5LC6A

Crystal structure of a single chain monellin mutant: q28k/c41s/y65r-mnei
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
92
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGKYGRLTFNKVIRPSMKKTIYENEIKGYEYQLYVRASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B,Monellin chain A
publication title Sweeter and stronger: enhancing sweetness and stability of the single chain monellin MNEI through molecular design.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 22
structure length 92
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5lc6A00
1TIJA 3PYJA 4N6MA 1STFI 3QRDA 1NB3I 4N6V0 4N6UA 1M9GA 3KSED 1ROAA 3MWZA 2BO9B 1DVCA 3UL6A 1WNHA 1GD4A 5A0OB 3PXMA 5EQLA 1N5PA 4EYCA 1N5HA 1IV9A 2OCTA 2O9UX 4LZIA 2W9QA 4IT7A 1A67A 1KWIA 1PFPA 3K9MC 2KXGA 1R4CA 3LH4A 3SVAA 3IMAB 4N6NB 5ELUA 5LC6A 1MNLA 3Q2PA 2W9PA 3UL5A 3S67A 4N6TA 3KFQC 1CEWI 3PS8A 3GAXA 1NB5I 3NX0A 1YVBI 4ZM8A 1FUWA 1N9JA 4TX4A 1MOLA 2CH9A 1EQKA 1LXEA 1FA3A 1RN7A 5ELJA 1CYUA 4N6LA 5LC7A 1DVDA 1IV7A 4N6OB 1G96A 1CYVA 1A90A 1GD3A 4CCVA 3L0RA
chains in the Genus database with same CATH superfamily
1W2ZA 2BMRB 1U5OA 1TTOA 1M1K4 1O7PB 3GWRA 4XM4A 4BL3A 3U97A 4K90B 5FGOA 1FGMA 5CK6A 1STDA 4HVNA 4HM5B 2CG1A 1BGSA 1JJ22 1BUQA 1MWUA 1VQM3 1WQLB 1M9GA 1RGLA 4I5QA 1BSCA 3F7XA 3VF1A 1NNVA 3MWZA 4CPKA 2OQEC 3CU3A 3DY5A 1AVKA 1LNIA 5CXOA 3H3HA 2P0MA 5IW9A 1IVUA 2R4IA 3G16A 1BSBA 3LXUX 1GSPA 1VQP3 3S5CA 1AY7A 4XB5A 1ASKA 5A0OB 3PXMA 3STDA 2P05A 1N8R4 1Q7Y4 2XSHB 1E3RA 3FF2A 1OF5A 1LRAA 2F5WA 3MYTA 3B4OA 1RGFA 1NDOB 1TRPA 1NWWA 2FXTA 3H51A 1MWTA 3V92A 1VQQA 1QMAA 3X40A 1I0XA 5CLKA 2OCTA 4NHFA 3V98A 3F40A 4O8SA 3NV0B 4LZIA 4IT7A 1A67A 5EEOA 1KWIA 4X2HA 3K9MC 4EW5A 1KC84 1R4CA 2RBIA 4HM6B 1BNGA 2CFDA 2K54A 2GBXB 1JKGB 3M8CA 2CK3H 3LZAA 3DGLA 4KFEA 4STDA 1W2B2 1I8VA 1YNVX 1T2HA 3AHSA 3G6E3 1LQGC 1D6YA 1PY3A 2QIYA 3DH2A 4LGQA 3BNBA 1M1XB 3WDGB 4GSPA 1SIHA 3HI7A 3MPHA 3NQZA 4BTYA 2Y74A 1SIIA 1RNBA 2RFRA 5AI1A 2E2UA 1KD14 1Q40A 2E2TA 1UCLA 1VQ63 2GEXA 4BTXA 1GS3A 4EXRA 1JKGA 1NB5I 1IQ8A 3PGBA 1BIRA 1YVBI 1A2KA 1JZDA 1N9JA 4JRFA 1O7NB 1BSAA 1SQWA 3AGNA 2CH9A 1B2MA 3X42A 1K9M4 5AYSC 4MMYB 4ILFA 1QAFA 4EV2A 5BVBA 1YGWA 2W04A 3CNXA 5BXQA 2Z77A 3NXJA 2C11A 1AQZA 3MSOA 2B1XB 1CQSA 3QK9A 1RGHA 4AEQA 3OXAA 1YVSA 3B7CA 3X3XA 2OOVA 2B24B 3MG2A 4NPBA 1BSDA 2O3OA 2OWPA 4L8OA 1IVXA 3NBJA 3NQYA 3LTAA 1D6ZA 5JBSA 3EBTA 3KN4A 1YJW3 1WMOA 3EJVA 3RGRA 4KFFA 1C7HA 1SPUA 1GD3A 2WOHA 5IEOA 2M7OA 3EQQB 1K41A 2BIRA 3K63A 3SX1A 3L0RA 3UJMA 5M19A 4FMCA 3JUQA 3A76A 1NJI4 1QAKA 5JPUA 3GZBA 1UI8A 2CW9A 1OHOA 1LQMB 4R9LA 4WP5A 2BT3A 1I2GA 5IG3A 4H3UA 1IT7A 3D9RA 3CC43 2XGLA 1YHQ3 1AV4A 1BNRA 4HM8B 3LTDA 1SJWA 3CMA3 4RBNA 4KT3B 2XFTA 3NM7A 1RGKA 2MF7A 1UUWB 4N6UA 5EVHA 1HYFA 5HGRA 3KSED 1B21A 4J9AA 3KIIA 1OHSA 2C4BA 7GSPA 3CCQ3 1IVVA 1ROAA 1TJDA 3FSDA 3G0KA 3OV4A 3SXXA 1IK3A 1RCKA 1Y4KA 2XFSA 1DVCA 3Q1CA 5G2GA 1OUNA 3GZRA 1VQ53 1UCKA 4J8TA 1IT8A 3NHXA 1RN1A 3G8ZA 2QA43 1KSIA 2W03A 1TFKA 9RNTA 2BU4A 5IERA 1RGEA 3HIIA 3JUNA 5EQLA 1HU9A 1FUTA 1DMNA 2KRTA 4EYCA 3CCJ3 2OOVC 3SEDA 1JBRA 4WWUC 4OK0A 2Y73A 1I3IA 3ECFA 3FGYA 3WODG 4IPBA 1UGHI 3D5GA 3NM2A 3VGNA 1DMQA 4HZBB 5BU4A 3PCRA 7RNTA 3G713 1RHLA 3BNEA 1OF5B 3LH4A 1EA2A 4HM7B 5TGNA 5D81A 5STDA 4FR9A 3D3LA 1J2BA 1JN5A 4XDVA 4J5KA 2L4VA 4R1KA 3GZYB 2P0XA 5AIFA 1NU3A 1WMNA 2QGUA 1JB5A 1B2SA 1Q9EA 3KSPA 5ELUA 2AAEA 2WOFA 3EF8A 1K734 1MNLA 1GMRA 2CWVA 3Q2PA 1G0TA 4BTWA 3CCU3 1JB4A 3UNLA 4FMDA 2LQVA 2SARA 3EHCA 1OGXA 3B4PA 4N6TA 2GU1A 2HOHA 5CF2A 2K3DA 5M18A 2KF3A 1JB2A 1BRKA 1TU5A 1MWSA 4AKYA 1BRHA 2C10A 1VQO3 1S5AA 3Q3FA 1YGEA 1BNFA 3EE1A 4AKZA 5KP4A 1T5YA 4BL2A 1W4NA 2Q07A 1Q40B 1NO3A 1BNJA 2Z7AA 4LSOA 4RNYA 2QEX3 1JBSA 5G1LA 3WOEB 1EQKA 1WMPA 1OH0A 1QJGA 1DYUA 1TFOA 1V74A 3KE7A 2CG0A 1TRQA 2D1WA 2IMJA 3GZXB 1FGRA 3LOYA 4MEIA 2KCDA 1IQXA 4KFDA 1RGGA 1PU4A 1AR0A 1VQ83 4N6LA 3ROBA 1BNEA 3FLJA 7STDA 4LMIA 6GSPA 5LC7A 3ZFZA 2R41A 3OWSA 2ZDJA 3DGMA 3DUKA 4RNTA 5M1AA 1W02A 3GSPA 1OPYA 1FGQA 4HAAA 3MG1A 5IG4A 3F9SA 3CPW2 2J8XB 1MGWA 1RMSA 4N6OB 2SBLA 3D79A 5DREA 1I0VA 2STDA 1EKMA 5IF6A 6RNTA 2YFLB 4XBTA 3GRDA 4JF8A 1O7MB 1RCLA 2P09A 4O2HA 3FF0A 2H0HA 4GB5A 4CCVA 3IPTA 5IENA 4CDLA 1FUSA 3S28A 1RGAA 2UGIA 4N3VA 4OUQA 1B20A 5DRVA 2ZL8A 4LEHA 3CC23 1O7HB 4RNZA 1ZGXA 4HM1B 1TIJA 2KF6A 4H61A 1BUJA 3ALAA 2GEYA 3I553 3E99A 3PYJA 3OWUA 3EN1B 1BRJA 2AADA 1A2VA 2A15A 1BOXA 2GXFA 3LTCA 3QRDA 2WO0A 1NB3I 3X41A 1I2EA 2KF5A 3B8LA 1GOYA 4N6V0 4WHAA 3A5EA 2UUGC 1ISKA 1RGCA 1W7CA 3Q90A 5GSPA 1RRHA 3AGOA 1VZZA 2F56A 2HMOB 1MGRA 1RLSA 1W00A 2WGOA 4WYKA 1VQ43 4J5GA 5IG0A 1BAOA 2YFJB 1GMQA 1UDII 2RSXA 1B27A 3TDGA 2F99A 3RNTA 3UL6A 4Q53A 3K7CA 1TP6A 1Q7HA 3BB9A 1WNHA 2W56A 2OTJ3 1GOVA 3LMLA 3CNMA 1EEJA 1U8CB 1QVG2 4XDWA 2HMJB 2CHCA 3BIRA 4R9KA 2GSPA 4HM3B 1V57A 2RNTA 1E97A 1N5HA 1RDSA 3BNCA 3U1WA 5I97A 4FMAA 5AEUB 3MKIA 1D6UA 1I70A 1QVF2 3EN8A 1O7GB 4HKVB 3DGNA 1BU4A 4DKIA 1Q42A 1PFPA 1TUHA 4ORLA 3IJEB 2P38A 3FCSB 1DETA 1I2FA 1OGZA 3T8NA 2CC3A 1ROVA 3X3YA 1W5ZA 3V99A 3KZTA 3FG4A 3JUPA 5IG5A 2ZHXB 4MJDA 1JZOA 1LNHA 4BU4A 3WA3A 1US1A 2HMNB 1DMMA 3DXOA 3OWYA 1SARA 6STDA 1BNSA 1T2IA 2JQ5A 2Z76A 2CX1A 1G02A 2XGNA 2GU3A 1T3BA 3I563 4QWTA 2W9PA 3S67A 3AMOA 1JN5B 1X1WA 3HK4A 5AIHA 3UB1A 3EB8A 3DM8A 1LOYA 1UW1A 2WGQA 3KFQC 3BLZA 3SOYA 1RJOA 3SLUA 2XRXB 3NX0A 2CWTA 2V1LA 1I3FA 4R4KA 2GBWB 2K0MA 1FUWA 3SYUA 2FGTA 1YJN3 2ZA4A 3CME3 1FGOA 4TX4A 4IIAA 5AIGA 1W6YA 1LXEA 1F8NA 1B2ZA 1FA3A 1OHPA 4GL6A 1RN7A 1KQS2 5ELJA 3LTBA 5G1KA 1BNIA 3LT8A 3URPA 5IEPA 1R4YA 2I9WA 3N54B 1FYSA 2CKFB 3ZG0A 3JUMA 1UCIA 3N9HA 4X2OA 3K5TA 1RNTA 1UUVB 1W01A 1RKYA 1DVDA 1N8QA 1RRLA 8RNTA 3ZG5A 2BNGA 1O7WB 3RDEA 4HJLB 4OVMA 3AHWA 3LYGA 1G96A 3KCHA 3PZWA 1CYVA 3F7SA 1PYLA 2H0IA 2ML6A 1VQL3 3EC9A 3HX8A 3CCS3 3FH1A 4XBXA 4HM2B 5BIRA 2H0GA 3MHEA 3JUOA 1UCJA 1RTUA 1JNQA 1EG9B 2KAAA 1X1YA 4FMBA 1LOWA 1GMPA 3LT9A 4K1UA 3CCE3 2F86B 4N6MA 1V58A 3DGYA 3X3ZA 3FZWA 1GOUA 3S27A 1STFI 1BRGA 2IY2A 3D4AA 2W2CA 5RNTA 4BIRA 1YIJ3 2BMQB 1BSEA 1DE3A 4HBRA 1K28A 4GHOA 3KKGA 3WA2X 1AVLA 3HOHA 4FCJA 1Q864 1ULIB 2F5MA 4EV5A 1YIT3 1X1UA 2BO9B 4R80A 5D82A 3OW22 2HMLB 1MWRA 1IQYA 1LVNA 1C54A 1YJ93 2CX0A 2IUKA 1IVWA 3PCSA 4FCZA 1B2XA 2YX9A 1GY5A 2ML5A 2E2VA 4FCMA 1JV2B 5FW5A 1IYYA 4L7KA 1GD4A 3NV0A 4WYKB 1W6CA 1E3VA 1VQN3 3BU4A 3RGAA 1HZ1A 1FZUA 1N5PA 4KVHA 4U13A 2W0QA 2CFLA 2IUJA 3CC73 5KP3A 4O3VA 3J7Yd 2W56B 3I0YA 8CHOA 3K0ZA 2F98A 3EX9A 2HMKB 1Z1SA 2F4YA 1IV9A 4HM4B 4WFOA 5KP1A 4KZ1A 2O9UX 3CCL3 2W9QA 1A2PA 4HYZA 3DMCA 2IA7A 3O8YA 3N8BA 2KXGA 3NBRA 2JDIH 1VQK3 3SVAA 5AYRB 1B2UA 1BVIA 1FGTA 3IMAB 4MMZB 3F14A 4N6NB 2Z6BA 4EC6A 3BNDA 4HM0B 1X1XA 2UX0A 3CPOA 3G4S3 1LOVA 1UGIA 1QALA 3ER7A 5LC6A 1ZS7A 3SOAA 2CIUA 1S723 2XR8B 2LYXA 3T0UA 3JVCA 3VSYA 5HOHA 4HOHA 4XBYA 3UL5A 2L1SA 2XH9A 1IDPA 2W6JH 1JBTA 3NUVA 5D83A 3S29A 3FG3A 1ZX2A 2CFKA 1CEWI 3PS8A 3GAXA 2RGQA 1VQ93 1HKXA 3OX9A 1K8A4 2YFIB 4K1VA 1FW7A 1RSNA 1CH0A 4ZM8A 2OQEA 4G1MB 3AMOB 4CJNA 4LYLB 1BANA 3MG3A 1MOLA 1WTHA 3FG1A 3F8HA 1BRSA 3WOFB 1B3SA 3WR2A 3CCM3 1UI7A 1YI23 3CD63 2KF4A 3HIGA 1RN4A 1CYUA 2XF3A 2CFGA 1JRQA 2D42A 1UUGB 3T8UA 3DGOA 3NBBA 5JPPA 5CF1A 2XSOB 3F8XA 1Q814 4EBGA 2CWUA 1BRIA 4HZ9B 2BMOB 3D5IA 1LOXA 3HZPA 1OCVA 1IV7A 1L5GB 2BHMA 1EUIC 1GY7A 2XEPA 2PNCA 2RCDA 1Q824 1N9EA 4MMXB 3CXC2 1M904 1OACA 2OTL3 2FNQA 1GYBA 4K61A 3CCV3 1A90A 2INXA 4NREA 1VQ73 2HMMB 3CCR3 5AIIA 2IYJA 4O02B 1W6GA 4L8PA 4PEJA 4RZMA 1ULJB 3EBYA 2PZVA 2MC8A 3WMDA 5AEWB 1BRNL 1GY6A 3DZLA 3WHOA 2CFWA 3FKAA 4I4KA 1IU7A 1ZO2A
chains in the Genus database with same CATH topology
1W2ZA 2BMRB 1U5OA 1M1K4 1O7PB 3GWRA 4XM4A 3U97A 4K90B 5FGOA 1FGMA 5CK6A 1STDA 4HVNA 4HM5B 2CG1A 1JJ22 1BUQA 1VQM3 1WQLB 1M9GA 3F7XA 3VF1A 3MWZA 2OQEC 3CU3A 3DY5A 1AVKA 5CXOA 3H3HA 2P0MA 5IW9A 1IVUA 2R4IA 3G16A 1VQP3 3LXUX 3S5CA 4XB5A 1ASKA 5A0OB 3PXMA 3STDA 2P05A 1N8R4 1Q7Y4 2XSHB 1E3RA 3FF2A 1OF5A 3MYTA 3B4OA 2FXTA 1NDOB 3H51A 1NWWA 3V92A 3X40A 6STDA 1QMAA 5CLKA 2OCTA 4NHFA 3V98A 3F40A 4O8SA 3NV0B 4LZIA 4IT7A 1A67A 5EEOA 1KWIA 4X2HA 3K9MC 1KC84 1R4CA 4HM6B 2CFDA 2K54A 2GBXB 1JKGB 3M8CA 2CK3H 3LZAA 3DGLA 4KFEA 4STDA 1W2B2 3G6E3 2QIYA 1D6YA 1K8A4 4LGQA 3WDGB 3BNBA 1M1XB 1SIHA 3HI7A 3MPHA 3NQZA 4BTYA 2Y74A 1SIIA 2RFRA 5AI1A 2E2UA 1KD14 1Q40A 2E2TA 1VQ63 2GEXA 4BTXA 1GS3A 4EXRA 1JKGA 1NB5I 1IQ8A 3PGBA 1YVBI 1A2KA 1N9JA 4JRFA 1O7NB 1SQWA 2CH9A 3X42A 1K9M4 5AYSC 4MMYB 4EV2A 1QAFA 5BVBA 2W04A 3CNXA 5BXQA 2Z77A 3NXJA 2C11A 3MSOA 2B1XB 1CQSA 3QK9A 4AEQA 3OXAA 3B7CA 3X3XA 2OOVA 2B24B 3MG2A 2O3OA 2OWPA 4L8OA 1IVXA 3NBJA 3NQYA 3LTAA 1D6ZA 5JBSA 3EBTA 3KN4A 1YJW3 1WMOA 3EJVA 3RGRA 4KFFA 1C7HA 1SPUA 1GD3A 2WOHA 5IEOA 2M7OA 3EQQB 1K41A 3K63A 3SX1A 3UJMA 3L0RA 4FMCA 3JUQA 3A76A 1NJI4 1QAKA 5JPUA 3GZBA 1UI8A 2CW9A 1OHOA 4R9LA 4WP5A 2BT3A 5IG3A 4H3UA 1IT7A 3D9RA 3CC43 2XGLA 1YHQ3 1AV4A 4HM8B 3LTDA 1SJWA 3CMA3 4RBNA 2XFTA 3NM7A 2MF7A 4N6UA 1UUWB 5EVHA 5HGRA 3KSED 4J9AA 3KIIA 1OHSA 3CCQ3 1IVVA 1ROAA 3FSDA 3G0KA 3OV4A 3SXXA 1IK3A 1Y4KA 2XFSA 1DVCA 3Q1CA 5G2GA 1OUNA 3GZRA 1VQ53 4J8TA 1IT8A 3NHXA 2QA43 3G8ZA 1KSIA 2W03A 1TFKA 5IERA 3HIIA 3JUNA 5EQLA 1HU9A 1DMNA 2KRTA 4EYCA 3CCJ3 2OOVC 3SEDA 4WWUC 4OK0A 2Y73A 3ECFA 3WODG 3FGYA 4IPBA 3VGNA 3NM2A 1DMQA 4HZBB 3PCRA 3G713 3BNEA 1OF5B 3LH4A 1EA2A 4HM7B 5TGNA 5D81A 5STDA 4FR9A 3D3LA 1J2BA 1JN5A 4XDVA 2L4VA 4R1KA 3GZYB 2P0XA 5AIFA 1NU3A 1WMNA 2QGUA 1JB5A 3KSPA 5ELUA 2WOFA 3EF8A 1K734 1MNLA 2CWVA 3Q2PA 4BTWA 3CCU3 1JB4A 3UNLA 4FMDA 2LQVA 3EHCA 1OGXA 3B4PA 4N6TA 2GU1A 5CF2A 1JB2A 1TU5A 4AKYA 2C10A 1VQO3 1S5AA 5KP4A 1YGEA 3EE1A 4AKZA 1T5YA 1W4NA 2Q07A 1Q40B 1NO3A 4LSOA 2Z7AA 4RNYA 2QEX3 3WOEB 1EQKA 1WMPA 1OH0A 1QJGA 1DYUA 1TFOA 1V74A 3KE7A 2CG0A 2D1WA 2IMJA 3LOYA 3GZXB 1FGRA 4MEIA 4U13A 2KCDA 1IQXA 4KFDA 1PU4A 1VQ83 1AR0A 4N6LA 3ROBA 7STDA 3FLJA 4LMIA 5LC7A 3OWSA 2ZDJA 3DGMA 3DUKA 1W02A 1OPYA 1FGQA 3MG1A 5IG4A 3F9SA 3CPW2 4N6OB 2SBLA 5DREA 2STDA 1EKMA 5IF6A 2YFLB 4XBTA 3GRDA 4JF8A 1O7MB 2P09A 4O2HA 3FF0A 4GB5A 4CCVA 3IPTA 5IENA 4CDLA 3S28A 4N3VA 4OUQA 5DRVA 2ZL8A 4LEHA 3CC23 1O7HB 4RNZA 4HM1B 1TIJA 4H61A 3ALAA 2GEYA 3I553 3E99A 3PYJA 3OWUA 3EN1B 1A2VA 2A15A 3LTCA 2GXFA 3QRDA 2WO0A 1NB3I 3X41A 3B8LA 4N6V0 4WHAA 1ISKA 1W7CA 3Q90A 1RRHA 1VZZA 2HMOB 1W00A 2WGOA 4WYKA 1VQ43 5IG0A 2YFJB 2RSXA 3TDGA 2F99A 3UL6A 4Q53A 3K7CA 1TP6A 3BB9A 2OTJ3 1WNHA 2W56A 3LMLA 3CNMA 1U8CB 1QVG2 4XDWA 2HMJB 2CHCA 4R9KA 4HM3B 1E97A 1N5HA 3BNCA 3U1WA 5I97A 4FMAA 5AEUB 3MKIA 1D6UA 1QVF2 3EN8A 1O7GB 4HKVB 3DGNA 1Q42A 1PFPA 1TUHA 4ORLA 3IJEB 2P38A 3FCSB 1OGZA 3T8NA 2CC3A 1ROVA 3X3YA 1W5ZA 3V99A 3KZTA 3FG4A 3JUPA 5IG5A 4MJDA 1LNHA 3WA3A 1US1A 2HMNB 1DMMA 3DXOA 3OWYA 2JQ5A 2Z76A 2XGNA 2GU3A 3I563 4QWTA 2W9PA 3S67A 3AMOA 1JN5B 3HK4A 5AIHA 3UB1A 3EB8A 3DM8A 2WGQA 1UW1A 3KFQC 3BLZA 3SOYA 1RJOA 3SLUA 2XRXB 3NX0A 2CWTA 2V1LA 4R4KA 2GBWB 2K0MA 1FUWA 2FGTA 1YJN3 3CME3 1FGOA 4TX4A 4IIAA 5AIGA 1LXEA 1W6YA 1F8NA 1FA3A 1OHPA 4GL6A 1RN7A 1KQS2 5ELJA 3LTBA 3LT8A 5IEPA 2I9WA 3N54B 2CKFB 3JUMA 3N9HA 4X2OA 3K5TA 1UUVB 1W01A 1RKYA 1DVDA 1N8QA 1RRLA 2BNGA 1O7WB 3RDEA 4HJLB 4OVMA 3LYGA 1G96A 3PZWA 1CYVA 3F7SA 2ML6A 1VQL3 3EC9A 3HX8A 3CCS3 3FH1A 4XBXA 4HM2B 3MHEA 3JUOA 1JNQA 1EG9B 4FMBA 3LT9A 4K1UA 3CCE3 2F86B 4N6MA 3X3ZA 3FZWA 3S27A 1STFI 2W2CA 1YIJ3 2BMQB 4HBRA 1K28A 3KKGA 3WA2X 1AVLA 4FCJA 1Q864 1ULIB 4EV5A 1YIT3 2BO9B 4R80A 5D82A 3OW22 2HMLB 1IQYA 1LVNA 1YJ93 2IUKA 1IVWA 3PCSA 4FCZA 2YX9A 1GY5A 2ML5A 2E2VA 4FCMA 1JV2B 5FW5A 4L7KA 1GD4A 3NV0A 4WYKB 1W6CA 1E3VA 1VQN3 3RGAA 1N5PA 4KVHA 2W0QA 2CFLA 2IUJA 3CC73 5KP3A 4O3VA 3J7Yd 2W56B 3I0YA 8CHOA 3K0ZA 2F98A 3EX9A 2HMKB 1Z1SA 4WFOA 1IV9A 4HM4B 5KP1A 4KZ1A 2O9UX 3CCL3 2W9QA 4HYZA 3DMCA 2IA7A 3O8YA 3N8BA 2KXGA 3NBRA 2JDIH 1VQK3 3SVAA 5AYRB 1FGTA 3IMAB 4MMZB 3F14A 4N6NB 2Z6BA 4EC6A 3BNDA 4HM0B 2UX0A 3CPOA 3G4S3 1QALA 3ER7A 5LC6A 3SOAA 1S723 2CIUA 2XR8B 2LYXA 3T0UA 3JVCA 3VSYA 4XBYA 3UL5A 2XH9A 1IDPA 2W6JH 3NUVA 5D83A 3S29A 3FG3A 1ZX2A 2CFKA 1CEWI 3PS8A 3GAXA 2RGQA 1VQ93 1HKXA 3OX9A 2YFIB 4K1VA 4ZM8A 2OQEA 4G1MB 3AMOB 3MG3A 1MOLA 1WTHA 3FG1A 3F8HA 3WOFB 1YI23 3CCM3 1UI7A 3CD63 3HIGA 1CYUA 2XF3A 2CFGA 1JRQA 2D42A 3T8UA 3DGOA 3NBBA 5JPPA 5CF1A 2XSOB 3F8XA 1Q814 4EBGA 2CWUA 4HZ9B 2BMOB 1LOXA 3HZPA 1OCVA 1IV7A 1L5GB 2BHMA 1GY7A 2XEPA 2PNCA 2RCDA 1Q824 1N9EA 4MMXB 3CXC2 1M904 1OACA 2OTL3 2FNQA 1GYBA 4K61A 3CCV3 1A90A 2INXA 4NREA 1VQ73 2HMMB 3CCR3 5AIIA 4O02B 1W6GA 4L8PA 4PEJA 4RZMA 1ULJB 3EBYA 2PZVA 2MC8A 3WMDA 5AEWB 1GY6A 3DZLA 2CFWA 3FKAA 4I4KA 1IU7A 1ZO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TIJ A;  3PYJ A;  4N6M A;  1STF I;  3QRD A;  1NB3 I;  4N6V 0;  4N6U A;  1M9G A;  3KSE D;  1ROA A;  3MWZ A;  2BO9 B;  1DVC A;  3UL6 A;  1WNH A;  1GD4 A;  5A0O B;  3PXM A;  5EQL A;  1N5P A;  4EYC A;  1N5H A;  1IV9 A;  2OCT A;  2O9U X;  4LZI A;  2W9Q A;  4IT7 A;  1A67 A;  1KWI A;  1PFP A;  3K9M C;  2KXG A;  1R4C A;  3LH4 A;  3SVA A;  3IMA B;  4N6N B;  5ELU A;  5LC6 A;  1MNL A;  3Q2P A;  2W9P A;  3UL5 A;  3S67 A;  4N6T A;  3KFQ C;  1CEW I;  3PS8 A;  3GAX A;  1NB5 I;  3NX0 A;  1YVB I;  4ZM8 A;  1FUW A;  1N9J A;  4TX4 A;  1MOL A;  2CH9 A;  1EQK A;  1LXE A;  1FA3 A;  1RN7 A;  5ELJ A;  1CYU A;  4N6L A;  5LC7 A;  1DVD A;  1IV7 A;  4N6O B;  1G96 A;  1CYV A;  1A90 A;  1GD3 A;  4CCV A;  3L0R A; 
#chains in the Genus database with same CATH topology
 1W2Z A;  2BMR B;  1U5O A;  1TTO A;  1M1K 4;  1O7P B;  3GWR A;  4XM4 A;  4BL3 A;  3U97 A;  4K90 B;  5FGO A;  1FGM A;  5CK6 A;  1STD A;  4HVN A;  4HM5 B;  2CG1 A;  1BGS A;  1JJ2 2;  1BUQ A;  1MWU A;  1VQM 3;  1WQL B;  1M9G A;  1RGL A;  4I5Q A;  1BSC A;  3F7X A;  3VF1 A;  1NNV A;  3MWZ A;  4CPK A;  2OQE C;  3CU3 A;  3DY5 A;  1AVK A;  1LNI A;  5CXO A;  3H3H A;  2P0M A;  5IW9 A;  1IVU A;  2R4I A;  3G16 A;  1BSB A;  3LXU X;  1GSP A;  1VQP 3;  3S5C A;  1AY7 A;  4XB5 A;  1ASK A;  5A0O B;  3PXM A;  3STD A;  2P05 A;  1N8R 4;  1Q7Y 4;  2XSH B;  1E3R A;  3FF2 A;  1OF5 A;  1LRA A;  2F5W A;  3MYT A;  3B4O A;  1RGF A;  1NDO B;  1TRP A;  1NWW A;  2FXT A;  3H51 A;  1MWT A;  3V92 A;  1VQQ A;  1QMA A;  3X40 A;  1I0X A;  5CLK A;  2OCT A;  4NHF A;  3V98 A;  3F40 A;  4O8S A;  3NV0 B;  4LZI A;  4IT7 A;  1A67 A;  5EEO A;  1KWI A;  4X2H A;  3K9M C;  4EW5 A;  1KC8 4;  1R4C A;  2RBI A;  4HM6 B;  1BNG A;  2CFD A;  2K54 A;  2GBX B;  1JKG B;  3M8C A;  2CK3 H;  3LZA A;  3DGL A;  4KFE A;  4STD A;  1W2B 2;  1I8V A;  1YNV X;  1T2H A;  3AHS A;  3G6E 3;  1LQG C;  1D6Y A;  1PY3 A;  2QIY A;  3DH2 A;  4LGQ A;  3BNB A;  1M1X B;  3WDG B;  4GSP A;  1SIH A;  3HI7 A;  3MPH A;  3NQZ A;  4BTY A;  2Y74 A;  1SII A;  1RNB A;  2RFR A;  5AI1 A;  2E2U A;  1KD1 4;  1Q40 A;  2E2T A;  1UCL A;  1VQ6 3;  2GEX A;  4BTX A;  1GS3 A;  4EXR A;  1JKG A;  1NB5 I;  1IQ8 A;  3PGB A;  1BIR A;  1YVB I;  1A2K A;  1JZD A;  1N9J A;  4JRF A;  1O7N B;  1BSA A;  1SQW A;  3AGN A;  2CH9 A;  1B2M A;  3X42 A;  1K9M 4;  5AYS C;  4MMY B;  4ILF A;  1QAF A;  4EV2 A;  5BVB A;  1YGW A;  2W04 A;  3CNX A;  5BXQ A;  2Z77 A;  3NXJ A;  2C11 A;  1AQZ A;  3MSO A;  2B1X B;  1CQS A;  3QK9 A;  1RGH A;  4AEQ A;  3OXA A;  1YVS A;  3B7C A;  3X3X A;  2OOV A;  2B24 B;  3MG2 A;  4NPB A;  1BSD A;  2O3O A;  2OWP A;  4L8O A;  1IVX A;  3NBJ A;  3NQY A;  3LTA A;  1D6Z A;  5JBS A;  3EBT A;  3KN4 A;  1YJW 3;  1WMO A;  3EJV A;  3RGR A;  4KFF A;  1C7H A;  1SPU A;  1GD3 A;  2WOH A;  5IEO A;  2M7O A;  3EQQ B;  1K41 A;  2BIR A;  3K63 A;  3SX1 A;  3L0R A;  3UJM A;  5M19 A;  4FMC A;  3JUQ A;  3A76 A;  1NJI 4;  1QAK A;  5JPU A;  3GZB A;  1UI8 A;  2CW9 A;  1OHO A;  1LQM B;  4R9L A;  4WP5 A;  2BT3 A;  1I2G A;  5IG3 A;  4H3U A;  1IT7 A;  3D9R A;  3CC4 3;  2XGL A;  1YHQ 3;  1AV4 A;  1BNR A;  4HM8 B;  3LTD A;  1SJW A;  3CMA 3;  4RBN A;  4KT3 B;  2XFT A;  3NM7 A;  1RGK A;  2MF7 A;  1UUW B;  4N6U A;  5EVH A;  1HYF A;  5HGR A;  3KSE D;  1B21 A;  4J9A A;  3KII A;  1OHS A;  2C4B A;  7GSP A;  3CCQ 3;  1IVV A;  1ROA A;  1TJD A;  3FSD A;  3G0K A;  3OV4 A;  3SXX A;  1IK3 A;  1RCK A;  1Y4K A;  2XFS A;  1DVC A;  3Q1C A;  5G2G A;  1OUN A;  3GZR A;  1VQ5 3;  1UCK A;  4J8T A;  1IT8 A;  3NHX A;  1RN1 A;  3G8Z A;  2QA4 3;  1KSI A;  2W03 A;  1TFK A;  9RNT A;  2BU4 A;  5IER A;  1RGE A;  3HII A;  3JUN A;  5EQL A;  1HU9 A;  1FUT A;  1DMN A;  2KRT A;  4EYC A;  3CCJ 3;  2OOV C;  3SED A;  1JBR A;  4WWU C;  4OK0 A;  2Y73 A;  1I3I A;  3ECF A;  3FGY A;  3WOD G;  4IPB A;  1UGH I;  3D5G A;  3NM2 A;  3VGN A;  1DMQ A;  4HZB B;  5BU4 A;  3PCR A;  7RNT A;  3G71 3;  1RHL A;  3BNE A;  1OF5 B;  3LH4 A;  1EA2 A;  4HM7 B;  5TGN A;  5D81 A;  5STD A;  4FR9 A;  3D3L A;  1J2B A;  1JN5 A;  4XDV A;  4J5K A;  2L4V A;  4R1K A;  3GZY B;  2P0X A;  5AIF A;  1NU3 A;  1WMN A;  2QGU A;  1JB5 A;  1B2S A;  1Q9E A;  3KSP A;  5ELU A;  2AAE A;  2WOF A;  3EF8 A;  1K73 4;  1MNL A;  1GMR A;  2CWV A;  3Q2P A;  1G0T A;  4BTW A;  3CCU 3;  1JB4 A;  3UNL A;  4FMD A;  2LQV A;  2SAR A;  3EHC A;  1OGX A;  3B4P A;  4N6T A;  2GU1 A;  2HOH A;  5CF2 A;  2K3D A;  5M18 A;  2KF3 A;  1JB2 A;  1BRK A;  1TU5 A;  1MWS A;  4AKY A;  1BRH A;  2C10 A;  1VQO 3;  1S5A A;  3Q3F A;  1YGE A;  1BNF A;  3EE1 A;  4AKZ A;  5KP4 A;  1T5Y A;  4BL2 A;  1W4N A;  2Q07 A;  1Q40 B;  1NO3 A;  1BNJ A;  2Z7A A;  4LSO A;  4RNY A;  2QEX 3;  1JBS A;  5G1L A;  3WOE B;  1EQK A;  1WMP A;  1OH0 A;  1QJG A;  1DYU A;  1TFO A;  1V74 A;  3KE7 A;  2CG0 A;  1TRQ A;  2D1W A;  2IMJ A;  3GZX B;  1FGR A;  3LOY A;  4MEI A;  2KCD A;  1IQX A;  4KFD A;  1RGG A;  1PU4 A;  1AR0 A;  1VQ8 3;  4N6L A;  3ROB A;  1BNE A;  3FLJ A;  7STD A;  4LMI A;  6GSP A;  5LC7 A;  3ZFZ A;  2R41 A;  3OWS A;  2ZDJ A;  3DGM A;  3DUK A;  4RNT A;  5M1A A;  1W02 A;  3GSP A;  1OPY A;  1FGQ A;  4HAA A;  3MG1 A;  5IG4 A;  3F9S A;  3CPW 2;  2J8X B;  1MGW A;  1RMS A;  4N6O B;  2SBL A;  3D79 A;  5DRE A;  1I0V A;  2STD A;  1EKM A;  5IF6 A;  6RNT A;  2YFL B;  4XBT A;  3GRD A;  4JF8 A;  1O7M B;  1RCL A;  2P09 A;  4O2H A;  3FF0 A;  2H0H A;  4GB5 A;  4CCV A;  3IPT A;  5IEN A;  4CDL A;  1FUS A;  3S28 A;  1RGA A;  2UGI A;  4N3V A;  4OUQ A;  1B20 A;  5DRV A;  2ZL8 A;  4LEH A;  3CC2 3;  1O7H B;  4RNZ A;  1ZGX A;  4HM1 B;  1TIJ A;  2KF6 A;  4H61 A;  1BUJ A;  3ALA A;  2GEY A;  3I55 3;  3E99 A;  3PYJ A;  3OWU A;  3EN1 B;  1BRJ A;  2AAD A;  1A2V A;  2A15 A;  1BOX A;  2GXF A;  3LTC A;  3QRD A;  2WO0 A;  1NB3 I;  3X41 A;  1I2E A;  2KF5 A;  3B8L A;  1GOY A;  4N6V 0;  4WHA A;  3A5E A;  2UUG C;  1ISK A;  1RGC A;  1W7C A;  3Q90 A;  5GSP A;  1RRH A;  3AGO A;  1VZZ A;  2F56 A;  2HMO B;  1MGR A;  1RLS A;  1W00 A;  2WGO A;  4WYK A;  1VQ4 3;  4J5G A;  5IG0 A;  1BAO A;  2YFJ B;  1GMQ A;  1UDI I;  2RSX A;  1B27 A;  3TDG A;  2F99 A;  3RNT A;  3UL6 A;  4Q53 A;  3K7C A;  1TP6 A;  1Q7H A;  3BB9 A;  1WNH A;  2W56 A;  2OTJ 3;  1GOV A;  3LML A;  3CNM A;  1EEJ A;  1U8C B;  1QVG 2;  4XDW A;  2HMJ B;  2CHC A;  3BIR A;  4R9K A;  2GSP A;  4HM3 B;  1V57 A;  2RNT A;  1E97 A;  1N5H A;  1RDS A;  3BNC A;  3U1W A;  5I97 A;  4FMA A;  5AEU B;  3MKI A;  1D6U A;  1I70 A;  1QVF 2;  3EN8 A;  1O7G B;  4HKV B;  3DGN A;  1BU4 A;  4DKI A;  1Q42 A;  1PFP A;  1TUH A;  4ORL A;  3IJE B;  2P38 A;  3FCS B;  1DET A;  1I2F A;  1OGZ A;  3T8N A;  2CC3 A;  1ROV A;  3X3Y A;  1W5Z A;  3V99 A;  3KZT A;  3FG4 A;  3JUP A;  5IG5 A;  2ZHX B;  4MJD A;  1JZO A;  1LNH A;  4BU4 A;  3WA3 A;  1US1 A;  2HMN B;  1DMM A;  3DXO A;  3OWY A;  1SAR A;  6STD A;  1BNS A;  1T2I A;  2JQ5 A;  2Z76 A;  2CX1 A;  1G02 A;  2XGN A;  2GU3 A;  1T3B A;  3I56 3;  4QWT A;  2W9P A;  3S67 A;  3AMO A;  1JN5 B;  1X1W A;  3HK4 A;  5AIH A;  3UB1 A;  3EB8 A;  3DM8 A;  1LOY A;  1UW1 A;  2WGQ A;  3KFQ C;  3BLZ A;  3SOY A;  1RJO A;  3SLU A;  2XRX B;  3NX0 A;  2CWT A;  2V1L A;  1I3F A;  4R4K A;  2GBW B;  2K0M A;  1FUW A;  3SYU A;  2FGT A;  1YJN 3;  2ZA4 A;  3CME 3;  1FGO A;  4TX4 A;  4IIA A;  5AIG A;  1W6Y A;  1LXE A;  1F8N A;  1B2Z A;  1FA3 A;  1OHP A;  4GL6 A;  1RN7 A;  1KQS 2;  5ELJ A;  3LTB A;  5G1K A;  1BNI A;  3LT8 A;  3URP A;  5IEP A;  1R4Y A;  2I9W A;  3N54 B;  1FYS A;  2CKF B;  3ZG0 A;  3JUM A;  1UCI A;  3N9H A;  4X2O A;  3K5T A;  1RNT A;  1UUV B;  1W01 A;  1RKY A;  1DVD A;  1N8Q A;  1RRL A;  8RNT A;  3ZG5 A;  2BNG A;  1O7W B;  3RDE A;  4HJL B;  4OVM A;  3AHW A;  3LYG A;  1G96 A;  3KCH A;  3PZW A;  1CYV A;  3F7S A;  1PYL A;  2H0I A;  2ML6 A;  1VQL 3;  3EC9 A;  3HX8 A;  3CCS 3;  3FH1 A;  4XBX A;  4HM2 B;  5BIR A;  2H0G A;  3MHE A;  3JUO A;  1UCJ A;  1RTU A;  1JNQ A;  1EG9 B;  2KAA A;  1X1Y A;  4FMB A;  1LOW A;  1GMP A;  3LT9 A;  4K1U A;  3CCE 3;  2F86 B;  4N6M A;  1V58 A;  3DGY A;  3X3Z A;  3FZW A;  1GOU A;  3S27 A;  1STF I;  1BRG A;  2IY2 A;  3D4A A;  2W2C A;  5RNT A;  4BIR A;  1YIJ 3;  2BMQ B;  1BSE A;  1DE3 A;  4HBR A;  1K28 A;  4GHO A;  3KKG A;  3WA2 X;  1AVL A;  3HOH A;  4FCJ A;  1Q86 4;  1ULI B;  2F5M A;  4EV5 A;  1YIT 3;  1X1U A;  2BO9 B;  4R80 A;  5D82 A;  3OW2 2;  2HML B;  1MWR A;  1IQY A;  1LVN A;  1C54 A;  1YJ9 3;  2CX0 A;  2IUK A;  1IVW A;  3PCS A;  4FCZ A;  1B2X A;  2YX9 A;  1GY5 A;  2ML5 A;  2E2V A;  4FCM A;  1JV2 B;  5FW5 A;  1IYY A;  4L7K A;  1GD4 A;  3NV0 A;  4WYK B;  1W6C A;  1E3V A;  1VQN 3;  3BU4 A;  3RGA A;  1HZ1 A;  1FZU A;  1N5P A;  4KVH A;  4U13 A;  2W0Q A;  2CFL A;  2IUJ A;  3CC7 3;  5KP3 A;  4O3V A;  3J7Y d;  2W56 B;  3I0Y A;  8CHO A;  3K0Z A;  2F98 A;  3EX9 A;  2HMK B;  1Z1S A;  2F4Y A;  1IV9 A;  4HM4 B;  4WFO A;  5KP1 A;  4KZ1 A;  2O9U X;  3CCL 3;  2W9Q A;  1A2P A;  4HYZ A;  3DMC A;  2IA7 A;  3O8Y A;  3N8B A;  2KXG A;  3NBR A;  2JDI H;  1VQK 3;  3SVA A;  5AYR B;  1B2U A;  1BVI A;  1FGT A;  3IMA B;  4MMZ B;  3F14 A;  4N6N B;  2Z6B A;  4EC6 A;  3BND A;  4HM0 B;  1X1X A;  2UX0 A;  3CPO A;  3G4S 3;  1LOV A;  1UGI A;  1QAL A;  3ER7 A;  5LC6 A;  1ZS7 A;  3SOA A;  2CIU A;  1S72 3;  2XR8 B;  2LYX A;  3T0U A;  3JVC A;  3VSY A;  5HOH A;  4HOH A;  4XBY A;  3UL5 A;  2L1S A;  2XH9 A;  1IDP A;  2W6J H;  1JBT A;  3NUV A;  5D83 A;  3S29 A;  3FG3 A;  1ZX2 A;  2CFK A;  1CEW I;  3PS8 A;  3GAX A;  2RGQ A;  1VQ9 3;  1HKX A;  3OX9 A;  1K8A 4;  2YFI B;  4K1V A;  1FW7 A;  1RSN A;  1CH0 A;  4ZM8 A;  2OQE A;  4G1M B;  3AMO B;  4CJN A;  4LYL B;  1BAN A;  3MG3 A;  1MOL A;  1WTH A;  3FG1 A;  3F8H A;  1BRS A;  3WOF B;  1B3S A;  3WR2 A;  3CCM 3;  1UI7 A;  1YI2 3;  3CD6 3;  2KF4 A;  3HIG A;  1RN4 A;  1CYU A;  2XF3 A;  2CFG A;  1JRQ A;  2D42 A;  1UUG B;  3T8U A;  3DGO A;  3NBB A;  5JPP A;  5CF1 A;  2XSO B;  3F8X A;  1Q81 4;  4EBG A;  2CWU A;  1BRI A;  4HZ9 B;  2BMO B;  3D5I A;  1LOX A;  3HZP A;  1OCV A;  1IV7 A;  1L5G B;  2BHM A;  1EUI C;  1GY7 A;  2XEP A;  2PNC A;  2RCD A;  1Q82 4;  1N9E A;  4MMX B;  3CXC 2;  1M90 4;  1OAC A;  2OTL 3;  2FNQ A;  1GYB A;  4K61 A;  3CCV 3;  1A90 A;  2INX A;  4NRE A;  1VQ7 3;  2HMM B;  3CCR 3;  5AII A;  2IYJ A;  4O02 B;  1W6G A;  4L8P A;  4PEJ A;  4RZM A;  1ULJ B;  3EBY A;  2PZV A;  2MC8 A;  3WMD A;  5AEW B;  1BRN L;  1GY6 A;  3DZL A;  3WHO A;  2CFW A;  3FKA A;  4I4K A;  1IU7 A;  1ZO2 A; 
#chains in the Genus database with same CATH homology
 1W2Z A;  2BMR B;  1U5O A;  1M1K 4;  1O7P B;  3GWR A;  4XM4 A;  3U97 A;  4K90 B;  5FGO A;  1FGM A;  5CK6 A;  1STD A;  4HVN A;  4HM5 B;  2CG1 A;  1JJ2 2;  1BUQ A;  1VQM 3;  1WQL B;  1M9G A;  3F7X A;  3VF1 A;  3MWZ A;  2OQE C;  3CU3 A;  3DY5 A;  1AVK A;  5CXO A;  3H3H A;  2P0M A;  5IW9 A;  1IVU A;  2R4I A;  3G16 A;  1VQP 3;  3LXU X;  3S5C A;  4XB5 A;  1ASK A;  5A0O B;  3PXM A;  3STD A;  2P05 A;  1N8R 4;  1Q7Y 4;  2XSH B;  1E3R A;  3FF2 A;  1OF5 A;  3MYT A;  3B4O A;  2FXT A;  1NDO B;  3H51 A;  1NWW A;  3V92 A;  3X40 A;  6STD A;  1QMA A;  5CLK A;  2OCT A;  4NHF A;  3V98 A;  3F40 A;  4O8S A;  3NV0 B;  4LZI A;  4IT7 A;  1A67 A;  5EEO A;  1KWI A;  4X2H A;  3K9M C;  1KC8 4;  1R4C A;  4HM6 B;  2CFD A;  2K54 A;  2GBX B;  1JKG B;  3M8C A;  2CK3 H;  3LZA A;  3DGL A;  4KFE A;  4STD A;  1W2B 2;  3G6E 3;  2QIY A;  1D6Y A;  1K8A 4;  4LGQ A;  3WDG B;  3BNB A;  1M1X B;  1SIH A;  3HI7 A;  3MPH A;  3NQZ A;  4BTY A;  2Y74 A;  1SII A;  2RFR A;  5AI1 A;  2E2U A;  1KD1 4;  1Q40 A;  2E2T A;  1VQ6 3;  2GEX A;  4BTX A;  1GS3 A;  4EXR A;  1JKG A;  1NB5 I;  1IQ8 A;  3PGB A;  1YVB I;  1A2K A;  1N9J A;  4JRF A;  1O7N B;  1SQW A;  2CH9 A;  3X42 A;  1K9M 4;  5AYS C;  4MMY B;  4EV2 A;  1QAF A;  5BVB A;  2W04 A;  3CNX A;  5BXQ A;  2Z77 A;  3NXJ A;  2C11 A;  3MSO A;  2B1X B;  1CQS A;  3QK9 A;  4AEQ A;  3OXA A;  3B7C A;  3X3X A;  2OOV A;  2B24 B;  3MG2 A;  2O3O A;  2OWP A;  4L8O A;  1IVX A;  3NBJ A;  3NQY A;  3LTA A;  1D6Z A;  5JBS A;  3EBT A;  3KN4 A;  1YJW 3;  1WMO A;  3EJV A;  3RGR A;  4KFF A;  1C7H A;  1SPU A;  1GD3 A;  2WOH A;  5IEO A;  2M7O A;  3EQQ B;  1K41 A;  3K63 A;  3SX1 A;  3UJM A;  3L0R A;  4FMC A;  3JUQ A;  3A76 A;  1NJI 4;  1QAK A;  5JPU A;  3GZB A;  1UI8 A;  2CW9 A;  1OHO A;  4R9L A;  4WP5 A;  2BT3 A;  5IG3 A;  4H3U A;  1IT7 A;  3D9R A;  3CC4 3;  2XGL A;  1YHQ 3;  1AV4 A;  4HM8 B;  3LTD A;  1SJW A;  3CMA 3;  4RBN A;  2XFT A;  3NM7 A;  2MF7 A;  4N6U A;  1UUW B;  5EVH A;  5HGR A;  3KSE D;  4J9A A;  3KII A;  1OHS A;  3CCQ 3;  1IVV A;  1ROA A;  3FSD A;  3G0K A;  3OV4 A;  3SXX A;  1IK3 A;  1Y4K A;  2XFS A;  1DVC A;  3Q1C A;  5G2G A;  1OUN A;  3GZR A;  1VQ5 3;  4J8T A;  1IT8 A;  3NHX A;  2QA4 3;  3G8Z A;  1KSI A;  2W03 A;  1TFK A;  5IER A;  3HII A;  3JUN A;  5EQL A;  1HU9 A;  1DMN A;  2KRT A;  4EYC A;  3CCJ 3;  2OOV C;  3SED A;  4WWU C;  4OK0 A;  2Y73 A;  3ECF A;  3WOD G;  3FGY A;  4IPB A;  3VGN A;  3NM2 A;  1DMQ A;  4HZB B;  3PCR A;  3G71 3;  3BNE A;  1OF5 B;  3LH4 A;  1EA2 A;  4HM7 B;  5TGN A;  5D81 A;  5STD A;  4FR9 A;  3D3L A;  1J2B A;  1JN5 A;  4XDV A;  2L4V A;  4R1K A;  3GZY B;  2P0X A;  5AIF A;  1NU3 A;  1WMN A;  2QGU A;  1JB5 A;  3KSP A;  5ELU A;  2WOF A;  3EF8 A;  1K73 4;  1MNL A;  2CWV A;  3Q2P A;  4BTW A;  3CCU 3;  1JB4 A;  3UNL A;  4FMD A;  2LQV A;  3EHC A;  1OGX A;  3B4P A;  4N6T A;  2GU1 A;  5CF2 A;  1JB2 A;  1TU5 A;  4AKY A;  2C10 A;  1VQO 3;  1S5A A;  5KP4 A;  1YGE A;  3EE1 A;  4AKZ A;  1T5Y A;  1W4N A;  2Q07 A;  1Q40 B;  1NO3 A;  4LSO A;  2Z7A A;  4RNY A;  2QEX 3;  3WOE B;  1EQK A;  1WMP A;  1OH0 A;  1QJG A;  1DYU A;  1TFO A;  1V74 A;  3KE7 A;  2CG0 A;  2D1W A;  2IMJ A;  3LOY A;  3GZX B;  1FGR A;  4MEI A;  4U13 A;  2KCD A;  1IQX A;  4KFD A;  1PU4 A;  1VQ8 3;  1AR0 A;  4N6L A;  3ROB A;  7STD A;  3FLJ A;  4LMI A;  5LC7 A;  3OWS A;  2ZDJ A;  3DGM A;  3DUK A;  1W02 A;  1OPY A;  1FGQ A;  3MG1 A;  5IG4 A;  3F9S A;  3CPW 2;  4N6O B;  2SBL A;  5DRE A;  2STD A;  1EKM A;  5IF6 A;  2YFL B;  4XBT A;  3GRD A;  4JF8 A;  1O7M B;  2P09 A;  4O2H A;  3FF0 A;  4GB5 A;  4CCV A;  3IPT A;  5IEN A;  4CDL A;  3S28 A;  4N3V A;  4OUQ A;  5DRV A;  2ZL8 A;  4LEH A;  3CC2 3;  1O7H B;  4RNZ A;  4HM1 B;  1TIJ A;  4H61 A;  3ALA A;  2GEY A;  3I55 3;  3E99 A;  3PYJ A;  3OWU A;  3EN1 B;  1A2V A;  2A15 A;  3LTC A;  2GXF A;  3QRD A;  2WO0 A;  1NB3 I;  3X41 A;  3B8L A;  4N6V 0;  4WHA A;  1ISK A;  1W7C A;  3Q90 A;  1RRH A;  1VZZ A;  2HMO B;  1W00 A;  2WGO A;  4WYK A;  1VQ4 3;  5IG0 A;  2YFJ B;  2RSX A;  3TDG A;  2F99 A;  3UL6 A;  4Q53 A;  3K7C A;  1TP6 A;  3BB9 A;  2OTJ 3;  1WNH A;  2W56 A;  3LML A;  3CNM A;  1U8C B;  1QVG 2;  4XDW A;  2HMJ B;  2CHC A;  4R9K A;  4HM3 B;  1E97 A;  1N5H A;  3BNC A;  3U1W A;  5I97 A;  4FMA A;  5AEU B;  3MKI A;  1D6U A;  1QVF 2;  3EN8 A;  1O7G B;  4HKV B;  3DGN A;  1Q42 A;  1PFP A;  1TUH A;  4ORL A;  3IJE B;  2P38 A;  3FCS B;  1OGZ A;  3T8N A;  2CC3 A;  1ROV A;  3X3Y A;  1W5Z A;  3V99 A;  3KZT A;  3FG4 A;  3JUP A;  5IG5 A;  4MJD A;  1LNH A;  3WA3 A;  1US1 A;  2HMN B;  1DMM A;  3DXO A;  3OWY A;  2JQ5 A;  2Z76 A;  2XGN A;  2GU3 A;  3I56 3;  4QWT A;  2W9P A;  3S67 A;  3AMO A;  1JN5 B;  3HK4 A;  5AIH A;  3UB1 A;  3EB8 A;  3DM8 A;  2WGQ A;  1UW1 A;  3KFQ C;  3BLZ A;  3SOY A;  1RJO A;  3SLU A;  2XRX B;  3NX0 A;  2CWT A;  2V1L A;  4R4K A;  2GBW B;  2K0M A;  1FUW A;  2FGT A;  1YJN 3;  3CME 3;  1FGO A;  4TX4 A;  4IIA A;  5AIG A;  1LXE A;  1W6Y A;  1F8N A;  1FA3 A;  1OHP A;  4GL6 A;  1RN7 A;  1KQS 2;  5ELJ A;  3LTB A;  3LT8 A;  5IEP A;  2I9W A;  3N54 B;  2CKF B;  3JUM A;  3N9H A;  4X2O A;  3K5T A;  1UUV B;  1W01 A;  1RKY A;  1DVD A;  1N8Q A;  1RRL A;  2BNG A;  1O7W B;  3RDE A;  4HJL B;  4OVM A;  3LYG A;  1G96 A;  3PZW A;  1CYV A;  3F7S A;  2ML6 A;  1VQL 3;  3EC9 A;  3HX8 A;  3CCS 3;  3FH1 A;  4XBX A;  4HM2 B;  3MHE A;  3JUO A;  1JNQ A;  1EG9 B;  4FMB A;  3LT9 A;  4K1U A;  3CCE 3;  2F86 B;  4N6M A;  3X3Z A;  3FZW A;  3S27 A;  1STF I;  2W2C A;  1YIJ 3;  2BMQ B;  4HBR A;  1K28 A;  3KKG A;  3WA2 X;  1AVL A;  4FCJ A;  1Q86 4;  1ULI B;  4EV5 A;  1YIT 3;  2BO9 B;  4R80 A;  5D82 A;  3OW2 2;  2HML B;  1IQY A;  1LVN A;  1YJ9 3;  2IUK A;  1IVW A;  3PCS A;  4FCZ A;  2YX9 A;  1GY5 A;  2ML5 A;  2E2V A;  4FCM A;  1JV2 B;  5FW5 A;  4L7K A;  1GD4 A;  3NV0 A;  4WYK B;  1W6C A;  1E3V A;  1VQN 3;  3RGA A;  1N5P A;  4KVH A;  2W0Q A;  2CFL A;  2IUJ A;  3CC7 3;  5KP3 A;  4O3V A;  3J7Y d;  2W56 B;  3I0Y A;  8CHO A;  3K0Z A;  2F98 A;  3EX9 A;  2HMK B;  1Z1S A;  4WFO A;  1IV9 A;  4HM4 B;  5KP1 A;  4KZ1 A;  2O9U X;  3CCL 3;  2W9Q A;  4HYZ A;  3DMC A;  2IA7 A;  3O8Y A;  3N8B A;  2KXG A;  3NBR A;  2JDI H;  1VQK 3;  3SVA A;  5AYR B;  1FGT A;  3IMA B;  4MMZ B;  3F14 A;  4N6N B;  2Z6B A;  4EC6 A;  3BND A;  4HM0 B;  2UX0 A;  3CPO A;  3G4S 3;  1QAL A;  3ER7 A;  5LC6 A;  3SOA A;  1S72 3;  2CIU A;  2XR8 B;  2LYX A;  3T0U A;  3JVC A;  3VSY A;  4XBY A;  3UL5 A;  2XH9 A;  1IDP A;  2W6J H;  3NUV A;  5D83 A;  3S29 A;  3FG3 A;  1ZX2 A;  2CFK A;  1CEW I;  3PS8 A;  3GAX A;  2RGQ A;  1VQ9 3;  1HKX A;  3OX9 A;  2YFI B;  4K1V A;  4ZM8 A;  2OQE A;  4G1M B;  3AMO B;  3MG3 A;  1MOL A;  1WTH A;  3FG1 A;  3F8H A;  3WOF B;  1YI2 3;  3CCM 3;  1UI7 A;  3CD6 3;  3HIG A;  1CYU A;  2XF3 A;  2CFG A;  1JRQ A;  2D42 A;  3T8U A;  3DGO A;  3NBB A;  5JPP A;  5CF1 A;  2XSO B;  3F8X A;  1Q81 4;  4EBG A;  2CWU A;  4HZ9 B;  2BMO B;  1LOX A;  3HZP A;  1OCV A;  1IV7 A;  1L5G B;  2BHM A;  1GY7 A;  2XEP A;  2PNC A;  2RCD A;  1Q82 4;  1N9E A;  4MMX B;  3CXC 2;  1M90 4;  1OAC A;  2OTL 3;  2FNQ A;  1GYB A;  4K61 A;  3CCV 3;  1A90 A;  2INX A;  4NRE A;  1VQ7 3;  2HMM B;  3CCR 3;  5AII A;  4O02 B;  1W6G A;  4L8P A;  4PEJ A;  4RZM A;  1ULJ B;  3EBY A;  2PZV A;  2MC8 A;  3WMD A;  5AEW B;  1GY6 A;  3DZL A;  2CFW A;  3FKA A;  4I4K A;  1IU7 A;  1ZO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...