3OJDB 4CDGC 1T5XA 3O6KH 2ZSWA 3MLWL 4ODUB 2OSLB 2NYYD 4DN4L 3WHE1 5BV7L 4GBXA 5LGJB 1OAQH 1N0LA 3TFKC 3VWKA 4LSUL 5HYFA 2L7UA 2OTPA 4FFWC 3KR3H 4XP5H 4EDWH 1S3KL 1MNUL 2YPVL 5L9DL 4HEME 4HIIA 3DSNA 1J10A 3MUHL 4OLVL 3P4MB 2FYYA 5CSBA 5DD1L 3LZFH 2UY7A 1FNHA 3L5IA 1UWXH 2W1NA 1G0YR 2DLGA 3BP5B 5EO1B 1IC4L 1K4CB 4HJGA 2AK4E 1XF5A 3QEGL 4LRNH 3SOBL 1A7BA 2L7JA 3B3IA 1G6VK 3IETA 1IGJA 3PWUA 2KZ1B 4APQD 3IGAB 4AM0B 3NCJH 1N64H 3IDYB 4L4VD 4JY6A 4UV4L 3LV3B 5DD3L 3OGCB 4WENB 2I5YL 3U4BL 1YNKH 4P57B 1MCJA 4JHWH 3MRQB 1FYTE 1MQKL 2J88L 3DROB 3O6LL 3VFRA 2LFGA 4P4KD 2VLLA 3RZCB 4PY8J 1NGXA 5HHVL 1UB6B 4WFFE 3ZKXC 3ZT7A 3C5ZB 4JN1H 4TOYL 4I48B 4BQBA 2FJFB 4I3GA 3NACH 4Y16A 5ILTH 1RUKH 5HVFB 3LCYA 1QHOA 1OP3H 4WO4A 1B0RA 5SWSD 1RZKH 3GI8H 1T89A 1FPTL 1TFHA 4LBEA 5KAQG 1GC1L 3FKUS 4KKBC 2NY4B 1MJJB 1OQXA 4KJPC 5JTWA 1U91A 3KPSA 2RGSA 2AQ1A 3HC4L 4QY8B 4WEBL 3WJLC 1EHLH 2R1WA 3GSNA 3QCTH 2V7HA 3MZGB 3VI3E 1FLRH 3HUJA 4HHAB 2VAAA 3GMNA 3FN9A 4JFEE 2CJUH 4LSSH 3G5YA 1C1EH 5DJZA 5I74B 5L2KB 4WWKD 2DM4A 2IFGA 3AVEA 4UUJB 2GCYA 5DA4A 5D7SL 4POZD 5CJOH 5GXBB 4OZGB 5BRZA 3JWOL 5IB2B 3RTQB 3TYFB 5CJQH 2I9TB 4KMQA 3LKQA 1V3LA 1GGCL 1P4LA 1YEJL 4P5KB 2X89D 2N4IA 5HGBA 4RAUB 3E6FB 5F44A 3H6JA 1U8KB 1NCAH 4XBEH 3VI4F 3OF6D 3H9HA 4GRWF 1PBYA 1Q94B 3MRJA 3VMOA 2VDKH 2AXGB 3R1GL 3MA7B 3B9KB 1T1WB 4HK0B 5IQ7L 1I8IB 1ZHBA 3LD8B 1DBBL 3U1SL 4MQ7B 5EU6E 2G75A 5I15L 4RQQB 4NO2A 3I50L 1A7PL 1A7OH 1NC4D 1U3HD 2R0KL 4GKSA 5F9WB 4OZHB 3ZE1E 2CO6B 3O11B 4EN3D 1QSEB 1U8QB 1S5IL 3DO3A 4HH9A 3ZKQD 5JDSB 3RFZC 4R3SB 5FXCH 2X4NB 3LQZB 3EYUH 4BK4A 2Z4QB 1XR8A 3LKNA 3CVIL 4OV5A 3RVUC 4C56A 1J8HD 1D5IH 2WUBL 1P84K 3FT3A 1PG7X 4YQXH 2WBJC 2XWBB 1KTLA 3MYJB 3SO3B 2HFFB 2IPKA 1AO7D 2VOTA 5GS2H 3QUXA 4H5SB 2Z91B 3WHE0 4CVZA 2VR9A 1KTRL 4NC1E 4V1DA 5IVOA 4J3UA 2BY0A 3TWCL 1WLHA 3C09C 4FP8L 4LHQB 4N0RA 4R0LC 5JO5B 4XNMA 5HYJA 4PJGB 3BIKA 1M7XA 3X17A 3SKOA 3SPVA 5TPWL 3HRZB 4Y4HD 1IAII 4Z8FL 1N2RA 3KPRE 3IDNA 1HINL 5JQ6H 1KLGB 4X7DC 4LCWB 4PJIE 1NEUA 3G5ZA 3TESA 3CDYA 3GSVB 1D9KD 2C7UA 2A6DB 2J2ZA 4NQTA 2IQ9L 1MCEA 3WNOA 4H8WL 5IBTL 3O3EB 3EYSL 3V5DB 3TBSA 43CAB 1H0DA 3TP4A 1BECA 1RZGB 3B8SA 2WM0A 2FL5A 4NIKB 3UX9B 3ZDXF 4F15B 5AUMB 1KXVC 4WW1A 4Y88A 5C0CE 1RULH 2ZNXA 3BAEL 4Q9RH 4JRXB 3BO8B 3VXPA 1M7DB 2X2YA 2K3TA 4KMTL 1AR1C 4GMSL 1NFKA 1OB1A 1YY9C 2DBLH 5C86A 3K8KA 4NQCB 2ZUTA 5DURD 1C5DA 2EDJA 4EI6B 4CU7A 2VUOA 3ARVA 1DQTA 4YHIB 1ZHKB 4TSCL 5EOQH 1HNGA 1N3NA 4KROC 4ZG1A 2HVKB 2NR6D 3CSBA 2DWDB 5EBWB 2XXMB 5C0AA 5TQ2L 1IAMA 3ZLQC 1JYVA 2A38A 3CC5B 3GI9H 3U9PH 4P3WA 4TUKL 4OKVA 5T1MA 4GLRI 2F54E 4GKZA 4P48A 3L3HA 5FGBC 4JFPA 3T0EB 4BFEA 2EDDA 2D03L 3BVNB 2EXYC 1WVZA 4IS6A 1QBLH 4YHML 4Y5YC 1IARB 2ITDA 2Z8SA 5MHSD 4XNUH 3CAFA 4ZUUA 3NAAH 2D9CA 3NCFB 5HHQB 4RGNE 3WYRA 5ITBH 1CLYL 3VXMD 5CBAB 4LLQB 3SE3C 5CINL 1FAKT 3VD4A 5KS9F 4YDJB 5J12B 3BISA 3IFLL 3INUL 2CIIB 1MI5D 5DQJA 2BOBB 4JG1L 4L3EA 4YH6A 1FORH 1D5XA 2ERJC 4XNYH 4HWBL 2R56L 3LIZL 3VDAA 3X3GH 4QT5B 4YWGL 3K80A 4IRSA 2WUCH 1VPOL 1A6WH 3DMMD 3CX5J 4OFDA 4P5MA 3F6IA 5C0GB 3BQUC 1FN4A 5T3XH 5EOTA 4AEIL 1AD0B 3H3BC 4M1CC 3BGFC 5DWUL 1K5NA 3HPJA 4JRWA 4FZEL 4JJ5A 3BH8A 4JFZH 5DJ6A 3SDAA 1ZS8B 2DQUL 1HQRB 3QHZL 1F6LL 4PP2B 3SDCB 4OD3H 4YDVA 3DV6B 4R6UA 1BM3L 1QLRA 4YE4L 4QCIB 5DGQA 1ULVA 2H2PD 1EX0A 1U8LA 2UWEA 4D3CL 5MEQB 1G7LA 5GRYA 4KZEL 3ZDZE 3EOBB 3HZKB 3DARA 1INQB 2BVPB 2VLKB 5F89A 5EC1B 3O3DA 3T09A 1A64A 1EZVY 4JZOA 3QDJE 5DZNA 5FYKD 3MV8A 1Q9OB 1CD1A 3BXNB 4KVNL 3EDEA 4PY7B 3TO4A 2AGJH 3QDGD 2HRLA 5LAXA 4OZIE 3T4YA 3C6SB 3WFCL 5I9QC 4BYHA 2NZIA 3ARFA 3RU8H 1G9NL 2OZ4A 1DE4A 3E8UL 3M45A 2DQIH 3RA7H 2QSQA 4OLWL 4XBPB 1INEH 3HE7D 2YPLD 1IGML 1BQLL 3BD3A 3SDXE 4HS8L 1DDHB 3GIZH 4V2BA 3KLSA 2Z8RA 3QHFH 3OWEA 5T3ZL 4YBQD 1NGZA 1UXSB 5TFSL 5D1XC 1MQ8A 2HKHL 4G80A 3TVMC 2NX5B 4JRYE 3V7MA 2BNQE 2OL3H 1C5CH 2O5XH 3S88H 1OOAA 2F5BL 3HC0B 2V7NA 4PV8A 4FFWD 5JPMA 4K7FB 3BDBA 4QF1A 5LGHH 2XA8L 3ZKND 1Y0LB 5D4QA 1NCTA 2P45B 1BD2A 1PKQB 4O02L 3EYVA 4Z7VF 3MLRH 1OAXL 4X80L 1UCBH 2J8OA 5DUPH 1ED3A 4LCCC 3TZVA 2LABA 3X14A 4P9ML 5EBGA 4MJ6B 4I0KA 3PHSA 5CP3H 1IGIL 4XVSL 2YBRA 4O5LL 4QRQA 1PZUB 3ARBB 2HT2C 4PRNA 4Z7WF 4HJ0D 3UYOD 3MRFB 1CXKA 3QWOB 3B2VH 3BPCA 3MBXL 5DC4B 1CDCA 4NQEE 5IB1A 3WUWB 2QADB 5EC2B 5GGQH 5HYIA 2BERA 1LE5A 1I1CA 3ESVF 2FJGA 5IT2H 3GBNL 4JPKH 1CXLA 2VTFA 4TPRH 3OHXB 4WIQA 2WW8A 4E9LA 3UTOA 2GITA 4ZFGH 4GH7B 1KB5H 4JY5L 2YSSA 1H8NA 4JHZA 3F7PC 5I1IL 4L9LB 4KDTA 5SWZD 1CG9A 2JIXB 5E4EB 1BOGA 4KKBD 1IE5A 3RX5A 3KXFB 3FO2A 3RUGE 4PJEB 2R4SL 4YZFF 5KJRH 1R3IH 4PJCA 5L8LB 2OXHA 3X11B 2W07A 5MEND 4OIIL 5C0BE 1OLZA 4OLEA 4OGXL 1T21B 3CFEB 3LPGA 1A6UL 4K2UH 3T0WA 1QUNA 1DSFH 3MGTB 1PG7L 2KQNA 4JO4L 2FNBA 3LQAH 1IKFH 4NSKB 3QIBB 4TSAL 3DIFA 5DHXB 4JO3L 3H9SD 4KPHH 2ZJSL 4U6HB 3QUZC 5IMLA 2B7DT 2HKFL 5HDLA 1KCLA 1FZKA 3IU4H 1HNFA 5GJTL 4MXQC 3NA4A 4DAGL 2OMNA 1U95A 2DIJA 1KENL 5KSBA 5E7BA 1AFVH 1FVDA 1YMHB 3MXWL 4UNVA 4ZUWA 4XBGB 4M7KL 1FH5H 1L6XA 3JV4B 4YGAB 1A3QA 1MCFA 4RDQF 4HIJB 4M6OH 4Y1AB 4LKCB 2VDRH 3F65A 2DQFA 4MVBD 1MCKA 2BMKB 4OZFG 1DQLH 3RL2A 4XPTL 4MAUH 2XN9D 4P5TA 1QACA 1WV7T 4G6JH 4OF3A 1A1MB 4L8SA 4LVOB 1NL0L 3DLQR 5BW7C 3DTXA 3FRUA 1PLGL 4LEXH 3MRHA 4MSWA 5A3ID 1JE6A 3DUSB 1L7IH 2APVA 1U58A 3KNBB 1C12A 5GRJH 3SE9H 2XQYK 4YPGB 3H7BB 4YHZL 3JUYA 3OJ2C 1AGDB 1DQQA 1NQBA 3QO0A 5J57B 1EEZB 4XAWH 3U0TA 4XPHL 3N1QC 4Q9CA 3P30H 5DJXA 4YDKL 4HQQL 4J4PC 4FZ8L 3LH2L 5KSUB 4XI5C 5DC9B 3L5WA 4WHCA 2BNRB 4O2CB 4UU9B 3HZVB 1V7NH 4TUJB 1BBJA 4NJ9H 3RIFF 3S35X 1I1AC 4WV1C 3T2PA 2Z9TA 3VFNA 1CXEA 1U2CA 5F3HB 3TA3B 4XCEB 5D5MA 1BZ9A 5JOPE 2WIMA 3GMQB 3IDXH 5DK0A 2IBBA 5FEBA 3LPWA 1TITA 1AI1L 5D7JB 3WIIH 4HJJH 4UTBL 4XAKD 4DVBA 1A02N 2PW1B 4Q97A 4ZSOA 3FTGB 3WHXA 3LKRA 5L2KE 2EEAA 2LVCA 2UV3A 5JIHA 1LO5A 4TVPE 3IJYB 3VRLE 4U1JB 4S1RL 1ITBB 1MLCB 2LAAA 4XPFL 4LCUB 5ADOH 4GQ9H 1ZSDB 5HHXH 3FOMA 4JQIH 2HFTA 1N5YH 5I2IB 4P2RD 1RV6X 1YJDH 2Q1EA 4APQB 1ZT7B 3QIUA 2J4WL 4LNRB 1KPRA 2B1AH 5E9DA 2H32B 1S7SB 4LQ1A 4L4VB 5INCB 2YD4A 1YY9D 4HKJB 1UM5L 2IG2L 3T3MF 2VDOL 3O6FD 2IH1B 3B5GA 4Z7UF 4P4KB 4KKAC 4I0PC 5AEAA 1AXIB 4HS6A 3X3FL 1DJSA 3PABA 4OZHE 4RGMC 5D7LE 4TTDC 2OQJA 3JVGA 3K8MA 2PETA 4Y89A 3OGOE 1JHKL 2NW3B 3PL6D 3RJDA 3F58H 5SWSB 1FAIL 5F9OH 5KVFH 4DGIL 2NXZD 3QQ4B 4Y5XC 1CZ8H 3HE6C 1W8NA 3OQ3B 2BFVL 2X4UA 4FQQB 3WFEL 4AJ0A 1TJIL 2Z93B 4JN2B 4BSWA 4PV9A 1I75A 5EUOE 5GRUH 3VFOB 4LNVA 5DUML 3UXFA 2AV7B 2FX8L 1UM6L 2NTFA 2ZOLA 1XMWA 4PG2A 3KPMB 4KWUA 3PWNA 3S3PA 5IG7A 4GG8A 1UKSA 2AEQH 5I1KL 1KNOA 4D9RE 3RKDC 4WW2B 5J0BA 4Z6AT 2VLME 1X5GA 4WWKB 5ALCH 2JJSA 4IIQB 4M4PA 4OLXH 1AGCB 4QOKA 5IMOB 1T6VN 5K9OA 4UIMB 3EGSA 4AEEA 3MRIA 3BDYH 4KTDL 4PJGE 3SKNA 2DKSA 3JV6A 5HI4D 1ORQA 2P5EA 3SKJL 1S7TB 2EXWC 3QB7C 4NNXA 1BJ8A 4DUXA 1RZIB 3CMOL 1NBYA 2G5BB 4G9DB 3NPZB 2P7TB 4HZAA 1FDLH 1T22A 1QSFE 5F6IB 4LCWE 3FQUA 3L3JB 4D2NA 3C6LC 1FHGA 3QRFM 4BKLB 1EV2E 1JZ7A 2J6EL 3BQUD 1BFVL 1ZA6B 4NN6B 4DGYH 4M1CD 4OCYH 3KG5A 5BJTB 5H35A 2IGFH 1K8DA 4G7YL 1D6VL 3BGMA 3C8HA 5B8CA 5EIQA 2D7MA 3CFKA 5EZLA 3ARSA 5GS0C 1Y18B 2GUOA 3MGOA 1NC4B 1U3HB 4NM8L 3DYMA 3D25A 5I8EB 4LDOB 5CEZL 1QFPA 4EN3B 3U4EB 1RHFA 1W72A 3LKPA 3L5JA 3PGDB 4EOWH 3DX9B 4S1QH 1A7RH 1ACZA 2H8PA 1MCHA 4DK6A 4AG4L 5KSAC 5DZOA 3OXSA 1IM9D 5IR1B 4NQCE 4JPWH 1HZHH 1JWUA 4NQVB 1BEYL 3RIAF 1KJ3L 2G60H 2CLZB 2X4TA 3U2SB 3SGKC 2DQEL 1AGFB 1YPZE 2Z0BA 3R0MA 1J8HB 4XPAL 1C7SA 4P2OA 5D2LA 5ELIA 1KTDA 1IRAY 1NFDA 5HHPB 5L6YL 4O2EB 1AO7B 1MCCA 3RY4A 4FQ1L 2FHBA 4NBYB 2A74B 5FGSA 1CWVA 4I18A 1GOGA 2E7LA 4ZUVB 4YXLL 2DJSA 3IVKB 2WV3A 4PJ9A 3MA9L 3S37H 1EVTC 4Q2ZB 5E94A 1UJ3B 3G04A 4YGVB 5IFJA 3T0EE 4Y16D 1J9CT 3PHQB 4HS3A 3WL9A 1IAOA 4WO4D 3V0VB 4MWFA 2P8MB 5D1XD 5EBLB 3CVHH 1MCPL 1CD0A 1OSZA 1V05A 4HH8A 4BUHA 4L1DA 4ODVH 1JPGA 5FYLL 3WO4C 1S5HB 3JTSB 4GO6B 1XF2A 3FAXA 3UEZA 1D9KB 1JHLL 1KB9K 2V5SA 2YOCA 3GFUA 1WZ1H 1S7XA 3GDBA 4Y8DC 5DI8A 3L5XH 5A2IH 3FRPG 5AD0B 2CDGB 5HGAA 4LF3B 4K3EH 1NFIB 2AK4A 4MD5A 3KHOA 1QFWL 2GKIA 1R3LB 3MRGB 4ORGA 4OSUL 1ZE3C 5B3JF 3AB0C 3ARZA 4AL8H 2H2SD 2OJZL 5E8NA 5GGSA 1BQHB 2VLJD 1MEXL 3P0VH 4RAVA 5A16A 3ZYZA 2E3VA 1BIIA 4U7MA 4X6DA 2NNAB 3NFPA 5C0IB 3S36L 3HA0A 4LPUA 2ZCLL 3NGBB 1KBGH 4OCNC 8FABA 3FFDB 1FYTA 3THMH 3V0AC 4CMMA 5C2UB 3R06B 1I7UA 2NLJA 4NKDA 5DURB 2IFFH 5CP7B 2GK0A 2KQMA 4XZUB 5AZ2H 3L6FA 1EZVX 2E6JA 1RZ7H 2FLBT 1HXMB 2V17L 3IYLW 1T7WA 4L3AA 1KELL 5IHUH 4YR6A 5IB4B 1AIFA 1WK0A 2VLKE 4KVCH 1RJZB 3OR6A 4K07A 2D7PA 1XIWA 2CH8A 4OQTH 2DWEA 1IGTB 1KG0A 1YEHL 3RNKB 4KZDL 4LASH 5J89A 3VWJA 4O4YH 4A6YH 4JFEA 4ZFOB 1HK6A 3GMMA 1NUFA 3OTTA 3OBAA 4R97B 4HUWA 2ATKB 4ZYKB 3FZUD 1INDL 2A0LC 3PXHA 4IHOB 5FUOH 3MLZL 4L4JA 3HZMA 1T2QL 4ZS7L 3ZTNH 4PTUA 3NPSB 1OSPL 4KHTL 1AGBA 4DN3H 4G6AC 3RGVA 3DV4B 2W0FB 4XNQA 1S9XB 2WIIA 3QUZD 3S35L 3GHBL 5T1LA 1PZ5B 1GH7A 1MI5B 1RUPL 3PV7A 1Z3GH 1EAPB 3UO1L 3FO1A 3G08A 2BSTB 4Z95H 1F58H 3DMMB 1VFAB 4Z77A 5EU5A 5I18H 1A5FH 4ODSL 3QQNA 2HTKC 1MFDL 3VG9B 1UA6H 4Y4FC 1EK3A 2HFEA 2CIKB 3F12B 3GMLA 4PLKD 4NRZA 4BFIB 4Z0BH 2D7OA 2MQ0A 1EO8L 2VXUH 4MZ3A 4TULL 1DFBL 4MDJB 4NQSB 2IADA 3MO1A 5JW5A 4X4XA 1SYVB 3DHMA 5FA4A 4G3YL 1DQJB 3GSRB 5FA3A 3EO0A 1XR9B 2W59A 3EW3B 4JM2A 3FCTB 4WY7L 4LLMB 1I3GL 4OFPA 1GZPB 2FGWL 2P5WD 2R1YB 4RMRA 5JORB 5IW6A 4DVRL 4ZO8A 5IVXB 1NANI 4NZRH 1BLNB 1MREH 2FB4L 4JQXA 4ZAKC 1BAFH 3RVVD 5KS9B 5F88A 1E28A 1JPTL 4Q9BA 3VD3A 4ZNEE 4N0YL 3KJ4C 1KGCD 2GHWB 5FF6B 3QJHA 2XZZA 2I60L 2PTTA 4J4PD 3QDGB 1HYRC 4QHMB 5GS0L 1FE8H 5EU3B 3QEUA 3QDAA 4YFDB 3I6GA 4LIQL 1RZKC 2FO4B 2OBGA 2X4QA 4YEFA 2PYED 2WLZA 1CS6A 3EOTH 3HE7B 2YPLB 2RCSH 1GOFA 2DM7A 2LU7A 4E5XA 4NHCL 4XRCB 1WTGT 3AUVA 3TT1H 4K8RH 3QJFA 4PLNC 5J1SC 4X83A 1GHFL 1M05A 4OGYH 4K3DL 3KPRA 2ICWB 2VDPL 3TT3L 2DTML 4PJIA 5ANME 1YYML 1I7ZB 1MF2L 4FQJH 9CGTA 5I30L 3BKCH 1HILA 3MLVH 4HKBA 1F2XK 1J1PL 3B43A 3QYCA 1BJMA 2CDFA 5IF0A 4HDIB 4JDTL 2QBWA 4JGJA 4MMXC 3QDME 3P0YH 2XNAB 2HRPL 4LU5H 2BVQA 2BVUA 4DZBB 2ZG2A 1U8MA 4P59H 1OM3H 1WBZB 4PJ8C 1XGPB 3STZA 3QFDB 4HF5L 1F3DJ 4NWUL 2QSCH 2G2RB 3S4SB 3V4VL 3SGDI 3OZ9L 5I8OL 2UUDH 5CJ8A 4EIGB 1MFEL 3BDXA 4YC2C 4HUXA 4U0QB 2HP4A 4XGZB 4ETQA 3BOVA 3GSOB 1UXWB 3BP6B 5FKPB 2YRPA 3GRWA 1VACA 2VH5L 3ZKXB 3OX8B 4KUZL 2OYPA 3P9WB 5T1DH 2R0ZH 3C8DA 2D9QB 4HXBL 3SDAD 4CU8A 1TQCC 4X4ME 4WHDA 3UTPE 1RFDH 5SWZB 5GRXG 5F1IA 3HE6D 1T0MB 4N0CD 1WCBA 3VGAC 4J3TA 5L2JA 1QSVA 5I1GH 2APFA 1IM3B 5MENB 4ORZC 5IW1A 2ADJB 5D2NC 1Q0XL 4FXLA 5AAWA 2CLRB 1CT8B 3MV9E 1R5WA 4R96A 5E8OB 5EZOL 3ZMRA 3QIWC 2VL5B 4MXVF 4EQ3A 4G8IA 3TO4D 1HWHB 3CIQA 4WNQA 1IVLA 1RD6A 3NN8A 5A43C 3H9SB 4X5WB 1JZ8A 2EXWD 1AKJA 2GY7B 4Q0XL 4MS8C 2KBGA 5DYOA 1G0XA 4MAYC 3KYNB 4N0UB 1C16A 4WU5B 1ZVSA 1KN4L 3C60C 1MHHA 2PW2A 4Z76A 4M8QB 3C6LD 5IK3A 1G7JA 2Y36H 1JMXA 3MLSL 2P8LA 1G7MB 4X98B 2OR9H 1S9VB 3EHBD 4J2XA 4RZCB 5IV2B 2XKUA 4RMUA 1CK0H 3H42H 3SY0A 2GFBA 3RX7A 5D71H 4OCLC 2YC1B 1JRHH 4PJFA 2XN9B 1CD9B 2HAZA 3FMGL 2E27L 3CXDL 2GSGB 3PWPD 2IQAB 3REVA 3ME0A 3H0TB 1JGEA 4YUEH 1KLUA 1LGVA 3P4NB 2UUDK 4PRDB 1YEKL 4K71C 4RA0C 5CILH 3TZVD 1LO4L 1ZWIB 2VISB 5ESVB 3MRRB 3KR3L 4L4VE 3JSSA 3QDJA 4PG9B 3QQ9D 2VIRB 1I3RA 2J8UB 1V7ML 3ARGA 4AIOA 2JELH 5HGDB 4W4NA 1G7PB 4XC1H 3S96B 4OZIA 4MA7H 3G6DH 1MJ7L 4GRLC 1WZKA 5FCSH 1RIVH 4PP1D 2D31B 3ECBA 1WBYA 5JOFA 1I8KA 2DQCH 2CDEA 5SWSE 2HLFD 4KI5C 1M7IA 5J3HC 1TZIA 3C5JA 4JKLA 3C09B 3ARXA 4JHWL 3UDWA 2PUQT 4JO2L 5D1ZC 4LEOB 3SGJA 3D0VA 3BD5A 5KVDH 2DYPA 4OBRA 3O3UN 3MLUL 2XIDA 4UBDD 3T77A 4JRYA 1S7QB 2BNQA 3HMWL 3NACL 1RUKL 1XGUB 2V9TA 1I9JL 1YEEL 4AZ8A 2BK8A 3WXVH 1E4WL 1EUUA 3P2TA 1RZKL 3QO1A 1HKLH 4LVEA 2BVEA 5T33H 1DVFC 3ULUD 1U8OA 3LRSA 3LDBB 1OF2B 2YKLL 4E42B 3IKKA 4NRYA 3OJMB 4XCCL 1EHLL 4G8GD 1B2WL 2OLDA 3O4LE 3Q5TA 2ICES 1F3RB 3M17B 4WHYH 4P2RB 2ITCA 3O9WA 5LXGL 1N59A 5FO8A 4M7ZC 4LSSL 5GS1A 4FABL 3BPOB 4CAGA 1SEQH 2HH0H 4OD2B 4NQEA 3F7YA 1FO0A 1JCKA 3MBEA 4XTRC 5FM5M 5CJ5A 1IEBA 2VL4A 5T1KA 2VZUA 3MJ9H 4JFXA 4XXDB 3GGWA 5CJOL 1Z9LA 4U31A 4HC1H 5JLZB 3ARRA 1FZMA 5LJYH 2K9UA 1T20B 1NGQL 2DJ4A 3O6FB 1DTUA 1B6UA 3HR5A 1DUZA 1WSST 4OI8A 3MLYH 4KROB 1NCAL 3QNYB 3KYMA 4XBEL 2XFXA 1LO0L 4Z0XB 4PGBA 2HN7B 4KHXH 3OKMA 3S6CA 3TBVA 2EIBA 4D8PB 1S7UA 4NQDE 3U46A 4BK5A 2NXZB 1FL5A 3MNWA 4AENA 4I9WD 4Y8AA 1WQVT 4BQ8A 3HG1A 1VSCA 4FQCL 2GJJA 1AQDB 2YS4A 1FL3A 5C0BA 1CLOL 3IDIA 1MFNA 3EBAA 2CKBH 3B9AA 4OZFA 4Y5YB 5H2BB 4S0SD 4LQFH 4GRWE 4YNYA 4OCWH 3RVXD 3MROB 1KOAA 2W9EL 4ZFFA 4PLJD 4LP5A 5AWNL 4MJ5B 3U7YH 3D18A 3BYYA 2AERT 4QHLB 4I2XB 3N1GC 4TUOA 4B53A 5C0RL 3QUMB 4JDZA 1NUGA 5KTEL 5EO9B 2UY6A 5DJ0B 5EZIL 3GM8A 4G6AD 4KQ4H 4U1KB 1I1FA 4RFOH 4YPJA 2GJ6E 2CRYA 2G9HB 3B2UC 3RWGA 1P4BH 3OJDA 5JIKA 3O4OC 5E8PB 2ERJB 1CI5A 3BEWB 4ODUA 2OSLA 2VZVA 4BZYA 1GJIA 3EJZC 1LK3L 2PO6C 3BQUB 3HR6A 3BGFB 1AD9B 1J87A 5JHLH 5HTSA 3FOLB 3P4MA 2FX9H 1T2JA 2DD8L 1T5XB 4JREC 4Y4FD 1RY7B 4PGDB 4IMLB 3BP5A 5EO1A 2CMRH 1K4CA 2W9DL 4Q6IC 1CFTA 5I1HH 2VJXA 5JUEH 4B50A 1B4JH 3QFJE 4H20H 3IGAA 3AY4A 4HIIB 2FHCA 2H6PA 3VW3L 4UILL 4OLYL 4NO0A 1QVOB 1U6AL 3PHOB 1IC5H 3OGCA 4P57A 1KCRL 1IM9B 4XP6H 3DROA 1N7MH 3CLEH 1E4XH 1IGJB 1NBVL 1OGAD 3C5ZA 5CZVH 1QPPA 3EKCA 4I48A 2VSCA 2FJFA 5FYJH 1RULL 2WAHA 5ICXA 2A6KA 4WVRA 3S3SA 5I9QB 4Q9RL 4IDJL 4M7LH 4HKZB 4F9PA 3ALWA 4QHUB 3VWKC 5BOZG 4NN7C 2VLLB 3UC0H 1KN2L 1P7HL 1MJJA 4MDIA 3PG2A 3DX8A 2V9QA 4WUUD 3JWDH 5SX5K 7FABL 4QY8A 4Y16B 3ILPA 4YDIL 2KPNA 1BQHG 1F4YH 5JNYB 3BZ4A 1N6VA 3ZDXE 3WS6C 4WO4B 1RMFL 4O2FA 1B0RB 1R5VA 3QPQD 4WTWA 4LBEB 5EOQL 4HHAA 3WFBH 3UROR 32C2B 5L88H 1NBZB 5D1XB 3CFIC 1CDGA 3NBNA 5L2KA 4GW1B 1U91B 3LQAC 2B4CH 3GI9L 3U9PL 1T7YA 1D5BA 2R1WB 2HFGL 2ILLA 3IFPB 4OZGA 1CL7I 3ARDC 3RTQA 3UZVB 2I9TA 3HUJB 4QRPE 2VAAB 1A7NL 2MCPH 2K7QA 3TN0C 3U48A 3E6FA 1FNSL 2C3VA 2Y4SA 1CYGA 1NCDH 4KKCD 1U8KA 1IBGL 4QOKD 4XNUL 4P99A 2QQLL 4TQEL 4NUGL 1Q94A 3F62A 3CUPB 2ZP0T 2VLJB 2AXGA 3B9KA 2BXZA 4PPTA 1T1WA 1EERB 3CH8A 5ITBL 2X40A 4C57C 2BCKB 4MQ7A 1HIML 4IRZH 3AS3A 1DLHB 4RQQA 2FZ3B 4ONOA 1UH4A 3I6KB 4PGZA 3PWVB 3UJJH 5GHWH 1IL1B 5FO9A 4OZHA 2LU4A 1TVDA 1U8QA 5IVZA 4N8PA 5IP4A 5JDSA 1ZHBB 2X4NA 1DEDA 2YUVA 2WUCL 3HNVH 3LQZA 1X5XA 1VKXA 4NO2B 2Z4QA 4X9FA 3AAZA 1IT9H 1IGCH 5KS9E 4M8VA 2BOCB 5FYKE 3IB4A 1R24B 3WUZA 5CIPH 1GIGL 3LMJH 1BWMA 2HFFA 4HWZB 4JE4B 1ZK9A 5J1AB 5EIIA 3QDGE 2Z91A 1LEKB 4M1GL 1XCQB 3BKMH 2YUWA 2CUIA 3U9UB 4X6EB 3ALPA 1AC6A 4ZOAA 3FT3B 2D4FA 5GGVH 1FNAA 3QIWD 3RWDB 1Z0NA 3BUYB 3R8QA 1HI6A 5CCKH 3EO1A 3MLWH 4PJGA 2LE9A 4DN4H 4OUUA 2WQRA 3NFSL 2VN7A 3QUZB 3HRZA 4LSUH 2QV2A 2DICA 4DKDC 2XTJE 4MS8D 3ALXA 2FEDC 1PEZA 1KLGA 2YPVH 5FM5O 3KPPB 5L9DH 4LCWA 2COQA 4OLVH 3WKML 3R4DA 3C60D 4XNMB 3GKWL 2F53E 4XMKL 3GSVA 1YN7B 2A6DA 5GGTL 1I85C 1IC4H 3SPVB 4PJAF 3V5DA 43CAA 5HGGS 3VFVB 4KI5F 2LAGB 5DGRA 5HDBE 1RZGA 1T2XA 1A6VL 1J0HA 2OP4H 3GIZL 3MRKB 1XF3A 5AUMA 2X09A 3QHFL 4FFVC 2Q87A 4UV4H 4F3FB 4XB7A 1YJDC 3V5HA 2I5YH 5CZXC 3U4BH 2R2CA 1X3DA 3BO8A 5HDOA 1WTLA 1M7DA 1MQKH 2J88H 5BZWA 3TBSB 2P5WB 1H0DB 3S8WA 3O6LH 3BRDA 1C5CL 1Q9KB 5HHVH 4TOYH 5D7IF 2AAVA 4NQCA 3VI3F 1JBJA 4XMPL 4EI6A 2M1KA 4LOUD 1YPZA 1H3VA 4JO1H 1CGYA 4YHIA 5DDHA 4PB9H 3CNKA 4XWGH 1GC1H 3G6JF 3HAEH 2HVKA 2DWDA 3FRPA 1P7QA 2IMMA 3HC4H 1SYSB 1HXYA 2WBKA 4MD0A 4WFFD 2EDFA 1G6RL 1VEOA 2R2HB 2PYEB 2ICWJ 1E0OB 3T0EA 4Z7VE 5J3HD 4HFWB 1N3NB 4JB9L 1OTTC 1JZ3A 2E8ZA 4MGXA 4NCC2 5EO0B 3BVNA 4IOIB 2ZUYA 5D1ZD 1CGSL 4PBXA 4M93C 5D7SH 3S4SG 3S37X 5MENE 4KGJA 4WI6A 3JWOH 3R0NA 4YJZL 3V0WH 1GGCH 1AXSB 5HHQA 4Z7WE 1XIWD 1YEJH 4N5EC 4KUCF 4MYWB 1P1ZB 4IS6B 4QXGH 4YDJA 4CKVX 4H1LB 2EDNA 2ITDB 2D0FA 5I1LB 4JFED 1A6ZB 1W2KT 2CIIA 3H9SE 2FCBA 3R1GH 4XXCC 1AR2A 1R3IL 4H26B 5IQ7H 1KC5H 4EXPX 2LQRA 4QWWC 1Z9MA 1DBBH 4KQ3L 2XY1A 3NIDF 4U1GC 4EDXA 3IJHB 4ZOCA 5T3XD 4K2UL 5C0GA 1AD0A 3C2SA 3I50H 5F71A 3EUUA 1T4KA 4YEEA 4RMSA 2AXFB 1IKFL 1D5XB 2WWMC 4CRPA 1WWAX 1HQRA 1T03L 2R29L 4QHNB 4YZFE 4HX1B 3SDCA 3H9ZA 3L7FA 1O0VA 3DV6A 1A2YB 5TF1H 4QCIA 3QXAA 1FN4B 3EDDA 4KI1A 5EOTB 2O61B 2X4RB 5EU6D 1K5NB 5EPMB 4FNLH 4JJ5B 3BH8B 1JHTB 5MEQA 3SDAB 2AJ3B 3RVTC 4KUCD 2WUBH 3HZKA 2GJZB 1INQA 2BVPA 2VLKA 1OGTB 5EC1A 5DRWA 5CFHA 1CR9H 4WI9A 4R8WL 1DQML 2X10A 3HE6B 1U8LB 4BFGA 2UWEB 3MRPA 2OTWB 4MAUL 1G7LB 2ZUXA 5KANG 3TWCH 2Y23A 3GSNL 4G6JL 3LN9A 1A3LH 5LVEA 4M62L 3T0AA 3OKKB 4Y2DC 4C55A 5F7KC 4LEXL 1X9QA 5TPWH 4XBPA 5LGKA 2LU3A 3LEXA 4PYHA 3TO4B 4Z8FH 2JK5B 5LAXB 1HINH 1TETH 4LGPB 3GSQA 2X05A 3DBXB 1UXSA 3P30L 3TPKA 2IQ9H 4W4OC 3OB0H 1KJMB 3EYSH 4E0RA 1ZT1B 2ID5A 4XAKE 5HI5C 1OP5H 4NNPL 2Q8AH 3C6LB 2GW5A 3HC0A 4DGVL 3EJZD 1RUAH 3ESUF 3O45B 4K7FA 1Y0LA 5EOCL 1LP9B 4BQCA 1PKQA 3KPRD 4EI5C 2DLFL 4G80B 2XYCA 1F02I 4XX1E 1NAMH 4KMTH 4C54A 5I0ZA 1WIUA 2DQDL 4MJ6A 3QPXL 2FECL 2MHAB 1G7QB 4PFEA 4RDQG 1BP3B 4QF1B 3WIIL 3PWPB 3ARBA 3ARFC 1CDBA 4XB8A 4P2RE 1IJ9A 5HY9B 1TQBC 3EYVB 1X44A 3QWOA 4YBLC 1ED3B 3TZVB 2GY5A 5K9KA 4Y19E 4TSCH 4UTAH 5ID0B 1KJ2B 2HMID 5C0CD 4EUPH 4P46D 5C09D 5TQ2H 4KRNA 2C1OB 4KK9D 4NKMA 2YD3A 4TUKH 3OHXA 1OY3B 4GQ9L 1F13A 3BPCB 2WNGA 4RX4D 4ALAL 1LDPL 4WCYL 1YJDL 5IQ9B 5IWLA 1LE5B 2D03H 5L7XL 3QH3B 5F7WC 2PKDA 2W0LA 4L9LA 4F57L 1QHPA 4XX1G 4YHMH 2JIXA 1NSNH 4TYUA 3GMRB 2JLLA 1PJ9A 2ED7A 5DHVA 4PJEA 4RGOL 4LDEB 4XHJC 2GITB 1CLYH 3DGGA 4UQ3B 3X13A 1YY8A 3EDJA 4HWNA 2F54D 5D93B 3CFEA 4Z7NF 3BT2L 3N06B 5CINH 5TE7L 2A1WL 1QNZL 5E5MA 5ANMA 3NZHH 1SJHB 3I9GL 3IFLH 3INUH 3MGTA 4KRPC 4PJCB 3MJGX 2EH8L 4LLUB 4D0BB 1MCIA 1P9MA 4HWBH 2IANE 3LIZH 3CPLB 5GGVY 5ICZB 5IEKA 5KOMC 3T3ME 3ARDD 4C4KO 1VPOH 1XGQB 1UCTA 3QDMA 4Z7UE 1HH6A 2YA2A 4RGND 4G8GB 5C2BL 3KPTA 4F8TA 5H37H 3I3BA 4FZEH 1YMHA 1CIUA 2GSIA 3AB0B 3FQWA 4XBGA 1F11B 1HHKA 5HVGB 5I8CB 1BM3H 3JV4A 2H45A 4YE4H 5C0DB 1AKJD 5BO1L 4P49A 4HIJA 3QA3A 4Y1AA 3H9YA 2MPAL 2VXSL 2BMKA 5D6DA 3BDYL 1U8JB 3KLAB 4KZEH 5TGBB 4E41E 2DN7A 3EFDL 1YECL 4HAFA 1AXTL 5LQBH 1RQ5A 3KYKL 1EIBA 1BWWA 4FRWA 3REWA 5F9DC 1FJ1B 1MHEB 2CGRH 2GTZB 1H3TA 5F7DA 2X4PA 4X4MA 1EH9A 2UZIL 5L8KB 1OTSC 4KVNH 3RDTA 3DUSA 4W6YB 1RU9H 3KNBA 2BC4A 5IJKA 2Z31A 5DMKA 2PCPB 4YPGA 3H7BA 2IGFL 3WFCH 1MCWM 1NMAL 2XG5A 4M43L 5GRWA 1AGDA 3OAZH 1G9NH 4L8SB 3LN5B 3QUYC 1EUTA 1EEZA 1ERNA 3RJQB 2BNRA 3O8XC 4O2CA 4UU9A 5CSZB 3HZVA 4UT9H 2BNUA 5DUBB 1U58B 4N0FA 4TUJA 2JB5H 4HS8H 3MV9A 3MUJA 1MELA 1DQQB 5A40E 1GPOL 4MQXD 3RWCB 1A7RL 5T3ZH 3CD4A 5F3HA 4XNZC 4EIZC 3TA3A 3CXHJ 1LE9B 2QHLA 1QRND 2HKHH 4QYOB 4XCEA 1KCKA 4K8RC 4NN5C 4QNPF 3L5WB 3GMQA 2XZAL 1JN6A 4P5TC 1BBJB 4FFZH 2F5BH 1EGJA 2LTQC 4JEGB 3V8OA 1AHWC 4BZ1L 5FIEA 3VFNB 1N26A 2NY1C 4O02H 3DVNB 4L8DB 2ORBL 1OPGH 1OAXH 2ED9A 1JI1A 4X80H 3KWWB 3QXDB 5D5MB 1BZ9B 4P9MH 3S7GA 3I3EA 4M61B 1TTGA 4OZ4A 5C6TL 1IGIH 3IJYA 5AYUL 4XVSH 4O5LH 2V2XB 4U1JA 2YWYA 3CH1B 4LHUD 4JRYD 1MLCA 2BNQD 4DVBB 4LCUA 4Y4FB 3VXUE 1FFQA 4HSQA 1ZSDA 4DEPB 4FFVD 3QQ3B 3DX7A 4N9GB 1HH9B 3MPCA 1LO5B 5CZXD 4ZUTB 1OD7A 3ABZA 5FHAH 1VA9A 1ZT7A 1JF5A 3U0WL 3D1MC 4LNRA 3OXRB 3CDCA 3GBNH 2H32A 1S7SA 2Y6SD 4L4VA 1D5MB 4HKJA 4MCYB 3ZYOA 1RIHH 3DXAE 3FOMB 1WZ1L 3W39B 2IH1A 5GZOC 2AKRB 3O9WD 4JY5H 1MCOH 4JHBA 5TDNB 1ZTXL 1OGAB 5I1IH 4NJAL 1FNFA 4K3EL 1FFRA 1PQZA 4L3CA 4YAQB 4NQED 1ZEAL 1BVLA 1BBDH 3UJTL 3WIHA 3ROOA 4FTVE 5I16B 4POYA 1SEBB 3MREB 3TPUB 4FQIL 5F7EL 4TNVF 4RMQA 5SWSA 1KV3A 5E8EA 1ZANL 1RJCA 2MQ3A 3ILQC 5K59F 4Y2OA 4OIIH 4HS6B 4OGXH 5JHDB 3K2UL 1MWAB 1Q8MA 4FQQA 3GMPA 4WUUB 3MLPA 3F5WB 4JN2A 3V7AE 4HWEH 1CFBA 2VB5A 5HD8C 1FNEB 2AV7A 3D87B 2NXYC 3KS0J 3KPMA 4JO4H 5AZ2L 5B3JE 2CR6A 4JDVB 4TSAH 3LEYL 1RZ7L 4JO3H 2DQHH 2ADIB 4WW2A 2HKFH 3QIUC 4WWKA 4N5ED 3JTTB 4IIQA 1KIQB 2CXGA 4KTEL 1FQ9C 5E00A 1KIPB 1FFOB 2RJMA 3RY5A 4DAGH 1A6PA 1G9MC 2V5RA 4XPGH 5E0QA 1GGIH 4M7KH 4GRMB 1KNOB 4S1DD 3O4LA 2R23A 2ESVE 3SCMC 5IFHL 5CEZE 3IU3B 1N8ZB 2G5BA 1AY1L 4G9DA 4QOKB 4F8QA 2P7TA 4N8CL 2JCCE 4FOMA 7CGTA 5K9OB 3L3JA 1DN2A 3EGSB 4BKLA 5FYKU 1DQDH 1PY9A 3L7EA 4G6ML 3V7AG 1ORQB 1CFVL 2EDYA 4NBZB 1PYWB 3ZTNL 1NL0H 1TNMA 3T1FA 5ADPL 1PLGH 4I0CC 2X4SB 1Y18A 1NC4A 2BVYA 1U3HA 3C8KA 5I8EA 1X7QB 5I75C 2VWEC 3U4EA 3O2DA 2HTLC 4YHZH 1K8DB 2AJXH 3PGDA 4Z95L 1VGKB 4PREA 3BGMB 3DX9A 1Y6NR 3CFKB 5F7FA 2JJSC 4XPHH 5EZLB 5FOJA 5D96B 3B9EA 4YDKH 4HQQH 2GUOB 4FZ8H 5IR1A 3D25B 4AK1A 4N90E 4YHYC 4RWHA 1MCQA 2CLZA 2AI0L 3RIFK 3ARWA 1AGFA 1J8HA 3KDMA 5ACMA 5CGYC 4Z0BL 2DMCA 1KGCE 4NO0D 1KT2B 3DECA 3VGAB 5HHPA 4IMKC 3CK0L 3E2HC 1Q1JL 1JWUB 3PQYE 4ZUVA 4KXZI 3OV6A 5FYLE 3V6OC 2CKNA 3IVKA 1P7KA 4NZRL 4UAOB 1YEDB 1JNHB 3C5ZD 4Q2ZA 1UJ3A 5D2LB 1RZFL 1KTDB 3QIWB 4R90L 2PYEE 4YGVA 3V4PH 4UTBH 5C0EA 4GG6F 1G1YA 1YEGL 4ZUSA 1KEMH 3PHQA 5HBBA 3VCLB 5ENWA 3V0VA 4H0HB 1S7WA 2HJFB 3TIDB 1IAIL 2XZCL 2P8MA 5EBLA 5GRZA 1JZ2A 1FE8L 3G04B 5E94B 4KK5D 1MAML 4S1RH 5IFJB 1A6AB 5JOPD 2ADFL 3MLTA 3C60B 3JTSA 4OV6F 3WL9B 1D9KA 1IAOB 1Q9LB 2X4OB 5KANI 4A2LA 4LLYB 5AD0A 3GJFK 2MCG1 2CDGA 1OSZB 4LF3A 5DQDL 2J4WH 1NFIA 4FQXA 2P42B 4K8RL 1ZLUH 1JWMB 1R3LA 4P23D 3MRGA 3QXVA 1UM5H 1BQHA 1U2HA 1FBIL 5HHNA 3H3PH 3E0GA 1ETZB 3VXSE 2VDOH 3LN4B 2E7LC 1HOCA 2NNAA 4FQJL 4K71B 4IRJC 5B3NA 3BKCL 4OCRL 5E2WH 5HGAB 4PRHE 3CXHK 2DL9A 3FFDA 1VFBA 4UV7L 4ORGB 3BN3B 4HW6A 1QFUH 5E8NB 1VFOA 5GGSB 1JHKH 1JGVH 5EBMB 5TE4L 1CICA 5A16B 5DRNA 1BIIB 3VG0L 1Q72H 3O81A 1HYSC 1FAIH 3CSYB 3NFPB 4ACPA 1HXMA 4LLWB 2APWA 4N5UA 4P59L 1OM3L 2BFVH 3WFEH 3VRIB 3ARTA 4CMMB 1TJIH 3DVFA 2OTUB 5IB4A 5DUMH 2FX8H 4PJAB 1UM6H 2GK0B 3SQBA 5D7LD 1NCWH 3L6FB 2EEDA 1HHJB 1QLEH 4NRXB 5I1KH 1IGTA