5LC6A

Crystal structure of a single chain monellin mutant: q28k/c41s/y65r-mnei
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
92
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGKYGRLTFNKVIRPSMKKTIYENEIKGYEYQLYVRASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B,Monellin chain A
publication title Sweeter and stronger: enhancing sweetness and stability of the single chain monellin MNEI through molecular design.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 22
structure length 92
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5lc6A00
3MWZA 1CYVA 3IMAB 1N9JA 3PXMA 5LC6A 4N6LA 4N6NB 1PFPA 1TIJA 2W9PA 4LZIA 2OCTA 1A90A 3Q2PA 3S67A 1N5PA 1NB3I 4N6UA 3LH4A 5LC7A 1FA3A 3QRDA 3UL5A 4EYCA 1IV9A 5EQLA 4IT7A 2CH9A 3K9MC 1GD3A 1N5HA 1ROAA 3PS8A 1MNLA 1M9GA 2KXGA 1FUWA 1R4CA 3UL6A 4CCVA 3SVAA 3KFQC 1KWIA 1IV7A 1NB5I 3NX0A 4N6TA 1DVDA 3GAXA 4N6OB 1CYUA 1GD4A 1RN7A 1DVCA 1LXEA 2W9QA 3PYJA 1MOLA 4N6V0 1CEWI 3L0RA 1WNHA 1A67A 1EQKA 4TX4A 1YVBI 5ELUA 1G96A 1STFI 3KSED 2O9UX 5ELJA 2BO9B 4ZM8A 5A0OB 4N6MA
chains in the Genus database with same CATH superfamily
1M904 4HAAA 1Q7Y4 1FGTA 3JUPA 1SQWA 1LNHA 3BU4A 2QEX3 4GSPA 1RN4A 1A2PA 1GOYA 1JBTA 3FLJA 3IMAB 3MPHA 4HM6B 4IIAA 1N9JA 2E2VA 4EW5A 5JBSA 1OHPA 4J5GA 4KZ1A 1NO3A 2H0GA 1JN5B 2J8XB 4HYZA 5LC6A 5IERA 3I553 3UJMA 1OGXA 4J5KA 4L8OA 3A76A 3D5IA 5AIFA 3KE7A 1G0TA 1BRGA 1W7CA 1BNSA 1I3FA 1JKGA 1MWTA 1MGRA 2D42A 2H0HA 3MHEA 4N6NB 5M18A 1PFPA 2W9PA 3LXUX 1ZO2A 4AKYA 1A90A 1GY5A 1FYSA 5IG3A 3O8YA 1RN1A 1YIT3 2WOFA 3X41A 5KP4A 1YNVX 2JQ5A 1JV2B 1N5PA 1NB3I 2GEXA 1VQ63 5IG4A 2GEYA 4BTWA 2HOHA 2HMNB 5IEPA 2BMOB 1LQMB 1Q42A 1BNGA 1BSDA 1W6CA 1W01A 2SBLA 3K5TA 1FA3A 4XDWA 1RNBA 2RNTA 2IUKA 1I2GA 3CPW2 1LNIA 2KCDA 3BIRA 4MMZB 6GSPA 4JRFA 3CC43 1D6UA 1Q7HA 4IT7A 3G713 1VQM3 5HGRA 3AGOA 1X1UA 5IEOA 3JVCA 4AKZA 3FG1A 2ZHXB 3WA3A 1B27A 2QA43 4H3UA 3QK9A 3BLZA 6STDA 5I97A 2WGOA 1BSBA 1Q864 3EF8A 1MNLA 1M9GA 2B24B 1KD14 3WODG 4I5QA 3I563 2W04A 5JPPA 2CX1A 4QWTA 1B2UA 1JN5A 3PZWA 1M1XB 1C54A 2GXFA 2Y73A 3UL6A 2HMLB 1V57A 1LOVA 1IVXA 1RCLA 1RGGA 3K0ZA 1Z1SA 1NDOB 4MMXB 1IT7A 1BNFA 2D1WA 3KFQC 1KWIA 2XEPA 3PCSA 3DGOA 1NB5I 1UCIA 2C4BA 1JJ22 2OTJ3 3ZG0A 1PU4A 4N6TA 2OTL3 4H61A 3NBRA 4RNTA 2E2UA 3S5CA 1B2XA 2W0QA 1Q814 3K7CA 1CYUA 5KP3A 3MG1A 3OW22 4GL6A 1VQL3 1GMPA 2CC3A 1C7HA 1HYFA 1VQP3 3CCU3 2B1XB 1RN7A 1GSPA 3EE1A 3NQYA 1WMOA 3L0RA 3AMOB 1QALA 1OPYA 2CWUA 4OUQA 3NM2A 1BOXA 2KRTA 4HZBB 1AR0A 1TFKA 3BNCA 4TX4A 1EQKA 4EBGA 1YVBI 3HZPA 1VZZA 1I0VA 5STDA 5ELUA 4I4KA 3KSED 4LMIA 2O9UX 3OWUA 3T8UA 3ZFZA 4HM2B 4OK0A 5ELJA 1RGCA 3Q1CA 1RHLA 1JB5A 2JDIH 3BB9A 4Q53A 3KCHA 4KFDA 1Y4KA 2BHMA 4LGQA 2E2TA 1TU5A 1BRHA 1DMMA 4FMDA 1EG9B 2BNGA 1BSEA 1LOYA 3U1WA 1VQ93 4HM5B 2F4YA 1CYVA 2IA7A 1RDSA 3NHXA 3N8BA 5G2GA 2GU1A 3G6E3 4O02B 5BXQA 5AYSC 1GY6A 1ASKA 3EB8A 2Z7AA 4NPBA 4O8SA 3CCJ3 1RGFA 5AEUB 1VQN3 1U8CB 1TIJA 4AEQA 3JUQA 3NV0B 4LZIA 3K63A 1ISKA 3BNBA 3G4S3 2F99A 1PY3A 3AMOA 2BU4A 3BNDA 2XSOB 4L8PA 1STDA 4R4KA 2HMMB 4G1MB 3X3ZA 1K9M4 1YGWA 2CFKA 3FZWA 4HM3B 1D6ZA 3OWYA 1QAFA 3VGNA 3UL5A 3AHSA 3EN1B 3X3YA 3CCM3 1VQK3 2ZA4A 2OQEA 5AEWB 4NHFA 3PGBA 2UUGC 3CNMA 1IV9A 3DGNA 1O7GB 3OWSA 4FMAA 1JB4A 1O7MB 3Q3FA 2CG1A 3WDGB 1LOWA 5RNTA 3JUNA 3CCL3 1BU4A 4XDVA 3K9MC 1U5OA 3WMDA 2IY2A 1ROVA 1W4NA 3KSPA 3J7Yd 4RNZA 3SOAA 4K1UA 1RGLA 3AHWA 3PCRA 3DMCA 3KN4A 1TRPA 2KXGA 4XBYA 1SPUA 3CXC2 2MF7A 2W2CA 1MWRA 1W5ZA 3ZG5A 1A2KA 1HKXA 4LSOA 4EC6A 2RBIA 3F14A 1I2FA 3EBTA 4CCVA 1S5AA 1AY7A 4BL2A 3LTDA 9RNTA 3GZBA 1GOVA 1UGHI 2Z77A 3SVAA 3F8HA 4XBXA 1IV7A 1OGZA 3NV0A 7RNTA 3CCS3 2YFJB 1TJDA 2P09A 3NX0A 1MWUA 3CNXA 1E3RA 1DETA 4ILFA 3GAXA 4MMYB 4PEJA 1HZ1A 4RBNA 1OF5B 2HMOB 1FGMA 3SLUA 3SXXA 1CQSA 1WQLB 3H3HA 4HM8B 4N6OB 1I0XA 2MC8A 2KF6A 1PYLA 3LT8A 4WFOA 3T8NA 1SARA 2CIUA 1KSIA 2INXA 3E99A 3HI7A 4LEHA 1W6YA 2F5MA 3HOHA 5FW5A 4HOHA 4BTXA 2W03A 3KIIA 1UUWB 1KC84 1FUTA 4R80A 2KF4A 2KF5A 1LQGC 2OOVC 3TDGA 1Q40B 5BVBA 5DRVA 1BUQA 1ZX2A 1IK3A 2P0MA 3NUVA 1F8NA 1BRJA 1W2ZA 1G96A 1JB2A 1FGRA 3DGYA 1BAOA 1WMPA 3DM8A 1DYUA 3N9HA 1K8A4 1KQS2 1BNRA 1D6YA 2FGTA 1OACA 1X1WA 1CH0A 3CU3A 2F86B 4EV2A 1TTOA 2WO0A 4RNYA 3CME3 1NNVA 4WYKB 1S723 3KZTA 4EV5A 2YX9A 4N6MA 3WHOA 5GSPA 3FCSB 4CDLA 3NQZA 1BUJA 2KAAA 3MWZA 1GMQA 3B7CA 1VQQA 6RNTA 1RKYA 2HMJB 3ECFA 1I3IA 1IYYA 1MWSA 1OF5A 1EEJA 1UCKA 1GOUA 1JZOA 2QGUA 3LTAA 4HM1B 3X3XA 2M7OA 4NREA 3RNTA 1UW1A 5D81A 2V1LA 3V98A 3DZLA 3EHCA 1TP6A 3G8ZA 4X2HA 1Q9EA 3STDA 1V74A 1IVUA 2K3DA 2RFRA 2RSXA 3ALAA 1O7NB 3GWRA 1K41A 1UUGB 5HOHA 2OCTA 3RGAA 5D82A 3Q2PA 2LYXA 1T5YA 2HMKB 3NM7A 2GSPA 3HK4A 1Q40A 4BTYA 3S67A 1BSAA 4HM4B 5AYRB 2CHCA 4BL3A 3LTBA 1WMNA 4N6UA 1BSCA 1M1K4 1G02A 2BMQB 1OHOA 2K54A 3LH4A 4WHAA 3CCE3 2LQVA 5IG0A 1UI7A 1JRQA 3DGLA 2L4VA 4J8TA 4CJNA 2L1SA 3QRDA 3LTCA 5KP1A 1NU3A 1QJGA 5CLKA 4EYCA 3V92A 1DE3A 2CX0A 4IPBA 4XBTA 2BT3A 3EQQB 3A5EA 3FG4A 4WYKA 2CG0A 1BGSA 2PZVA 1RLSA 5D83A 1B2ZA 1QVF2 1JBRA 2ZL8A 1Q824 4R9KA 3CCQ3 3D3LA 1US1A 1GY7A 3LYGA 3SYUA 3HX8A 1NWWA 4GHOA 1B3SA 1RGKA 2XSHB 1GD3A 3MYTA 1N5HA 1ROAA 3PS8A 1AVLA 2O3OA 1W02A 4HM0B 3FF2A 3SOYA 3UNLA 5M19A 1BRNL 3AGNA 2P38A 4O3VA 1OCVA 1LOXA 1EA2A 1RRHA 2CWVA 3LZAA 1R4CA 4ORLA 1FGQA 3B4OA 1RGHA 4KFEA 4KT3B 1UUVB 2RGQA 3F7SA 1B20A 3FF0A 3MSOA 3CC73 3ROBA 1YJN3 3D4AA 4R1KA 5JPUA 1B2MA 1K28A 4KVHA 4K1VA 1I70A 1RCKA 3HIIA 1RGAA 3IPTA 2Z6BA 3S29A 3X42A 1B21A 2CK3H 2CFGA 2SARA 4RZMA 1QAKA 4STDA 1UDII 3NBJA 2F98A 5M1AA 5BIRA 1GD4A 1FGOA 2Z76A 2CW9A 3NXJA 1IVVA 1DVCA 2XFSA 2ZDJA 2BMRB 2XGLA 4HZ9B 4HM7B 3D5GA 2R4IA 2W9QA 1FUSA 1SIIA 1JZDA 4MJDA 2CFWA 3DH2A 3PYJA 4WP5A 1VQO3 1MOLA 4N6V0 1CEWI 3OV4A 2C11A 5CF1A 1WNHA 2K0MA 3OXAA 2YFLB 1GYBA 1YVSA 1ZGXA 3I0YA 3RDEA 1A67A 1BRSA 3CC23 5BU4A 1V58A 4U13A 5AIIA 3G0KA 1GMRA 1N8QA 2RCDA 4JF8A 1W2B2 1UI8A 3CCV3 2XGNA 3V99A 3LMLA 1J2BA 5IENA 1RRLA 1B2SA 1QVG2 2BO9B 3H51A 1L5GB 1ZS7A 3VSYA 8RNTA 3ER7A 3F8XA 3X40A 2XH9A 1O7PB 3DXOA 1T2IA 4DKIA 3HIGA 3WA2X 3S28A 1RJOA 3WOEB 2P05A 5AI1A 1BNJA 1UCJA 3LT9A 1N9EA 1SIHA 3CD63 3G16A 1BVIA 4MEIA 1TFOA 3WOFB 3WR2A 4KFFA 1A2VA 3PXMA 4FCJA 7GSPA 2AADA 1HU9A 1T2HA 3F9SA 1VQ83 4XM4A 4L7KA 4LYLB 4N6LA 3T0UA 1LVNA 2FNQA 1E97A 2I9WA 2H0IA 3IJEB 2KF3A 5FGOA 4O2HA 2BIRA 4FCZA 3S27A 3SEDA 3URPA 2CWTA 1JNQA 1JBSA 3N54B 5CK6A 1UGIA 4CPKA 1TUHA 1TRQA 1RTUA 3OX9A 3D79A 1YJ93 1O7WB 1K734 3B4PA 4OVMA 2ML6A 1BNIA 1ULIB 3FSDA 1DMNA 2PNCA 5IG5A 3F7XA 1NJI4 3MG2A 1I8VA 3JUOA 3UB1A 2F56A 4BU4A 5LC7A 1OH0A 2XRXB 5G1LA 3DGMA 1OUNA 3CPOA 1MGWA 2OQEC 1BNEA 1IU7A 1YI23 2W56B 3GZXB 1DMQA 2UX0A 4HVNA 1QMAA 2CKFB 5EQLA 3DUKA 2IYJA 1IVWA 3MKIA 3JUMA 2CH9A 4HBRA 4HKVB 1IT8A 5IF6A 1YJW3 1FW7A 1FZUA 2ML5A 3EJVA 2F5WA 1VQ73 1VQ43 8CHOA 5CXOA 1YIJ3 3NBBA 1IDPA 2P0XA 3F40A 3FKAA 2GU3A 2IUJA 4X2OA 3RGRA 1I2EA 1EUIC 1FUWA 4WWUC 2IMJA 4FCMA 2GBWB 1GS3A 3EBYA 1ULJB 1BRIA 1IQYA 1W6GA 5G1KA 4HJLB 1OHSA 5AIGA 3U97A 4FMCA 1YHQ3 5AIHA 2WGQA 2STDA 2R41A 2CFDA 2Q07A 5TGNA 1IQ8A 1SJWA 1DVDA 2CFLA 2OWPA 4FR9A 3EC9A 1EKMA 1T3BA 2W6JH 2XF3A 1R4YA 1LRAA 4FMBA 1X1YA 3SX1A 1RSNA 3BNEA 3VF1A 7STDA 2XR8B 4XB5A 3CMA3 1JKGB 5EEOA 1RMSA 5CF2A 1LXEA 3LOYA 1N8R4 1RGEA 3KKGA 4GB5A 2FXTA 2YFIB 1W00A 1AVKA 3D9RA 5IW9A 2AAEA 2OOVA 1AQZA 2A15A 5DREA 2W56A 4K61A 2C10A 3DY5A 2XFTA 3EN8A 1IQXA 2WOHA 3FGYA 1VQ53 4J9AA 2Y74A 5EVHA 3Q90A 4K90B 4BIRA 3EX9A 3MG3A 1UCLA 3GZRA 3FG3A 1STFI 3B8LA 1BANA 1E3VA 1RNTA 1WTHA 1BRKA 3M8CA 2GBXB 3GSPA 1O7HB 4EXRA 3GRDA 1AV4A 3FH1A 3GZYB 4R9LA 2QIYA 2UGIA 3CCR3 1BIRA 4ZM8A 1YGEA 1X1XA 5A0OB 4N3VA
chains in the Genus database with same CATH topology
1M904 1Q7Y4 1FGTA 3JUPA 1SQWA 1LNHA 2QEX3 3FLJA 3IMAB 3MPHA 4HM6B 4IIAA 1N9JA 2E2VA 5JBSA 1OHPA 4KZ1A 5LC6A 1NO3A 1JN5B 4HYZA 5IERA 3I553 3UJMA 1OGXA 4L8OA 3A76A 5AIFA 3KE7A 1W7CA 3MHEA 1JKGA 2D42A 4N6NB 1PFPA 2W9PA 3LXUX 1ZO2A 4AKYA 1A90A 1GY5A 5IG3A 3O8YA 1YIT3 2WOFA 3X41A 5KP4A 2JQ5A 1JV2B 1N5PA 1NB3I 2GEXA 1VQ63 5IG4A 2GEYA 4BTWA 2HMNB 5IEPA 2BMOB 1Q42A 3K5TA 1W6CA 2SBLA 1W01A 1FA3A 4XDWA 2IUKA 3CPW2 2KCDA 4MMZB 4JRFA 3CC43 1D6UA 4IT7A 3G713 1VQM3 5HGRA 4AKZA 5IEOA 3JVCA 3FG1A 3WA3A 2QA43 4H3UA 3QK9A 3BLZA 6STDA 5I97A 2WGOA 1Q864 3EF8A 1MNLA 1M9GA 2B24B 1KD14 3WODG 3I563 2W04A 5JPPA 4QWTA 1JN5A 3PZWA 1M1XB 2GXFA 2Y73A 3UL6A 2HMLB 1IVXA 3K0ZA 1Z1SA 1NDOB 4MMXB 1IT7A 2D1WA 3KFQC 1KWIA 2XEPA 3PCSA 3DGOA 1NB5I 1JJ22 2OTJ3 1PU4A 2OTL3 4N6TA 4H61A 3NBRA 2E2UA 3S5CA 2W0QA 1Q814 3K7CA 1CYUA 5KP3A 3MG1A 3OW22 4GL6A 1VQL3 2CC3A 1C7HA 1VQP3 3CCU3 2B1XB 1RN7A 3EE1A 3NQYA 1WMOA 3L0RA 3AMOB 1QALA 1OPYA 2CWUA 4OUQA 3NM2A 2KRTA 4HZBB 4TX4A 1AR0A 1TFKA 3BNCA 1EQKA 4EBGA 1YVBI 3HZPA 1VZZA 5STDA 5ELUA 4I4KA 3KSED 4LMIA 2O9UX 3OWUA 3T8UA 4HM2B 4OK0A 5ELJA 3Q1CA 1JB5A 2JDIH 3BB9A 4Q53A 4KFDA 1Y4KA 2BHMA 4LGQA 2E2TA 1TU5A 1DMMA 4FMDA 1EG9B 2BNGA 1VQ93 3U1WA 4HM5B 1CYVA 2IA7A 3NHXA 3N8BA 5G2GA 2GU1A 3G6E3 4O02B 5BXQA 5AYSC 1GY6A 1ASKA 3EB8A 2Z7AA 3CCJ3 5AEUB 1VQN3 1U8CB 1TIJA 4AEQA 3JUQA 3NV0B 4LZIA 3K63A 1ISKA 3BNBA 3G4S3 2F99A 3AMOA 3BNDA 2XSOB 4L8PA 1STDA 4R4KA 2HMMB 4G1MB 3X3ZA 1K9M4 2CFKA 3FZWA 4HM3B 1D6ZA 3OWYA 1QAFA 3VGNA 3UL5A 3EN1B 3X3YA 3CCM3 1VQK3 2OQEA 5AEWB 4NHFA 3PGBA 3CNMA 1IV9A 3DGNA 1O7GB 3OWSA 4FMAA 1JB4A 1O7MB 2CG1A 3WDGB 3CCL3 3JUNA 4XDVA 3K9MC 1U5OA 3WMDA 1ROVA 1W4NA 3KSPA 3J7Yd 4RNZA 3SOAA 4K1UA 3PCRA 3DMCA 3KN4A 2KXGA 4XBYA 1SPUA 3CXC2 2MF7A 2W2CA 1W5ZA 4EC6A 1A2KA 1HKXA 4LSOA 3F14A 4CCVA 3EBTA 1S5AA 3LTDA 3GZBA 2Z77A 3SVAA 3F8HA 4XBXA 1IV7A 1OGZA 3NV0A 3CCS3 2YFJB 2P09A 3NX0A 3CNXA 1E3RA 4PEJA 4MMYB 3GAXA 4RBNA 1OF5B 2HMOB 1FGMA 3SLUA 3SXXA 1CQSA 1WQLB 3H3HA 4HM8B 4N6OB 2MC8A 3LT8A 4WFOA 3T8NA 2CIUA 1KSIA 2INXA 3E99A 3HI7A 4LEHA 1W6YA 5FW5A 4BTXA 2W03A 3KIIA 1UUWB 1KC84 4R80A 2OOVC 3TDGA 1Q40B 5BVBA 5DRVA 1BUQA 1ZX2A 1IK3A 2P0MA 3NUVA 1F8NA 1W2ZA 1G96A 1JB2A 1FGRA 3N9HA 3DM8A 1WMPA 1K8A4 1DYUA 1KQS2 1D6YA 2FGTA 1OACA 3CU3A 2F86B 4EV2A 2WO0A 4RNYA 3CME3 4WYKB 1S723 3KZTA 4EV5A 2YX9A 4N6MA 3FCSB 4CDLA 3NQZA 3MWZA 3B7CA 1RKYA 2HMJB 3ECFA 1OF5A 2QGUA 3LTAA 4HM1B 3X3XA 2M7OA 4NREA 1UW1A 5D81A 2V1LA 3V98A 3DZLA 3EHCA 1TP6A 3G8ZA 4X2HA 3STDA 1V74A 1IVUA 2RFRA 2RSXA 3ALAA 3GWRA 1O7NB 4O8SA 1K41A 2OCTA 3RGAA 5D82A 3Q2PA 2LYXA 1T5YA 2HMKB 3NM7A 3HK4A 1Q40A 4BTYA 3S67A 4HM4B 5AYRB 2CHCA 3LTBA 1WMNA 4N6UA 1M1K4 2BMQB 1OHOA 2K54A 3LH4A 4WHAA 3CCE3 2LQVA 5IG0A 1UI7A 1JRQA 3DGLA 2L4VA 4J8TA 3QRDA 3LTCA 5KP1A 1NU3A 1QJGA 5CLKA 4EYCA 3V92A 4XBTA 4IPBA 2BT3A 3EQQB 3FG4A 4WYKA 2CG0A 2PZVA 5D83A 1QVF2 2ZL8A 1Q824 4R9KA 3CCQ3 3D3LA 1US1A 1GY7A 3LYGA 3HX8A 1NWWA 2XSHB 3MYTA 1GD3A 1N5HA 1ROAA 3PS8A 1AVLA 2O3OA 1W02A 4HM0B 3FF2A 3SOYA 3UNLA 2P38A 4O3VA 1OCVA 1LOXA 1EA2A 1RRHA 2CWVA 3LZAA 1R4CA 4ORLA 1FGQA 3B4OA 4KFEA 1UUVB 2RGQA 3F7SA 3FF0A 3MSOA 3CC73 3ROBA 1YJN3 4R1KA 5JPUA 1K28A 4KVHA 4K1VA 3HIIA 3IPTA 2Z6BA 3S29A 3X42A 2CK3H 2CFGA 4RZMA 1QAKA 4STDA 3NBJA 2F98A 1GD4A 1FGOA 2Z76A 2CW9A 3NXJA 1IVVA 1DVCA 2XFSA 2ZDJA 2BMRB 2XGLA 4HZ9B 4HM7B 2R4IA 2W9QA 1SIIA 4MJDA 2CFWA 4WP5A 3PYJA 1VQO3 1MOLA 4N6V0 1CEWI 3OV4A 2C11A 5CF1A 1WNHA 2K0MA 3OXAA 2YFLB 1GYBA 3I0YA 3RDEA 1A67A 3CC23 4U13A 5AIIA 3G0KA 4JF8A 1N8QA 2RCDA 1W2B2 1UI8A 3CCV3 2XGNA 3V99A 3LMLA 1J2BA 5IENA 1RRLA 1QVG2 2BO9B 3H51A 1L5GB 3VSYA 3ER7A 3F8XA 3X40A 2XH9A 1O7PB 3DXOA 3HIGA 3WA2X 3S28A 1RJOA 3WOEB 2P05A 5AI1A 3LT9A 1N9EA 1SIHA 3CD63 3G16A 4MEIA 1TFOA 3WOFB 4KFFA 1A2VA 3PXMA 4FCJA 1HU9A 3F9SA 1VQ83 4XM4A 4L7KA 4N6LA 3T0UA 1LVNA 2FNQA 1E97A 2I9WA 3IJEB 5FGOA 4O2HA 4FCZA 3S27A 3SEDA 2CWTA 1JNQA 3N54B 5CK6A 1TUHA 3OX9A 1YJ93 1O7WB 1K734 3B4PA 4OVMA 2ML6A 1ULIB 3FSDA 1DMNA 2PNCA 5IG5A 3F7XA 1NJI4 3MG2A 3JUOA 3UB1A 5LC7A 1OH0A 2XRXB 3DGMA 1OUNA 3CPOA 2OQEC 1IU7A 1YI23 2W56B 3GZXB 1DMQA 2UX0A 4HVNA 1QMAA 2CKFB 5EQLA 3DUKA 1IVWA 3MKIA 3JUMA 2CH9A 4HBRA 4HKVB 1IT8A 5IF6A 1YJW3 2ML5A 3EJVA 1VQ73 1VQ43 8CHOA 5CXOA 1YIJ3 3NBBA 1IDPA 2P0XA 3F40A 3FKAA 2GU3A 2IUJA 4X2OA 3RGRA 1FUWA 4WWUC 2IMJA 4FCMA 2GBWB 1GS3A 3EBYA 1ULJB 1IQYA 1W6GA 4HJLB 1OHSA 5AIGA 3U97A 4FMCA 1YHQ3 5AIHA 2WGQA 2STDA 2CFDA 2Q07A 5TGNA 1IQ8A 1SJWA 1DVDA 2CFLA 2OWPA 4FR9A 3EC9A 1EKMA 2W6JH 2XF3A 4FMBA 3SX1A 3VF1A 3BNEA 7STDA 2XR8B 4XB5A 3CMA3 1JKGB 5EEOA 5CF2A 1LXEA 3LOYA 1N8R4 3KKGA 4GB5A 2FXTA 2YFIB 1W00A 1AVKA 3D9RA 5IW9A 2OOVA 5DREA 2A15A 2W56A 4K61A 2C10A 3DY5A 2XFTA 3EN8A 1IQXA 2WOHA 3FGYA 1VQ53 4J9AA 2Y74A 5EVHA 3Q90A 4K90B 3EX9A 3MG3A 3GZRA 3FG3A 1STFI 3B8LA 1E3VA 1WTHA 3M8CA 2GBXB 1O7HB 4EXRA 3GRDA 1AV4A 3FH1A 3GZYB 4R9LA 2QIYA 3CCR3 4ZM8A 1YGEA 5A0OB 4N3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MWZ A;  1CYV A;  3IMA B;  1N9J A;  3PXM A;  5LC6 A;  4N6L A;  4N6N B;  1PFP A;  1TIJ A;  2W9P A;  4LZI A;  2OCT A;  1A90 A;  3Q2P A;  3S67 A;  1N5P A;  1NB3 I;  4N6U A;  3LH4 A;  5LC7 A;  1FA3 A;  3QRD A;  3UL5 A;  4EYC A;  1IV9 A;  5EQL A;  4IT7 A;  2CH9 A;  3K9M C;  1GD3 A;  1N5H A;  1ROA A;  3PS8 A;  1MNL A;  1M9G A;  2KXG A;  1FUW A;  1R4C A;  3UL6 A;  4CCV A;  3SVA A;  3KFQ C;  1KWI A;  1IV7 A;  1NB5 I;  3NX0 A;  4N6T A;  1DVD A;  3GAX A;  4N6O B;  1CYU A;  1GD4 A;  1RN7 A;  1DVC A;  1LXE A;  2W9Q A;  3PYJ A;  1MOL A;  4N6V 0;  1CEW I;  3L0R A;  1WNH A;  1A67 A;  1EQK A;  4TX4 A;  1YVB I;  5ELU A;  1G96 A;  1STF I;  3KSE D;  2O9U X;  5ELJ A;  2BO9 B;  4ZM8 A;  5A0O B;  4N6M A; 
#chains in the Genus database with same CATH topology
 1M90 4;  4HAA A;  1Q7Y 4;  1FGT A;  3JUP A;  1SQW A;  1LNH A;  3BU4 A;  2QEX 3;  4GSP A;  1RN4 A;  1A2P A;  1GOY A;  1JBT A;  3FLJ A;  3IMA B;  3MPH A;  4HM6 B;  4IIA A;  1N9J A;  2E2V A;  4EW5 A;  5JBS A;  1OHP A;  4J5G A;  4KZ1 A;  1NO3 A;  2H0G A;  1JN5 B;  2J8X B;  4HYZ A;  5LC6 A;  5IER A;  3I55 3;  3UJM A;  1OGX A;  4J5K A;  4L8O A;  3A76 A;  3D5I A;  5AIF A;  3KE7 A;  1G0T A;  1BRG A;  1W7C A;  1BNS A;  1I3F A;  1JKG A;  1MWT A;  1MGR A;  2D42 A;  2H0H A;  3MHE A;  4N6N B;  5M18 A;  1PFP A;  2W9P A;  3LXU X;  1ZO2 A;  4AKY A;  1A90 A;  1GY5 A;  1FYS A;  5IG3 A;  3O8Y A;  1RN1 A;  1YIT 3;  2WOF A;  3X41 A;  5KP4 A;  1YNV X;  2JQ5 A;  1JV2 B;  1N5P A;  1NB3 I;  2GEX A;  1VQ6 3;  5IG4 A;  2GEY A;  4BTW A;  2HOH A;  2HMN B;  5IEP A;  2BMO B;  1LQM B;  1Q42 A;  1BNG A;  1BSD A;  1W6C A;  1W01 A;  2SBL A;  3K5T A;  1FA3 A;  4XDW A;  1RNB A;  2RNT A;  2IUK A;  1I2G A;  3CPW 2;  1LNI A;  2KCD A;  3BIR A;  4MMZ B;  6GSP A;  4JRF A;  3CC4 3;  1D6U A;  1Q7H A;  4IT7 A;  3G71 3;  1VQM 3;  5HGR A;  3AGO A;  1X1U A;  5IEO A;  3JVC A;  4AKZ A;  3FG1 A;  2ZHX B;  3WA3 A;  1B27 A;  2QA4 3;  4H3U A;  3QK9 A;  3BLZ A;  6STD A;  5I97 A;  2WGO A;  1BSB A;  1Q86 4;  3EF8 A;  1MNL A;  1M9G A;  2B24 B;  1KD1 4;  3WOD G;  4I5Q A;  3I56 3;  2W04 A;  5JPP A;  2CX1 A;  4QWT A;  1B2U A;  1JN5 A;  3PZW A;  1M1X B;  1C54 A;  2GXF A;  2Y73 A;  3UL6 A;  2HML B;  1V57 A;  1LOV A;  1IVX A;  1RCL A;  1RGG A;  3K0Z A;  1Z1S A;  1NDO B;  4MMX B;  1IT7 A;  1BNF A;  2D1W A;  3KFQ C;  1KWI A;  2XEP A;  3PCS A;  3DGO A;  1NB5 I;  1UCI A;  2C4B A;  1JJ2 2;  2OTJ 3;  3ZG0 A;  1PU4 A;  4N6T A;  2OTL 3;  4H61 A;  3NBR A;  4RNT A;  2E2U A;  3S5C A;  1B2X A;  2W0Q A;  1Q81 4;  3K7C A;  1CYU A;  5KP3 A;  3MG1 A;  3OW2 2;  4GL6 A;  1VQL 3;  1GMP A;  2CC3 A;  1C7H A;  1HYF A;  1VQP 3;  3CCU 3;  2B1X B;  1RN7 A;  1GSP A;  3EE1 A;  3NQY A;  1WMO A;  3L0R A;  3AMO B;  1QAL A;  1OPY A;  2CWU A;  4OUQ A;  3NM2 A;  1BOX A;  2KRT A;  4HZB B;  1AR0 A;  1TFK A;  3BNC A;  4TX4 A;  1EQK A;  4EBG A;  1YVB I;  3HZP A;  1VZZ A;  1I0V A;  5STD A;  5ELU A;  4I4K A;  3KSE D;  4LMI A;  2O9U X;  3OWU A;  3T8U A;  3ZFZ A;  4HM2 B;  4OK0 A;  5ELJ A;  1RGC A;  3Q1C A;  1RHL A;  1JB5 A;  2JDI H;  3BB9 A;  4Q53 A;  3KCH A;  4KFD A;  1Y4K A;  2BHM A;  4LGQ A;  2E2T A;  1TU5 A;  1BRH A;  1DMM A;  4FMD A;  1EG9 B;  2BNG A;  1BSE A;  1LOY A;  3U1W A;  1VQ9 3;  4HM5 B;  2F4Y A;  1CYV A;  2IA7 A;  1RDS A;  3NHX A;  3N8B A;  5G2G A;  2GU1 A;  3G6E 3;  4O02 B;  5BXQ A;  5AYS C;  1GY6 A;  1ASK A;  3EB8 A;  2Z7A A;  4NPB A;  4O8S A;  3CCJ 3;  1RGF A;  5AEU B;  1VQN 3;  1U8C B;  1TIJ A;  4AEQ A;  3JUQ A;  3NV0 B;  4LZI A;  3K63 A;  1ISK A;  3BNB A;  3G4S 3;  2F99 A;  1PY3 A;  3AMO A;  2BU4 A;  3BND A;  2XSO B;  4L8P A;  1STD A;  4R4K A;  2HMM B;  4G1M B;  3X3Z A;  1K9M 4;  1YGW A;  2CFK A;  3FZW A;  4HM3 B;  1D6Z A;  3OWY A;  1QAF A;  3VGN A;  3UL5 A;  3AHS A;  3EN1 B;  3X3Y A;  3CCM 3;  1VQK 3;  2ZA4 A;  2OQE A;  5AEW B;  4NHF A;  3PGB A;  2UUG C;  3CNM A;  1IV9 A;  3DGN A;  1O7G B;  3OWS A;  4FMA A;  1JB4 A;  1O7M B;  3Q3F A;  2CG1 A;  3WDG B;  1LOW A;  5RNT A;  3JUN A;  3CCL 3;  1BU4 A;  4XDV A;  3K9M C;  1U5O A;  3WMD A;  2IY2 A;  1ROV A;  1W4N A;  3KSP A;  3J7Y d;  4RNZ A;  3SOA A;  4K1U A;  1RGL A;  3AHW A;  3PCR A;  3DMC A;  3KN4 A;  1TRP A;  2KXG A;  4XBY A;  1SPU A;  3CXC 2;  2MF7 A;  2W2C A;  1MWR A;  1W5Z A;  3ZG5 A;  1A2K A;  1HKX A;  4LSO A;  4EC6 A;  2RBI A;  3F14 A;  1I2F A;  3EBT A;  4CCV A;  1S5A A;  1AY7 A;  4BL2 A;  3LTD A;  9RNT A;  3GZB A;  1GOV A;  1UGH I;  2Z77 A;  3SVA A;  3F8H A;  4XBX A;  1IV7 A;  1OGZ A;  3NV0 A;  7RNT A;  3CCS 3;  2YFJ B;  1TJD A;  2P09 A;  3NX0 A;  1MWU A;  3CNX A;  1E3R A;  1DET A;  4ILF A;  3GAX A;  4MMY B;  4PEJ A;  1HZ1 A;  4RBN A;  1OF5 B;  2HMO B;  1FGM A;  3SLU A;  3SXX A;  1CQS A;  1WQL B;  3H3H A;  4HM8 B;  4N6O B;  1I0X A;  2MC8 A;  2KF6 A;  1PYL A;  3LT8 A;  4WFO A;  3T8N A;  1SAR A;  2CIU A;  1KSI A;  2INX A;  3E99 A;  3HI7 A;  4LEH A;  1W6Y A;  2F5M A;  3HOH A;  5FW5 A;  4HOH A;  4BTX A;  2W03 A;  3KII A;  1UUW B;  1KC8 4;  1FUT A;  4R80 A;  2KF4 A;  2KF5 A;  1LQG C;  2OOV C;  3TDG A;  1Q40 B;  5BVB A;  5DRV A;  1BUQ A;  1ZX2 A;  1IK3 A;  2P0M A;  3NUV A;  1F8N A;  1BRJ A;  1W2Z A;  1G96 A;  1JB2 A;  1FGR A;  3DGY A;  1BAO A;  1WMP A;  3DM8 A;  1DYU A;  3N9H A;  1K8A 4;  1KQS 2;  1BNR A;  1D6Y A;  2FGT A;  1OAC A;  1X1W A;  1CH0 A;  3CU3 A;  2F86 B;  4EV2 A;  1TTO A;  2WO0 A;  4RNY A;  3CME 3;  1NNV A;  4WYK B;  1S72 3;  3KZT A;  4EV5 A;  2YX9 A;  4N6M A;  3WHO A;  5GSP A;  3FCS B;  4CDL A;  3NQZ A;  1BUJ A;  2KAA A;  3MWZ A;  1GMQ A;  3B7C A;  1VQQ A;  6RNT A;  1RKY A;  2HMJ B;  3ECF A;  1I3I A;  1IYY A;  1MWS A;  1OF5 A;  1EEJ A;  1UCK A;  1GOU A;  1JZO A;  2QGU A;  3LTA A;  4HM1 B;  3X3X A;  2M7O A;  4NRE A;  3RNT A;  1UW1 A;  5D81 A;  2V1L A;  3V98 A;  3DZL A;  3EHC A;  1TP6 A;  3G8Z A;  4X2H A;  1Q9E A;  3STD A;  1V74 A;  1IVU A;  2K3D A;  2RFR A;  2RSX A;  3ALA A;  1O7N B;  3GWR A;  1K41 A;  1UUG B;  5HOH A;  2OCT A;  3RGA A;  5D82 A;  3Q2P A;  2LYX A;  1T5Y A;  2HMK B;  3NM7 A;  2GSP A;  3HK4 A;  1Q40 A;  4BTY A;  3S67 A;  1BSA A;  4HM4 B;  5AYR B;  2CHC A;  4BL3 A;  3LTB A;  1WMN A;  4N6U A;  1BSC A;  1M1K 4;  1G02 A;  2BMQ B;  1OHO A;  2K54 A;  3LH4 A;  4WHA A;  3CCE 3;  2LQV A;  5IG0 A;  1UI7 A;  1JRQ A;  3DGL A;  2L4V A;  4J8T A;  4CJN A;  2L1S A;  3QRD A;  3LTC A;  5KP1 A;  1NU3 A;  1QJG A;  5CLK A;  4EYC A;  3V92 A;  1DE3 A;  2CX0 A;  4IPB A;  4XBT A;  2BT3 A;  3EQQ B;  3A5E A;  3FG4 A;  4WYK A;  2CG0 A;  1BGS A;  2PZV A;  1RLS A;  5D83 A;  1B2Z A;  1QVF 2;  1JBR A;  2ZL8 A;  1Q82 4;  4R9K A;  3CCQ 3;  3D3L A;  1US1 A;  1GY7 A;  3LYG A;  3SYU A;  3HX8 A;  1NWW A;  4GHO A;  1B3S A;  1RGK A;  2XSH B;  1GD3 A;  3MYT A;  1N5H A;  1ROA A;  3PS8 A;  1AVL A;  2O3O A;  1W02 A;  4HM0 B;  3FF2 A;  3SOY A;  3UNL A;  5M19 A;  1BRN L;  3AGN A;  2P38 A;  4O3V A;  1OCV A;  1LOX A;  1EA2 A;  1RRH A;  2CWV A;  3LZA A;  1R4C A;  4ORL A;  1FGQ A;  3B4O A;  1RGH A;  4KFE A;  4KT3 B;  1UUV B;  2RGQ A;  3F7S A;  1B20 A;  3FF0 A;  3MSO A;  3CC7 3;  3ROB A;  1YJN 3;  3D4A A;  4R1K A;  5JPU A;  1B2M A;  1K28 A;  4KVH A;  4K1V A;  1I70 A;  1RCK A;  3HII A;  1RGA A;  3IPT A;  2Z6B A;  3S29 A;  3X42 A;  1B21 A;  2CK3 H;  2CFG A;  2SAR A;  4RZM A;  1QAK A;  4STD A;  1UDI I;  3NBJ A;  2F98 A;  5M1A A;  5BIR A;  1GD4 A;  1FGO A;  2Z76 A;  2CW9 A;  3NXJ A;  1IVV A;  1DVC A;  2XFS A;  2ZDJ A;  2BMR B;  2XGL A;  4HZ9 B;  4HM7 B;  3D5G A;  2R4I A;  2W9Q A;  1FUS A;  1SII A;  1JZD A;  4MJD A;  2CFW A;  3DH2 A;  3PYJ A;  4WP5 A;  1VQO 3;  1MOL A;  4N6V 0;  1CEW I;  3OV4 A;  2C11 A;  5CF1 A;  1WNH A;  2K0M A;  3OXA A;  2YFL B;  1GYB A;  1YVS A;  1ZGX A;  3I0Y A;  3RDE A;  1A67 A;  1BRS A;  3CC2 3;  5BU4 A;  1V58 A;  4U13 A;  5AII A;  3G0K A;  1GMR A;  1N8Q A;  2RCD A;  4JF8 A;  1W2B 2;  1UI8 A;  3CCV 3;  2XGN A;  3V99 A;  3LML A;  1J2B A;  5IEN A;  1RRL A;  1B2S A;  1QVG 2;  2BO9 B;  3H51 A;  1L5G B;  1ZS7 A;  3VSY A;  8RNT A;  3ER7 A;  3F8X A;  3X40 A;  2XH9 A;  1O7P B;  3DXO A;  1T2I A;  4DKI A;  3HIG A;  3WA2 X;  3S28 A;  1RJO A;  3WOE B;  2P05 A;  5AI1 A;  1BNJ A;  1UCJ A;  3LT9 A;  1N9E A;  1SIH A;  3CD6 3;  3G16 A;  1BVI A;  4MEI A;  1TFO A;  3WOF B;  3WR2 A;  4KFF A;  1A2V A;  3PXM A;  4FCJ A;  7GSP A;  2AAD A;  1HU9 A;  1T2H A;  3F9S A;  1VQ8 3;  4XM4 A;  4L7K A;  4LYL B;  4N6L A;  3T0U A;  1LVN A;  2FNQ A;  1E97 A;  2I9W A;  2H0I A;  3IJE B;  2KF3 A;  5FGO A;  4O2H A;  2BIR A;  4FCZ A;  3S27 A;  3SED A;  3URP A;  2CWT A;  1JNQ A;  1JBS A;  3N54 B;  5CK6 A;  1UGI A;  4CPK A;  1TUH A;  1TRQ A;  1RTU A;  3OX9 A;  3D79 A;  1YJ9 3;  1O7W B;  1K73 4;  3B4P A;  4OVM A;  2ML6 A;  1BNI A;  1ULI B;  3FSD A;  1DMN A;  2PNC A;  5IG5 A;  3F7X A;  1NJI 4;  3MG2 A;  1I8V A;  3JUO A;  3UB1 A;  2F56 A;  4BU4 A;  5LC7 A;  1OH0 A;  2XRX B;  5G1L A;  3DGM A;  1OUN A;  3CPO A;  1MGW A;  2OQE C;  1BNE A;  1IU7 A;  1YI2 3;  2W56 B;  3GZX B;  1DMQ A;  2UX0 A;  4HVN A;  1QMA A;  2CKF B;  5EQL A;  3DUK A;  2IYJ A;  1IVW A;  3MKI A;  3JUM A;  2CH9 A;  4HBR A;  4HKV B;  1IT8 A;  5IF6 A;  1YJW 3;  1FW7 A;  1FZU A;  2ML5 A;  3EJV A;  2F5W A;  1VQ7 3;  1VQ4 3;  8CHO A;  5CXO A;  1YIJ 3;  3NBB A;  1IDP A;  2P0X A;  3F40 A;  3FKA A;  2GU3 A;  2IUJ A;  4X2O A;  3RGR A;  1I2E A;  1EUI C;  1FUW A;  4WWU C;  2IMJ A;  4FCM A;  2GBW B;  1GS3 A;  3EBY A;  1ULJ B;  1BRI A;  1IQY A;  1W6G A;  5G1K A;  4HJL B;  1OHS A;  5AIG A;  3U97 A;  4FMC A;  1YHQ 3;  5AIH A;  2WGQ A;  2STD A;  2R41 A;  2CFD A;  2Q07 A;  5TGN A;  1IQ8 A;  1SJW A;  1DVD A;  2CFL A;  2OWP A;  4FR9 A;  3EC9 A;  1EKM A;  1T3B A;  2W6J H;  2XF3 A;  1R4Y A;  1LRA A;  4FMB A;  1X1Y A;  3SX1 A;  1RSN A;  3BNE A;  3VF1 A;  7STD A;  2XR8 B;  4XB5 A;  3CMA 3;  1JKG B;  5EEO A;  1RMS A;  5CF2 A;  1LXE A;  3LOY A;  1N8R 4;  1RGE A;  3KKG A;  4GB5 A;  2FXT A;  2YFI B;  1W00 A;  1AVK A;  3D9R A;  5IW9 A;  2AAE A;  2OOV A;  1AQZ A;  2A15 A;  5DRE A;  2W56 A;  4K61 A;  2C10 A;  3DY5 A;  2XFT A;  3EN8 A;  1IQX A;  2WOH A;  3FGY A;  1VQ5 3;  4J9A A;  2Y74 A;  5EVH A;  3Q90 A;  4K90 B;  4BIR A;  3EX9 A;  3MG3 A;  1UCL A;  3GZR A;  3FG3 A;  1STF I;  3B8L A;  1BAN A;  1E3V A;  1RNT A;  1WTH A;  1BRK A;  3M8C A;  2GBX B;  3GSP A;  1O7H B;  4EXR A;  3GRD A;  1AV4 A;  3FH1 A;  3GZY B;  4R9L A;  2QIY A;  2UGI A;  3CCR 3;  1BIR A;  4ZM8 A;  1YGE A;  1X1X A;  5A0O B;  4N3V A; 
#chains in the Genus database with same CATH homology
 1M90 4;  1Q7Y 4;  1FGT A;  3JUP A;  1SQW A;  1LNH A;  2QEX 3;  3FLJ A;  3IMA B;  3MPH A;  4HM6 B;  4IIA A;  1N9J A;  2E2V A;  5JBS A;  1OHP A;  4KZ1 A;  5LC6 A;  1NO3 A;  1JN5 B;  4HYZ A;  5IER A;  3I55 3;  3UJM A;  1OGX A;  4L8O A;  3A76 A;  5AIF A;  3KE7 A;  1W7C A;  3MHE A;  1JKG A;  2D42 A;  4N6N B;  1PFP A;  2W9P A;  3LXU X;  1ZO2 A;  4AKY A;  1A90 A;  1GY5 A;  5IG3 A;  3O8Y A;  1YIT 3;  2WOF A;  3X41 A;  5KP4 A;  2JQ5 A;  1JV2 B;  1N5P A;  1NB3 I;  2GEX A;  1VQ6 3;  5IG4 A;  2GEY A;  4BTW A;  2HMN B;  5IEP A;  2BMO B;  1Q42 A;  3K5T A;  1W6C A;  2SBL A;  1W01 A;  1FA3 A;  4XDW A;  2IUK A;  3CPW 2;  2KCD A;  4MMZ B;  4JRF A;  3CC4 3;  1D6U A;  4IT7 A;  3G71 3;  1VQM 3;  5HGR A;  4AKZ A;  5IEO A;  3JVC A;  3FG1 A;  3WA3 A;  2QA4 3;  4H3U A;  3QK9 A;  3BLZ A;  6STD A;  5I97 A;  2WGO A;  1Q86 4;  3EF8 A;  1MNL A;  1M9G A;  2B24 B;  1KD1 4;  3WOD G;  3I56 3;  2W04 A;  5JPP A;  4QWT A;  1JN5 A;  3PZW A;  1M1X B;  2GXF A;  2Y73 A;  3UL6 A;  2HML B;  1IVX A;  3K0Z A;  1Z1S A;  1NDO B;  4MMX B;  1IT7 A;  2D1W A;  3KFQ C;  1KWI A;  2XEP A;  3PCS A;  3DGO A;  1NB5 I;  1JJ2 2;  2OTJ 3;  1PU4 A;  2OTL 3;  4N6T A;  4H61 A;  3NBR A;  2E2U A;  3S5C A;  2W0Q A;  1Q81 4;  3K7C A;  1CYU A;  5KP3 A;  3MG1 A;  3OW2 2;  4GL6 A;  1VQL 3;  2CC3 A;  1C7H A;  1VQP 3;  3CCU 3;  2B1X B;  1RN7 A;  3EE1 A;  3NQY A;  1WMO A;  3L0R A;  3AMO B;  1QAL A;  1OPY A;  2CWU A;  4OUQ A;  3NM2 A;  2KRT A;  4HZB B;  4TX4 A;  1AR0 A;  1TFK A;  3BNC A;  1EQK A;  4EBG A;  1YVB I;  3HZP A;  1VZZ A;  5STD A;  5ELU A;  4I4K A;  3KSE D;  4LMI A;  2O9U X;  3OWU A;  3T8U A;  4HM2 B;  4OK0 A;  5ELJ A;  3Q1C A;  1JB5 A;  2JDI H;  3BB9 A;  4Q53 A;  4KFD A;  1Y4K A;  2BHM A;  4LGQ A;  2E2T A;  1TU5 A;  1DMM A;  4FMD A;  1EG9 B;  2BNG A;  1VQ9 3;  3U1W A;  4HM5 B;  1CYV A;  2IA7 A;  3NHX A;  3N8B A;  5G2G A;  2GU1 A;  3G6E 3;  4O02 B;  5BXQ A;  5AYS C;  1GY6 A;  1ASK A;  3EB8 A;  2Z7A A;  3CCJ 3;  5AEU B;  1VQN 3;  1U8C B;  1TIJ A;  4AEQ A;  3JUQ A;  3NV0 B;  4LZI A;  3K63 A;  1ISK A;  3BNB A;  3G4S 3;  2F99 A;  3AMO A;  3BND A;  2XSO B;  4L8P A;  1STD A;  4R4K A;  2HMM B;  4G1M B;  3X3Z A;  1K9M 4;  2CFK A;  3FZW A;  4HM3 B;  1D6Z A;  3OWY A;  1QAF A;  3VGN A;  3UL5 A;  3EN1 B;  3X3Y A;  3CCM 3;  1VQK 3;  2OQE A;  5AEW B;  4NHF A;  3PGB A;  3CNM A;  1IV9 A;  3DGN A;  1O7G B;  3OWS A;  4FMA A;  1JB4 A;  1O7M B;  2CG1 A;  3WDG B;  3CCL 3;  3JUN A;  4XDV A;  3K9M C;  1U5O A;  3WMD A;  1ROV A;  1W4N A;  3KSP A;  3J7Y d;  4RNZ A;  3SOA A;  4K1U A;  3PCR A;  3DMC A;  3KN4 A;  2KXG A;  4XBY A;  1SPU A;  3CXC 2;  2MF7 A;  2W2C A;  1W5Z A;  4EC6 A;  1A2K A;  1HKX A;  4LSO A;  3F14 A;  4CCV A;  3EBT A;  1S5A A;  3LTD A;  3GZB A;  2Z77 A;  3SVA A;  3F8H A;  4XBX A;  1IV7 A;  1OGZ A;  3NV0 A;  3CCS 3;  2YFJ B;  2P09 A;  3NX0 A;  3CNX A;  1E3R A;  4PEJ A;  4MMY B;  3GAX A;  4RBN A;  1OF5 B;  2HMO B;  1FGM A;  3SLU A;  3SXX A;  1CQS A;  1WQL B;  3H3H A;  4HM8 B;  4N6O B;  2MC8 A;  3LT8 A;  4WFO A;  3T8N A;  2CIU A;  1KSI A;  2INX A;  3E99 A;  3HI7 A;  4LEH A;  1W6Y A;  5FW5 A;  4BTX A;  2W03 A;  3KII A;  1UUW B;  1KC8 4;  4R80 A;  2OOV C;  3TDG A;  1Q40 B;  5BVB A;  5DRV A;  1BUQ A;  1ZX2 A;  1IK3 A;  2P0M A;  3NUV A;  1F8N A;  1W2Z A;  1G96 A;  1JB2 A;  1FGR A;  3N9H A;  3DM8 A;  1WMP A;  1K8A 4;  1DYU A;  1KQS 2;  1D6Y A;  2FGT A;  1OAC A;  3CU3 A;  2F86 B;  4EV2 A;  2WO0 A;  4RNY A;  3CME 3;  4WYK B;  1S72 3;  3KZT A;  4EV5 A;  2YX9 A;  4N6M A;  3FCS B;  4CDL A;  3NQZ A;  3MWZ A;  3B7C A;  1RKY A;  2HMJ B;  3ECF A;  1OF5 A;  2QGU A;  3LTA A;  4HM1 B;  3X3X A;  2M7O A;  4NRE A;  1UW1 A;  5D81 A;  2V1L A;  3V98 A;  3DZL A;  3EHC A;  1TP6 A;  3G8Z A;  4X2H A;  3STD A;  1V74 A;  1IVU A;  2RFR A;  2RSX A;  3ALA A;  3GWR A;  1O7N B;  4O8S A;  1K41 A;  2OCT A;  3RGA A;  5D82 A;  3Q2P A;  2LYX A;  1T5Y A;  2HMK B;  3NM7 A;  3HK4 A;  1Q40 A;  4BTY A;  3S67 A;  4HM4 B;  5AYR B;  2CHC A;  3LTB A;  1WMN A;  4N6U A;  1M1K 4;  2BMQ B;  1OHO A;  2K54 A;  3LH4 A;  4WHA A;  3CCE 3;  2LQV A;  5IG0 A;  1UI7 A;  1JRQ A;  3DGL A;  2L4V A;  4J8T A;  3QRD A;  3LTC A;  5KP1 A;  1NU3 A;  1QJG A;  5CLK A;  4EYC A;  3V92 A;  4XBT A;  4IPB A;  2BT3 A;  3EQQ B;  3FG4 A;  4WYK A;  2CG0 A;  2PZV A;  5D83 A;  1QVF 2;  2ZL8 A;  1Q82 4;  4R9K A;  3CCQ 3;  3D3L A;  1US1 A;  1GY7 A;  3LYG A;  3HX8 A;  1NWW A;  2XSH B;  3MYT A;  1GD3 A;  1N5H A;  1ROA A;  3PS8 A;  1AVL A;  2O3O A;  1W02 A;  4HM0 B;  3FF2 A;  3SOY A;  3UNL A;  2P38 A;  4O3V A;  1OCV A;  1LOX A;  1EA2 A;  1RRH A;  2CWV A;  3LZA A;  1R4C A;  4ORL A;  1FGQ A;  3B4O A;  4KFE A;  1UUV B;  2RGQ A;  3F7S A;  3FF0 A;  3MSO A;  3CC7 3;  3ROB A;  1YJN 3;  4R1K A;  5JPU A;  1K28 A;  4KVH A;  4K1V A;  3HII A;  3IPT A;  2Z6B A;  3S29 A;  3X42 A;  2CK3 H;  2CFG A;  4RZM A;  1QAK A;  4STD A;  3NBJ A;  2F98 A;  1GD4 A;  1FGO A;  2Z76 A;  2CW9 A;  3NXJ A;  1IVV A;  1DVC A;  2XFS A;  2ZDJ A;  2BMR B;  2XGL A;  4HZ9 B;  4HM7 B;  2R4I A;  2W9Q A;  1SII A;  4MJD A;  2CFW A;  4WP5 A;  3PYJ A;  1VQO 3;  1MOL A;  4N6V 0;  1CEW I;  3OV4 A;  2C11 A;  5CF1 A;  1WNH A;  2K0M A;  3OXA A;  2YFL B;  1GYB A;  3I0Y A;  3RDE A;  1A67 A;  3CC2 3;  4U13 A;  5AII A;  3G0K A;  4JF8 A;  1N8Q A;  2RCD A;  1W2B 2;  1UI8 A;  3CCV 3;  2XGN A;  3V99 A;  3LML A;  1J2B A;  5IEN A;  1RRL A;  1QVG 2;  2BO9 B;  3H51 A;  1L5G B;  3VSY A;  3ER7 A;  3F8X A;  3X40 A;  2XH9 A;  1O7P B;  3DXO A;  3HIG A;  3WA2 X;  3S28 A;  1RJO A;  3WOE B;  2P05 A;  5AI1 A;  3LT9 A;  1N9E A;  1SIH A;  3CD6 3;  3G16 A;  4MEI A;  1TFO A;  3WOF B;  4KFF A;  1A2V A;  3PXM A;  4FCJ A;  1HU9 A;  3F9S A;  1VQ8 3;  4XM4 A;  4L7K A;  4N6L A;  3T0U A;  1LVN A;  2FNQ A;  1E97 A;  2I9W A;  3IJE B;  5FGO A;  4O2H A;  4FCZ A;  3S27 A;  3SED A;  2CWT A;  1JNQ A;  3N54 B;  5CK6 A;  1TUH A;  3OX9 A;  1YJ9 3;  1O7W B;  1K73 4;  3B4P A;  4OVM A;  2ML6 A;  1ULI B;  3FSD A;  1DMN A;  2PNC A;  5IG5 A;  3F7X A;  1NJI 4;  3MG2 A;  3JUO A;  3UB1 A;  5LC7 A;  1OH0 A;  2XRX B;  3DGM A;  1OUN A;  3CPO A;  2OQE C;  1IU7 A;  1YI2 3;  2W56 B;  3GZX B;  1DMQ A;  2UX0 A;  4HVN A;  1QMA A;  2CKF B;  5EQL A;  3DUK A;  1IVW A;  3MKI A;  3JUM A;  2CH9 A;  4HBR A;  4HKV B;  1IT8 A;  5IF6 A;  1YJW 3;  2ML5 A;  3EJV A;  1VQ7 3;  1VQ4 3;  8CHO A;  5CXO A;  1YIJ 3;  3NBB A;  1IDP A;  2P0X A;  3F40 A;  3FKA A;  2GU3 A;  2IUJ A;  4X2O A;  3RGR A;  1FUW A;  4WWU C;  2IMJ A;  4FCM A;  2GBW B;  1GS3 A;  3EBY A;  1ULJ B;  1IQY A;  1W6G A;  4HJL B;  1OHS A;  5AIG A;  3U97 A;  4FMC A;  1YHQ 3;  5AIH A;  2WGQ A;  2STD A;  2CFD A;  2Q07 A;  5TGN A;  1IQ8 A;  1SJW A;  1DVD A;  2CFL A;  2OWP A;  4FR9 A;  3EC9 A;  1EKM A;  2W6J H;  2XF3 A;  4FMB A;  3SX1 A;  3VF1 A;  3BNE A;  7STD A;  2XR8 B;  4XB5 A;  3CMA 3;  1JKG B;  5EEO A;  5CF2 A;  1LXE A;  3LOY A;  1N8R 4;  3KKG A;  4GB5 A;  2FXT A;  2YFI B;  1W00 A;  1AVK A;  3D9R A;  5IW9 A;  2OOV A;  5DRE A;  2A15 A;  2W56 A;  4K61 A;  2C10 A;  3DY5 A;  2XFT A;  3EN8 A;  1IQX A;  2WOH A;  3FGY A;  1VQ5 3;  4J9A A;  2Y74 A;  5EVH A;  3Q90 A;  4K90 B;  3EX9 A;  3MG3 A;  3GZR A;  3FG3 A;  1STF I;  3B8L A;  1E3V A;  1WTH A;  3M8C A;  2GBX B;  1O7H B;  4EXR A;  3GRD A;  1AV4 A;  3FH1 A;  3GZY B;  4R9L A;  2QIY A;  3CCR 3;  4ZM8 A;  1YGE A;  5A0O B;  4N3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...