5LBSH

Structural basis of zika and dengue virus potent antibody cross-neutralization
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
121
structure length
121
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCSASGFTFSTYSMHWVRQAPGKGLEYVSAITGEGDSAFYADSVKGRFTISRDNSKNTLYFEMNSLRPEDTAVYYCVGGYSNFYYYYTMDVWGQGTTVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein E
publication title Structural basis of potent Zika-dengue virus antibody cross-neutralization.
pubmed doi rcsb
source organism Zika virus
molecule tags Immune system-viral protein
total genus 25
structure length 121
sequence length 121
chains with identical sequence I
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lbsH00
4PGJA 1PG7L 3SDAB 4DW2H 3TWCH 2WNGA 1K4DB 2DI9A 4TUJB 5A16A 1FDLH 3MV11 5SWZB 3SE8H 4M6OH 4P3DB 3UTTA 1HHGA 1GPOH 3ARFD 5MEPA 2BMKA 4JANB 4OCSL 5JORB 5BZDB 3DX6B 2W1NA 1DQDH 2FATL 4R90H 4EUPH 4LCIL 2P5EE 4WO4D 2VQUA 2PO6A 2EIDA 4OLYL 5SWSA 4QEGA 2EDEA 4LASL 4PLKD 2DQJL 5L6YH 5B3JE 1JI1A 1NEUA 2VTFA 1CGUA 3IDXL 4HIJA 5KJRH 3GSWA 5DK3A 1RZJC 3D0LA 2Q7YA 4XZUB 5D8JH 3WFZA 4JRXB 1WAAA 2VDRH 3BXNB 5EU3A 3WLWC 4MMXC 1Y18B 1D9KB 3MV9D 2BVQA 3IJSB 5IHUL 3UTSA 4QXGH 2ZG2A 2DBLL 2FJFA 4LP4A 3TBYB 2APWA 4H1LA 3LKRA 3S3PA 1XF3A 1ZHLB 1HHJB 2IQ9H 2ZCHH 2E3VA 3MLPA 5KSAB 1JHLH 5HHOD 1MCNA 1SBBA 2XYCA 3HNTH 1JWUA 5CZXD 1MFDH 2P24A 3QNXB 4ZPVB 2GK2A 1QSEE 2R56L 4ERSL 1UACH 4ZUTA 3BWAA 4NUGH 4GSDL 1MAJA 3O9WB 3TT1H 5A2LH 3FHQA 3MNVB 3DETD 2FRGP 1WITA 3WCYA 2OR8A 2VXUL 3N1MC 4KAQH 2I07B 5GRWA 5GRYA 1FVEA 4JCLA 4M6AA 3IETB 5EU6E 4XPAH 5IIEA 4NNXB 2AXGB 3KYOA 5EOCH 2VIRA 3VWKA 4YXKH 3HI1B 4LMQI 4LLAA 1F90L 5I1DB 4TSBH 5IQ9A 3B6SA 4WFGD 5H2BB 3JTSB 5DJXA 3QG6B 4YBLC 3LQAC 3GRWL 1BVLB 5T3ZL 5CWSA 1JUFB 1A6TA 5TH2A 5GIRB 2DD8H 5JMOC 2BVEA 3DX8B 1V7ML 1AR1C 4JFOA 4M8QB 5H94A 4C4KT 1I1AC 5JNYA 3RL1A 3C5ZD 5IVZA 3CDYA 3PWNA 5D1ZC 4JN1L 2D03L 1DQLL 3FKUS 4HWBL 5AG8A 5CILH 1ZLUH 2Z91B 2CLZA 2YXMA 1DN2A 3QWQB 2EXYC 2R39A 4Y2DA 4RAHA 2XWJB 3HNSL 4JQXA 3LHPL 3X12A 4XVJL 5J1AA 5J89A 5KG9A 5CSZA 1MCRA 3TPKA 4PLJC 3O6FD 3F62A 3LIZL 2EEBA 4O5LH 5GZOD 5DZNA 4XAKE 1FRGL 5ICYA 3MUZ1 1J8HE 4NWUL 4HKZB 4HBQA 3WIHA 3UC0L 3VFRA 1YEEH 4U2YA 3EJYD 1WC7B 3PXHA 1T04B 2MKLC 2G5BA 2EZ0D 3RZCA 1KYOK 3RA7L 2CRZA 1QNZL 5IMKA 1CL7H 4K23L 2FH8A 2A9ML 4KFZC 4PJIB 1MHEB 3KPSE 3LCYA 2NPLX 3IDJA 4PJCA 1NANH 3UO1L 3EGSA 3HC4L 1QHOA 1GVIA 4MNQE 5F3HA 4F9LA 2E6QA 5BOZG 4NN5C 2FJHB 3GMPA 4PRID 3ARUA 4QYOA 4MXVF 5EUOF 1M05A 5EOQH 4D94A 4KUZL 3KPMA 2I9TA 3FFCB 1JZ5A 3F5WA 3T2NH 5GJTH 1MRDL 4KROB 5IMMA 4ZOCA 1IBGL 4RGOH 4HXAH 5T1DL 1S7UB 1N6QL 3BWUC 3WHXA 5FK9B 1OAQL 1INDL 1T80A 1F8TL 3D18B 5EFIA 3C5SA 3EFDL 3L3KB 4IOIB 5D7LB 4NM8H 3EYUH 2BNQB 2RFXB 4XGZA 5DA0B 2NXZC 4GSDH 2ERJB 1KCLA 3U46A 5L8LB 5DSCB 1ETZB 5EPMA 3REWB 2ADFL 2Z31C 2FX7H 4RGNE 2X6MA 5I1LA 1ZHKB 1PX3A 4BZ1L 3OJMB 2V17H 4N0UA 1FNAA 4CVXB 1B2WH 4OZHB 2YWYA 4UTAH 1INQB 3GSRA 2X7LA 2AQ1A 4AK1A 2JIXD 1D5XA 3QWRD 1PZ5A 1MIML 2E9IA 1NCWL 2Y1VA 3NPZB 3QIBC 2ESVA 3KLDA 3CVHB 4XPFH 2YPLD 1I1YB 3HKFA 1UXSA 1N59A 1WJ3A 4Z7VE 4K9EC 5HYFA 4FQXD 2AAVA 2QKIB 2G9HB 4LPXA 1SEQL 4LHUD 1DE4B 1P84J 4XCCL 1RQ5A 4GKNA 4N8CL 1KSRA 4WV1A 1I8IB 5JHDE 4N0FA 4DWHA 4ZPTA 4FFVD 4YHMH 4PYGA 3MCLL 1XGPB 3R8QA 1YY8A 5C0CD 1WK0A 3L3HA 2R2BB 4NOBA 1CFNA 4N9GB 2OL3A 3C60B 1FZKB 1G9NL 1WZLA 3SDAA 4DGYH 5IF0B 3LPFA 4Z7QE 5DD0L 1K4DA 2YUZA 4DKDC 4TUJA 4YDKH 5SWZA 1FRGH 4NWUH 4P3DA 4DN3L 4MA7L 4WW2C 2CO7B 5BZDA 4EN3B 3DX6A 5ADOH 3RHWK 3O8XC 3TZVD 2O5YL 1U8MB 2C4FU 4FQ2L 4EKXA 2QADB 3QYCA 1CCZA 3EYVB 4Q97A 1I8LC 1MJ8H 4XZUA 1T1WA 4JRXA 4RGMC 3BXNA 1ZVHA 2RHEA 3KPNB 3UTOA 1Y18A 1D9KA 3NZ8B 4TVPH 3IJSA 3S98A 3UJJL 5D93B 3ARZA 4PRBB 4APQD 1IGMH 3TBYA 1WISA 1ZHLA 1HHJA 1T4KB 5KSAA 4MAYB 3SCMD 1ES0B 2ZG1A 4Y5YB 3QNXA 4ZPVA 2EYSB 4GS7B 4J3WA 3HG1B 4PP1D 3O9WA 2RGSA 3MNVA 4NPYB 1A4JB 3HMXL 4I3RL 2I07A 4WW1B 4HCRL 4HK0B 1PYWB 3IETA 2C3XA 5CJQL 4OZGB 4RFOL 3S5LB 2FH6A 1I3UA 1HKLH 5DXWA 4NNXA 2AXGA 5A2KH 5FYLE 5FUCC 3HI1A 1UM5H 1DLFH 5I1DA 1AQKL 2IPTH 5H2BA 5JR1L 1M71B 2VR4A 4FFWD 4KKAD 3QG6A 4MCYB 1BVLA 4WFEE 2WP3O 1JUFA 5EA0L 1F02I 3CK0H 4K7PH 1FZJB 4ZNCD 1OTSC 1L7TH 5GIRA 5I30H 3PG2A 5D9SB 3LOWA 3D69B 1DQQA 3DX8A 3O4OB 2GJ6E 5IWLA 4NBZB 4M8QA 1JZ6A 4P9MH 1TZHB 1CU4H 4GG8B 1SEQH 4N90E 3GO1L 1XR9B 3FO0L 2IJ0C 5D2LB 1A7OH 4XCCH 2HLFD 5D7JC 1OARH 2IH3B 4Y19D 2QQQA 3MODL 3CLFL 1BP3B 1W2KT 1CZ8L 3IGAB 5F97E 1J87A 3I9GL 2CH8A 2DAVA 1I8MA 5J3HD 3D3VD 2Z91A 3HI5H 5BS0E 1G7PB 4NKIH 2XWJA 4L3AA 4ODSH 4QT5B 4X6CF 4X7TB 3D9AL 3P9MB 5IW6B 1PG7W 2YD8A 4HULB 1FN4A 4ZFFB 2DIBA 1MCCA 5E2WH 2QQKH 3QXAB 4HKZA 5EO1A 1QQDB 4MA7H 3ARBD 1OAKL 3QI9B 3Q6GH 1WC7A 1BBJB 1FFQA 1QLEL 1T04A 4P5TC 5CP7B 4OM0L 5LBSH 5MI0C 3VXRE 3A6CH 4Q6IA 3T0DA 2F8OA 4M7JL 4RWYH 5C0BE 4PJIA 4PJXE 1MHEA 2P5EB 4FQ2H 4ONGL 2I9LB 2D0GA 4GAFB 4XH2A 4TQEL 1RVFL 2D4DA 4MXWH 3OAZK 2B1HL 1XIWC 4JGMA 5HXMA 1HEZB 1INEH 2KPNA 2FJHA 4A6YH 3CFBB 1DFBH 3DSNA 2CRIA 4WENB 5JXEC 4NUJB 4LSVL 1YEHL 3UJJH 3W0WE 1NFIB 3SJVE 4GT7A 3WDIA 3FFCA 3VFPB 1FCCA 4D0CB 5FFLA 3IJYB 4GBXB 4MJ2A 1S7UA 1HH9B 1L9NA 3CVIH 4J3XA 4U6YB 5FK9A 4L8SC 3D18A 3OKYA 2Q7NA 2XTJD 4K2UL 3L3KA 4IOIA 5D7LA 3PNWB 1X5JA 2BNQA 2RFXA 5JOFB 4L4VD 5DSCA 1ETZA 1QSEB 1B4RA 2P8PB 3REWA 4XX1G 4KJWC 5TDOB 4I3RH 3HZKB 4ZUUA 1BJMA 1ZHKA 2DQDL 4PJ7E 5JOEA 4N68A 4OM1L 3RWGB 3QUZB 1P5VA 5CUSH 2O93L 4JM2C 4CVXA 1WTGT 4LSQL 5EU6B 2OI9C 4OZHA 3ZT6A 1INQA 3ZKSD 4PRHD 2EDNA 3VD4A 3AS1A 4RFNC 1FNHA 3QQNA 4TSAL 3CVHA 3NACH 1I1YA 1J18A 3RTQB 4MXQC 1Z3GL 4G6FD 4OLWL 5I73B 4PJGE 4RAUB 2YN5A 3ZHKA 4MJ4A 2QKIA 3I84A 3QPXL 2G9HA 2HLAB 5DI8A 4YHYB 3ZDXE 4HGKC 3P0YL 1DE4A 4AIZB 5ALCL 3AY4A 1AY1L 3MODH 4XXDB 1I8IA 3WD5H 1C5CL 5D71H 5M7QA 3BKCH 4NYLB 3VU2A 4CUCA 1XGPA 5HJ3B 1TNMA 5FGBA 1IAIL 1MCIA 2R2BA 4ZS6C 1GGUA 1H3TA 4N9GA 5KN5B 3C60A 1RUKH 3BKYL 1FZKA 1UXWB 3CDCA 3K4ZA 2VH5H 1MCWM 4FZEL 5IF0A 1KJ3H 4KJQD 2E27L 4G7VH 3CZFB 3DRTB 4JDZB 2NY7H 1C7SA 1NCNA 4NO3B 4XVTH 1J8HB 4EN3A 1QLEH 2QQLL 5DURD 3MV9E 3HE7D 1E4KC 3LB6C 2F19L 3MUY1 4GFTB 3WS6C 2CXKA 3QIWD 4R2GC 1U8MA 3SHSA 1KN4L 1N4XL 3K46A 4OGXL 4ONGH 2ICWI 2CUIA 4O02L 1RVFH 3INUH 4OZ4A 3TF7C 4KTYA 5E8EB 3KPSB 4JHBA 5HHOE 15C8H 1QFHA 5DJZB 3T0BA 2BVYA 3QH3B 1RHFA 4OFYD 3MRLB 3KPNA 4ZOBA 2MCG1 3NZ8A 3JWDC 4Q0XL 5I17B 4LLMA 3BE1H 3FB7B 4U1IB 4PRBA 3BD4A 2XQYK 3IDGA 1QFUL 2ATKB 3VFMA 4YHLH 3T4AB 3S4SB 2R2EB 3QUYB 2Y36H 3LRSB 1T4KA 4URTB 4TTGA 2A0LD 1BFSA 4MAYA 4K94L 1DSFH 3BPNB 3L3OB 4UV4L 1ES0A 2X1WL 1BGXH 4MX7B 3O3BB 2EYSA 3NTCL 3QSKB 3C6LD 3WSQH 2PR4H 1W0VB 3HG1A 2ZPKL 3MXVL 3MLRH 4NPYA 4GRWF 4WFGE 1MEXH 1KELH 4H26B 4WW1A 4HK0A 1PYWA 4J6RL 2FO4B 4P4KB 2BHUA 4RGNB 4LLQB 4OZGA 1Q9LB 3S5LA 3I6GB 1H8SA 4FQIH 4YDIL 4B0MM 2I24N 1JN6B 2PUQT 5J9PA 1A8JH 1NLDL 3T04D 1M71A 5T5NF 1OGTB 3ALWA 4UV7H 1JGLL 4MCYA 4X9GA 3BISA 4ONOA 5DEGB 4Z95L 2P49B 1MFEL 1FZJA 3OAYH 12E8H 4GRWH 5D9SA 2AXFB 3D69A 4QXTB 4Z7VB 2NYYD 1TZHA 3T0EC 4GG8A 1U3HB 1XR9A 5DVOA 4NN6B 3JXAA 4Y5XA 3QG7H 5D2LA 3PGFL 2EDLA 5ALCH 4KV5E 2H2PC 2IH3A 3GSNB 3WXVH 1TQBC 3IGAA 2ARJA 1MREH 4NC2B 4XP6L 2E7CA 1KC5L 5JHDB 2NY4B 4M4PA 1G7PA 4Q9CA 2ZNXA 4EIGB 4NC1C 4G43B 4XTRC 2PN5A 4QT5A 4UZGA 4CMMB 3U7WH 5JW4R 3P9MA 4FZEH 3FJTA 3NBNA 3I3DA 3GK8L 4ZFFA 3MZGB 5HVWA 2E7BA 4NHUB 5FDYA 2JCCF 2W9LA 2Y9RT 1QQDA 3S37X 3LQAH 1FGVH 5GISH 4B7LA 3QI9A 4HFWB 4Y4HC 2VDPL 1BBJA 5CP7A 1T1ZB 5D2NC 1KEGL 2QQLH 1YEJL 9CGTA 5AYUH 1NCUA 4HWNA 3OGOE 5FYJL 1JRHL 3QHFL 4QLRA 2P5EA 2I9LA 4NO5B 1BIHA 3JSSA 3TN0B 5L0QC 1OWWA 4BQ9A 3WS3B 1MPAL 5EBLB 3EO9H 4MSWB 3GKWL 1HEZA 2IAND 5JXAL 2NY3D 3CFBA 2AP2A 4NGHH 4P2OD 5DVKA 4G3YH 1AXSB 4NUJA 5EOTA 5ADPH 2DQCL 1NFIA 4BSWB 4M1DH 2NZ9C 3OXSB 4G6AC 4PJHF 3VFPA 5E8PB 5KVGL 4U0QB 4D0CA 1OSPL 3UP1A 4TNVF 3IJYA 2OTWB 4GBXA 5E2VH 1HH9A 4U6YA 2Z8WC 4UV4H 5E6YA 4UIKL 4U4BA 3PNWA 1MOEA 3AM8C 5JOFA 5IJVB 3TBSB 1X5AA 1QSEA 1L0YA 2P8PA 1I7RB 5TDOA 3HZKA 1U58B 1IC1A 3U1SL 1T89C 4RMTA 2YHGA 2WSKA 4DFIA 2YPLE 4X4XB 3RWGA 1EZVY 4TPRH 3VWJB 3S5LG 1Q9OB 3W9DB 1BJ1J 4AMKL 1NFDB 5EU6A 2HH0L 4OCNC 3CX2A 1A6WH 4LGRB 1KTLB 4EDWL 4OT1L 4KZDH 3ALPA 2AXHA 2EXWD 3QFDB 3H9HB 4OGAC 2CDEB 5J12C 1JGLH 2C26A 3V7AE 1N3NB 5F9WB 2L0DA 1B0WA 1RUML 4RMVA 4D8PB 1G0YR 1MFEH 3RTQA 5IBTH 4B50A 1S7XB 4MNGE 3RBSA 2J8UF 2VDLL 3CDFA 4RAUA 5BVPL 4OD1H 1RZFL 4BJLA 3ECBB 5E03A 4OZFB 1URLA 2GJ6B 4AIZA 1A0QL 3SKNB 2LAAA 4R0LC 4XXDA 3DMMB 2GFBB 3SGJA 2P43B 3H3PL 4LNRB 3SQBA 4NYLA 5D1XA 1T21B 4HEPG 4R4FH 5I8OH 5HJ3A 4YFLI 3M8OL 4MD4B 1Z9LA 5BS0B 1IKFH 3ZE1F 5KN5A 3VGGA 1UXWA 5JPMA 4HAFA 3OWEA 3E3QE 4LCWE 3CZFA 3DRTA 4JDZA 4U6VL 3BPCB 3CU1A 1DVFD 1VPOH 4NO3A 3QDJD 1ZLWK 1CXIA 4RCAA 1J8HA 1A7PL 4X7EC 4K9EH 2EIZB 4ORZC 2A77L 4P2QE 4W4OC 3QHFH 2DKSA 2PETA 3VXRB 2X5PA 4XPHL 4XNXH 4IRSC 4RMUA 4XBPB 4PJXB 3C6SB 3KPSA 1VGKB 2YWZA 5DJZA 4QHKJ 4Z7WE 3QH3A 1BQLH 2V2TB 1CK0L 3RL2B 3MRLA 1V5JA 3LD8C 1BD2D 5I17A 1B3JA 4FG6D 2WIMA 4U1IA 2DQCH 4HSQA 3LH2L 2ATKA 1IARB 2YRZA 3SJVB 3T4AA 3S4SA 2R2EA 3QUYA 5DWUL 2GEEA 4DQOL 3LRSA 4MB4A 4O9HH 1U42A 3L3OA 1UT9A 4MX7A 4JHZA 3JZ7A 5BO1H 3O3BA 1UWXH 2BSSB 1B4JL 6FABH 1TQCB 1FIGH 1W0VA 1H3GA 4M7KH 4AEHL 1KB5B 3RU8L 1QA9B 4P46D 5B8CB 2ZCKL 2IMMA 4OF5A 4H26A 1L6XA 4LSSL 5GRZA 2FO4A 4P4KA 2AK1H 3VFGH 4LLQA 3VXNA 1Q9LA 3I6GA 4PJ7B 4FNLL 2AJSL 3TO2B 2YRPA 3K81A 1KENL 4JKPH 2E9BA 3VFSB 3S8WA 3LKOB 1V7NH 5CS7A 5CIPH 1JN6A 1M7XA 4KI5C 2AJXH 5C0IB 1KLGB 2MSPA 1QSFB 1OGTA 1Q8MA 3SQOL 2IF7A 5J6GB 4Y19E 3L5WB 1S78D 3CU7A 4I18C 3BZEB 5D7KD 2OK0L 4P5KA 5DEGA 2VLRA 2PF6A 1YJDC 3D3VE 2AXFA 5BVPH 3R0MA 4QXTA 1SY6A 3WHE0 2C9AA 5E94B 4Z7VA 2EKJA 1IGFH 3TP4A 1S9WB 4PJGB 1DL7L 3IU3B 1U3HA 2WM0A 4WHTB 1A0QH 3GSNA 4OI8A 1OT1A 1Q1JH 3KJ4C 4GW1B 2FGWH 1AD0B 1YMHB 2YXFA 5JHDA 1R3LB 4CMHB 1S7QB 4ZSOE 1H8OA 2OCFD 5DHVH 1KCSL 3ARFB 4G43A 3KR3L 3EOTH 1NBZB 4ZAKD 5EZIL 1YEKH 1FVDB 4CMMA 3BSZL 3LDBB 1FCGA 5LVEA 4QHMB 4WO4B 2FJGB 2VZVA 2D3VA 4NHUA 4XNMB 4U6VH 3U0WH 3RWDB 4OKVB 5IEKB 1MCFA 4HFWA 2EH8H 1RMFL 4F33B 2QQNL 4KUCF 1T1ZA 3V4PH 3QQ3B 4KK9C 1G84A 2DS4A 2IALB 2CIIA 1AGEB 1WAAF 1HHKB 4X6BB 3BVNA 2QLVB 3MV9B 5DD3L 2A6DB 1T66C 2IBGA 3JUZA 5F96H 4M9PA 3TN0A 3KPLB 4R7NB 5C6TL 1CGVA 5JUEL 3WIHL 3WS3A 5LQBH 5EBLA 4MSWA 3BKML 1EHXA 1BPVA 4LSPL 2V6HA 4WVRA 5CP3H 4F15C 3DUHA 4BFIB 1VGEL 5HHOB 2XTJE 3F7RA 1HINH 1AXSA 1QSZA 4BSWA 1UYWH 3OXSA 3QDAA 2D9CA 5E8PA 4EI5D 4HG4K 1MELA 1XZ0B 4HXBL 1ZK9A 5K9JH 4PRPD 1T3FB 1B4JH 1AGDB 1CE6B 1QFOA 2Q8BH 3HR5B 4GMSL 1UA6H 2X9YA 5IJVA 2Q20A 4PRHE 3TBSA 2G75B 3EDJA 2X44D 3SKJH 1I7RA 4PJEE 4YQXH 2IFFL 1U58A 1TETL 3DYPA 2OS7A 5I15L 4X4XA 3VWJA 1Q9OA 3W9DA 3UYRL 3ZMRA 4LKXB 3LPGA 4FNLH 1NFDA 2AJSH 5CZVH 2Q3AA 5FYJU 2E7LA 1KTLA 2UWEE 1LO5B 3B5GA 2CRMA 3LZFH 2M8XA 4CKVX 2HTLD 3CMOL 1W0WB 3QFDA 4LQ1A 3FL7A 3H9HA 2CDEA 1OAXL 1N3NA 3QO1B 4D8PA 2QV2A 3VE0B 1FFRA 1S7XA 1VEMA 2YN3A 4AENB 1S7SB 4X4ME 4ZFOB 1OOAA 1CLOL 3ECBA 1UM4L 3IRPX 3SE4C 4OZFA 4HWEH 5HPMB 2EE3A 3SKNA 4FQ1H 1MAML 5E8DH 4LPWA 3DMMA 2GFBA 2AEPH 5J4MA 4LNRA 1PKOA 1R6VA 4JRWA 2O5ZL 3VFTB 1T21A 2AEQL 1LDPL 1NGZB 1TLKA 4MD4A 4N0CC 5BS0A 2X1XR 3K2MC 5CEZL 1FE8H 3P11H 4GOSA 3BSZH 3QJHB 3TBTB 4Y5VC 4C57C 5D70H 2V5MA 5IG7B 3BPCA 1G9ML 4GAYB 4NKOB 4OQTH 3MJ9A 4PJCF 1JNLL 1PG7X 4XP4L 1RMFH 2R1YB 3VXME 1UKQA 4W6WB 1DCLA 2EIZA 2H32B 4HPYL 1EJOH 2OL3L 1GGCH 4F37K 1Q9KB 1IM3B 2XZQL 5DD3H 3VXRA 2V5YA 1NPUA 3VD7A 4XBPA 2DM2A 4PJXA 4QRRE 3C6SA 1VGKA 4GKSB 4PJ8A 4M9OA 2V2TA 3RL2A 3GMQB 5IQ7H 4G9FD 2FZ3B 2VO5A 5ESVB 1ADQA 3QIUB 5IVXE 4OTXL 2GJJA 5BV7C 4XPBL 2ADIB 1JWSB 1NGYB 1P1ZB 2WBWB 3GMNA 3H0TB 1HWGB 5HGGS 4HIHB 3SJVA 2GI7A 5FHBH 4KRPD 3SDCC 5DD5L 2LABA 1YECL 2BSSA 3R1GH 4ZUWB 1OCWH 4CN4A 2K7PA 3SPVB 1OGAA 1QA9A 1AR1D 2ZSWB 5B8CA 5HGBB 3CLEH 5HYQB 1I1AD 3NH7H 2IFFH 3BIAX 3DV6B 5ENWB 2HN7B 4JO2H 2JIXB 4N8PA 2FSEB 3ZKXB 1IGYB 1CG9B 3O3UN 5D1ZD 4FTVA 4PJ7A 3DVGA 1GOFA 3TO2A 2YPLB 4KVCL 1ONQB 3LKOA 2EEDA 4K71B 5C0IA 4WUKL 1KLGA 3LMJH 1DQJB 3JWDH 4PB9L 2EXYD 4FQXB 1QSFA 1AJ7H 4W81A 3DSFH 2HFFB 3CMOH 3KGRA 5J6GA 4LHUB 2ZUXA 3L5WA 4UINL 4LEXL 3HNVL 2GUOB 2BJMH 4PLJD 3RKDC 4YXKL 4OCWL 4Q9RH 5ESQB 2JJSC 2PYED 4JE4B 2HG5B 1N7ML 1CFQB 4RIRB 5E94A 1JPFB 5KSUB 3QPQC 4EQ2A 4PJGA 5EC2B 3IU3A 3T3MF 3T8XA 4WHTA 3IJHB 4HS3B 3H7BB 4JM4H 4WI4A 1FIEA 3PHOB 4KRNA 1I8KB 3AB0C 4QF1B 3ME0A 5CD3B 3NCYP 4GW1A 2LV4A 5GGQH 1YMHA 2HTKC 1U6AL 4R97C 3WJLA 2O5ZH 3D85D 1R3LA 1S7QA 3FZUC 4YJZL 1HNFA 4Q58C 1DBJL 3ARFA 2BK8A 2VZOA 3QUXC 4JKKA 1VA9A 5E56A 1HWHB 5E4EC 1UQSB 3QT2A 2I5YL 1FVDA 2DTMH 3WNOA 1XGTB 3FQXB 5JW3L 3VFOB 1OB1B 4WO4A 1E4XL 2FJGA 3TZVB 4XCYB 4XNMA 4LCWB 1Z5LB 2WZPD 3RWDA 5CD5C 1OY3B 5IEKA 3BP6B 4TN9A 1S7RB 3MROB 5CKGA 5KVEH 4TUOB 2IANE 4F33A 4LFHG 5H8DA 5DMYA 1U92B 3KXFD 3QQ3A 5DQ9B 2IALA 2DQFB 4HKXB 1AGEA 1HHKA 1JPSH 3MV9A 2A6DA 2DKUA 3U7YH 4P2QB 2NXZD 3KPLA 4MQSB 4R7NA 1G7MB 4APQB 5F7WC 2Z31D 1D5BB 5LJYH 4EJ1C 3SE9H 3IU4H 3NIFE 4BFIA 5HHOA 5HVHC 3SCMB 3UBXG 3ARGC 3BGAA 4Z7WB 1J86A 1DBKL 3LEYH 2ORBL 4AZ8A 1QR1B 2YZ8A 1SJXA 3VA6A 3K3QA 1R0AL 4ZS7H 4BZ2L 1CD0A 3MQIA 1NC4B 1XZ0A 5LGHL 3QIBD 1KTRL 1JJUA 1JVKA 1T3FA 3MYJB 1AGDA 1CE6A 3HR5A 2XKSA 4TVPE 4XHQA 1CDBA 1Z2KA 2G75A 3C09B 3B9AA 4NZUL 4XCFL 4RNRB 3WBDA 1J1XH 2H1PL 2JK5B 3TJEL 3SN6N 5D1QC 4FQCL 4KTDH 4LKXA 4MA8H 5C09E 2F9BT 2UZIL 1TPXC 4KTEH 1TNNA 2AABL 5EDXA 4FS0A 1LO5A 3PGDB 4BQ6A 1NAMB 1DANT 3NCYS 1W0WA 3B3IB 3V52L 4NJAL 4LLUB 4UINH 1J9CT 3QO1A 3GNMH 1B6UA 4S1QL 4M6NH 4Y19B 5GRVL 3VE0A 3OB0K 4OCWH 5L7XL 3LN9A 4GMTL 4M7ZC 4H20L 4OLEA 4WY7H 4AENA 1S7SA 2LU7A 5HVGB 3MJ7B 4ZFOA 3GI8H 3OAUL 3D3VB 3AS3A 3KPRB 5HPMA 4AEIH 5CCKL 2DLFL 1U8JB 2GCYB 4Z8FL 4NZJA 3FMGL 3O8XD 2CR3A 3CVHL 5T1MB 4JQVA 4PBWD 1FSKC 1NCBL 3N85L 3RDTC 3BHBB 1U6AH 3VFTA 4L4TD 5DQDH 3UXFA 3QDJE 3GIVB 1NGZA 5KAQF 2BY0A 2OR9L 2XZCL 4ZSOB 3CFEB 4PY8I 1YEDB 1F45A 4XNQB 5JW3H 4NFDA 5IROC 3T0VA 2R0KH 3QJHA 4JO4L 3TBTA 1UGNA 4CU8A 4MB3A 5IG7A 4YHOH 1A7QL 4GAYA 4PJIF 4NKOA 5F1NB 3QCUL 3FN3A 2UZXB 4U31A 4XC3L 3SO3C 2R1YA 4WWID 5AG9A 1BD2E 3FRPA 2H32A 4IJ3B 1PBYA 2DQEL 5CSBA 4JDTH 5FCUH 1A7BA 1Q9KA 1IM3A 3FQNB 4NSKB 2M1KA 4NBXB 3IAPA 4PJFF 3IDMB 3F12B 4GKOA 3GSXB 1NLBL 4GKSA 1EDQA 2ZJSL 3GMQA 4CVUA 1I9IL 1NBVL 2FZ3A 5ESVA 3QIUA 4FN0A 1ZS8B 1W72H 1A14L 3BKJL 1KN2L 4EXPX 4F58L 2ADIA 1JWSA 1NGYA 1P1ZA 2XTJB 5E70A 1KNOB 1KIPB 1UZ8B 4LGSB 4WI7A 1FNGB 4HIHA 3FRUB 1AI1H 4BZ2H 4EUPB 1EBAA 5FO7B 4UDUB 3GMLB 1JPTH 4JRYE 1WEJH 2DKMA 3AREC 2Q87A 2ARWA 4ZUWA 3UJIH 5ICXB 5I6XC 4L8DB 1OAUL 3IFOB 1OTSD 3SPVA 4Z18A 2ZSWA 4OZHF 5HGBA 2HP4A 5HYQA 3DV6A 3BP5B 3BGFB 4PRHB 2HN7A 2JIXA 1VCAA 3LN4B 1IGCH 2FSEA 4PJEB 1IGYA 4CVWA 1CG9A 5D7KE 5D7JD 1RUAH 4FQCH 1S9KC 2YPLA 1ONQA 4G6FB 3B2UC 1NGQH 1HCFX 3MGAA 1DQJA 1EXUB 2Z9TA 2Z8VC 1AHWB 3O4LD 4FQXA 2HFFA 5EO0B 3GIZL 1NEZA 3V52H 2UWEB 4LHUA 1F2QA 4NJAH 2GUOA 3I3BA 5LG1A 3ZT5A 4KZEL 5DC4B 2ICES 5ESQA 4XWOD 4JVWA 3TT3H 2HG5A 4H20H 2YEZA 1CFQA 4RIRA 5KSUA 1JPFA 4KDWA 4MB5A 2CK0H 5EC2A 2KZWA 4P2RE 5KOVC 3IJHA 4HS3A 3H7BA 4P5TD 4J1UB 1CF8H 1KTKE 3PHOA 5IEHB 4M93C 1I8KA 4IOFC 4QF1A 4UMGA 5CD3A 4YXLL 4PJBA 2J5LB 1FGNL 1CBVL 1HILB 3ILQC 4XP1H 5IESL 4LAQH 3MPCA 1QFWI 1MI5D 1XIWD 3MRGB 4GXUM 3V5DB 2DN7A 2GHWB 1UQSA 2CKBH 4E41E 1XGTA 3FQXA 4U0RB 1A7RL 5DURB 3HE7B 3WMSA 3VFOA 4YUEL 1JF5A 4YNYB 5JXED 2K7QA 2MPAL 1OB1A 3TZVA 1ZT7B 4BUGA 4XCYA 1IEHA 5IFJB 4LCWA 1Z5LA 1I3GL 2W38A 3S36L 4Y8DC 5IT2L 3BP6A 4UT7L 1S7RA 3MROA 5ITFB 4TUOA 5DR5L 2J7LA 5IHZB 1A1OB 1U92A 3FRPG 1YJDH 5DQ9A 2DQFA 4HKXA 4ZO9A 3B5TA 3NZHH 3VXMB 4EBQL 2DMCA 1CLZL 4JKMA 5DD1L 2EDXA 2AK4D 1O7VA 4P2QA 3VH8B 3RVTC 1SJVA 3GM8A 4OV6F 3UMTA 3DGCR 1G7MA 4APQA 3KS0J 1EO7A 4KJWD 4OF0A 2VC2H 1D5BA 1D5ZB 2P5WD 4PV8B 2IFGA 4PRPE 3U0TA 4PG2C 2ILLA 4LIQH 4QRRB 4XP5L 3VFUB 1A9EB 1CS6A 1SBSH 2HFTA 3SCMA 5BMFH 5GS0L 1BLNB 4JHAL 4JM2D 1QR1A 1QFPA 3C6LB 5IVXB 4Y4KC 2WBJC 1E28B 4ZUSB 5CLTA 4RWHA 1NC4A 1YC7A 4JQXC 2Q1EA 4OCYH 3WE6B 4TTDC 4KXZI 4UAOC 3MYJA 3RY6A 4OZGF 3WFHB 2AQ3A 1R5IB 3T09A 4I8DA 5T5FL 4RNRA 3GFUA 5GRJL 2IQAB 4MZ3A 2WUBL 3RWFA 5IW3A 2BVPB 2JK5A 3RZCC 1LEIB 3C9NB 1XFPA 4MA3B 1ZAGA 5D7IE 2Y25A 2G60L 5E08H 5INDB 3PWPD 1IGIL 5E99H 3PGDA 4EZMA 4DVRH 4LARH 1NAMA 1RFDH 4ZS6D 1SYSB 4PPTA 1NEZG 3B3IA 3PWLB 3UX9B 4LHUG 4LLUA 1F4WL 1W8OA 1UH2A 5D2LF 4Y19A 1ZV5A 3V7AG 2Z93B 1CICB 4R7DB 3MJ7A 3D3VA 4QRPD 3DX7B 3KPRA 1U8JA 1TJGL 2GCYA 4LLWB 3TV3H 3BW9B 2PCPB 3UZEA 1WVZA 2NY1B 2VABB 3L1OL 5BW7C 3LB6D 1UJ3B 3GB7B 5T1MA 4GAGH 4WDIB 2V7NB 4X80L 1B0GB 5GS1B 3G08B 1D5MB 3BHBA 1KB9K 5ESAB 4X7SL 1QFWM 3GIVA 1JNHA 3TH3T 4F3FB 3CFCL 5FGCE 4ZSOA 3CFEA 1YEDA 2MNUA 4XNQA 1JZ3A 3ARPA 1A7RH 3HB3C 5MP6L 4CVZB 1JFQL 4CBPA 4OB5L 3NAAH 3MGTB 1U3ZA 5F1NA 3RVVD 5IT2H 1CLCA 4GUPB 1H3UA 5B3JF 4G9FE 2ADJB 1CL7I 5E9DD 2IANB 35C8L 4NQCD 2NY3B 3FQNA 4NSKA 4HIEB 5KSBE 3F12A 1N5YH 4TRPH 2H9GB 4PJ9C 4FXGB 2R4SL 2RB8A 1CE1L 1ZS8A 4RZCB 5CMAA 4JHAH 2XKNB 2FGZA 1KNOA 1KIPA 2HMIC 5ACLA 1UZ8A 1FNGA 2BX5A 3FRUA 4EUPA 4IIQB 3G9VA 5FO7A 4UDUA 1VENA 1FNSL 2ZUSA 4YEEA 5T3XH 2UYLB 5I9QB 3V4UL 4D0BB 2XQBH 5ICXA 4L8DA 1QBMH 1GIGH 3MGOB 1Q38A 2WIIB 5E2TH 3WDJA 2P7TB 4JY5H 5BOPA 3BP5A 1FBIL 4PRHA 2FCBA 2OZ4L 3T0ED 1I7ZB 5C0GB 3LN4A 5I66A 1JNNL 3O0RL 1XGUB 1EHNA 2H2PD 5C07D 3EO1B 4JB9L 3RNQB 4YEFA 1NAKL 2CJUH 3GBNL 4Q9BA 4PS4H 2PYEE 4J3VA 3RUGE 2QSTA 4Q9QL 2J8HA 1R5WB 3O2WH 4LRNH 5C0AD 1GCFA 4M1GH 4FQLL 2JB5L 1IGIH 5KS9E 5C09B 4CRPA 5LKNA 1EXUA 3T2PA 2Z8RA 3VFNB 5BV7H 1X44A 5EO0A 4QOKE 4D3CL 2UWEA 4X5WB 5I16B 1F4WH 1R5VB 2EDDA 1RURH 1CR9L 1MJUL 1UH3A 2AJUL 5KBNC 4X99B 1WTLA 3NGBC 1U3YA 2A1WL 4LSRH 4WEUD 2FEEL 1WBYA 1EK3A 5KSAC 1P6AB 4Y4HD 3S3SA 4X4MA 4J1UA 1FL3B 5IEHA 1T6WA 2FX8H 2EYRB 1V3MA 4K07A 2AEIT 3P4MB 4PTTA 1MAKA 2FBJL 1KB9J 1HILA 2XOTA 5DDHB 5F9OH 1T83A 1SY6L 1BBDL 2MWCA 5I75C 4YZFE 1DVFB 1LO4L 3MRGA 3V5DA 3KXFE 3QDJB 2X4UB 4C55A 2I25N 4BH8B 4PRAB 3GSNL 1RI8A 2R4RL 3I50H 5FA4B 1MCOH 4WCYL 4YNYA 2A9NH 1ZT7A 2VKWA 4BZYA 2EO9A 3IB4A 2NZ9D 4G6AD 4NJ9L 2HFGH 4DEPC 3RNKB 5ITFA 3ULUH 3CXDH 3C08H 1P9MA 2B4CC 1A1OA 5CBAB 4I0CC 4I3GA 3HUJE 1GSMA 4OFYA 3VXMA 5D6DA 1BD2B 3KYKL 4YC2C 2J88H 5TE7L 1PZUB 2FO1A 1TVBA 5CJOL 1MCJA 3S35H 3PUCA 5EOCJ 3X3FH 2BVUA 2YA1A 1GRWA 4DVBB 5LWYH 1D5ZA 4PV8A 1I9RH 1P69B 3LPWA 3Q5OA 4N1CA 1AXTL 4QRRA 5GHWH 2I26N 1UCBL 3VFUA 1CE1H 1A9EA 4IBLT 3D39D 3BJLA 1BLNA 1LE9B 1QD0A 1UCTA 4HUMB 2ED7A 4JREB 1AGFB 5IVXA 2OJEB 1E28A 2BFVL 2IWGA 4ZUSA 3JTTB 4RFEB 3TH2T 3T3PE 5GJSH 1FNSH 4P46B 3DI2B 2WWKT 3WE6A 1FZOB 3Q3GB 4OGAD 3U4AA 3V4UH 1FL6B 4JRYB 1MCWW 2P1YA 3WFHA 3F7QA 4ZFGH 3CAFA 1R5IA 4XMLL 2XKUA 3LS5H 4AEFA 4ZTPL 3TNMB 4A6YB 2IQAA 1A02N 2OZ4H 3VXTB 4RBPH 1CI5A 2BVPA 5KTEH 4LLYA 2B2XL 4Q6IC 3C9NA 4K8RL 1EIBA 1ZVYA 4MA3A 1GL4B 3EYFB 3ZZ1A 4ZG1A 4CJ1A 3IDYB 1KLFA 4R96B 4ZTOH 3ES6B 2GSIB 5INDA 3QEQE 3MV7D 4OLUL 3FQRB 4Z7VF 4PBVC 1OT2A 3K2UL 5EH1A 1SYSA 3ZSTA 3PWLA 4U7KA 4NKQB 3HC0B 1KT2B 4HUKB 1G1CA 4KK8C 3PWJB 3L7EB 1YC8A 4L4TE 4M6MH 3ARYA 2ITDB 4M8VA 2Z93A 3MACL 1CICA 1RK0B 2A1WH 3QEHB 4KROC 4R7DA 1CXKA 3DX7A 3WFEL 1P4BH 5FYLL 2VLKE 4Z9KB 4LLWA 3BW9A 2PCPA 4AJ0A 5JIIA 2VABA 4UU9B 4IRZH 1F4HA 4OUUB 4JZOB 3GB7A 3ZKQD 4P2RB 4WDIA 1N26A 1QOKA 2V7NA 4ZAKB 3KJ6H 1B0GA 1WF5A 2DIJA 1D5MA 3G08A 3Q48A 5ESAA 5GS1A 3CXHK 2FBJH 1IZJA 1IC4L 2ITCB 2UUDK 5J13B 4JFFD 1ZLSH 1FPTL 2GYSA 4IRSD 5E5UB 4F3FA 5IFHH 4H0HB 3AGVA 4IDLA 4DKAA 4Z7QF 2J4WL 1FH5L 5AZ2H 5CEYB 1CDHA 5B38B 3MLWH 1KBGH 5EO9B 3ULVC 1X5HA 2IBZX 4CVZA 1EX0A 1WIPA 4JZJB 4E41B 2ZKHL 1AFVH 2IC2A 1GAFL 3MGTA 3OKLB 3ORJA 4JPVH 1VFUA 2DL2A 4YFLF 1L6ZA 3SE3C 4GUPA 2ADJA 4XT1C 3T08A 2IANA 2VLMD 4D9QE 4PTUB 2N7AA 4YXHH 5L9DL 4S0SD 4HIEA 5FUCE 5DTFB 3D2UB 1MRCH 1BFVL 4XNYL 4OUOA 2H9GA 1AKJD 1KEMH 4YDVB 4EI5B 5JDJA 1AXTH 1C8PA 4FXGA 4YX2H 1J8KA 4PRPB 4RZCA 2WANA 2XKNA 2CD0A 3E8UH 2ENYA 3CD4A 2IGFL 5ETUB 1AH1A 2IPUK 3UTZB 2JELH 4IIQA 5JMRA 4KI5D 4L8BB 1KFAH 5EIVA 1ZANL 4GO6B 2UYLA 3O6LH 1ZEAH 1MHCB 4UT9H 1XF2B 1QBBA 3X11B 3MRBB 4D0BA 5J0BA 1ADQL 1WICA 1WZ1L 3AS2A 4G80B 2MFNA 5EIQA 3AU1B 3MGOA 4ODTL 3TO4C 1MFBL 3QRGL 5DF0A 3P0GB 1WFTA 2CRYA 3Q2CA 3O4LE 2P7TA 2MCPL 25C8L 2AXJA 4EN3C 1I7ZA 3GI9H 5C0GA 3VGAB 4U1KB 2DQHL 4PLNC 1R24B 1XGUA 5DMJB 4HWUA 4L9DA 2JTDA 3EO1A 5SX5H 3RNQA 1I4FB 4LVOC 5C2UB 1R5WA 1KB5L 5C09A 4OLXH 2ZWLT 3Q0HA 1IFHL 5D7IB 4HJJH 4Y16C 1HNGA 3UBXI 1LK2B 3PE9A 1ZMYA 3VFNA 4DN4H 5C0FB 4W4NA 2ICEB 5I16A 4ZQKA 2I27N 1R5VA 5D93C 4X99A 3BN9C 5D7SL 4WNQB 4XBEL 5C3TA 2DQIL 3WFEH 4O4YL 2R29H 4IMKC 4MAYC 5FHAH 5FYLH 4NHCL 1FL3A 4DUXA 4KK9D 4OLZL 2EYRA 3PXJA 4YHZH 1BVKB 2NX5B 3P4MA 4LHJB 3BQUC 1T66D 3CXHJ 3EBAA 5DDHA 1IC4H 4F2MB 1OL0A 1FPTH 4ODVL 3ZTNL 4LCCB 5FO9B 5JOPD 3QDJA 2X4UA 4QWWC 1N8ZB 1NGPL 4BH8A 5FGCB 2P44B 4PRAA 5FA4A 2DQGL 2AK4E 4UTBL 5F7KC 4AYFA 3MA9L 5GS3A 1EVUA 3PJSB 3UDWA 4HIIB 3MNZB 2R8SH 3RNKA 5KZCD 2P5WE 1JMZA 1U91B 2D7TH 4PJXF 3HAEG 5CBAA 2LU4A 4HQQH 4S1SL 4LBEB 3W9EB 1BD2A 5L88L 1T0PB 4G9FB 5DHXB 3TPUB 1I85A 5C71A 1JTOA 2RCSH 4JFYB 4KK5C 2Y72A 3WKNA 4DVBA 4Y5XC 5KSBB 4KRPB 3QAZB 2A6IB 3TYFB 3ARRA 1LE9A 4YBLB 3G5ZB 1DP0A 2F58L 4M43H 4O2FB 4D0DB 2EC9T 3IFNL 3MLVH 2IGFH 1AGFA 2OJEA 4KMTL 4KMQA 4F7EB 2H26B 3JTTA 4RFEA 3L95B 1ZANH 2BRQA 4P46A 4HF5L 5C08D 1I1AB 5JQ6H 2BHZA 1FZOA 1EPFA 1FL6A 3BESR 3MJGX 4JRYA 2DM4A 5K59E 4L4JA 4PJ7F 4ESKA 4P3WA 4MQTB 5AWNH 4HJGB 4NZTH 2Q8AL 1LK3H 3HC3H 1YMMD 3PWPE 3WN5A 2XA3A 4NM4H 1RZKL 1L4IA 4P59H 4WU5B 2XXMB 3TNMA 4A6YA 5E95B 1S5IL 3VXTA 1NMCC 2DQHH 3HA0A 1F58H 4OLVL 3VRIB 4KRLB 4LDEB 3EYFA 4QRUB 5F88B 1MJ7H 1YY9C 4R96A 3ES6A 2GSIA 2ZCLL 1KB5H 4QRPE 3RUGB 2PYEB 2CIKB 3B2VL 2B5IC 3FQRA 1AO7D 1JIBA 4N0CD 4U2ZA 4QXWA 5KS9B 3HC0A 4PJGF 1KT2A 4X9IA 5F72S 1SMOA 3AMLA 2Y5EA 2NLJB 3IDUA 4G42B 4QOKB 4CGTA 3MTRA 3PWJA 3L7EA 4OAWA 5AYQA 4M48L 3ZDXF 4LLDB 1U95B 5T3XD 1IL1B 3QEHA 1RK0A 3D85B 3OXRB 4J3TA 5F7NC 1LE5B 1IEAB 1BAFH 3LKSB 43CAB 5TPWH 4UU9A 2CDGB 4OUUA 4JZOA 5I74B 4P2RA 3NA9L 4HMDA 4ZAKA 4W68A 3KHQA 3T77A 1QTYT 1OPGH 3AC0A 2ITCA 5MEQB 4ZFOL 3F65A 5KANI 5EZOH 5C7XH 1MCPL 5E9DE 5CEYA 5B38A 4NQCE 3KXFB 3O6ML 4WRLA 1YEGH 5EO9A 2QHRL 4I0KA 4KRMB 4JZJA 1KCRH 2DLTA 4E41A 2VXSH 3MLZH 3OKLA 2LVEA 2NXZB 4PB0L 1FNEB 1P4IH 1UG9A 3BUTA 3SDCD 3WJJC 3P3YA 2Z31B 1PVHA 4YIQB 3CFKB 4PTUA 4HGMA 5CGMA 3JV5A 5DUBB 1R3JB 1ZTXH 3EKCA 3HUJB 4HC1H 5DTFA 1UZ6E 3D2UA 4Y89A 4YHYC 1RUQL 5HHXL 4LMQE 4M03A 4EI5A 4YDVA 3BD3A 3P0VL 5E1HB 3SKMB 2F54E 3SGJC 3QIBB 4PRPA 1MCEA 3V8CA 3LEVH 1P5UA 5D1XC 5ETUA 3M17B 3VW3L 5HHNB 2APFA 3AMKA 3UTZA 1TTFA 3T0EE 4L8BA 4I48B 1OM3H 2AJZB 4YLQT 2BNRD 2XZZA 1OTTC 5H37H 1G7IB 1E4WH 1Z9SA 1MHCA 1I9JH 4GRLC 1XF2A 2VDNL 3X11A 3MRBA 4XPTL 3RJDA 3P2TA 4HBCL 4KVNL 4G80A 3RKDD 4PGCB 5F7MC 5C0AE 4X7CC 2KUTA 3UJTH 5C0EB 1RZKH 1ORSB 1CQYA 1L9MA 3QPQD 1S5IH 4NC1E 1IC7L 4U1KA 1FNFA 4GLRI 1R24A 4H5SB 1DBBL 5IBUB 3BI9X 4Q2ZB 5TDPB 1I4FA 3FT2B 1BVZA 2B0SL 1SVZA 2HTKD 4FFZL 4NOFA 2B1AL 3Q5TA 1KOAA 3TFKC 4MCZB 1FJ1B 3GBML 2UVEA 3FZUD 5D7IA 2QTEA 3OJ2C 2R0ZH 1CFVL 4UNTA 1LK2A 5HD8C 5C0FA 3THML 2ICEA 3QUXD 3QEQB 4NZDA 2B8OT 4WW2B 4JFZH 5IB2B 2BZDA 3GUTB 3J8F7 3AROA 3DPBA 4WNQA 3RVWC 2YK1H 1ROWA 4KV5F 2WQRA 4U6TA 5FEBA 5CD5D 3QUYC 4HUUB 3EO0B 2FNBA 5ITBH 4L4TB 1J0ZA 4JG1L 3NIDE 3MLXL 4JPWH 1A3QA 4C56D 3HI6L 1BOGB 3C2SA 1J0IA 3SDYL 1GHFL 2XN9D 5IW1B 1K8DB 4RGMB 2VLKB 1X5FA 5CIPB 2FX9H 1EHLL 2NX5A 3I2CH 4WEMB 1YEIL 4F2MA 2J6EH 4DFHA 5I19L 4LCCA 5I8KL 3BYTA 1ZWIB 4HZLB 5FO9A 1A6UL 1N8ZA 5IP4A 3C8HA 3BH9B 1CFSB 5BJTB 4NQUA 1KF9B 2YMXH 5GPRA 3ARGD 4TUKL 4I0PB 1I3RB 1G7HB 3I02B 4P9HC 3PJSA 1ERNA 4HIIA 3MNZA 4XPGH 4OV5B 1J1PH 3GJFK 1U91A 4JFPA 1Q72L 3D39E 5FYJD 4LBEA 3W9EA 3S88H 2AGJL 4EEEA 3B9DA 3KG5A 4G9FA 2AI0L 5DHVB 5HHVH 4JFYA 3WV0A 5L8JB 1MWAH 4G9DB 1U3HC 4TNVK 1FFNB 2X4PB 2X4QA 5KSBA 4ZOEA 5D72H 3L3DB 1L7IL 4XBGB 2A6IA 2VDKL 3TYFA 5D1QD 1U3JA 4G6ML 3PP4L 3W81A 1RK1B 3G5ZA 4O2FA 3TGXA 4D0DA 2NY6C 5EN2B 2NY4C 2OQJA 4GXVH 3QHZL 1UWGH 2DMBA 3U4EB 1RZ7L 2H26A 3RIFF 4F7EA 1AP2B 3L95A 5DFTA 1BECA 5SV4A 1I1AA 5MHSD 3G6AB 3M1BB 1BMGA 4Z0XA 1PLGH 2WINB 5FKPB 4ALAH 2FWOB 1P53A 1SM3L 4HJGA 2OJZL 2B4CH 5IKCB 4PR5A 5B22A 2IPKB 4WU5A 3DBXB 4JO1H 1YN7B 1P7QA 2A83B 4P57B 2YKLL 2VSCA 1F4AA 1G7LB 3O4LB 4YFDB 3OHXB 3VRIA 4QHUB 2JCCA 1IKNC 1DBBH 2VITB 1HIMH 4QRUA 3NCFB 4HLZH 2HVKB 5F88A 3RDTD 3L6FB 3KLAB 3SGKA 2V2WB 3RUGA 2O5XH 2PYEA 5F89B 1QBLH 2CIKA 1NJ9B 1RULH 1Q0XL 4JFDD 5KS9A 2NY2C 4LCUB 4G7YH 1NFKA 4PP2B 1VEPA 2XACC 2NLJA 4G42A 4QOKA 3EYOB 3BH8B 5MI0B 4PIRF 4AT6B 3WDHA 2H2SC 4LLDA 1NDGA 1U95A 1IL1A 3WIIL 5DUMH 2I60H 4Y4FC 3D85A 3BRDA 1MCHA 3OXRA 1LE5A 1IEAA 1NAML 3RPIB 3SDXE 2EKSB 4DTGH 3LKSA 2OR7A 4K8RC 43CAA 1XIWB 2CDGA 2NY0B 3LS4L 5HY9B 1PSKH 4ZO7A 2VAAB 1H3PL 4XWGL 5MEQA 4M1CC 5I19H 5DK2B 1OAZL 3U9PH 2BCKB 3BGMB 4XXCC 2VLME 4BKLB 3KXFA 1RSFA 3VRLE 4XVUC 2DDQL 4L8SB 1KCUH 1D6VH 4OCRH 5DD6A 3OKEB 3T4YB 5C8JB 2FHCA 4S1RH 2E7LC 2XXCB 1FNEA 3TNNB 4U05A 1IQWL 2Z31A 1EAPB 4KHTL 2P5WB 5F9WC 3BD5A 4YIQA 1G1YA 4HS8L 3ARED 4X8JB 1ZSDB 3CFKA 1IMHC 2EDHA 3C2AL 1QYGL 5DUBA 4Z7WF 4JM2B 5ID1B 4KI5E 2VAJA 3GHEH 5K9QG 3MOAL 2C5DC 5JHLL 3SKMA 2VDKH 4ONFL 3QIBA 4RFNB 3X17A 4G6MH 3PP4H 5SWSD 4PUBH 3DUSB 4WI6A 2W9EL 3DGGA 2YR3A 5GGVY 3WO4C 4LPCA 4B41A 5TJWK 3M17A 5HHNA 3NFSL 2WUCL 3B2UD 1R3IL 1QFWL 4I3SL 4I48A 2AJZA 4M62H 3ULVH 4DW2L 3TWCL 2VZSA 3MRCB 1G7IA 5DJAB 5FUZH 4F8QA 3BN3B 1FDLL 5HVFB 1JZ2A 3VXPB 3SE8L 4XCNB 4M6OL 5FYKU 4OFKA 4LIQE 4PGCA 3J7HA 3ZHLA 5C0EA 2QR0B 4HAGA 3MMEB 1ORSA 1DQDL 3OKDA 4R90L 4O58H 3PWPB 3RGHA 2FD6L 4ZOAA 1OP5K 4NQED 4FQJH 1U8LB 4MWFB 4L3CA 4H5SA 3E2HC 1YN6B 5L6YL 2MHAB 3OPZH 4Q2ZA 4IOFD 2EO1A 1BQUA 5KJRL 3FT2A 4KI1A 1FAIH 1XH3B 2BOBB 5D8JL 3ILQD 3DYMA 1FJ1A 3L7FB 3OAZH 2VDRL 4MCZA 4WFHE 4PJ8C 2D7NA 2HVJA 4GRMB 3HFMH 3ZKNC 4N1EA 3CCHB 3QEQA 4OGYH 1KCVL 4QRPB 4PGEB 1NKRA 4WW2A 2GITB 3QDGD 1DZBA 1NQBA 5IB2A 1EO5A 3AXLB 5F8QC 3GUTA 2AW2A 5KW9H 2ZCHL 1JHLL 4HUUA 3EO0A 5JOPE 4L4TA 1MFDL 4M4RA 4C59B 1J5OH 1A3LH 1BOGA 1UACL 2HA1A 4NUGL 5IW1A 1K8DA 3TT1L 1VFMA 2VLKA 2W60B 3QNZB 5CIPA 3O3AB 4KJYB 4HHAB 3CDGA 1FVCB 5F1KC 4PJ5D 3ZE2E 3VXUE 5JW4Q 1JGUH 2W0KA 4KAQL 3RVTD 1JYXA 1V3JA 3I6LD 4HZLA 1ZWIA 4XPAL 1OAZH 3IFPA 5EU7C 1TZIB 4NNYB 5EOCL 3BH9A 1CFSA 5BJTA 4Z7OE 1YUHB 4YK4B 4XAWH 2FECI 2DDQH 1U2CA 2VKXA 3BJ91 4I0PA 1I3RA 1X5XA 4XVSL 5E9DB 4TSBL 5M94B 1G7HA 3I02A 4NQCB 1AXIB 4U3HA 2MQCA 5DHYB 4Y4KD 2WBJD 2A73B 2KBGA 3QNYB 3QQ4B 1TJIH 2X1QA 4J12A 2VNCA 2DD8L 4TTDD 2XY2A 4N8VB 1GGBL 3OKKB 3S36X 1VADB 5DHVA 4HGWB 5I1KH 2DM3A 1WCBB 4G9DA 3V9FA 1FFNA 2X4PA 5C08E 1OTUC 5IB1B 5FECB 2OTUB 4ZUVB 4NKDB 3RZCD 1F3DH 5CILL 2JE8A 1RK1A 4KWUA 2NNAB 3D87B 3LRHA 3WJLC 5L2KE 2F54B 1YMME 4NQXB 5EN2A 5GZNC 4CMHC 1U2HA 2C4XA 4L9LB 3U4EA 1QFWH 3FONB 1AP2A 3UAJC 3E6FB 4E9LA 4BYHA 1ULVA 1OW0C 5F6HI 3T0EB 3M1BA 4KGJA 2WINA 4O5LL 5FKPA 2FWOA 4PJEF 4K3DH 4LU5H 1N64H 3G6JE 1YEEL 3GHBH 5IKCA 5DJDB 1EA9C 1JYNA 1S9YB 1FLTX 1T2QH 2IPKA 3DBXA 5CP3A 5C0JA 1YN7A 1AO7E 2A83A 5C0AB 2AV1B 3RIAK 4P57A 2FD6H 2YBRB 1P4LB 4WI3A 1Z9MA 1G7LA 1CL7L 3OHXA 4V2BA 2VITA 2UWEF 4JKLA 4Z77B 3BOVA 5T3XE 2WWMC 5JIPA 3L6FA 4IEFB 4I2XE 3KLAA 4LAJH 2V2WA 2YD6A 5F89A 1NJ9A 2W0PA 4P3CH 5J1SC 2OSLB 1C5DB 1KCVH 4LCUA 3WFCH 5EOQL 3HE6B 4Y4HB 4PP2A 2OYPA 3WNMA 1L0QA 5CZXC 4OFDA 3EYOA 3BH8A 5I71C 3HB3D 3T2NL 1IQDB 3EDEA 5GJTL 4AT6A 4LKCB 4RGOL 2PTTB 3IS0X 4HXAL 1A6VH 2Y7QB 2HYMA 5L0QB 1FC1A 3RPIA 2EKSA 3G6DH 5HDQH 3VD9A 3BPLC 1XIWA 4KXZH 4NM8L 4PG9B 3EYUL 1CT8B 4HD9A 4LOUC 5FOBB 5HY9A 4JEGB 1TENA 4YWGH 2VAAA 2FX7L 3A6OA 1BWWA 1WIUA 2AEWA 3TCLB 2V17L 5DK2A 3IDIA 1E4JA 4OF3A 1N0XH 2BCKA 3BGMA 4PJ9D 1B2WL 1X6LA 3BIKB 4BKLA 1BJ1H 2ADGB 5GS2D 4UTAL 4TOYH 4L8SA 4W6YB 4XVSH 2BSED 2QHLA 4ZNEE 5C8JA 4BQCA 2HMID 3GKZA 1MCKA 4MMZC 4HFUL 4N1HB 2DLEA 2YC1B 3QDMD 1EJ6A 4XPFL 3TNNA 4KKCC 1EAJA 3SO5A 4K7FB 1EAPA 5IJKC 2P5WA 1U36A 2V7HB 4X8JA 1ZSDA 5F9DC 1WT5C 1UEMA 1GGBH 4JFXB 3VD5A 3D39B 1HI6B 1KIQB 4JM2A 5ID1A 1DLHB 1A7NH 1P84K 1CXHA 1BZ7B 2NY5C 5IVXF 2BNRE 5F1OB 4NRYB 4NRXB 3D6GA 1CD8A 5HYSB 3ARXA 3PDGA 1VEOA 2X9XA 3MLSH 1QUNA 3WFDH 4YHML 3S35X 3MRMB 3ULUE 3KHOA 3DUSA 3EFFA 4OQTA 2VWEE 5J12B 4MJ6B 5JW4M 2C7UB 2DLHA 4DGYL 3MRCA 3D5OF 1GJIA 1XR8B 4H88H 4YDKL 3DIFB 5TFSH 3N06B 3VXPA 4R0LB 4XCNA 2VDOH 4JJ5B 1AE6H 2HT4C 2QR0A 2NXYC 2V2XB 3MMEA 1U9KA 5ADOL 1DUZB 3PWPA 1F4XL 3EJZC 1CXEA 1W72B 1U8LA 4MWFA 1YN6A 3EYQC 4HUWB 2MHAA 4MZ2A 3RX7A 1UB6B 2PTUA 1HYRC 4IM8A 1BQHB 1XH3A 2BOBA 1JZ8A 1MJ8L 1P7KB 3L7FA 4Z76B 4U1LB 2BXYA 4C56E 1OAYH 4GRMA 2VXVL 4TVPL 5E5MA 3CCHA 4QRPA 1XT5A 3A67L 1B88A 2VDQH 4PJFB 4PGEA 2XN9E 2GITA 1GGIH 1BJ8A 3QIUC 3L5JA 1IGML 3AXLA 5L8KB 1E4KA 4H1LG 4PJAE 2CUMA 3QUMH 2RIKA 4KQ3L 1GXEA 3ZYZA 3IRZA 1KJ2H 4XHJC 2WQ8A 4CJ0A 4IRSB 2XA8H 1TTUA 1R3HB 3NCJH 3SDXB 3QNZA 2W60A 3LD8B 4HHAA 4KJYA 1FVCA 5K9KB 2BXZA 4N0YL 2VN4A 1IM9D 4Q7DA 5ID0B 1K6QH 3WNLA 5KVDH 4PD4J 1Y0LB 1HKLL 1TZIA 1S5HB 4NNYA 2YPVH 4IS6B 1A6PA 2PTVA 4JGUA 1YUHA 1EGJH 1UM5L 4M7LH 1DLFL 4MHHG 5E9DA 2IPTL 3LRGA 2X4OA 4NQCA 5I2IB 5F3BB 5E00B 1EBPA 1OHQA 5I1CH 4HFUH 2A73A 3QNYA 3CK0L 2VUYA 4K7PL 1QO3B 3VI3F 1L7TL 5I30L 1AKJB 2VL4A 2VLJD 4N8VA 3DURB 4F7PB 2DYPB 3OKKA 1VADA 1ZGLP 3TJHC 4P9ML 1CU4L 3B9KA 3FN0H 4FP8L 3QXUA 4HGWA 4ISVB 4KY1H 4OIAA 5D5ME 1JWMA 3NIFF 1UVQB 2CKBB 1A7OL 1WCBA 2HKFH 1OARL 3QRFM 3FT3B 2A38A 2R69H 2B39A 5MHSE 2M2DA 4JG0L 5IB1A 1S3KH 5A2JH 2OTUA 4ZUVA 4CNIA 2V5RA 4NKDA 5FECA 3UPRB 3H2WA 2NNAA 3HI5L 2YD5A 2F54A 4I18B 4NQXA 4NKIL 4AQ1B 4QGYA 4L9LA 4ODSL 3FONA 3E6FA 1TCMA 4H8WC 4G8EB 3T0EA 4P9HH 3OF6D 5E2WL 2QQKL 3FO1B 4K3JH 4KK8D 2W0FB 3FFCD 3AS0A 3STZB 3Q6GL 5KVFH 4JANA 1S9YA 1C5BH 3MX0A 5JORA 4KROD 5LBSL 1HHHB 5C0AA 2AV1A 1ZLWH 4JFDE 1F4XH 3A6CL 3CX5J 4RWYL 3RGVC 1P4LA 2W59A 1FG2B 4TULH 5I1GH 5J8OA 4KDTC 5T1LB 1M7IB 3L5XH 5D7LD 3S3JA 1JF1B 4MXWL 3SBWA 1INEL 4X4ZA 1HHIB 4A6YL 2X09A 1DFBL 2OSLA 2VXVH 1C5DA 3BT2H 3A67H 3HE6A 4Y4HA 4MA1B 4LQFL 2V9QA 5F9AC 1IQDA 2CGRH 3ULVD 4LKCA 3S34H 4EDXB 3VFVB 1MIEH 2PTTA 3MBXH 3MXWH 2C3GA 3BZDA 2Y7QA 4KQ3H 3CVIL 5EC1B 2FLRT 1CT8A 3RY6C 5FOBA 4DGIH 3ILPB 3C09C 3OMZA 1RJZB 1VB9A 4N0YH 3VXUB 5C2BH 3TCLA 1VFAB 1CWVA 5CUSL 1IGJB 3NFNB 3QZWB 4N9OB 3BIKA 2ADGA 4UB0H 1OQOA 1X7QB 3C87A 3KNBB 1YYLH 2AJVH 3JTSA 4YAQB 3U30C 2YC1A 5FUOH 3NACL 4K7FA 3NMEA 4M61B 4RQQB 4ZO6A 3JWOC 4L1DA 2V7HA 4P23B 5SWSE 1T89A 3FN9A 4BA8A 3CSBA 4JFXA 5DMGC 2Z0BA 1HI6A 1KIQA 4FP8H 1TZGH 3HPJB 1DLHA 3TO4D 1N5AB 4J7RA 1BZ7A 1C1EH 4NRYA 4NRXA 4EN3D 5HYSA 3WD5L 4JG0H 3B43A 4OQ1A 5EBWB 1DUYB 1LO3H 3MRMA 5D71L 5C08B 5TF1H 3BKCL 1TJHH 5I1HH 3TYGH 3RWEB 1LO0H 1RUPH 3AVEA 4MJ6A 5GRVK 3UYOD 1TMCB 5L2KB 1RUKL 1YMMB 2C7UA 2VH5L 4Y16D 4F80A 4NQEE 2CO6B 3U4BL 1KJ3L 4G7VL 2E8YA 1XR8A 5HYJD 3IAQA 2EH7H 1QKZL 3DIFA 4R0LA 2BY3A 4X7DC 2NY7L 3FB5B 4JJ5A 5BCAA 3HRZB 3BN9D 5E1AB 3QJFB 4JVUA 3L3GB 4XVTL 1YNTB 2V2XA 1PW3A 3G6JB 1D5IH 3MLYH 1H5BC 2J8OA 1FC2D 1QHPA 4IJ3C 1W72A 4MAYD 1ACYH 3QDGE 1AO7B 4FQHB 4L5FH 3SOBL 4P2CG 4XP9H 4HUWA 2X4TB 1EVTC 3P73B 1UB6A 3B8SA 3INUL 4NRZB 3ZYJA 2D4FA 1KLUB 1WLHA 1BQHA 2JJUA 3BQUD 2R0LH 15C8L 1P7KA 4Z76A 5DK0B 4U1LA 5B39B 2HRLA 4I2XB 1CDUA 2VQTA 1CQKA 3BE1L 3K74B 4PJFA 3ZTJH 4QWWD 4MQ7B 1A4KB 5IMOB 2KQNA 1VFBB 4DK3A 3V2AR 4LQFH 4PJ5E 1KULA 5E6IB 4YHLL 3H8NA 1QACA 1U8PB 2Y36L 4W4OA 5ANME 3BEVB 2D7QA 1SMAA 3I6LE 1DSFL 5CHNB 1UWEL 1BGXL 4JGJA 4IRSA 1OP3H 1G6RH 3WSQL 2ICWB 2PR4L 5HSFA 1YNKH 1R3HA 1X5YA 3SDXA 3MLRL 4CDHA 4G6JH 3WHE1 5K9KA 1MEXL 3KDMB 1KELL 5BV7B 1LP9E 3F6LA 2LU3A 4KK5D 5ID0A 3BDXA 1SJHB 4ODWB 2XICA 1Y0LA 4FQIL 2PNDA 1S5HA 4IS6A 3VG0H 3SDCB 2P46B 3ZL4H 3W82A 4WU7B 2MMXA 5I2IA 5F3BA 4MJID 5C9KA 2V9TA 5ILTH 4UV7L 1AIFB 1HOCB 2ZSVB 1E0OB 1GC1C 3QCTH 3RI5F 5HPOA 1QO3A 2QL1A 1AKJA 12E8L 1QPXA 3MCKB 3DURA 2DYPA 4A2LA 4U6HB 1BHGA 3MBEC 4YHIB 1RU9L 4ISVA 4QCIB 5C70A 3BO8B 2HRPH 3QG7L 1UVQA 2CKBA 5F8RC 4X5LA 1HZHH 3FT3A 3WXVL 3UPRA 1MREL 2BNRB 5EWIH 1SQ2N 3L5HA 4I77L 3FTGB 4NIKB 4JHWH 1YNLH 4I18A 5EZLB 1T83C 1YY9D 1MF2H 4OCXH 1F4YH 7FABH 3U7WL 3P77B 4FOMA 4G8EA 2EE9A 3U4BH 3K7UA 4U33A 1QKZH 5KAQG 5T33H 3M07A 2XG4A 3FO1A 2W0FA 3LQAL 3AB0B 1FGVL 5GISL 3STZA 3EOYG 1VACB 2VOTA 2M26A 3MYZA 4R97B 5AYUL 2L4OA 5D7IF 1TTGA 1FG2A 1FORH 3SOBH 5T1LA 2APXA 5E4EB 1JF1A 3ESUF 3EO9L 3EYVA 3MUJA 2W0LA 2QSQA 1QSED 3VXOB 3VCLB 1HHIA 4MNQB 3ZDZE 4NGHL 4G3YL 3IXTB 5GGTH 5ADPL 3MRDB 4M1DL 4HKBB 1VESA 2WAHA 5CKAA 2XN9B 2UVFA 4EDXA 3VFVA 1ZA6B 1DBAH 4EQ3A 3O2DL 5E2VL 5EC1A 5DJ6B 1A5FH 1UWEH 4PJAB 1BZQK 4Y5YA 5FOJA 1T7XA 4ZODA 4RMSA 1IGTB 5TE6H 1H3VA 3KPPB 1A4JA 5HVHB 3ILPA 3ARGB 3RWCB 2LE9A 1RJZA 3BP4B 2R23B 3QDME 4ZYKB 4LRIA 3VXUA 1VFAA 3HMWH 4TPRL 4YDJB 4KPHL 3NFNA 1RZJH 3QZWA 1BZ9B 5DQJB 5FF6B 4ZXBC 1A6WL 1X7QA 3KNBA 3F7PC 5D1XD 3QEUB 3NVQA 1QP1A 2GSGB 4YAQA 4KZDL 4KQ4H 3NABH 3Q1SH 4AM0B 2NQCA 4POUB 4OF6A 4M61A 4RQQA 1OTTD 5IBTL 5KSBF 4P23A 4HMEA 4GRLD 4XC1H 2VE6B 4OD1L 5D1QB 2ZUQB 1CICC 3EYSH 1RU9H 2APVA 3HPJA 3MA7B 3EHBC 4KHXH 1N5AA 1TPXB 5D5MB 3X3GH 2NY1C 2Y06H 3V0WL 4OCLC 4F57H 5EBWA 4HW6A 5JA9A 1DUYA 2PXYC 4KK6C 5C08A 2HT2C 1HE7A 3WFBH 3H42L 4I77H 5GS1C 3V5KB 3G04B 5GRUH 4R4FL 5I8OL 3RWEA 4P2YA 2P48B 4GXUN 1IKFL 2QBWA 5L2KA 3TFKD 1YMMA 2CMRH 5TF0A 2AJYH 4M7ZB 4X7TA 1E6OH 5IW6A 1CLYH 3FQUB 5HD8D 2FB4L 4AEEA 3U48A 1IRAY 1NC2D 3QCVH 4MLIA 4FFYH 4OCMC 4NQSB 1A9BB 3QXAA 4DZ8B 3FB5A 3QFJD 3HRZA 3MR9B 1VPOL 5E1AA 3QJFA 4LP5A 3NPSB 1FSKB 5FXCH 2VL5B 3L3GA 4J4PC 4XX1E 1YNTA 4M5YH 3RVWD 4MDIB 3G6JA 4R3SB 4K9EL 3AUVA 4PRIE 2UV3A 5K93A 4UILH 3RUGF 1QRND 2Z4QB 3TA3D 1AO7A 4FQHA 1JF6A 3I6KB 4JFDB 4MAUH 2X4TA 5KS9F 4M3KB 2YOCA 3P73A 1MRFH 4XNXL 4NRZA 2FHFA 2BNUB 5FYKH 2B7DT 1KLUA 4G8GD 3VFWB 1V3LA 5TQ0H 1BQLL 5DK0A 4F7MB 5EIIB 5B39A 4I2XA 5EB9A 3ARDB 3PF2A 4MQ7A 5IMOA 3SO3B 1VFBA 4UI2A 1D7FA 3DXAD 5E6IA 1E27B 1U8PA 1N0LA 3BEVA 4O9HL 5GSVB 1VKXB 3G5XB 3O2DH 5CHNA 5DUPH 1WFUA 5BO1L 1BX2B 1ZHBB 1JCKA 2HT3C 2ICWA 6FABL 1FIGL 2ICCA 4M7KL 2VLRD 4YZFF 4NZRH 2VMFA 2IAMB 2ZP0T 3KDMA 1DQMH 1EO8H 1NCAH 2AK1L 2G5RA 3PDOB 3QISA 3VFGL 2OP4H 1U3HD 1SJHA 3QUZA 4GLRH 4ODWA 4KPHH 2XG5A 3P4LA 2CK2A 3QZWG 2VLJE 4JKPL 3S37H 2JJTC 1K2DB 1V7NL 1MUJB 2E8ZA 3AREB 2AJXL 4WU7A 4W70A 2NY6D 2NY4D 3STLB 5I6XB 3IXAB 1FO0H 3HUJF 3DV4B 4ZNEA 4WWKC 1AIFA 1HOCA 2ZSVA 3JVGC 4Y1AD 2D7PA 4HZAA 3T0WA 3MCKA 5E5RB 4HUVB 2NR6C 4U6HA 3OB0H 5C0CE 2HLAA 1IGFL 4YHIA 3G5VB 4QCIA 3BO8A 2ICWJ 1S7WB 1Q1JL 3V0WH 4LSUH 4M5ZL 2BNRA 2FGWL 1XCQB 5IM7B 3PGCB 3H42H 3FTGA 3FFCE 3T3PF 5EZLA 3MOBH 3BAEH 3K1DA 3EOTL 2JJSA 2VZUA 1YEKL 3P77A 1RIHH 4JO3H 1K85A 2FB4H 2NY2D 2N4IA 1MNUH 4NQEB 5E2UH 2VDMH 1D6EB 3LV3B 3P30H 3U0WL 2V5SA 4M93B 3UDWC 1H8NA 2H2SD 1MSPA 2EH8L 2DICA 1VACA 2IBZY 3DARA 3V4PL 1L0XA 1A3RH 4Y4FD 4MNHB 5GGSY 1BFOB 4K8RD 5E6ZA 1FYTD 2FDBP 5F96L 2ED9A 1QR4A 5C0BB 3QDGB 1I85C 4WW2F 3ULVE 5LQBL 5C3LD 1IJ9A 5E8EA 2XY1A 3FOLB 1P7HL 1F6AB 4KGLA 2VIRB 3KS0H 4HJ0C 1G9NC 3VCLA 3VXOA 5AAMA 1GH7A 4M1CD 4MNQA 2DI7A 5B39G 5EORH 1HINL 3FB7A 3KYNB 5F70A 3MRDA 1UYWL 3MREB 4HKBA 3JV6B 2XZAH 3LN5B 4XVUD 2KL6A 2XN9A 4JREC 3W0WB 1Q0YH 1ZLVK 2OZ4A 5TH2B 4NQVB 4PJ5B 1O0VA 1XCTB 5K9JL 5DJ6A 4PJAA 5ANMB 3F58H 2YPKB 1Z0NA 2Q8BL 3C5JB 1JGDB 4QNPE 1UA6L 1IGTA 3O45B 4OFIA 3KPPA 3DI3B 3SKJL 4YQXL 4WFED 3WN5C 3ARGA 3ZKMC 3RWCA 3OZ9H 2HKHH 3BP4A 2R23A 4ZYKA 4J3OC 1ZGLB 4FABH 4NWTH 1XF4B 1LP9B 2WBJB 4Y4KB 4YDJA 1Q94B 4J3UA 4KU1A 1BZ9A 5CZVL 5DQJA 1NL0H 1UKTA 5FF6A 3G9AB 5DC9B 1MQ8A 3CZJA 4N5EC 2ZZUT 3JBG7 2HWZL 4UAOB 5F6IB 3QEUA 3LZFL 1WWWX 2H8PB 4R26H 4IRJB 2ATPB 4AM0A 3DWTA 1AC0A 2V9RA 2H45A 1YPZE 1NMAH 4DKEH 2VE6A 5IR1B 4DK6A 2BHYA 5D1QA 2GQHA 5IMKB 3CUPB 5F7FA 4WJ5B 5C0RH 4HWEL 3MA7A 3LQZB 4FQ1L 5I1IH 1HYSC 2DQTH 2DQUH 5E8DL 5D5MA 4LFHD 2AEPL 3MJ6A 5HYJE 4M5ZH 1I3VA 1NBYB 4TVSa 3V5KA 3G04A 3A6BL 3KPQB 1CDIA 5J13C 1IT9H 1NCCH 2XT1B 1FE8L 2Q3ZA 4PJ8D 3P11L 3FQUA 1JHKL 1QEWB 3ZKND 3DO3A 4MQXC 3WHXB 5D70L 3IVKB 2FECL 4NQSA 1A9BA 4HK3N 2X10A 4DZ8A 1EEYB 4UOW0 3C5SB 3MR9A 4OQTL 5TDNB 4M3JA 4MDIA 3SDDC 3V0VB 3SJVD 3JWOH 4R3SA 3QULB 1EJOL 1GGCL 2C4FT 2Z4QA 2VR9A 4I9WD 2C3VB 3I6KA 4NO5A 5DEZA 2BNUA 1MHHB 3VFWA 5JPNB 5IROA 1OGAD 2R1WB 4OD2B 2DTSA 5E4IA 3NFPB 5DT1H 5IQ7L 5DMIH 4F7MA 5EIIA 3MRRB 3ARDA 3K1KC 4FTVD 5TQ2H 3VGDA 4L4VE 4U1GC 1ZHNB 3JWNC 2F74B 5FHBL 3S4SG 2DB8A 2MOVA 5GSVA 2OTWA 1VKXA 4NO2B 3G5XA 5GGVH 1OP3K 3QR2A 1QSFD 5C6WH 1BX2A 1ZHBA 4C4KO 3R1GL 3HR6A 1OCWL 5FM4A 3TLRA 4JFQB 4PJ9B 1CGSL 1CTNA 4WI2A 2IAMA 3CLEL 2KQMA 4MJIE 4ZPTB 3NH7L 4JO2L 3HCVB 4WTZA 1AR2A 1WWAX 3ALXA 3PDOA 1CGYA 3IFLH 4NN7C 3VGAC 3WKMH 5MEOB 5CINL 3QDMB 1OTUD 4U1NB 1QSVA 3L3HB 8CGTA 1J1OH 1FAKT 1K2DA 5IOPB 3OQ3B 1MUJA 3AREA 4QO1A 5DS8B 3LMJL 2HWZH 3JWDL 4XNUH 5GZND 1AJ7L 3DSFL 3STLA 3DECA 3IXAA 5DVNA 3DV4A 3C5ZB 4JM2F 4OIIH 3UAJD 2CLRB 2BJML 3D0VB 4Q9RL 4Z7NE 3EAKA 3PIQB 4R8WL 4HUVA 1J7VR 3GSQB 3C8KB 5FO8B 1YQVH 3ULSB 3G5VA 1LEGB 3KLHC 2GJ6A 1VERA 4JM4L 3RVUC 5IMLB 1S7WA 3LEXB 1W0YT 1T1WB 2EECA 5GGQL 1XCQA 4DOHE 5C0NC 3DVIA 2HAZA 2BDNH 2FBOJ 2Y07H 3PGCA 3V6OC 5IM7A 3O6FB 3A6BH 1J0KA 2WWMD 3DVNB 2KDGA 5TGBB 1JPST 4JPKH 5IFAH 3NGBB 4LCCC 5K59F 3R8BB 3WLWD 2DOCA 2DTML 2VJXA 4OFVA 1JHKH 1HSAB 4U6XB 1U0QA 3T65B 1F3RB 4ZD3H 4NQEA 2CSPA 1D6EA 3LV3A 1MWAB 4ORGB 5GQBA 3GBLA 2MQ0A 2YRLA 1PY9A 5KVEL 1GC1H 3CSGA 5DJ8B 1RV6X 1LQSR 1JYWA 4MNHA 1JPSL 1PX4A 4YR6B 1BFOA 4PRIB 1OSZB 1TIUA 5I75B 3U7YL 3M45A 4UUJB 4LOUD 1CIUA 5C0BA 3QDGA 1U8IB 5J11C 1X5GA 2EDOA 4DJMA 2ID5A 3FOLA 1ZGLM 1F6AA 1TFHA 3NA4A 4UT6L 1QG3A 3SE9L 3IU4L 1UKSA 1X5KA 4KRPC 1C12B 4DEPB 4JAMB 3QAZC 3KYNA 4EOWH 4QRTB 5FV1L 1Y6NR 3MREA 3JV6A 3LEYL 3LN5A 2OMBA 4ZS7L 3W0WA 1RJCA 4NQVA 3P4NB 4PJ5A 4YC2B 1XCTA 3FQWB 1DQQB 3X14B 2VXQH 4JR9H 5ANMA 2YPKA 1IM9B 4KKCD 3F8UB 5LCVH 4Y2OA 3C5JA 1NCDH 1JGDA 3BDYH 3N1PC 4FA8A 3O45A 4IDJL 4PG2A 3K80A 1KB5A 1CGSH 4U7MA 4XMKH 3S6CA 1JZ7A 1A1NB 1ZGLA 1I8MB 1J1XL 4G8FB 4WTZG 4OZIE 1J0HA 1GGYA 1XF4A 3O2VH 5FYKD 1LP9A 2WBJA 4G5ZH 4TYUA 4Y4KA 4KTDL 1Q94A 5CINH 1YEFH 3R0NA 1ZT1B 4MA8L 2HJFB 2YUVA 3MZTA 1T5WB 4KTEL 3HPLB 3VFSA 4PRNB 1J0YA 1PG7H 2VLJB 5CJXC 1FN4B 3SGKC 1Z6JT 4K94C 2H8PA 4IRJA 1F6FB 2DBJA 2ATPA 5EO1B 3VGBA 3BZEA 2YZ1A 5J06A 3GNML 4YHPB 2DF3A 4M6NL 1X4YA 4OCSH 1CVRA 1UZ6F 2FATH 4R8WH 4WY7L 1V8HA 4LCIH 5IR1A 5J1TC 3E1F1 4Q6IB 5HI3C 3GI8L 4OLYH 1T7VA 3CUPA 4MNGB 4WJ5A 4LASH 1S9WA 2DQJH 2HT4D 4OZFG 1JTPA 4AEIL 2NXYD 3LQZA 4XH2B 1ZKAA 5C0CB 3IDXH 4MD5B 4LCYB 4RMQA 1EH9A 3EJZD 1W8NA 3TVMC 1I9EA 5I74C 1NBYA 1AD0A 2BY2A 3EYQD 1WIOA 3QFJE 5DQDL 3KPQA 2E7HA 5IHUH 1QBAA 5EBGA 4L8CB 4NO0D 1NBZA 4J2XA 1QRNE 2DBLH 2UY7A 1QEWA 5SX4I 1OF2B 4QHMA 3ABZA 2R0KL 1DJSA 4HC1A 3QIUD 3IVKA 4IMLB 4YHOL 4X98B 1EEYA 5CSGA 5BW7A 4G8GE 5TDNA 4OKVA 2KZ1B 2R56H 4ERSH 3MNWB 3V0VA 4LPYA 3QULA 6CGTA 1I75A 3O6KL 1B0RB 4XHJD 4JDTL 2VXUH 2X4RB 5FCUL 4X6BA 5HHPB 3VI4E 2C3VA 4ZUUB 4XNZC 3ARSA 2VUOA 3DXAE 3HZMB 3BDBA 3PL6C 5FM5O 3RQ3A 4OF8A 1MHHA 5JPNA 4FMKA 2R1WA 4OD2A 1E4XI 3NFPA 5B4MC 4UT6H 4GKZB 1F90H 3MRRA 1TDQA 1W72L 3UPCA 3V8OA 5M95B 1ZHNA 4P5MB 3T2QA 2VLRE 3GRWH 4KJPC 3NIDF 5T3ZH 1AI1L 2F74A 4QTIL 4JKWA 4UIMB 1WFOA 4NO2A 4WTWA 1JPTL 1MH5B 3DJ9A 2XNAB 1WEJL 1V7MH 1F5WA 1CVSC 3UZVB 2PKDA 3UJIL 5DI8B 5BVJB 5HHQB 1HH6B 4JFQA 1OD9A 4IDJH 4PJ9A 2VN7A 4JN1H 4KKLC 4AG4L 2D03H 1DQLH 3HAEH 3W11C 3TJHD 3RX8A 4HWBH 3RY4A 4X9HA 1T7ZA 3HCVA 1IGCL 4D9LL 4Y1AE 1RUAL 5MEOA 3QDMA 3VXSD 4U1NA 1JL8A 3HNSH 5E8OB 3LHPH 3VDBA 4XVJH 1T0NB 5IOPA 1ZXQA 1AGCB 1NGQL 3WNKA 5DS8A 2E6PA 4OIBA 4HUNB 1QRKA 4X6DE 3FAXA 3LIZH 1LO2L 3C5ZA 3TO4B 1S9VB 3UC0H 2CLRA 5A3IC 4RX4D 3T2OA 3D0VA 1JGEB 4WHYG 3PIQA 3TT3L 3GSQA 2J6EA 3C8KA 5FO8A 3RA7H 1KYOJ 3ULSA 2ZUVA 5FDWB 3IDNB 1QNZH 1YPZB 3I75B 4K23H 2OBGA 2A9MH 2CK0L 4LCWD 1LEGA 4LVOB 1JPGB 4K7PX 1CF8L 1IEBB 3RIFK 5IMLA 3UO1H 4OZ4B 3LEXA 3HC4H 3RGVD 4Y16B 4RDQF 1EEZB 4FQQB 7CGTA 3O6FA 4XP1L 5HYJB 2K1MA 4LAQL 1BIIB 4LLMB 4P2QD 1IAMA 3DVNA 5TGBA 4KUZH 1EFQA 2UUDH 3ARBB 3ZT7A 4UDTB 2EE2A 3IDGB 3VFMB 2CKBL 2L7UA 1MRDH 1HSAA 4U6XA 1IBGH 4BH7B 2W9DL 1FYTE 3T65A 1DQTA 5T1DH 1N6QH 1OAQH 1INDH 1FG9C 4I0PC 4NNPL 1MWAA 4ORGA 1F8TH 2YA0A 3EFDH 4HV8B 1U8NB 5DJ8A 5JDSB 3BQUB 1NC4D 1YJDL 3O6KH 2ADFH 4YDLB 3NZHL 4YR6A 4PRIA 1OSZA 3U0PB 2W92A 1NFDE 4AH2B 3SEPA 4BZ1H 5SWQB 4UUJA 3CMGA 1U8IA 2VC2L 1VFOA 3B83A 5H37G 5JIKA 5DJ0B 4F7TB 4LIQL 3DYOA 5J9PB 1C12A 2AKRB 1SBSL 4JAMA 2P4AB 3ZHDA 5BMFL 1MIMH 4QRTA 4MJ5B 1Y6MR 1NCWH 4IHOB 3L9RB 3BEWB 1CFBA 3H0TA 5KVMC 2YUWA 4QY8B 4QTIH 3O41B 3SDXF 4L4VB 2X70B 1ZVSB 3P4NA 1FLRL 3WIFB 4OCYL 3FQWA 4X6FB 3X14A 2VB5A 3H6JA 1IM9A 3MJ8B 2C1OB 4Y5XB 2WK2A 2VQ1B 4N8CH 4AG4H 5DMGD 2Q86B 2ARJB 5ISZD 5ENWA 1A1NA 5DFVC 3DUUB 4G8FA 3QWRA 1N2RB 3MCLH 4MJIB 3KPRD 3VRLF 4D9LH 3B5HA 2EDWA 3K8MA 2PO6C 1ZT1A 1FQ9C 2HJFA 5DA4A 3EUUA 1T5WA 2BOCB 3HPLA 1OWRM 4LVHB 1G9NH 4PRNA 5E08L 2VLJA 5E99L 4JQIL 4DVRL 5DD0H 4LARL 1RFDL 4XWOC 1PJ9A 1LO2H 5L2JB 4DN3H 2EDQA 1JBJA 2EDBA 4U49A 1XF5B 1MJJB 4YHPA 4KI5F 1NMCB 2ARJQ 3SGDI 4Z5RB 2LAGB 2O5YH 4MNGA 3TV3L 5C0CA 4MD5A 1WSST 4LCYA 3RJQB 2FR4B 5JTWA 4GAGL 3RWJB 1BQSA 2NY0C 2B5IB 4YGAB 1F13A 4Z78B 3CSPA 2D31B 4JVPA 1JHTB 3OF6A 4DOHB 5EOTB 2DRUA 4L8CA 2FLBT 3CIQA 4OBSA 4I9WE 2XRAL 1OF2A 4G8IB 2MJWA 2W9DH 5FCSH 3ROOB 3PP3K 3N50A 3QIWB 3W39B