5LBSH

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCSASGFTFSTYSMHWVRQAPGKGLEYVSAITGEGDSAFYADSVKGRFTISRDNSKNTLYFEMNSLRPEDTAVYYCVGGYSNFYYYYTMDVWGQGTTVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Immune system-viral protein
total genus 25
structure length 121
sequence length 121
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lbsH00
1DBJH 2VLRE 1YYMH 1DANU 2JE8A 5DVLA 3TP4A 3ARFC 4KMTL 5DRXA 3MA9H 1CDGA 4J6RH 1NMBL 3PWPD 4OGZA 3LQZA 3WN5C 4Y2DC 3RKPA 4OF3A 1UZ8A 2FCBA 2AJYL 1AGFA 4PJ5E 3QUMB 3QYCA 3NCYP 3QXTA 4FP8L 1UEYA 5IJKA 4JAMB 4K2UL 1MFBL 4E5XA 1HI6A 3HFMH 2D7PA 5E8OB 4JRXE 4U1NA 1J87A 1TJIL 4P4KA 4YHYC 3IS0X 4OD3L 1EHAA 2YPLD 1INDH 2G60L 4ZFZA 1KLUB 2VWEE 2VKWA 1FH5L 2FD6H 4KUCD 4KY1L 4IRJD 3WDHA 3QUZB 1S9WA 3CXDH 3NGBC 4TUOB 3CMGA 3ILQD 4Y19A 3S36L 4F7CB 2NYYC 3T65A 1QHOA 4X5XB 4DKEL 1DLHB 1G6RB 4NP4H 1HYRC 1IAOA 4O2EB 5E2VL 4OV5B 3LAFA 1CD8A 3WXWL 4YX2H 1MCBA 4HUXA 5DJ0A 3HR6A 4G42A 4OB5H 3RPIA 1ORQA 2FGZA 4XCEA 4RFEA 2YD4A 5F7FA 5FYLE 1U3JA 4NKQB 4PJFA 1ZHKA 3LKSB 5I17B 1FL6B 5DJCA 5FUOL 5I76A 2IPUK 5BO1H 2DQIL 4X9GA 4NHCL 2O5XH 4J2XA 2R69L 4BFGA 4OI8A 3S35X 1JVKA 1FL3B 4QHNB 3CFKB 4DQOH 3FOLA 5SWQA 5GRZA 2IG2L 4QCIB 1LP9F 1JNLH 5DTFB 3P9WB 4JFEE 3O4OB 1AGBB 3L9RA 4F8TA 1A1OB 4L1HA 4GLRI 1IILE 3F6IA 2FZ3A 3UCRA 1YECL 5SWSD 1EHLL 2EIZB 1JPTL 4HWEL 4QWWD 1XIWB 5HVHB 2BVPB 3KHOA 1AFVH 4HXAH 2V9QA 3WIFB 3GSQA 1GYAA 4X6FA 5F96L 3VXME 1KG0B 1A5FH 3EFFA 1L7TH 1QZ1A 3UYPA 4QNPE 5I18H 2MOVA 2F53A 2PR4H 4HMDA 4JG1L 3G04B 3AMLA 1NBQA 1R3KB 1RIUH 3RWIB 3IETB 4M62H 3VFWA 4ODTH 4Y5YB 5I8CB 3MRRA 1PGRB 3FN9A 4KQ4L 1ZLWK 3F58L 1J7VR 4QRTA 2I27N 2LVEA 2NTFA 3RWEB 4OZGA 4PJBA 2ZUYA 3MOBH 3RWHA 4NN6B 3NCEB 1RFDL 1HOCA 3V6FB 3VU2A 4IRZH 4BSVB 3U0PA 1IGMH 5AAWA 1HHGA 3RU8H 1PBYA 4QF1A 4POYA 3N50A 2P7TA 5KVEL 3NTCH 4MNQB 1KYOJ 4UTAL 4TNWK 3QQ4B 4OAWA 3TYFA 5T3XE 4FQ1H 4ZUUA 4X98A 3SDAB 4Q6IA 5CJ5A 1MCDA 3HE7A 1KCUH 4HUUB 4QY8B 4P5KA 2Z0BA 1MH5A 3RVTD 4OCMC 3ZTJH 4B50A 3AREC 4D8PB 1BMGA 5DHVB 3RHWK 1NUFA 1QLFA 2AGJL 1MCQA 4JB9L 2OSLB 1R3LB 1WZ1H 3IXTA 2W65A 3OBAA 2MQ3A 3RWFB 1BIIB 4XNZC 3EFDL 4XZUA 5IWLC 1KB9K 3PDOA 5FHAH 4M1DL 1U8JB 3GHBH 5GZND 4M1CC 1YPZB 5IHBA 4Y2OA 1HWHB 3CIQA 1GGIH 1HSBA 1T2QL 3OXSB 3HI5L 4P46A 2DMBA 3DXAD 2CIKB 3X3GL 4OLUH 5IBLD 2ICEB 5KSVB 5B3JF 5C0BA 3G5XA 3EJYC 5IGXH 4Y0GA 1T2XA 5IB3A 3B2VL 1I7UA 3I6LE 2YA2A 2X4TA 5ANMA 5EPMB 5LGJB 4FRWA 5CD3A 5ERWB 3GMLA 1UJ3A 1MHEA 1F97A 1QACA 2D03L 3ARFD 3BPLB 2IBZX 1MHHB 3WLWD 5F7EH 1T04A 3UTTA 4JFQB 1WIOA 4LPXA 4MHHG 5IUSA 3DO7B 5ITFB 3HZKA 2R4SH 2FBJL 2GSIA 1IBGH 4Y2DD 3ARGC 4J4PA 2FLRT 3R8QA 1J10A 3VD4A 2CDGB 3O3BB 1FO0H 1CVSC 3KLAA 4V1DA 1V7ML 3H0TB 3QUXC 4ONFH 4PJGF 4HK0B 1ONQA 5HGHA 2VIRB 4WO4A 5I30L 3GUTB 4KZEL 3GMOA 5D93B 2A73A 1OGTA 4MAYD 1ZLVK 4Y5VB 3KPLA 2NTSP 3G5ZB 1QLEH 4AMKH 5MERB 4M00A 5HHNB 4RZCA 3JV0A 4NKOA 3T0EC 3VFVB 1FP5A 3BPCA 2EDNA 4PLOB 1N4XL 5DJAB 5IK3A 4FFWC 5IBUB 5C0DB 1G7MB 2YEZA 2NYYD 4YBQC 3EGSB 5D1XA 3UO1L 4EZMA 4NQEA 4ZUWB 3O3EB 4CVZB 4NCC1 4PTUA 3U82B 4KTDH 2PYFA 3SJVE 1G6VK 3ARTA 1SJHB 1MHPH 3Q5YA 1R6VA 4OJFH 3U7YH 4QRUA 4ZNEA 1NKRA 1UQSA 4FTVA 4YDJA 3D87B 4UDUA 5EZJB 4YBLB 4G6AC 3EYSL 3N1PC 3QG6A 4MJIB 2ZSWA 5DK3A 4YFDB 4IS6B 5ACLA 4CVUA 2R2HB 1KUMA 3CVHL 1FNSL 4XT1C 3RAJL 4KK8D 3LN5A 4OCXL 3RWCB 2XN9A 2C3VA 3BP6A 3V5HA 2ZNXA 2FX7H 2OXGA 2H9GA 3CFJA 3H7BB 3B9EA 4XCNB 1S9XA 3EDKA 3TYGH 3KXFD 4I77L 1MFEL 4NPYB 2C7UB 4D0BA 3DVGB 3KS0J 2ZG1A 4PRNA 1A7QL 2XTJB 4KZDH 5CINH 3QPQC 3CFDA 2ZCKL 1AGEA 1RZIB 4IMKA 4ZFFB 1U8PB 1I1RA 1MJ8L 3ULVE 4OZ4A 2CKBH 1JYWA 1YQVH 1HHKB 1CZ8H 5MEPB 4Q9RL 1MI5D 1U0QA 3MRGA 1SVCP 4WVRA 4LNVA 3TH3T 3BJ91 1T0PB 5CSBA 4P2OC 3U48A 1CGXA 4GQ9H 4HHAA 2A77H 1TITA 5EN2A 1N2RA 3VXRB 4KAQH 3QFJD 3LN9A 4TTGA 4GBXB 4PGEB 1HINL 2PTUA 5JUEL 1JV5A 2KKQA 4LQFH 5BZDB 5FUCC 2H6PA 3SE3A 5I1HL 3CPLB 4G6KL 1IGFH 4AJ0A 1E4KC 4PV9A 3RA7H 4LCWD 3L5WB 1YEIL 3KG5A 1D5MA 1LO3L 4LVHC 4UAOC 3MLWL 4R97C 2QBWA 3V9FA 2FATL 4WFHD 5I1LB 3P77B 1K2DA 2B5IC 3ARED 3BP5B 3A6BH 5BJTA 2F74A 5K59E 4KRLB 1N7MH 3VG0L 1I1AD 1RUPH 4XCCH 1J5OH 1H8OA 1NDMA 3O8XD 4ONHB 2APXA 4N9OB 7FABL 2Y25A 2JCCB 1OQXA 5HY9A 2WBJC 1B6UA 4X0KA 5JOEA 2WBWB 3VXUA 4M1CD 5MI0B 2ZJSL 4OFYD 1N5AA 5D2NC 4JPIB 3ZKQD 4DVRH 5LQBH 4DWHA 1BOGA 4YXHH 1HQ4B 2BNRA 5BQ7B 5DR5H 2DDQH 3OJVC 2GK0A 1A4JB 1EEQA 2YPKA 3EJYD 1BVLB 4XB7A 4YUEL 2DS4A 3AB0B 1QFWI 2VLJB 5EOQH 1A1NA 5I1IH 4GKSB 3TO2B 1I1YA 4Z0XA 3QXAB 3WLBB 3MGTB 5J6GA 1DUZB 2GJJA 3ESVF 4RGMC 1U42A 3QIBA 2GIYA 1H0DA 5F1SA 3EDFA 3PWPA 5CJOL 4DGYH 2VDOL 4XP9L 1RUML 2WQRA 3KYKH 2H8PA 4KK9D 5I1CL 4NRXB 1URLA 1I9IH 2BVEA 3ARGD 4M5YL 5T1DL 2HFEB 4XBGB 2EYTB 3BN3B 3GMQB 4D9LL 1B0RA 1QSZA 2BY1A 3QIWB 4JHBA 2IH3B 1ZT1A 4ZNCD 2YPLA 4GG6F 4Z7OE 3IDNB 4P23B 4LPTA 1JWMB 5HI5C 4PP1C 1EVUA 5H94B 2EXWC 3LRHA 3V5KB 4ZD3L 1RUQL 3ZL4L 3VCLB 4U1MB 5CHNA 1ROWA 5C1MB 4FFWD 1G7QA 3L3GB 1MRFL 2PW1B 3QEUA 3QISA 5GSVA 4YBQD 1D3CA 3CDCA 1UACH 4DZBA 1W72B 3AAZA 2G9HB 3DX6B 3DX8A 3NCFB 5CP3H 2XXCB 5C0CB 5IW1A 1G7PA 3RTQB 3PL6A 3DV6B 1IE5A 3V0WL 1E6OL 2AK4D 1QBBA 4OLZH 3G6JE 3OZ9H 4TSAL 2ITCA 3VFNB 1HILB 1UZ6F 4AEHL 3H3KA 1J0HA 2NY7L 5E5UB 5TF1L 3UTSE 5HHQB 1QG3A 5GRJH 4PREB 3VG9B 4F7EA 4XNQB 4PRHE 4PD4J 2G2RB 2MCPL 5LXGL 3KPRB 1E6JL 1NBVL 3UYRL 5CZXD 5E70A 5E4IA 4TVPD 3IDGB 4XWGL 2ADFH 3DETC 1FFPA 1A7OH 3MRDA 2F8OA 5SWSA 5I2IA 4RQQB 3ZO0A 1VDGA 3SKOA 2ZUVA 2H32H 3FB7B 2EDTA 2AEPH 4CU6A 5ALBL 4NBYB 4LEXH 4XPFL 5C0JA 5BMFH 2HLFC 4LSTH 4YIQA 1ACYH 5CKGA 3O11A 4R3SB 3F7PC 3IVKB 4QOKE 1MCOL 2HVKB 3ARDC 3P0VL 4XX1G 5ABDE 35C8L 2ADGB 2FJFB 1A2YB 2BJMH 4R4FH 4RFOH 3BP7B 4BJLA 3VXQB 1NGXA 5CCKH 3CDGA 1RVFL 1XF1A 4QGTA 1V3MA 5LWYH 5FM5O 1FFNB 3E6FB 5EIQA 4LLVB 2WSKA 1U95A 5K93A 3NN8A 1PEZA 1ZTXH 3NIFF 4RFNC 1XF2A 2HVJA 3B4NA 1MQ8A 2E7LC 5IVOA 1NANI 4P57A 4GRWH 5E9DB 1MCNA 3NFNB 2YSSB 3CDFA 4UIKL 3HMWH 4YHIB 5FB8B 5JA8B 1Z9MA 5JHDB 4M03A 3VI3F 2DWDA 2NY3C 1T7VA 4CGTA 1SBSL 1LNUA 4QT5A 3U79A 5CUSL 1D5XB 3SDXA 5FM5M 2VITB 3BI9X 1G84A 4X4YB 3U36B 1Q9OB 5JIPA 4HIEA 1CXKA 3ES6A 5J06A 1KCVH 3LZFL 1BVKB 2CLZB 3QAZB 3R06B 5D5MA 3R1GH 4RGNE 5J3HC 1GGYA 3LQAL 5DK0B 5DJXA 4L8BB 4E41D 3T1FA 1FSKC 4MQ7A 3I50H 1IGTA 2DQCL 3BW9B 3JUYA 1J86A 5C8JB 2DL2A 5KOVC 4WGWB 1TPXC 4S1DD 1AXTH 4OZHB 1TQCB 3W39A 4H1LH 4MDJB 1KOAA 3IF1A 4ELKA 2ZOLB 3VFTA 5HSFA 2NX5E 1GC1L 4NO0B 4IDJL 1A0QH 4ENEC 2IADA 4J7RA 4OKVB 1ACZA 5DHYA 3W11D 1LEKA 5GGSY 2X4NB 1OTTC 3IU4L 3BZDA 5FYJD 1WZKA 4G9DB 4K7FA 1FVDB 4H8WC 4UBDC 2VQ1A 1F90L 5AYUL 3OKDA 1MFDL 3HRZA 3TPKA 5AWNL 5AUMB 4J1UB 1HCVA 3PWLA 1AHWA 2BOCB 1IQDA 1T2JA 3L7EB 4LLYB 4ZUVA 4WI5A 1T21A 4JVPA 4XC1L 4HZLA 4RNRA 4WHCA 3WN5A 1JZ6A 3U7WH 5K9QG 3D39D 3KPQB 12E8H 4Z7UE 2GJ6D 4GW4B 2LQRA 4PRAB 1T03L 4RMRA 1CI5A 4OGAD 3ECBB 4DKDC 5FKPB 1G7IB 4WUUB 3MNWA 4XPHL 1B0GA 3PGFH 4K8RL 4MAYA 4PRDA 4GXUN 4XTRC 4GS7B 2BERA 4S2SB 3OR6A 1U8IB 2Z35B 1P69B 4WENB 3MR9A 5HI5D 5EZOL 1P7QD 2X4PA 1C5BL 3IDXL 4PP1D 3H9HA 3UPRA 3BIKB 2EXWD 4F58L 4Y5XB 2NNAA 2R0WL 3DGGA 4WY7L 2BSRB 5C7XL 5J6HB 4G8IB 5DUPL 4PJIF 4ZOAA 1F3DH 1MEXH 5I8KL 1RUKH 5F7WC 2DBJA 4XCFL 3FQWA 5C0AD 1P7KA 1DQJA 1MREL 3LQZB 3MREA 4F9LC 1UZ8B 5IMKB 5FOJA 1NGZB 3NCJL 3L3JA 1CDBA 1DE4B 4HT1H 3SDDC 5FYKD 1HXYB 3D69B 1QOKA 2OJZH 1VADA 3ALPA 5I1DA 5L6YL 3MPCA 1XGYL 2QQNL 3N85L 3JWOC 3FFCE 4P4KB 4PRIB 1LO2L 1JN6A 5JW4N 3X11A 4U0RB 5A3IC 1XR9B 4F3FA 3EYOA 2FECL 3Q2CA 1NC2B 1NDGA 2D7TL 5HHMD 4EI5A 1UM4L 1S9WB 3DHMA 5EO1B 1AGDA 3P0GB 1MHCA 5E94B 4M9PA 5JOFB 2A74A 3RY6C 3DETD 2E7BA 3V7AG 1ETZA 4PJEA 4KHTH 1F00I 5F71A 3T8XA 1M7DA 4KROC 3PWUA 2MQ0A 4GMTH 1OARL 1DQQB 3BWAB 4XCYB 5C07D 3EJJX 5F93C 2CUMA 4ZPVA 4R96B 4F2MA 1CD1A 1UWEH 3KXFA 5C08E 4LARL 3ARDD 1ES0A 4GLRH 3KPNA 1F11B 2XKSA 4RMSA 4PG2A 1T5WA 3QWOB 1H15B 1BPVA 4I0PA 5J12C 5DFWH 5CZKA 3V0AC 1OTSD 3KGRA 1YEEL 4JDZB 2R2CA 5EO9A 5ADPH 2OJEA 3EOTL 3J8F7 1D6VL 4K94H 3QFJA 5GSRB 4NQDB 1OSZB 4TOYL 1JNNH 1KIRA 2X1QA 4QRQA 3WFEL 3C08H 2XNAB 5SWZE 5IB4B 1FIEA 4LP5A 3ZKXB 2NY3D 5KAQG 1F8TH 1QLRA 4L8CA 3EFFB 4LCWA 4P2QA 2G75A 1P4LA 5C0RL 2F53B 1UKQA 2CXKA 3P4OA 5DMYA 1ZSDA 1LO0L 2FHBA 1JHLL 3SKNB 3D6GA 2BFVL 1LP9B 1HHJA 2ICWA 4PTTA 2ITDA 1M4KA 4MA7H 4UT7H 3ROOA 3UYOD 5ICZA 4KGJA 5FYJL 5GGVY 4YZFF 1I1AA 5J3HD 1KCKA 1U93A 1FVCA 3VRLE 4IMLA 4KPHH 3O8XA 2XXMB 4CMMA 4LKXB 1BHGA 3CFEB 1T7ZA 1YMMD 4XVJH 5JNYA 2X4UA 1J1XH 3ZDYF 5ITBL 4WEUD 3RUGE 3ROLB 3LN4A 3NAAL 4OFYA 2NZ9C 4ODHH 1XCQA 1N59B 3B5GA 1SQ2N 1B6DA 3GKWH 5BZWA 4OCYL 3UJIL 4RWYL 1TMCB 2IC2A 2VDLH 1OW0C 4PGJA 1ZLWH 3UXFA 5A2FA 4TSCL 3V4PH 4UBDD 4X4ME 3ZHDA 4P5KB 4G8GD 1T1XA 4NT6B 3HR5B 1IEBA 5KANG 3SGDI 2AEWA 5IFJA 5DMIL 5KSBF 3C9NB 4Y89A 4HJGB 2CPCA 4TNVK 3GSWB 2WP3T 3DVIA 3TN0A 3IXTB 3H6JA 4OSUL 1DZBA 2FSEB 3QHZH 1ZLSH 4FQLH 1U8MB 5ID0B 2VDML 2N4IA 3X3FL 4LIQL 2AJSH 3ARGA 1HKFA 1W8NA 3P3YA 5F97E 3M17A 3B83A 1QFUL 1FV1B 3EHBC 1AQKH 1GAFH 4TQEL 3E2HB 4W4OA 4NHUB 4WWKB 1CXHA 5JW3L 4LSQL 5E8NA 4U6HA 1LWRA 1KBGL 2X1WL 1T0NA 3ZSTA 3TBTB 2X2YA 4WUKL 5CMAB 1M7XA 5FYKL 4FQXC 3ET9F 2SEBA 4EQ3A 5ESAA 4U6YB 4XH2A 4OT1H 1TJGL 1ZVHA 4L3CB 3KYNA 4HZAA 5HVFB 5FYLH 1OAKH 2AEQL 5HHVL 2DI7A 2Q8AL 2E27L 1J0KA 1KGCE 3QPXH 3U9UA 1HH6A 3GJEA 1I9RL 3MCG1 2ESVE 2CLRB 4GSDL 4UQ3A 3SDDD 4MAUH 2AXFA 4LSUL 4O51B 3HPLA 2VDNL 2B4CH 4DKFL 3DPBA 1ONQB 1VGEH 5HGHB 1NGPL 3OX8B 2F54A 4YO0A 3BD5A 1MJ7L 2CGRL 3KPLB 5DD3L 2EDBA 3O3DA 3VXSD 3W9DA 1C7TA 5DRNA 4HUWA 5IVZA 2YRLA 3MACL 2P5ED 4Z7VE 5IK3B 4Z7QF 1MCJA 3RVVD 5T33H 3MRCB 3QDGE 1REIA 1MFAH 3HAEG 5ISZD 3VXTA 4HKJB 2G5BB 1ZGLA 4XHQA 1BZ9B 1F58H 3V5DB 1YEKH 2QSQA 4JZJB 4PJGB 1JHKL 3C5ZB 2PUQT 3IDJB 3QEHB 3DX9B 3K2UH 4PJHA 5GS1C 4AG4L 3U6RA 1PVHA 3MLZH 1ZLVH 2BDNL 4BH7B 2GITB 3RVUC 5DQDH 3BPNB 5AZEH 3U1SL 4XP1H 1EFXB 4GG8A 3OKOA 4S1SL 1MLBA 3OJMB 3TNNB 3VGEA 5JIKA 3CXHJ 1LQSR 3O2WL 4PG9A 3MROB 3VFRB 1JFQL 3BAEH 4HIJB 2ZSWB 3IDIB 4LNRB 3VH8G 1BQHA 1FNEB 3HC3L 4K94C 5KAQF 4ODSL 5J11C 1T20B 1K8DA 4OZIF 4X5WB 5DO2C 1CCZA 1RUAH 2DLFL 2DQUH 1E4WL 4M43H 4YHOH 2YPVH 4S1RH 3ZTNL 4RAVB 4JKMA 1AIFA 4QRPB 2C3VB 2DQHH 1WF5A 3V5HB 3UAJC 5F8RC 2FWOB 4HLZG 3VI4F 4PR5B 1HWGB 4Y19E 3CFJB 2W0KA 4HULB 6FABH 1A1MB 1EXUA 2AJXH 4GUPA 1VCAA 3FQTB 3WNKA 1P7HL 3VDCA 4M1GL 1IFHH 4K9EC 4Q74A 4YXLL 1QR1A 5DMGD 2A6JA 4JANA 4LSPL 1QYGL 1HHIB 4PJFE 4OZ4B 3QUYD 3TWCH 1A3LH 4JREB 5EBWB 4E41A 2ZKHH 3N06B 3D3VD 4H8WL 4AIOA 2HYMA 4KDVA 4DW2L 4X7TA 1NFDA 2AJVL 2VLKD 5HGBB 1FDLL 5EN2B 4AQ1B 5IT2H 1J8KA 2GTWB 1FBIL 1BD2E 1WWBX 5D1ZC 3PQYE 1KB5B 4F15B 1FAIH 3CFBB 1WZMA 3MV7A 4LDLB 5HXMA 1OAQH 4YHKL 1K9TA 1NGWA 1YEFL 2IAMB 4N0YL 2KZWA 5ENWB 1DVFB 5FOBA 3D2UB 5DEFA 1H3PL 3FO1B 2DJ4A 5BV7C 3OKEA 3TT3L 1VSCA 3VA6A 3DRQA 2DBLL 4TULL 4X7FC 1TJHH 1P2CA 2A6DA 3LEXB 1UB5A 1M71B 5D7SL 3FO2B 2VMFA 1NDMB 3SDYL 4MA1C 5I73B 3B9KA 2GUOA 2Y5EA 3QQ3A 4KMQA 2VWEC 4KKLC 5FGRA 4CAGA 3FT3A 1HXMA 1QFWH 3D39A 3MRLB 3FQNB 4IIQA 4X0KB 4JGMA 5BVPL 3VXUB 4ORZC 4K3DL 4JPVL 4PJ9C 2GJ6A 4ZO8A 1A7NH 4OM1H 2B1AL 1KN4H 4KUZH 2AKRB 5DS8B 4N0FB 3S34H 1DSFL 3DUUB 2HKFH 4R4BA 1IGYA 4OLYL 2F8XC 1RJCA 1I9JH 2QL1A 4FQXD 2VDRH 4CADB 4QRRA 4WFGD 4YPJA 1BQSA 3JWOL 3T0WA 5B4MD 3B9DA 1Z3GH 1BBJA 3QZWB 5AD0A 5SV4A 4MA3A 1XEDA 5F9DC 3V79C 3G6AA 3MFFA 4OD1H 1LK3H 1RSFA 3QDMD 4C54A 5C0AA 3GBML 4L8SC 2NY6C 3LD8C 5CIPA 3FTGB 4ERSH 2EH8L 2NY2B 3SKJH 5IMMA 2AP2A 4XB8A 2WMPA 1CBVL 1DQMH 3ALWA 3P2TA 1P4IH 5D7IE 1NCAH 2HKHH 3HNSL 4OF5A 5JMRA 3ZT7A 5GQBA 4NIKB 3U9PL 2YPLB 4XPGL 3VFMA 1KC5H 3AUVA 2ZCLL 2C3WA 4N90E 3DTXB 5KG9B 4HBCH 2R56L 3C6LC 2N7BA 3O9WD 4IRJB 1EMTH 4X6EB 1HSAA 5DD0L 4HH8A 1SMOA 1FFOA 1I3GL 5HGAB 4X6DF 4YHLL 3C60D 2F5AH 2BVOB 4JM2A 5C0BE 1LD9B 3K4ZA 4HPOH 2BNUB 4ZO9A 4OLXH 3EZJB 4ZS7L 5ANME 5C07A 4XBEL 4YLQT 4LSSL 1D6EB 3HC4H 3HAEA 4GG6B 2IGFL 3ULVH 2E3VA 3M45A 4QHLB 2VZUA 4O02L 3RVUD 3UTTE 2FLBT 5H37H 5I0ZA 2F19H 2IFFL 1ZOXA 3WFHA 8FABA 1A14L 1JWUA 3OR7A 1UADC 4WTZG 4HFUL 1KFAL 1PG7L 4HEME 4N9GA 2B2XL 4MA8L 5EU6B 4XMKL 5IB2B 1RY7B 1CFNB 2EDEA 5F1IB 5FECB 4FZEL 2WUBL 2VLMD 4Q97A 2E7LA 3FB5B 3BISA 5B8CB 1AKJD 1AQDA 3VH8A 3S3JA 5E0QA 5L7XL 3SDCB 3MLXH 1C08B 4HQQH 2A6IA 5CILL 3GZKA 1U8QB 1YEHH 3DV4B 4OQTH 3CFCH 1M7IA 3MJ6A 4L4VE 4YIQB 2H2SC 1KJVA 4XPTL 1Z9OA 2M26A 1AP2A 3OB8A 3LEVH 5EZIL 3MGOB 2GT9B 2P8MA 4MS8D 2IWGA 3OQ3B 4NQEE 2AV7A 3PIQB 4ZO7A 1NANH 5F7KC 4H1LG 2EE6A 5D6CA 2J1KA 5A2KH 2OK0L 2V17L 5INCB 2X9XA 3F12B 4UDTB 1KACB 3UBXB 3BPOC 1P84K 3KHQA 4P2RD 2QKIB 3CSPA 1YMMA 3VFSB 2XA3A 3KDMB 5I9QC 4N0UA 4FTVE 3C5JA 3INUH 3RI5K 1RIVL 3P9MB 2XWBB 3MRIA 5D1ZD 1A6VH 1S7UB 4JFHD 4PB9H 3TM6A 1NMCC 4R2GC 5DC0A 2DWDB 2YD9A 1KJMB 2EO1A 4QT5B 4MZ2A 5E8EA 2D0HA 2HP4A 1DN0A 1Q9WB 3H9SB 5DDHA 1JUFA 2V2WB 4EOWL 4NWTL 5HHXH 4HWNA 1FE8L 1Y0LA 2XN9E 2CLVB 2P24A 5MHSD 4NCC2 4G8GA 1NCWH 4G9FB 4UB0L 4E0RB 3QEGH 1QSFE 2XQYK 4MNGA 5EZLA 3ZHLA 4G6FD 4KVCL 1K8IB 2V2TA 3N9GL 3TV3H 1BECA 1CLCA 3LIZL 4HGWB 5DJXB 2OX5A 4TSBL 4JRXD 1I1CA 4AEIH 4P4RA 2J8HA 1JWSA 4OCWH 1TVBA 3U83A 3WNNA 1FGNH 1UGNA 4KKLD 5GGTL 4QO1A 3B3IB 4GKZA 4ELKB 1VFBA 3VFTB 1YNKH 5GZOC 5LKNA 1JL8A 3SEPA 4PJ9D 4UV4L 4YDLC 4IRSD 5JXAH 4KJQC 2IADB 4FFVC 3DXAB 4HKXA 5JXEC 5F9WC 2P47B 4QHMA 1WVZA 1OWRM 3SBWC 1SEQL 2J8UF 4FNLH 4OF7A 1JF1A 3OKMA 1JPSL 1T1WB 2D0FA 5E2TH 2ID5A 4UIMA 3REWA 4PUBH 4WV1B 4Y4FC 3HRZB 5T5FH 2XKNA 2HJFB 2VNCA 3PWLB 4YEEA 4OUOA 3M8OL 3JUZA 2EKJA 1I1FB 4JFYA 5J1AA 1T1ZB 3ARFB 1ZE3C 2EZ0C 2XFXA 2Q6WB 5F1OB 5B38B 1KV3A 4OIIL 1PSKL 5E6IA 2NLJA 4KKBC 2I26N 5SX5K 4KXZI 3STBA 2AXGA 4F9LA 4Y2DB 2E6JA 2NY6D 3S5LA 5B39G 1YN7A 1ZVYA 2PYED 5FKAB 4F37F 5FIEA 3QO1B 2R0KH 1A9EB 2EKSB 2OTUB 1JGUL 1SJEA 3O6ML 3QBTB 5EFIB 3MNWB 3DWTA 3EW3B 2V5SA 1DLFL 4KRMB 2AS5M 4YHYB 3L6FA 4RMQA 2X4PB 4HF5L 3C6LD 3VXMD 3QA3B 4M5ZL 1HN1A 2P5EA 2HJKB 4H25A 3NGBB 2KUTA 1KJ2B 2OR9H 1FNHA 4U1GC 1KELL 2BNRE 4Y16C 2JJVA 5ISZA 1A6AA 1SM3L 1B4RA 1J11A 1KNOB 3EO9L 4P2CG 4FXKB 2ATKA 1QTYT 1WJ3A 1P7KB 1RZFH 3OKKA 3ULVC 1WT5A 4GRWF 1DR9A 1OP9A 4CNIB 2XI9A 2P45B 1F2QA 1MAMH 3NZHL 1CT8B 4FQQB 1EFQA 1QSEA 3PWPE 1MIEH 4PY8J 4RISL 4PJDF 3WO4C 4HWBH 1RHHB 4P3CH 3ZDXE 2AJ3A 1CD0A 4UILL 4PJIB 3RY5A 2I60L 1ZANH 2DM7A 4LF3A 3JTSB 1RJZA 5D7KD 5T3XD 1EJOL 3P4NA 1RJLB 4K9EL 4ZXBD 2ENYA 4JHWH 3HUJA 4WTZA 2YWZA 5C0GA 4JJ5A 3BDYH 1N5YL 1M7DB 4NNPL 1N64L 3PWUB 4DKAA 3T3MF 3WL9B 4XWOC 2WM0A 4JG0L 3BESR 2H2SD 4YFLI 2VXQH 2DYPB 3RIFF 3OAUL 1OAZL 4JZOB 2X9WA 3KPNB 4G3YH 4ZFGL 4NQSA 4YHNA 1ADQL 3MZTA 4RGOH 1LILA 1QBML 2EXYD 4GMSH 4I3SL 4LLMB 1DEDA 1L7IL 2DLIA 1WFNA 3QUYA 2JELL 3ULUE 3V6ZB 1RHFA 3UZQA 1ZS8A 3D3VA 1MI5B 1F02I 4LOUC 4ZFOL 2V2XB 2FEDC 4OCRH 1QRKA 2WK2A 3C09C 4PD4K 4LSRH 1H3UA 3I6LD 2R4RH 3H8NA 5GHWH 1RQ5A 1XGUB 1TDQA 5IW6A 5BVJA 2IQ9L 3FCTB 3GSXA 3G9AB 4R2GD 1MNUH 4NKMB 2CIIB 1NEZB 2VC2H 2EC8A 4NZTL 3RQ3A 4L8CB 3P4MA 1TZGH 2BVTA 3HMXH 4LCWB 3IFLL 5SWSE 1OW0A 4L3EB 4HAGA 1UXSB 4HXBL 3B43A 2DQTL 1ZSDB 5DJZB 4LRNL 3G5YB 2Y36L 3AREB 4O2CB 4R7DB 2ITDB 4D0DB 1HK6A 3V52H 3UPCA 4O9HH 2C3HA 2X09A 3D25B 1S7VA 4OBSA 5E5MA 4XNZB 1NLDL 3BKML 1Q9KB 4MXWH 3VA2C 2W1NA 5C71A 1OM3H 5IHUH 2X4UB 1T22B 5C09B 1Q8MA 1J0ZA 1XMWA 1MPAH 2YRZA 3CLFH 1DBKL 3U46A 2ZOKA 2IALB 1UA6L 1BLNB 3SGDH 4X5LA 1YDPA 4PS4H 4KMLB 2L0DA 4Y1AB 4W81A 2VXSL 4YK4C 2BCKA 4KJQD 3BDBA 4TUKL 4FFVD 4HUKB 1U92A 2Q8BH 4AENB 3PXHA 3RWGB 1GOFA 2AV1B 4NC1E 2BSTB 3EO0B 3V6BR 3MX0A 5L0QB 3W5MA 3Q3GA 3WUWB 3MLVH 2OTWA 4FQXA 4DEPC 3AROA 1OPGH 2CJUH 3ILPB 3V4UH 4EVNB 1KIQB 3SJVD 5TDPB 1ZWIB 3FN3A 4LL9A 1XH3A 5GGTA 1K5NB 5FK9A 4HGMA 1A4KB 3HE6C 2QQLH 1YN6A 3SDXE 2YUZA 1A7PH 4JRYB 5DJ8B 2EZ0D 2NY5H 1BF8A 1NGQH 2V5YA 4MLIA 3ZE0F 3QNYA 4G6JH 4G7YH 3QDMA 2P1YA 3GSOB 4JRWA 1MAJA 4M7KH 2W60B 5GRVL 1CDIA 4KKBD 4FABL 2A83B 3E3QE 4JQVC 5D5ME 1H5BB 4NYLB 3WJLA 3BN9D 4FXLA 1L0XA 3QUXB 5E8PA 3B9AA 3IU3A 3DLQR 3FB6A 1UWXK 4TRPL 4MYWB 2ZUSA 5AEAA 1KIUA 4LCUB 5KSBB 4PP2A 3WBDA 3VRIB 3NCCB 2B1HH 5LAXA 3O9WA 1RURL 3T0EB 1CFSB 3WFZA 2EE3A 4MHHI 5DC4B 3C60A 5GGVL 1H8SA 1I9EA 2ATPB 4Z77B 3GMMB 2IPTH 3GBNL 3V4VL 3U9UB 1LE5B 1HH6B 2HJLB 5T3XL 4Z7WF 1ZT7A 1X6NA 4UV7L 2VDQL 3VWJC 4PLNC 5L2KB 3RZCD 2J6EL 4ZPTB 3MV9B 2XA8H 4NJAH 3JV4A 3ULVD 4Z7NE 5H8DA 2AK4B 1XGTB 3R8BB 4DJMA 2P5WE 5EOCH 4Y4KC 4MJ4A 1NCCL 2HMIC 2X40A 25C8L 5BS0D 4OLEA 3TZVC 5CJQL 2NW3B 1CLZL 1G9NL 4G5ZH 3NMEA 4FFYH 1CR9L 1SMAA 4MJIE 4CU7A 3IJYA 3E1F1 4HJ0C 3STLA 2CMRL 3O3DB 1X9QA 1W0YT 5ETUB 2EIDA 4HAFA 3T2NL 4TVSa 5DMKB 1T83C 4QRSB 4I1NB 3GIVB 4ISVA 2LAGB 2NY4C 3BZEA 1Y18A 1AKJA 5IG7B 3TT1H 4R26H 4RGNC 1YY8B 3TVMC 4XWOD 4M8VA 5GGSA 1HDMB 1IAIL 1IM9D 1Q0XH 4LCCC 4XXCA 4PJ8C 1LEGA 5ELIA 1QNZH 1X5HA 2R29H 2XTJE 5JORB 1T89A 2ADIA 1MF2L 1WEJH 3TBSA 1PLGL 3FQXA 1QP1A 3NBNA 3D18B 5C0EA 1F3DJ 3FT2B 2ILLA 5CBEA 1OCWH 4CN6A 4U1SA 4YE4H 3CD4A 4PG9B 3EOYG 1M05B 2GSGB 2MQCA 5DYOA 3R0NA 4P2RA 2X41A 1Q72L 4LOUD 3PHOB 4P2OB 5DQJB 5C0IB 2FEDD 2BMKA 2Y1VA 2VDKL 3KPOB 4LQ1A 3X12A 1IEAB 3MRQA 4NZDA 5EUOA 1INDL 5D1ZA 3RFZC 3QCTL 5KBNC 3BUYA 3I75A 5I1JL 5DJYA 2X42A 4TNWF 3ZYJA 4XNMB 3W81A 1ADQA 2IFGA 5DF0A 2NXYC 3SCMD 1TVHB 1EXUB 4GAGL 3FO9A 5INDA 1ZGLM 3QSKB 4AEFA 4M4RA 4PJEE 4UAOB 2ZSVB 1CLYH 4R97B 5ILTL 2EIEA 1PG7W 2DQJL 3VFUB 1NSNL 3RHWF 2P49B 4I2XB 3VXNA 4HDIB 3LMJL 1U91A 2B5IB 4OZIB 4O2FA 1A02N 2BHUA 4JRXA 4NJ9H 1G9ML 3VWKC 3AU1A 2I07A 4X7TB 3BZFB 1G7LA 2WBJB 2XKUA 5CLWA 2VOTA 1EGJH 5D2NB 4KDTA 4XX1E 4PJ9A 1VFAA 2Q7YA 5DJ6A 4IRSA 5IQ9A 4J3TA 2DTSA 5M95B 4YNYA 3STZB 3MJ8A 4ODVH 3O2DA 3QFJE 4IOIA 1QRNB 3NFPA 4OM0L 3OAZK 5JW4R 4XPBL 2J4WH 2BVQB 1IEHA 3UTQA 2Q3AA 5DLMH 5KVMC 5F7YC 5D6DC 3D85D 3MYZA 3LVEA 4XHJC 2NY5C 4P2QE 3L1OH 5JMOC 3MJ7A 5T1MA 5FHBL 3JWDL 1N0XL 1OL0A 2VJXA 4RGMB 3UTSD 5I18L 2R1XA 4FQIH 2VH5L 1P9MC 3NZ8B 4U31A 2GUOB 1RZJC 5IM7A 4QNPF 4L3AA 3QEQD 4WDIA 4YR6A 4OFVA 2CRIA 4L8SA 5I19L 1FO0B 1YUHA 2PYEA 3GNML 5ACZA 1JZ7A 1FCGA 4LLUA 3HG1E 5GGRA 3CVIL 5GS0L 3WS6A 3F62A 2Q87A 4KTYA 5KZCD 2QJDA 3ME0A 2O61B 3BMVA 3PGDA 3WFCL 1MCEA 2AK1H 1A6UH 1P7QB 4NUJA 3BWUC 1H3VA 1BBDH 3VXMA 2B0SL 1T1YB 2Z31C 3VRJA 4KRPC 2HT3C 4QOKD 1ZEAL 3MLPA 4JEGB 3I84A 1EUUA 4ORGB 1XF3B 1Q9LB 3U0TA 5E7BA 5A43C 4FQJL 4LEOB 1L9NA 1UXWA 2CO6B 2NQCA 2R2BB 3VGAC 4KQ3H 3F7YB 1FIGL 3NIGE 3VWJD 3FRUB 3OHXA 1ZHNB 3UZVB 3O0RL 4K7PH 5CIPB 2DD8H 4MCZB 3TBYA 5K9JH 4JFOA 5IMMB 4Y4KD 3JTTB 4OF8A 3EOAA 3EO1B 1CU4L 2APTA 5IMOB 5IFHH 1S7SA 4HJ0D 3RBSA 5FO9B 3SY0B 4HK3N 4NO3B 3EYUH 5CKAA 3GIZH 3Q0HA 5D7JC 2J6EA 1HSAB 4ZXBA 1JPFB 2HG5B 4PGCA 1PZUB 4NBXB 2NY4D 1QPXA 4NUGH 3KWWB 1J05B 5JDSB 5FV1L 3OMZA 2WIMA 4ODBD 5IGXL 2APWA 1KPUA 4LP4A 1FL5A 4RGND 4EI6B 4U1IA 4ZDHA 3TJHC 1ZMYA 4HUNB 4PJ8D 4M7LT 3ARDB 5KVGH 1VB9A 3CK0L 4WW2C 3MV8D 3MLSL 5IKCB 5JR1H 4ELMA 5I15H 4LSVL 2D7QA 1YEDA 3ZT5A 4X6DB 3SN6N 4R90L 3LKNA 5TH2A 2VN4A 5IVXA 1F4YH 5L88H 4JQXA 3GHEH 3JXAA 3MRNA 4RIRA 2F54E 1CFVL 4RFNB 3TJEH 4HD9A 1A3RH 4PLKC 4ZUSB 1V7NH 1ZT4B 3CLEH 5I66A 4PJ7E 2R8SH 2HTKC 4K3JH 4HCRH 3VH8B 4AMKL 2VAAB 2A6IB 1F4WL 5DI8A 1KJVB 3F7VA 3TESA 1AP2B 4I5BA 5F9OL 4CBPA 2P8MB 1T5XB 4L1DA 1F4XL 1U2HA 4Y7MA 1TQBC 3MJ9L 5EBGA 5FCUL 5ALCL 5HYQB 4AEEA 4C59B 1NFIA 4IHOA 1F4AA 4PJHE 3QNXA 3NPSC 3R0MA 3LEYL 3T0VA 5IQ7L 4MB4A 3RX7A 4C56E 3QQ9C 2X4QA 1NCNA 1FSKB 3A67H 3I6GA 3FFDA 1Q0YH 5D9SB 5IR1A 1TPXB 4I0KA 4N0UB 4U1KA 3S8WA 5D1QC 2GHWB 1U8KB 3CXHK 1HKLH 1DQLH 3JV6B 3OB0K 4HWZA 5HD8D 4C55A 2VR5A 3PGCA 2K1MA 5FF6A 2ICWI 5TDNB 4JM4H 3JVGC 3QIUC 4CJ1A 4HJJL 2R23A 4BSWA 3IRZA 4F80A 3MUHL 3SBWA 4FQ2L 5DDHB 4DCQA 2JB5L 3DYPA 3BP4B 4OD2B 5FGBA 4NM4L 1JGVL 1DEEB 2VLLA 4M6MH 5TE4H 3SJVA 3L5XL 4PYGA 3SE9H 4XP4L 4CDHA 3ULSB 4HS6A 4WGVB 2AEIT 5IOPB 3L3OA 1WBZA 2D3VA 4XHJD 5LCVL 5I8OL 1JZ4A 1MLCB 3IT8D 4YJZL 3SE4C 3FFCD 4CVXA 4CUCA 1WC7A 4PFEA 1F6LL 5BRZD 4DN3L 1JGEA 3VW3L 1M6OA 3QG7H 5A2IH 1BOYA 3UC0H 1DCLA 4X7CC 3VFGL 5DRZB 1RULL 1R24A 3ULVF 4RRPG 3H9YA 4QHMB 1G0DA 1EAJA 3FMGH 4GQ9L 4UUJB 3CSYB 3CC5A 4P5TC 1FG2A 4KAQL 1IT9H 4KXZH 4TUJB 5J57B 2LE9A 1RIHL 1PQZA 1F5WA 2XYCA 2AJUH 3MV7E 2Z31D 4XAKE 4KRPD 3WIIL 5C08D 2FX8H 2IEPA 2I24N 1GZPA 5T3ZL 5J1AB 5FYJE 2XFXB 5EO0A 3RZCA 4LMQE 1DQTA 4YHMH 5MEQA 2NLJB 2WW8A 5IJKC 4LCIH 2J8UB 4PJAA 1GCFA 5T1LA 3SDDB 4OGXL 1CGWA 1UYWH 1YZZA 5BS0A 4XRCA 3NABL 3WO3B 4EDWH 4S10A 3E0GA 5FAAA 3LSOA 2MHAA 1F42A 3TBVA 3X13B 5HYJB 3UJTL 3D39E 5FA3A 4KMTH 3VXSB 1RK1B 2YR3A 4WU7B 2GJ6E 1NMBH 2GAZB 4JN1L 5D7JD 4M61A 4JY4B 1BZ7A 5EOTB 2EC9T 4DTGL 1MQKL 1NBZA 2AJYH 3P4LA 2H32B 5SX5H 3B6SA 5ISZB 4KVNH 3NA9H 1FJ1B 4FP8H 5DZLA 4ZSOA 1LVEA 2B7DT 4L4TB 2AJZA 4K2UH 3NA4A 1MFBH 1NH6A 4KROB 2A6KB 4OLWL 4QRRE 3QULA 1TJIH 4KKAC 3FQUB 3BGMA 4LPCA 4OD3H 1JRHL 1E27A 5E03A 2G60H 4LIQE 3TJHD 3MRHB 1FH5H 4LGRB 4U1JA 4KY1H 5IV2A 1UM6L 43C9A 3S36H 2AW2A 5GISL 1T4KA 4N1CA 4DKEH 4QTHA 3PHQA 5J12B 4JFXB 4LF3B 3BHBA 3WXWH 4N8VG 4P9ML 3H3PL 4NQCD 1MCRA 1QUNA 1BFTA 2FECI 4GRWB 4RBPK 3BZ4A 2UVEA 4PLKD 4KHXL 5D7LD 2OR7A 5FUOH 1X5JA 2P44B 2QSCL 2HTKD 2WAHA 2DQIH 4Z7OF 4NHCH 2GJZB 4PJDB 4P9HL 4GT7A 3SCMA 2R69H 3THML 3G6DL 3QJHA 4HW6A 1CDCA 3BH9A 4LLWB 2EC9U 4X9HA 2IG2H 4NQSB 4YHNB 3BEVA 2E7HA 2B39A 4XNUH 1K6QL 5EG6C 1YECH 2XZZA 1ZGLP 3WS3B 1JPTH 3OKNA 4HWEH 2VXVL 3FQRA 2JB6A 4OLZL 1U9KA 2K7PA 3QQ9D 3OXRB 4ZAKD 1CE6A 4H1LB 2FIRT 2VLKB 3OKYA 5F96H 1WFOA 3G6JF 1I8MA 3LKOB 1I8KA 5HJ3B 3I6KB 5D1QD 4NKDB 1OAXL 4IOFD 2OI9B 5J0BA 4JG1H 3ZDZE 2MPAL 3PV6B 1S8DA 4GXVL 1RZJL 4Q6IC 4WEBL 1D5ZA 3HE7C 4HS3B 1YMHB 3L7FA 1UC6A 4KQ4H 3F58H 3T4AB 1OTUC 3BH8A 2MJWA 2GTZA 3SPVA 1UCTA 2UYLA 3UTZA 1RFDH 1T3FB 2Q7NA 2Z4QB 4OIBA 1RZ8A 1TETL 5GIRB 4G8EA 3H42L 4Y4HD 3QO0B 3G6JA 5E00A 2WQ8A 1QPPA 4LSTL 3DGCR 5CP7A 3SGJC 5KVEH 5IW3A 1FVEA 4UTAH 1ZVSB 5GS3A 3SGKC 3QEQA 3VGDA 2XT1B 1W0VA 2EDJA 1MAKA 5EA0L 2ZOKB 1JF5A 4PYHA 4P46C 1WBXA 5SX4I 3H3BC 5F9AC 3QDGD 5IROA 1U92B 1KXQE 3MRFA 5E8DL 2W9EL 1EAPA 5TF0A 4DVBA 2AGJH 1CXEA 4JB9H 4P5TD 5KANI 4FQXB 3PWJB 2QR0B 5E6ZA 2ZG3A 3UP1A 1I7TA 3EFDH 2MSPA 4LKCA 2EO9A 4YPGB 3KYMB 3MYJA 4RRPA 1UJ3C 1XH3B 1VKXB 1KJ3L 4QOKA 4M1DH 4AL8L 5C9KA 1AO7E 2VZTA 3TIEA 1BWMA 1VERA 1FZKB 1T2QH 1KIPA 3HI5H 1C7SA 4WI4A 5T5NG 4CVWA 4J4PC 2BC4A 4G8GE 1PDKA 5GGQL 4BUGA 3X3GH 1WAAA 1OF2B 3WHXB 2EDXA 3LH2L 5IBTL 1FRGL 4Y4KA 1R0AL 3B2VH 2UY7A 5CS7A 1I4FA 1CGTA 4DK6A 2BSSB 4JHZA 3IFPA 3IDMB 4D0CB 5B39B 5HHPA 2D03H 1JF6A 1EBPA 4UOJA 2MKWA 4Y19D 5HI4C 1T83A 5ESQA 4MJ5A 2Q76A 2FBJH 5D1XC 3WNMA 1YNLL 5EU5B 5EUKA 5TE7L 3E8UL 4I13B 5HHOB 2QEJA 3NACL 4ODUA 1U6AL 2CK2A 32C2A 4NKIL 3D0VA 3TIDB 5ESVB 1ZT7B 3CFIC 4KZEH 5I30H 2BOBB 4PLJD 4WNQA 2XG5A 4MJ6A 3MRKA 1UWXH 5GS1B 1TZHA 4FXGA 4PJ8A 5IHZA 1IAKB 3WNLA 3MV8A 1D5BB 4G6ML 5C86A 3S88L 1N4XH 1G9EA 4X6CA 1KTDB 1BD2D 3IRPX 3L3HB 2EDOA 3PQYD 3IJYB 3ARWA 1ODAA 3J7HA 3UO1H 4U6VL 2WINA 4ZUTB 3K0WA 2X4SA 4YAQB 4G8FB 4M6NH 2XZCH 4Z7WB 5J4MA 3QXUA 4WCYL 4QRPE 4URTB 1EEZA 1IC5L 3ISWA 3P0YL 3QH3B 5JO5A 5J11B 2VN7A 1RPQA 4MD4B 3VFOB 1NUDA 5GJSL 1IL1B 3DSNA 1AKJB 5DUBB 1R5WA 1PX3A 2P5EE 1L4IA 4NN5C 2ZNWA 3T4YB 3K8LA 2OL3L 2Q20A 4NDMB 2DQFA 1UH2A 4K23L 3IB4A 3V0VB 3EYSH 3L3DA 1OGAA 3FT4B 5DRWB 3LKQA 4HIIB 8CGTA 3ZE1E 3FQXB 2P46B 3RVWD 3WJJC 4IMKC 3CVHH 4YDIL 1JZ5A 5C0EB 4Z7UA 3W0WB 1FNSH 3RAJH 4CMHC 3TGXA 4UQ2B 4OCXH 4BM7A 1LE9A 1KTLA 5JPNB 3OPZH 3BMWA 1UKSA 1QSEE 2WIIB 1TCRA 1AXIB 4ODWB 3E6HB 4H0GA 4JDTL 5ADOL 3TLRA 5EC2B 4I77H 1MFEH 1CG9A 3I75B 1ZXQA 1BFVL 1NFKA 1FLRL 2VLRB 3BD3A 1A7QH 1AXSA 1B3JA 1SEBB 3B2UC 1GVIA 3HE7D 4WTWA 3RJQB 4JKWA 3HUJE 2RCSL 4U7KA 4NBZB 1MJ8H 2V5TA 1S7XB 1RZKL 4S0SD 3WEXA 4Q9RH 5BV7B 5MP6L 2I5YL 4APQB 5DWUL 2R0ZL 4PJ5B 3OGOE 5FGSA 1HNGA 4GMTL 4I4WB 5MEOA 2I9TA 5D6DA 4LAQL 2AERT 1BWWA 4TNVF 1JE6A 1SYVA 3LPWA 5E4EC 2QSVA 4UU9A 4JRXB 5JUEH 4MA1B 4LRIA 5I1HH 3QUZC 4G6KH 5BRZA 1R3HA 2NZIA 3U4EB 4N90D 4UNUA 3DX7B 5EDXA 2EIBA 3DMMB 5JA9A 3TNMB 1YEIH 4XP6H 1HEZA 2OP4L 3MLWH 4P46D 4A6YL 4E42A 3D3VE 2CDFB 2FATH 4PGBA 4Q6YA 3K1KC 1DQDL 3T1WA 4G43A 4YNYB 4XXDA 1MFNA 1BAFL 4IJ3C 5MENA 3MTRA 1E28A 3VG0H 3P11H 5T5NF 1EDQA 1KPRB 7FABH 3UTQB 1RV6X 4MQSB 3GJFH 3RKDC 1NGYB 5C08A 4POZC 5C0FA 3ZKNC 3QIBC 4Z18A 1JK8B 1N6UA 2ZJSH 2HLAA 3QCVL 4MB3A 1FNAA 5HI3C 3ARXA 1INQA 4PJXA 2R1XB 4H5SB 1FZMB 4J4PD 4M6OL 1K4CA 4Z8FL 4L8SB 2NY6B 2X10A 2YD1A 3LD8B 2X4OB 4LPYA 2JLLA 4FQHA 2JJSC 3BFOA 4YUEH 1UJTA 5GGRB 3GMRA 4JFEB 1CIUA 3MBED 2VE6B 3OAZH 3K46A 5D2LA 4WJ5B 4ACPA 4FMKA 2UV3A 3VRLF 2Z91A 3O6LL 2FO4A 1CK0L 4PV8B 2YXMA 4M7JL 3RL2A 4UT6H 4NGHL 4P5MA 2NY1D 2XQBL 3LQMA 3C6LB 5CJOH 4FHBD 2VDOH 4L4VD 4X9IA 4XP9H 1RUMH 5HI4D 3RUGF 4U1HB 2ADJB 3QHFL 1SY6L 5I1CH 1A22B 4NWUL 2VTFA 4M5YH 5T1DH 4K55A 3S37L 4XBPA 3B8YA 4D9LH 3KVQA 3PL6C 4NRYA 3U2SB 1QA9B 2EICA 1ZA6A 4L29A 4NN6C 4WI2A 3ULUC 3BQUA 1IVLA 2LABA 3B5HA 5DJ2A 4RDQF 1A6ZA 3NIDE 2XPGB 1S7WA 4UOW1 4JZNB 5JPMA 43CAA 4WW2A 5C6WH 3PJSB 3FONA 1RUQH 4ZD3H 4FTVD 3ZL4H 1SJVA 3IFOA 3QDME 2X4RA 1Z2KA 3B8SA 1UH4A 3I02A 1MRFH 4FOMA 1JNHA 5E2JA 4WHTB 3MXVL 1KLGA 2CRMA 5FEBA 4NQCA 1DUYA 5H35B 4ZYKA 4PGCB 1FPTL 1EEYA 1S7RA 4JFDB 3S4SA 3V0WH 3BVNA 1E6OH 5F3BA 5CD5D 2E8ZA 3U0WL 2JJWA 5D7LA 5AAMA 1QSFD 4LASL 4TSAH 3MRJA 4AEHH 2NY7H 4JFPA 5TF1H 1FL5B 1CDHA 3DBXB 2J12B 3HZVA 4NQVB 1OAKL 1UVQA 5TJWK 5KS9A 2MCPH 3BKCL 5LXGH 5DJDB 1XR8A 1E6JH 1NBVH 3UYRH 1CD9B 4Z76A 4RAUB 2HT4C 3D9AH 2AABL 4XWGH 5IEKB 3MCLL 3UEZA 1LO5A 4D9RE 4EDXA 3W9EA 3BPOB 4WEMB 4ZAKA 2NW2B 4NC1C 5ALBH 4XPFH 15C8L 1AH1A 1CICA 2OL3A 1KCLA 5I9QB 2DLHA 3VJ6B 5D1QA 4GRMA 2J8OA 1MCOH 3P0VH 4AIZA 3FJTA 2BK8A 35C8H 3WIHL 2P4AB 3NH7L 5F89A 1WLHA 3H9SE 1NL0L 4R2GB 3ARVA 3K4AA 3B2UD 3F7VB 2IH1B 4U33A 2PW2B 4NO2B 4WW1A 5T33L 1JHTA 1S5IL 2WLYA 4Z7VF 1RVFH 2WZPD 2E7MA 1NAKL 2Q3ZA 4QLRA 3O41A 2HRPL 2HTLD 4X4XA 5I1KL 3GSNL 4U1LB 3TPUA 1YEKL 2BX5A 4Y4HA 4HFWB 3TEUA 5I16B 1O5DT 1TXKA 2XG4A 1Z5LB 5IEHA 4F57L 2EYSA 3HPJA 1R5IB 4UIKH 1AD9B 2YKLL 4R7NB 1SBSH 3O45A 3QUZD 3WNPA 3AXLA 5CUSH 1HHHA 1S5HA 5DSCA 4HKBA 5FF6B 3PGCB 2DMKA 5GGUB 4AQOA 4D3CL 4YDLB 3LZFH 3GSUB 4P2RE 3MRBB 3QDGA 1BX2A 1K4DB 5M7QA 5F9WB 2FIKB 1J12A 3KLDA 3FOMA 3LQAH 4P5TA 5EUOE 1S78C 4M43L 4YHOL 1RAMA 3SJVB 4JQIL 2DQCH 4Y4FB 1AHWC 3T77B 4KH2A 5FO7B 3RKDD 1LDPL 3WLWC 4POZD 4RMVA 4YBLC 3QIBD 3ZKND 2AJXL 2NPLX 2EECA 4L8DA 4A6YA 1S9YA 3OB0H 5HI3D 4JY5L 1FNGB 4IDJH 5MHSE 1WC7B 1UB6B 3GI8L 3L3KA 1CFQA 1JGEB 5JQ6L 3KPMA 1M6OB 2BXZA 3DUSA 4BKLA 3IU4H 4MD5A 1PZ5B 4OUUB 3N0PB 4R0LB 5ICXB 1F90H 5AYUH 2KQMA 4U6XB 1QFWM 1XIWD 4MAYC 4Q2ZB 5ICYA 1MFDH 3REVB 4GW1A 5AWNH 1UCBH 3FB8A 4PJFF 3F8UB 2PCPA 3AS0A 3PDDA 1I75A 2A38A 2A9ML 5FV2A 3CC5B 1FG2B 3BYYA 4I3GA 4XPAL 4XC1H 3LRSB 1WBYB 1OSPL 2XTJC 3WD5L 2EYRA 3D1MC 4U1GB 4Y16B 5IB1A 4UNTA 1INEL 3C6SB 4JLRB 3OJDB 3GGWA 2EH7L 1T03H 4HK3J 3HZMB 3LS5L 3PL6D 3CX2A 1YEJL 5IMLA 2DM4A 4JO2L 2ZCHL 4XPHH 5FUZL 4K8RH 3ULUD 3UPAA 1YC8A 4QYOA 3VE0A 4F7TA 1NAML 1W0WB 2CSPA 4MB5A 5EU3B 1XGRA 5EZOH 3SE8H 3MXWL 2J3SA 5EIIB 1G7JB 3IDXH 4AM0A 4F58H 3CH1B 1BD2A 2R0WH 1N6QL 1SY6A 3WO4B 4WY7H 3W2DL 3PQYA 4JN2A 4UTBH 5C7XH 4EUPG 2V9RA 3X14B 4OZFA 5DUPH 3T0AA 5CEZL 4X8JA 5FA3B 1ITCA 4EI5C 2PYEE 3SDAD 2V6HA 4LAJH 2ZUXA 4ZQKB 5I8KH 1XGQB 3Q6GL 5E24E 1ZA3A 4XCFH 4M61B 2Y7QA 4KK8C 5GJTL 1MREH 3RWDA 3I3BA 5F72S 4TVPH 3NCJH 3C8KB 1OLLA 4JO1L 5EC1A 2OYPA 1IC7L 4OZGF 4PJBF 4HCRA 1JYXA 2HKFL 2EE9A 5DQ9B 5L6YH 4XNXH 1HNFA 4A2MA 1XGYH 2QQNH 3N85H 3QULB 5JLZB 1GGCL 1LO2H 3BGMB 1IM9B 2R1YB 1EO5A 5CBAA 3IDYC 3P73A 4L9LA 3BKJL 5MI0C 1Q94B 3O3AA 4CKVX 4OKDA 2D7TH 4PG2C 1UM4H 4I0PC 1R5VA 4N5EC 3G5VA 4H20L 5EORL 1LK3L 3MC0A 5SV3A 2HT4D 4QTHB 4LHUB 1PFCA 2HFGL 3PABA 3QUML 3S97C 3BHBB 1B2WL 3D5OF 1P1ZB 2DQEL 5EH1A 3CH8A 3FRPG 1CVRA 1T0MB 1I3UA 3AB0C 3LV3B 1CTNA 3QT2A 3PNWB 3RI5F 1YY9C 3KYOB 1DDHA 3C09B 5D7IF 1TZIB 4LARH 3M1BB 4YQXH 1M1SA 5D7KE 1HQRB 5F7DA 2Z92A 2O93L 5ID1A 3BEWB 3F7QA 3HA0A 2JK5A 1U8LB 3QJHB 4AT6A 4MQXD 4MDIA 4GW5B 2LU7A 1G6RL 4O4YH 1YEEH 4PRPE 2OZ4L 5KN5A 5M94B 4AIXA 4LLQB 1U58A 1XGPA 3EOTH 3S96A 2LAAA 1I1AC 1D6VH 3K8KA 4HX1B 5F7LB 4B41A 3K2MC 3O8XC 2V7HA 3O6KH 1CFTB 5DXWA 4C4KO 4NSKA 4RBPH 5D7IA 4TOYH 5IFAL 3WFEH 5C70A 1PD6A 3SGJA 4QXUL 3WIHA 3IGAA 5FDWA 2H26B 4JR9L 4ELME 5FGCE 3SGKA 2DB8A 4I48B 4GAFB 4BH8A 3I85A 1X7QA 2HFFA 5C0RH 2Z93B 3VD7A 5D4QA 4FQPA 3RL1A 4KFZC 4M7ZB 4XGZA 1LO0H 1JHLH 4YK4B 5IVXE 3GSNA 2BFVH 3UJJL 4YZFE 3LQAC 3Q5OA 2GK2A 5F7HA 3BSZL 5FYJH 1OB1B 3VDAA 4JFFA 1J8HB 2H2PD 3GI9L 5E6YA 1S78D 4DEPB 2CUHA 2YZ1A 2UYLB 3Q6FA 3DROB 3P40A 2P43B 3SO3B 2BY3A 4BQ9A 3EDJA 4AH2A 4EN3A 3D85B 1YEHL 2P5WD 3G6JB 5ITBH 5SX4H 1BFSA 1CYGA 3NAAH 1EHNA 3HE6B 3TN0C 1GC1C 4NNXA 5T1KB 3CGTA 5KTEL 3UTSB 5GRVK 3BO8B 4KK9C 4MJID 1DP0A 4OCYH 2R1WA 3KPSA 4PRHB 4RWYH 3UJIH 4WFEE 5J9PB 2OMNA 4I9WE 2BRRL 2FGWL 4DN4L 2WBKA 5KSAB 2VDPL 2GY5A 5E08L 1GHFL 4TSCH 4W4OC 1RJYA 3C2AL 3DVNB 2IJ0C 3DUHA 1WBXB 3GB7A 2ICCA 3MCKA 3MBEA 2DIJA 4NM8L 5JDJA 3RDTB 1TNMA 1QKZL 5FYKU 3K81A 2Y4SA 2XWJA 4X6BA 1EAPB 3ULUL 5DMIH 3ZYIA 3EYVA 1DFBL 2Q86B 3AGVA 3SHSA 4I3RL 2UWEA 2FYYA 1I7TB 4HLJA 4L4VA 4OSUH 3IJSA 3MUJA 1VENA 4N5UA 3QJFB 5C2BL 3TA3C 4EJ1C 5I75C 2VDMH 1KF9B 4QOKB 2XTJD 3X3FH 4LIQH 1U8OB 5L2KE 4DZ8A 4UOW0 1QFUH 4YFLF 1KIPB 2D2OA 5HHXL 2BNQA 4K8RC 4TQEH 3VWJB 5CSZA 2UZIL 4JO4L 5JW3H 4LSQH 3MO1A 3CDYA 4HIHA 1KBGH 5CIPH 3TCXA 4WUKH 1IM3B 1MCFA 5FYKH 1P84J 5IJVB 1J1PL 4GBXD 2PO6A 2ZUTA 1TJGH 3TZVB 3QRGH 3BXNA 4GJTB 5TGBA 5HHVH 1QR4A 1A47A 2Q8AH 2E27H 5CEYA 2VXUL 2RFXA 4EI5D 5CZXC 1NCDL 4MX7A 2O5YL 1X44A 3KNBA 5ESQB 5TDOA 3CU1A 3GMPB 2FJHB 4EUPA 2ZUQC 3HCVA 1JYVA 2VISA 5EU4A 2NY4B 5I8EB 3LKPB 1NAMA 4GSDH 3EZ8A 1EVTC 4X9FA 4LSUH 1QSFA 5IF0B 3RZWA 1GGUA 2VDNH 4DKFH 1L6ZA 1B88A 1NGPH 2PF6A 4PY7B 4RGNB 4G80A 3TVMB 1MJ7H 1TQCC 2CGRH 3QUKB 3HAEH 4LCCB 5DD3H 4FXGB 3T08A 4PJ8B 3KLHC 5IHZB 3BGAA 3MUGB 3WXVL 3MNVB 5F3HB 4XNYL 4I0PD 4N5ED 3V6OA 1LK2B 3WJJA 4XMLH 1B90A 2NX5B 1QO3A 1FYTE 4FS0A 1S7QB 3D0LB 4NRZA 4PJAE 5C6PB 5TE6L 3FN0H 2FX9L 4TPRL 5BS0E 2IQAA 2V7NA 1J18A 1C5DB 2XRAL 5E1HB 1JHKH 4X99A 3SKMB 4ZMAT 4AG4H 1YY9D 4J3WA 2BDNH 4NC0B 2BP3A 2VQTA 3FRPA 3IXAB 4N8VB 2FR4B 4PRBB 1R5WB 4KK5C 4OF0A 3U1SH 2QV2A 2DLGA 3QDJB 2E7CA 4P2QD 2R2EA 4S1SH 2GW5A 2H1PL 2C1OB 2NXYB 5H2BB 2DQFB 3O2WH 3QUMA 5CAYB 3EYFB 3T0DA 1JFQH 4ZSOE 4NO5B 1IAII 4HLZH 1TNNA 3MODL 1YJDL 2RR3A 3HC3H 1IGJB 4U7MA 1MVUB 1QD0A 4UI2A 4JAMA 1WZLA 5D8JL 1ERNA 5E8OA 2DLFH 5IBUG 3HG1D 1E4WH 3ZTNH 2V9TA 1KLUA 4LLDA 4P23D 5DD6B 1KTLB 4S1DC 5A40E 1J0JA 3VWKB 4RCAA 5HYEA 3QUZA 4MZ3A 5L9DL 4KJYA 4TUOA 2YC1B 4PJCE 1ZHBB 4F7CA 4X5XA 1G6RA 4O2EA 1CG9B 4OV5A 4M1GH 3C5SB 2OZ4A 3W11C 1F6AB 4YXLH 1NJ9B 5A16B 5J13C 5C0CD 4J3UA 1I8IB 3RTQD 1MJJB 4JHWL 4LSPH 1QYGH 5FCSH 3TBWA 3LKSA 4H8WH 5I17A 1FL6A 3WMSA 4K07A 5AG9A 3QXDB 4DW2H 1BGXL 1WSST 2AJVH 2VUOA 1AC0A 1FDLH 3G08B 3IJHB 2UVFA 2Y23A 4KUCF 3U7AA 1FBIH 3B9KC 3TN0D 3KPTA 1FL3A 4QHNA 3CFKA 3FFCB 1JGDB 5L8LB 4KDWA 3KR3L 4QCIA 4IIQC 1BQLH 4YHKH 1R3HB 3QR2A 3RGVB 1C12B 1CF8L 5DTFA 2GCYA 1YEFH 1A1OA 3HKFA 1KT2B 1FZJB 3MBXL 4N0YH 1KSRA 1UH3A 2RBLA 3CUPB 4OGAC 4S11A 1X4YA 2JJSA 1H3PH 5HDOA 4Z5RB 2EIZA 3TT3H 1XIWA 2DBLH 4TULH 2BVPA 3WIFA 4G43B 5I1GL 4XXDB 1KG0A 1ED3A 1ND0B 2VB5A 4HGKC 5D7SH 3MMEB 3OKLB 4YHZL 3KPPB 3TF7C 2PXYC 1MVFA 4BK4A 4FFZL 4MLSA 3F65A 3IKCB 2Z31B 3G04A 1XZ0B 3TA3D 1VACB 3CX5J 3IETA 2YS4A 5C08B 2QSTA 4Y5YA 5BVPH 4K3DH 4JPVH 4YHPB 1MY7A 1NEUA 1OAYL 3AM8C 2ZPKH 4K8RD 4NOBA 2X70B 2B1AH 2W9DL 4O5LL 3MJGX 3DIFA 3V6FA 2VAJA 1BEYL 1DSFH 5HGDB 2BY2A 4OLYH 5C9JB 5FO8A 1QVOB 1FZOB 5E9DD 2F54D 5DVMA 4O58L 1YA5A 4MNQA 5CEXA 3OGCB 3QQ4A 3JWOH 3QEQE 2Z91B 1EIBA 4C57C 4M8QB 2C1PB 2FO4B 3WDJA 5CSGA 5SWZB 3CLFL 3SDAA 1I7RB 5IP4A 2VZSA 1MWAL 3PWNB 4GAYB 4HUUA 2X7LB 1A7BA 2QHRL 5D7JB 4Y88A 3UTOA 4QY8A 2MCG1 3GBMH 4JM2C 4D8PA 1PEWA 4GRLC 1KXTB 1MCCA 3MV01 2EH8H 4M48L 1CBVH 3CSBA 2OSLA 3MQIA 1R3LA 1KN2L 2Y5TB 4U2ZA 1BIIA 3RWFA 1ZA6B 2ZUUA 1RK0B 3MNZB 3U9PH 4XPGH 5DJ2B 1MRCL 4C56D 4MSWB 3RNKA 1U8JA 2ZCLH 3GSVB 2ARWA 1S7WB 1YPZA 2J5LC 3KLHD 2R56H 4JY6B 4Z6AT 5HYSB 2VL5B 3PUCA 3CVHA 5FM8A 3OXSA 5DD0H 4NO0D 3RUGB 3SDXF 3LDBC 2DLTA 2P8PB 4G6JL 4Z78B 4Y8AA 2DQDL 1I3GH 1WAAE 2CIKA 4YHLH 1G7HB 1OTSC 4PB0L 2ICEA 2OXHA 5KSVA 1JNHB 1MUJA 4P49A 5TPWL 3F5WB 1CS6A 4J12A 4EQ2A 3BIAX 5D5MF 4ZS7H 4MNHA 5LGJA 3HI1B 3QXWA 4LSSH 4WIQA 1XCTA 2LTQC 2IGFH 5ERWA 5EU7E 5T3ZE 3MLTA 4HC1L 1EBAA 4O02H 3T3PE 1MHHA 1KCRL 1PY9A 1ITBB 1N8ZB 2PTTB 4JFQA 3NFSL 4P3WA 2BZDA 3RNQB 4KK5D 4J8RB 3DO7A 1AGCB 5ITFA 3FZUD 2IFFH 2C4FT 3HZVB 4JO3L 2APFA 4HFUH 2CDGA 1X5KA 1KFAH 2DMCA 1PG7H 3O3BA 2B2XH 4MA8H 1W72L 3H0TA 1TQBB 4XMKH 2ED7A 5F1NB 1JTOA 4HK0A 1H9VA 3SQOL 2VIRA 3GUTA 2E5EA 2WUBH 4WUUD 3QWQB 1OP5H 3NPSB 4PBXA 4BQBA 3G5ZA 5MERA 5L7XH 5HHNA 1D5IL 5D70L 3MV8E 5CILH 3VFVA 4X6CE 4FQCL 5DJAA 4XPTH 4DFIA 1G7MA 4LVOC 5D1QB 5EZIH 3EGSA 1F3RB 3MV7D 4L5FL 4XAKD 3SGEI 3HC0B 4ZUWA 3QIUB 1TIUA 5F70A 4HIXL 4MCYB 2OK0H 2V17H 1RZGB 4JHAL 3QCUL 2E6QA 2HT2C 1YQ2A 1SJHA 1U41A 4F33B 3GJFA 2OQJB 3CCHB 3CZFB 4X80L 2ESVB 2P5WA 1IC4L 2IANE 3N1MC 4PRID 1RIVH 3B9KD 3QFDB 1OGAE 5CJXA 4KGLA 2C4FU 4MJIA 1JPGB 4EBQL 4F7PA 4IS6A 4NZJA 4CJ0A 2R2HA 4QXTA 2DKSA 4EOWH 3QNZB 4NWTH 1FE8H 4Z7VB 4FZ8L 3EKCA 4BA8A 4OTXL 3QDGB 4UB0H 1OD9A 2VABA 5CWSB 4KVCH 5IB5B 3N9GH 1EUTA 3LIZH 1CDJA 5HDQL 3H7BA 1BFOB 4XCNA 4NZRL 4ODXB 1XF5B 4ETQB 4TSBH 4QRRD 4NPYA 2C7UA 2PXYD 3DVGA 1E0OB 3BPNC 5GGTH 2IPKA 5DRXB 2A9NL 1RZIA 4ZFFA 1U8PA 4UV4H 4L8DB 5E6IC 1S9YB 1HHKA 2DIAA 5MEPA 3CMOL 4NZUL 1AGFB 2P8LA 4PJEF 4BSJA 1SEQH 3VD9A 4MD5B 4NQDD 1JPSH 4GBXA 4KKCD 4E5XB 1HI6B 4PGEA 4U1NB 5C6TL 4NJ9L 5BZDA 1DJSA 3N1QC 5BRZE 1RU9L 4ZFZB 3CPLA 1C1EH 3M8OH 4BQ8A 1R3IL 2DTML 4Y19B 3RVVC 4OIIH 1PSKH 3VXPA 3T65B 1IAOB 5I1LA 2EYRB 3P77A 4JM2D 4K3GA 2EDHA 4GRLD 5MENE 3WKML 4NC2B 3BP5A 4HUXB 5JW5A 1J0YA 5DJ0B 4G42B 3VFPA 3OV6A 3RPIB 3AC0A 1ORQB 4XCEB 1WT5C 4RFEB 1JGUH 3GSRA 4ONHA 3RVXC 4DGVL 4PJFB 2JCCA 1ZHKB 1DLFH 5DJCB 5DT1L 5I76B 3VE0B 4OGYL 1MWAA 1BQHG 4HF5H 4PJXE 4M5ZH 2OMBA 3LHPL 1BD2B 1CGVA 1HQ4A 1KELH 3U30C 3FOLB 1SM3H 5SWQB 3EO9H 5I1AA 1A4JA 1BVLA 1LGVA 5LVEA 4BZ1L 1XF4A 3L9RB 3QRFM 2VLJA 4K3EL 2FZ3B 4G7VL 5D2LE 2YA1A 3TO2A 4GH7B 3QXAA 3WLBA 2FB4L 3L3IA 1I85A 3MGTA 1DUZA 1RD6A 4CL7A 1L0YA 1A6UL 1I3RA 3GSQB 4Q9QL 4X6FB 4RISH 1IQWL 3BE1L 2Y6SC 1N6VA 4M3KB 3DI2B 4UILH 4DUXA 5KVDL 2I60H 4GKOA 1SYSA 2HFEA 4XBGA 2EYTA 5DMGC 1AI1L 1JRHI 1R5VB 3GMQA 1EJOH 3VFWB 3G5VB 4K9EH 3MRRB 3QIWA 2APVA 4QRTB 4WWKD 2AI0L 2RB8A 3QUYC 2IH3A 2C5DC 2NTFB 3HG1A 5AZ2L 1WISA 3PP3K 2IBZY 4N8PA 1U8HA 4OZGB 4PJBB 2AQ2A 3NIGF 4HC1A 3RWHB 3IDNA 4P23A 4HUVA 1JWMA 1ZAGA 4N68A 1HOCB 1N5YH 2JF1A 1L0QA 4NNPH 1MRDL 1N64H 3U0PB 4R8WL 3ARZA 1HHGB 2HRLA 1NQBA 1X5GA 4QF1B 4U1MA 3VCLA 4JG0H 2P7TB 3L3GA 2CRYA 1JI1A 2B8OT 3OAUH 4MXQC 1OAZH 4LBEA 4Q58C 4OAWB 1W72A 3TYFB 5F7DB 3ZKMD 4ZFGH 1KCSL 4ZUUB 1ADQH 2G9HA 3DX6A 1AO7D 4NQCE 4X98B 1CFBA 4Q6IB 5ID1B 4Z95L 5C0CA 3HE7B 4JGJA 3RTQA 3DV6A 4I3SH 1L7IH 2HT2D 2JELH 1MH5B 5D7LE 5BV7H 3VFNA 1HILA 4RAHA 1XGPB 4CDGC 1QLFB 4LGSB 5HHQA 5I1EL 4PREA 1JJUA 1BIHA 4XNQA 5C92A 2W65B 5D7IB 4KTEL 5KS9E 4XZUB 2IQ9H 2J88L 3PDOB 4LU5L 3KPRA 4CN4A 4U6TA 1HZHL 5JR1L 4XC3L 1OD7A 4NZTH 2DRUA 1CGSL 1X7QB 1HSBB 3IDGA 1C5CL 4HXBH 2DQTH 4P46B 4RQQA 4JGUA 4XGZB 3FB7A 4Z0BL 4LRNH 3BKYL 2Y36H 5C0BB 3G5XB 1JMZA 2EEAA 3ELAT 3O2DH 5IB3B 1VPOH 4R3SA 1I7UB 3DI3B 3IVKA 2X4TB 3CLEL 2HVKA 4U7SA 5ANMB 5DZNA 2XTLA 1IJ9A 5CD3B 1AR2A 2ADGA 1NLDH 3BKMH 5B4MC 5F1KC 3GMLB 3TA3A 3BIBX 1A2YA 1UJ3B 5DA4A 4PJ7F 1MHEB 4YEFA 1DBKH 1EFXD 2ARJQ 1JP5A 1T04B 3UTTB 1UA6H 3VXQA 4J23A 1Q1JL 3HZKB 4YC2C 5LBSL 2VXSH 4ESKA 5E6ID 2GSIB 1FFNA 3E6FA 4TUKH 1KEGL 4LLVA 3PHSA 3I3EA 3WJLC 3KLAB 4V1DB 1NMAL 2ICWJ 2UY6A 3ARUA 4ONGL 4WO4B 4QRPD 2OR8A 3GMOB 3NFNA 5E9DA 2YSSA 4JPWL 2A73B 4PJHF 1OGTB 4FN0A 4YHIA 4ZTOL 4AK1A 2XWTA 4PJ7A 3O9WC 1A7RL 3EYVB 4RZCB 1D5XA 4NKOB 3BPCB 2VITA 4JFZL 2LV4A 3U36A 1Q9OA 1E4XL 1HIML 4YDVA 5DA0B 2YEZB 3F6LA 3C60C 1BVKA 2CLZA 5D1XB 4NFDA 2ZUWA 3VMPA 4FABH 1HH9A 3R06A 4NQEB 4PTUB 4L8BA 3V95A 2PYFB 2Y07L 4TRPH 1J9CT 3RVXD 5C8JA 1A6TA 4UT9L 4C56A 5E99L 2WANA 2PN5A 2CK0L 3BJLA 4QRUB 1MJUL 1QSED 3O4LE 1DBML 1FGVH 2E9BA 1UQSB 4M7LL 4FTVB 4YDJB 4NO0A 4UDUB 1UM5L 1KEML 4F8QA 1EZVX 5GGVH 3QG6B 3DARA 2RFXB 2X4NA 2IAMD 3GBNH 2QQKL 4G9DA 3V4VH 5T3XH 1FVDA 4UV7H 5HBBA 2VDQH 2J6EH 5L8JB 4EUPB 3OAYK 1YYLL 2CUIA 3LN5B 5KSUA 3OL2A 5AUMA 4J1UA 3AVEA 4E9LA 3RJDA 2XN9B 3BP6B 1N0LA 3MOAL 1NCCH 1NFDF 25C8H 3L7EA 3HNTL 4LLYA 2H9GB 5DD1L 1RMFL 5CJQH 1CLZH 4XXCC 4JCMA 1G9NH 1S9XB 4NN5B 1CE1L 1CR9H 2Y6SD 1T89C 4MS8C 4D0BB 1TTFA 2CMRH 3A6CL 4PRNB 5CGTA 3T2NH 3HHRB 3W0WE 4GW4A 5GRUL 3CFDB 4PRAA 1AGEB 4H26A 3ECBA 3VXOA 5FKPA 1G7IA 4WUUA 4M3JA 5DFVC 4CMHB 1SBBA 3V8CA 3V7MA 3FHAA 3MRGB 3S9DB 4MWFA 2Z35A 4HHAB 1N2RB 4WV1C 3BIKA 3WSQL 3WNOA 4S1QL 1GPOH 1IAIH 4DOHE 5KJRL 2BSRA 5J6HA 4G8IA 3OWEA 1JV5B 2LU4A 1G0XA 1H3GA 1MF2H 2H6PB 4J3XA 1PLGH 4MXQD 4OFDA 3HLAA 4PV9B 4JPKL 2R2EB 1F4HA 5IMKA 1D5MB 5DD5L 1NGZA 5DURD 1NCBL 3WFBL 3LB6C 5FM4A 1DE4A 4KVNL 3NA9L 2NY2D 3ZHKA 1HXYA 3D69A 5TQ0L 1K2DB 1Q72H 5BJTB 2F74B 1QFOA 2VDKH 4PRIA 5LGKA 3QCTH 2RQ8A 4LLDB 1XR9A 5E4EB 1VA9A 3DURA 5I1JH 3WYRA 1NC2A 5HY9B 5F7NC 2DM2A 4YGAB 4XMPH 3TH2T 4YXKL 4KJYB 1MCKA 3KJ6L 1J1OL 4I18C 3VGHA 1FORL 1YEGL 5EO1A 4XVUC 1N5AB 1AR1C 1K85A 4KDTC 4GAGH 5E94A 4IRSC 5JOFA 3MA7A 2DIBA 1BOGB 2O5ZL 4R4ND 2YK1L 2A1WH 5ILTH 2YHGA 2BNRB 2DQJH 2L7UA 1NSNH 1I7ZA 2GK0B 3LMJH 1JZ2A 4IJ3B 3GRWL 1DQQA 2YPKB 3BWAA 4XCYA 3VDBA 4R96A 3TBWB 4C83A 1AE6L 1G9MH 1A1NB 2PXYA 4BFEA 1JZ8A 3MLRL 1I1YB 4Z0XB 2B20A 1F11A 4ZS6C 3S5LG 5J6GB 3QWOA 1H15A 4KJPC 3QIBB 1H0DB 3PWPB 3CNKA 3T0BA 1GIGL 2H8PB 3AM8A 3K4DA 4JDZA 2Z8WC 4PGDA 5EU6D 4JM2F 2GCYB 1L9MA 4XNUL 3WS6C 2XV6B 4M93B 4NQDA 5GSRA 1B0RB 1OSZA 4OM0H 3AFLA 3VGFA 4XPBH 1ZT1B 2XNAA 5IB4A 3SDCD 4GAJL 4C4KT 4ALAL 1ED3B 1QBLL 1UWGL 4CN1A 1IGCL 3K3QA 5FHBH 3JWDH 1N0XH 1J0IA 1QBAA 4M9OA 2X1PA 1KB5L 2VH5H 5CHNB 4OCSL 1G7QB 3U4AA 3SKNA 3UX9B 5J7CC 1LP9A 3QEUB 5GSVB 4OLVL 2DAVA 5I19H 4GRLA 3ZDZF 2DF3A 3GNMH 4DZBB 1IKNA 1PKQE 2HA1A 3AAZB 3DX8B 1T6VN 2XZAL 4JFFE 2HH0L 3IFNL 3CVIH 5GS0H 5IW1B 1GJIA 1G7PB 4KI5E 3PL6B 3HN3A 4UZGA 2D7OA 4JVWA 4LKXA 3CFEA 3DIFB 4D9RD 3WFCH 2ORBL 3GKZA 2OM5A 2G5RA 2ITCB 1DL7L 3ROLA 2XZQL 5FO8B 1N59A 1UKTA 2B0SH 4JDVA 1X3DA 5TQ2L 3T2OA 4F7EB 5CEXB 4Y8DC 3KPSE 2FEEL 1VFUA 1ZEAH 4FQJH 3WFDL 3H9SD 4JFDE 2R0LH 4ZXBC 3VMNA 1FIGH 1FFPB 3MRDB 5SWSB 4G9FD 4QXGH 5I2IB 4NT6A 3O0RH 4KWUA 3HR5A 3SKOB 3C9NA 4HJGA 2DLEA 3GSWA 3AMKA 1G9NC 3ARBC 5C0JB 9CGTA 2UWEE 3MLUL 2YA0A 1LO4L 2FSEA 3O11B 1CU4H 4P48A 2ED9A 1U8MA 5ID0A 3RNKB 1HYSD 3MLYL 1FV1A 3CVHB 3ALXA 4UNVA 2EXYC 2BNQE 3PXJA 1X5XA 3UTPE 4NHUA 4WWKA 1NGXB 3CDGB 4ZTPL 5DFVD 1MUJB 3TO4C 3BD4A 3TBTA 5L0QC 5CMAA 3Q48A 3OF6A 3QZWG 4JQXC 1U95B 1OLZA 3NN8B 3BOVA 5E2WL 1XF2B 2HVJB 2N1KA 4MNHB 4U6YA 4L3CA 1P5UA 4P57B 1SJXA 3ZE2E 1XCTB 5LJYH 3MLTB 5CZVL 3CK0H 3MLSH 4P59L 1LNUB 2APBA 4LPUA 1AO7A 3LS4H 3SDXB 4LSVH 3SQBA 4R6UA 1NLBL 1H3WM 4JKKA 5IESL 3AS1A 4HIEB 2CLRA 3LB6D 3ES6B 4R90H 1H5BC 4KV5E 4JE4B 1EX0A 2GQHA 4PGZA 4O51A 3AY4C 3PE9A 1EEUA 1CFVH 5D5MB 3OX8A 3SGEH 2WUCL 3MFGB 5CEZE 3T1FB 4MQ7B 2AVGA 2MNUA 1IGTB 4CW1A 4U05A 3W39B 4J3SA 4N8CL 3V6OE 1KTKE 3IF1B 3V2AR 1F4WH 4XVUD 5BCAA 1AR1D 5F9OH 3RGHA 3MRCA 2X6MA 3FO0L 4HKJA 1F4XH 5C2UB 2G5BA 1P4BL 2F58L 3MJ9H 5FCUH 1BZ9A 5ALCH 5DHYB 1LEKB 3V5DA 4M6NL 5J1TC 2XZCL 4JZJA 4PJGA 5FGBC 3C5ZA 2W91A 3IDJA 4K7FB 3QEHA 2VQ1B 1G9MC 3DX9A 3LEYH 1U3ZA 5IQ7H 3OKDB 4HPYL 2AXJA 2BVUA 4BH7A 2XACC 1BM3L 2GITA 4YBHA 3GJFB 1VEMA 1AHWB 2DM3A 4ZS6D 2P5WB 2H3NA 4YWGL 1IQDB 1UENA 4F9PA 7CGTA 1EFXA 4KJPD 1TTUA 4ZUVB 3TNNA 1T21B 1NC4D 3U4BL 3MROA 3VFRA 4HZLB 4LDEB 4RNRB 4Q0XL 4HIJA 3IDIA 3WN5B 4LNRA 4F7PB 4HJJH 3A0OA 1FNEA 4LLAA 3D48R 1AD0A 4EIGB 4QXTB 1T20A 3BN9C 3ZE1F 1EO8L 3GRWA 4X5WA 4FQ2H 5GRYA 2JB5H 4NM4H 1JGVH 4RAVA 3UMTA 4QRPA 5EWIL 1P5VA 3L5XH 1Z0NA 4XP4H 1B0GB 4MAYB 4PRDB 2FWOA 2JKXA 3O6FC 3OPZL 2VABB 4PR5A 3OR6B 4O00A 3JWDC 5JHLL 4RA3A 3MR9B 5LCVH 5I8OH 1A1MA 1MELA 3H9HB 5A2JH 3UPRB 3FQTA 2NNAB 2DYPD 2YOCA 3UBXG 2OLDA 3DGGB 1QSVA 4MVBC 2IBGA 4DN3H 3QWRD 1WFTA 3VW3H 2IPKB 1RZ7L 4GKNA 2Y06L 4EXKA 5GS0C 4M4PA 3RZCC 3FQWB 1HHIA 3O3UN 1MIML 4LHJB 1DQJB 5EBWA 3MREB 3VFGH 3HUJF 4FMFA 3EIFA 2P8LB 1RULH 3L3JB 5HGBA 1GGBL 5TFSL 1G1CA 1VADB 4LK4A 4YGVA 5I1DB 2GTWA 4YDKL 4UINL 1RIHH 2YD3A 1KB5A 1W2KT 5DUML 1TCMA 3CFBA 1JN6B 5EBMA 3SKUD 3X11B 3MSPA 3WIIH 4MXVE 1V3JA 1MCPL 4F3FB 3EYOB 3C87A 5T3ZH 2N56A 1NDGB 4EI5B 2IAMA 5LGHL 5ENWA 1DVFA 4XP6L 2HWZH 4L3ED 3D2UA 2YMXL 1AGDB 3FO1A 3GO1L 1MHCB 3VXPB 4HG4K 2A74B 3I3DA 1ETZB 4PJEB 3LEXA 2CDEA 1M71A 4PRPD 1HCFX 3T8XB 5JW5B 1LEIA 4OGXH 3FO2A 3VFPB 3NABH 1DBAL 3BRGC 3P11L 4NQUA 4XP5L 3ARBD 2R9HC 1A6PA 3GSRB 3ARSA 2GY7B 1BJMA 3BT2L 1DBBL 2VZ3A 4ZPVB 3CX5K 4F2MB 1CD1B 3KXFB 1FCCA 5IHLB 3UJTH 5C09D 4AYFA 1KENL 3MRLA 1ES0B 3FQNA 1II4E 3IDYB 4JVUA 1MWAB 3HS0A 4NFCA