5LC6A

Crystal structure of a single chain monellin mutant: q28k/c41s/y65r-mnei
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
92
Chain Sequence
b'GEWEIIDIGPFTQNLGKFAVDEENKIGKYGRLTFNKVIRPSMKKTIYENEIKGYEYQLYVRASDKLFRADISEDYKTRGRKLLRFNGPVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B,Monellin chain A
molecule tags Plant protein
source organism Dioscoreophyllum cumminsii
publication title Sweeter and stronger: enhancing sweetness and stability of the single chain monellin MNEI through molecular design.
pubmed doi rcsb
total genus 22
structure length 92
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5lc6A00
1A90A 1CYVA 4N6MA 4N6NB 3IMAB 5LC6A 1G96A 5LC7A 4N6OB 1PFPA 1GD3A 4EYCA 3LH4A 4IT7A 5ELUA 1EQKA 1FA3A 1N9JA 1FUWA 3PS8A 3KSED 1TIJA 3L0RA 4N6V0 1NB5I 2W9PA 3KFQC 1STFI 1KWIA 3PXMA 3SVAA 1IV7A 1N5HA 3UL6A 3NX0A 2W9QA 3Q2PA 1NB3I 1LXEA 1ROAA 2BO9B 1R4CA 2OCTA 4N6LA 1CYUA 1CEWI 2KXGA 4LZIA 1A67A 4N6TA 1YVBI 3MWZA 1WNHA 2O9UX 4N6UA 4ZM8A 5A0OB 4TX4A 1N5PA 1RN7A 1GD4A 1MNLA 2CH9A 3PYJA 5EQLA 3GAXA 3UL5A 4CCVA 5ELJA 3QRDA 3K9MC 1IV9A 3S67A 1DVCA 1DVDA 1M9GA 1MOLA
chains in the Genus database with same CATH superfamily
3AGOA 3GZYB 3HX8A 2RGQA 2M7OA 1YJW3 2BT3A 5KP3A 3KKGA 5IEPA 4G1MB 1GD3A 1W6GA 3CNMA 1PYLA 3PZWA 1UCIA 1RGKA 1BNJA 3DMCA 3GZBA 2E2TA 4RZMA 5D81A 4MMXB 2OQEC 3OX9A 1FGMA 3RGAA 2GU1A 2V1LA 1VQM3 1Z1SA 3LTBA 2BU4A 5CLKA 1HYFA 2SARA 1OHSA 4KFFA 3MWZA 1WNHA 2HMMB 2P05A 3NUVA 3DXOA 1JN5B 2IYJA 3SXXA 1JBTA 4FMBA 1YGWA 3CCQ3 1FGOA 1IVWA 1BAOA 3EBTA 3CCL3 1NDOB 3ER7A 3JUMA 2HMOB 1IV9A 5G2GA 2CX0A 1LQGC 3FH1A 3WOEB 3S5CA 1MGWA 1MOLA 1WMPA 1DMNA 3B7CA 1GYBA 3D79A 4JRFA 4AEQA 3NXJA 1T3BA 1UI8A 9RNTA 5LC7A 4X2OA 1BRNL 2YX9A 2P0MA 1BNIA 1LOWA 5STDA 1V58A 1YNVX 1OGXA 2WOFA 2KF4A 4HKVB 1FUSA 3FG3A 1W6CA 2YFJB 4RNTA 4N3VA 1BSDA 3FF0A 1W4NA 3A76A 2D42A 3CC73 3EQQB 1OF5A 1W6YA 1D6ZA 2BHMA 1RN1A 2L4VA 3KCHA 4O2HA 1ZGXA 5DRVA 1IQ8A 1D6YA 1TUHA 4ZM8A 5A0OB 1GSPA 5EQLA 3F7XA 2GXFA 1ZO2A 1RGHA 5CXOA 1LVNA 2Z77A 3KSPA 2K54A 3MG3A 4HBRA 4RNZA 3X42A 5EVHA 4CPKA 1Q40A 1UCKA 2C10A 3MG2A 4FCZA 1YIT3 1YJ93 3B4OA 1JBRA 2XRXB 4RNYA 4EW5A 1I0VA 2PNCA 1N9JA 3DY5A 2KAAA 3V99A 1WTHA 1WQLB 1KWIA 2ML6A 1BRJA 4XDVA 2MF7A 1MWTA 2AAEA 3G0KA 3A5EA 5JBSA 1OHOA 3NX0A 4AKYA 2KF6A 1VQP3 2KCDA 1RLSA 1LRAA 3FGYA 4XBTA 1F8NA 2RNTA 3NV0A 1OF5B 7GSPA 1T5YA 4I4KA 3SYUA 1FUTA 3CC23 1V57A 2GBWB 1AY7A 3BNBA 3BNDA 3OXAA 4O3VA 4PEJA 3O8YA 2WO0A 4HAAA 2QA43 3JUPA 1US1A 2RCDA 2HMJB 1RRHA 5AI1A 1Q9EA 4R80A 3K5TA 1IT8A 1GOUA 1DETA 3LMLA 1ROVA 2LYXA 1AV4A 2UGIA 3BB9A 4LSOA 1PU4A 3LH4A 2Z6BA 3EJVA 5BU4A 1I2EA 2FXTA 3WA2X 1TIJA 1C54A 2BIRA 1JB5A 2GEYA 1B2UA 1YI23 4BU4A 3SLUA 3MHEA 1I3IA 1Y4KA 4ORLA 1UCLA 1D6UA 3ROBA 2PZVA 1QJGA 5I97A 5IG5A 5RNTA 1EKMA 2CWTA 4NREA 5AYRB 1TRPA 4GSPA 2ZDJA 1JB2A 4CDLA 1PY3A 2KRTA 5JPPA 3MSOA 3KE7A 3OWUA 4N6UA 4AKZA 5KP4A 3IJEB 2W0QA 1OPYA 5AEWB 3CXC2 1NNVA 1FGRA 2F99A 1RHLA 2BNGA 1VZZA 1VQ63 4Q53A 3S67A 1M9GA 1EG9B 3CU3A 3MPHA 3CPOA 3FG4A 2Y74A 1G96A 1BNFA 2UX0A 1A2KA 4WFOA 1LOXA 1NU3A 1RCLA 3AMOB 1GMQA 2Z7AA 1RGLA 3WHOA 1STDA 4K61A 3SVAA 5IG3A 1QVF2 2GSPA 5AIIA 4HM8B 1DYUA 2XFSA 5IENA 1L5GB 2STDA 2L1SA 1M904 1O7MB 1GY5A 2CK3H 3EN1B 2R4IA 3UL5A 1N5PA 2XSOB 3GAXA 4IPBA 1JRQA 1RGEA 1T2HA 3NBJA 3CCV3 4LEHA 5GSPA 1QVG2 3AMOA 3Q90A 1JNQA 1ZX2A 3ALAA 4R9LA 4J5KA 3BNCA 3NBBA 1W7CA 1LOYA 3WOFB 4IT7A 1FUWA 2WOHA 3B4PA 3LXUX 2ZL8A 1DMMA 4N6V0 1TFKA 2W9PA 1STFI 3CNXA 1LNHA 1N5HA 2XFTA 4JF8A 2CIUA 3M8CA 3OWSA 2OTJ3 1B2MA 3X3ZA 1A67A 4HVNA 4WYKB 4K90B 3I553 1RGCA 7RNTA 3G6E3 2CFLA 3EB8A 1BSBA 2CFDA 3D3LA 3FF2A 3ZFZA 4WYKA 4EBGA 3IPTA 5ELJA 2O3OA 3GWRA 1RNTA 3LTCA 4KZ1A 3QK9A 1BANA 4EC6A 1B2XA 5G1KA 5CK6A 1A90A 3EBYA 3CCR3 3EE1A 1CYVA 1GY7A 3LYGA 3RNTA 3HZPA 1U5OA 4KVHA 1RN4A 1MWRA 1B21A 4GB5A 1OH0A 5DREA 4DKIA 1NJI4 1K8A4 3HK4A 2F98A 2CX1A 3DGNA 3EC9A 1ZS7A 1B27A 1BNSA 3L0RA 1O7NB 4HM1B 1KSIA 1AVKA 2INXA 3HIIA 2HOHA 2W03A 2CKFB 4NPBA 4MMZB 1I2FA 1BUQA 3Q3FA 1RMSA 1BRIA 1GMPA 3BIRA 3SOAA 1O7WB 1VQK3 3DZLA 3LOYA 1S5AA 3S29A 5EEOA 2H0HA 1MNLA 2RBIA 2HMLB 3I563 1CH0A 2YFLB 1Q814 3UNLA 3K7CA 3LZAA 1QALA 3F8HA 2FGTA 1B3SA 4FCJA 5IF6A 1W2ZA 1IQYA 3N8BA 3G4S3 1DMQA 2IUJA 4EV2A 2B1XB 1IU7A 1GY6A 3S27A 3X3XA 1BRSA 1W5ZA 2IA7A 4HM4B 3AHSA 1Q7Y4 1V74A 5IG4A 1BNRA 3OW22 1M1XB 1ISKA 3PCRA 5D83A 1NB5I 1O7PB 3X40A 2P0XA 2SBLA 2I9WA 1GS3A 2D1WA 3WR2A 4LGQA 4O8SA 1JBSA 3F40A 4IIAA 1T2IA 5G1LA 1GD4A 4KFEA 1VQO3 2W6JH 3KZTA 4ILFA 2Z76A 4BTXA 4HJLB 1QAKA 2W56A 3AGNA 2BMOB 4XBYA 3D4AA 2XEPA 2XGLA 4XB5A 1YGEA 5AYSC 2F4YA 4XBXA 5M19A 5LC6A 2Q07A 1QMAA 1I70A 4J8TA 4N6OB 2CFKA 1AQZA 3EHCA 4R1KA 4STDA 1BRHA 5AIGA 5FW5A 3VF1A 2W56B 1OGZA 1FA3A 2HMKB 1A2VA 6RNTA 1VQ43 1K28A 1OHPA 4HOHA 8CHOA 4HZ9B 1RKYA 1N8R4 3Q2PA 2W9QA 3AHWA 1LXEA 1MGRA 1JB4A 3UB1A 2OTL3 3GZXB 1R4YA 2R41A 3K63A 3E99A 3PGBA 4MJDA 4MMYB 4HM7B 3MYTA 3CCS3 1IVXA 2CG1A 1TJDA 5AEUB 1BUJA 5BVBA 2B24B 1IDPA 3V98A 4LYLB 1MWSA 2IUKA 2XGNA 3VGNA 1TU5A 1O7GB 6GSPA 1I0XA 2JQ5A 3FCSB 4KFDA 3SEDA 2C11A 2FNQA 2W2CA 3DGLA 1LQMB 1VQ93 2H0IA 1K41A 1SPUA 4OK0A 5KP1A 1N8QA 1ULJB 2OWPA 3WMDA 3CCE3 1NB3I 2OCTA 1IQXA 2ZA4A 4N6LA 1SJWA 1VQQA 1E97A 4HM5B 4EV5A 4N6TA 1JKGB 2OQEA 3TDGA 3WA3A 3LTDA 1SIIA 4FMCA 4CCVA 3VSYA 1NO3A 1TRQA 2BMRB 1I8VA 3CC43 5HOHA 1VQL3 1Q42A 3T8NA 4LMIA 1EA2A 1JV2B 1BVIA 2XF3A 3D5IA 3LT8A 4FR9A 4N6MA 3U1WA 1Q864 3MG1A 2J8XB 1A2PA 2IMJA 1EUIC 3ZG0A 2QGUA 3G16A 1LOVA 3GRDA 2XSHB 1S723 3NQZA 4WHAA 3F9SA 1GOVA 1HKXA 4L8PA 2GEXA 3RGRA 1X1UA 1BSAA 3HIGA 3JVCA 1SARA 3CPW2 3ZG5A 2F5MA 1R4CA 1VQ53 1BSEA 4BL2A 1E3RA 1YVBI 1G0TA 1HZ1A 1ASKA 1SIHA 2ZHXB 4WP5A 4I5QA 7STDA 3JUNA 2QEX3 4H3UA 1VQ83 4O02B 4HM3B 5AIFA 3QRDA 3K9MC 3F14A 1DVDA 1DVCA 2F86B 3FSDA 1C7HA 3DGOA 1OUNA 3IMAB 1U8CB 1RGAA 2GBXB 2C4BA 4EYCA 1AR0A 5TGNA 3ECFA 5AIHA 1BGSA 1IT7A 3KSED 3SOYA 1B2ZA 1IVUA 1O7HB 3DM8A 1YHQ3 1FZUA 1YIJ3 1BNGA 3UL6A 2OOVA 3D9RA 1JN5A 3BNEA 3GZRA 3RDEA 1QAFA 1K9M4 3WDGB 1IK3A 1CQSA 1W01A 1CEWI 2K0MA 3S28A 1RTUA 3FG1A 2CFGA 1TFOA 1UUWB 1OCVA 2IY2A 4R9KA 2KF3A 3N54B 1RN7A 3G8ZA 5IW9A 3GSPA 3NBRA 5IEOA 4XDWA 1NWWA 2P38A 2JDIH 2W04A 4HM6B 4K1VA 2LQVA 4OUQA 3T8UA 3NM7A 1ULIB 1B2SA 4BL3A 3FZWA 2CC3A 3NM2A 4RBNA 1KC84 1RJOA 1TP6A 2KF5A 1EEJA 1EQKA 3CCM3 3PS8A 1BRKA 1RGGA 4L8OA 2P09A 1W00A 3EX9A 4L7KA 3T0UA 1RRLA 1BU4A 1ROAA 2BO9B 1KD14 2UUGC 4FMDA 3CME3 4HM0B 1UCJA 1YVSA 3DUKA 3PCSA 5IG0A 2HMNB 3LTAA 3NV0B 3PYJA 1I2GA 1WMOA 1DE3A 4HZBB 2E2VA 2CW9A 1UW1A 1RGFA 1BIRA 1HU9A 3BU4A 3LT9A 3KIIA 4GL6A 3CCJ3 3UJMA 3DGYA 4GHOA 4N6NB 1GMRA 1JZOA 1RDSA 3X41A 5M18A 1UUGB 3JUQA 2CWUA 3URPA 1W2B2 1PFPA 5FGOA 1VQN3 1W02A 3NHXA 1RNBA 2AADA 3N9HA 1Q40B 1BOXA 3NQYA 5BIRA 2CG0A 1X1YA 1I3FA 1UGHI 2WGQA 3BLZA 4LZIA 1UI7A 2O9UX 2A15A 4HM2B 2QIYA 3CMA3 1JKGA 2CH9A 4BTYA 3FKAA 4KT3B 2CFWA 5M1AA 1JJ22 4J5GA 1G02A 1JZDA 3WODG 4WWUC 2H0GA 2K3DA 3F7SA 5JPUA 3K0ZA 1RSNA 4MEIA 2RSXA 1IVVA 3FLJA 5ELUA 1BNEA 1UDII 1VQ73 1RCKA 2CWVA 4XM4A 2GU3A 1X1WA 2YFIB 2WGOA 4X2HA 3PXMA 1BSCA 4BIRA 1YJN3 1K734 2RFRA 3STDA 4H61A 4FMAA 4OVMA 1IYYA 3DH2A 1CYUA 3J7Yd 2KXGA 2F5WA 3HOHA 1BRGA 3CD63 3U97A 3X3YA 3F8XA 1N9EA 4NHFA 1Q824 2XR8B 2Y73A 1M1K4 1TTOA 1LNIA 3H3HA 4J9AA 3SX1A 1J2BA 3EN8A 1UUVB 1FYSA 2ML5A 1B20A 3I0YA 3V92A 4HYZA 3EF8A 6STDA 1MWUA 4QWTA 2MC8A 1WMNA 4R4KA 3HI7A 1OACA 1SQWA 3KN4A 5IERA 1Q7HA 1UGIA 2XH9A 1KQS2 4U13A 3KFQC 1FGTA 8RNTA 3OV4A 3DGMA 5HGRA 1IV7A 3G713 1FW7A 4K1UA 3MKIA 4FCMA 1GOYA 5BXQA 3B8LA 2E2UA 4EXRA 1FGQA 4CJNA 3CCU3 3Q1CA 5D82A 4BTWA 1X1XA 2F56A 3OWYA 4TX4A 1E3VA 3D5GA 3H51A 1AVLA 2BMQB 2OOVC 5CF2A 3JUOA 5CF1A 2CHCA
chains in the Genus database with same CATH topology
3GZYB 3HX8A 2RGQA 2M7OA 1YJW3 2BT3A 5KP3A 3KKGA 4G1MB 1GD3A 1W6GA 3CNMA 3PZWA 3DMCA 3GZBA 2E2TA 4RZMA 5D81A 4MMXB 2OQEC 3OX9A 1FGMA 3RGAA 2GU1A 2V1LA 1VQM3 1Z1SA 3LTBA 5CLKA 1OHSA 4KFFA 3MWZA 1WNHA 2HMMB 2P05A 3NUVA 3DXOA 1JN5B 3SXXA 1JJ22 1ISKA 4FMBA 3CCQ3 1FGOA 1IVWA 3EBTA 3CCL3 1NDOB 3ER7A 3JUMA 2HMOB 1IV9A 5G2GA 3FH1A 3WOEB 3S5CA 2QA43 1MOLA 1WMPA 1DMNA 3B7CA 1GYBA 4JRFA 4AEQA 3NXJA 1UI8A 5LC7A 4X2OA 2YX9A 2P0MA 5STDA 1OGXA 2WOFA 4HKVB 3FG3A 1W6CA 2YFJB 4N3VA 3FF0A 1W4NA 3A76A 2D42A 3CC73 3EQQB 1OF5A 1W6YA 1D6ZA 2BHMA 2L4VA 4O2HA 5DRVA 1IQ8A 1D6YA 1TUHA 4ZM8A 5A0OB 5EQLA 3F7XA 2GXFA 1ZO2A 5CXOA 1LVNA 2Z77A 3KSPA 2K54A 3MG3A 4HBRA 4RNZA 3X42A 5EVHA 1Q40A 1YJ93 2C10A 3MG2A 4FCZA 1YIT3 3B4OA 2XRXB 4RNYA 2PNCA 1N9JA 3DY5A 3V99A 1WTHA 1WQLB 1KWIA 2ML6A 4XDVA 2MF7A 3G0KA 5JBSA 1VQP3 1OHOA 3NX0A 4AKYA 2KCDA 3FGYA 4XBTA 1F8NA 3NV0A 1OF5B 1T5YA 4I4KA 3CC23 3OXAA 2GBWB 3BNBA 4O3VA 3BNDA 4PEJA 3O8YA 2WO0A 3JUPA 1US1A 2RCDA 2HMJB 1RRHA 5AI1A 4R80A 3K5TA 1IT8A 3LMLA 1ROVA 2LYXA 1AV4A 3BB9A 4LSOA 1PU4A 3LH4A 2Z6BA 3EJVA 3WA2X 2FXTA 1TIJA 1JB5A 2GEYA 1YI23 3SLUA 3MHEA 1Y4KA 4ORLA 1D6UA 3ROBA 2PZVA 1QJGA 5I97A 5IG5A 1EKMA 2CWTA 4NREA 5AYRB 2ZDJA 1JB2A 4CDLA 2KRTA 5JPPA 3MSOA 3KE7A 3OWUA 4N6UA 4AKZA 5KP4A 3IJEB 2W0QA 1OPYA 5AEWB 3CXC2 2F99A 1FGRA 2BNGA 1VZZA 1VQ63 4Q53A 3S67A 1M9GA 3CU3A 1EG9B 3MPHA 3CPOA 3FG4A 2Y74A 1G96A 2UX0A 1A2KA 4WFOA 1LOXA 1NU3A 3AMOB 2Z7AA 1STDA 4K61A 3SVAA 5IG3A 1QVF2 5AIIA 4HM8B 1DYUA 2XFSA 5IENA 1L5GB 2STDA 1M904 1O7MB 1GY5A 2CK3H 3EN1B 2R4IA 3UL5A 1N5PA 2XSOB 3GAXA 4IPBA 1JRQA 3NBJA 3CCV3 4LEHA 1QVG2 3AMOA 3Q90A 1JNQA 1ZX2A 3ALAA 4R9LA 3BNCA 3NBBA 1W7CA 3WOFB 4IT7A 1FUWA 2WOHA 3B4PA 3LXUX 2ZL8A 1DMMA 4N6V0 1TFKA 2W9PA 1STFI 3CNXA 1LNHA 1N5HA 2XFTA 4JF8A 2CIUA 3M8CA 3OWSA 2OTJ3 3X3ZA 1A67A 4HVNA 4WYKB 4K90B 3I553 3G6E3 2CFLA 3EB8A 2CFDA 3D3LA 3FF2A 4WYKA 4EBGA 3IPTA 5ELJA 2O3OA 3GWRA 3LTCA 4KZ1A 3QK9A 4EC6A 5CK6A 1A90A 3EBYA 3CCR3 3EE1A 1CYVA 1GY7A 3LYGA 3HZPA 1U5OA 4KVHA 1NJI4 4GB5A 1OH0A 5DREA 1K8A4 3HK4A 2F98A 3DGNA 3EC9A 3L0RA 1O7NB 4HM1B 1KSIA 1AVKA 2INXA 3HIIA 2W03A 2CKFB 4MMZB 1BUQA 3SOAA 1O7WB 1VQK3 3DZLA 3LOYA 1S5AA 3S29A 5EEOA 1MNLA 2HMLB 3I563 1Q814 2YFLB 3UNLA 3K7CA 3LZAA 1QALA 3F8HA 2FGTA 4FCJA 5IF6A 1W2ZA 1IQYA 3N8BA 3G4S3 1DMQA 2IUJA 4EV2A 2B1XB 1IU7A 1GY6A 3S27A 3X3XA 1W5ZA 2IA7A 4HM4B 1Q7Y4 1V74A 5IG4A 3OW22 1M1XB 3PCRA 5D83A 1O7PB 3X40A 2P0XA 2SBLA 2I9WA 1GS3A 2D1WA 4LGQA 4O8SA 3F40A 4IIAA 1GD4A 4KFEA 1VQO3 2W6JH 3KZTA 4BTXA 2Z76A 4HJLB 1QAKA 2W56A 2BMOB 4XBYA 2XEPA 2XGLA 4XB5A 1YGEA 5AYSC 4XBXA 5LC6A 2Q07A 1QMAA 4N6OB 4J8TA 4STDA 2CFKA 3EHCA 4R1KA 5AIGA 5FW5A 3VF1A 1FA3A 2W56B 1OGZA 2HMKB 1A2VA 1VQ43 1K28A 1OHPA 1N8R4 8CHOA 4HZ9B 1RKYA 3Q2PA 2W9QA 1LXEA 1JB4A 3UB1A 2OTL3 3GZXB 3K63A 3E99A 3PGBA 4MJDA 4MMYB 4HM7B 3MYTA 3CCS3 1IVXA 2CG1A 5AEUB 5BVBA 2B24B 1IDPA 3V98A 2XGNA 2IUKA 3VGNA 1TU5A 1O7GB 2JQ5A 3FCSB 4KFDA 3SEDA 2C11A 2FNQA 2W2CA 3DGLA 1VQ93 1K41A 1SPUA 4OK0A 5KP1A 1N8QA 1ULJB 2OWPA 3WMDA 3CCE3 1NB3I 2OCTA 1IQXA 4N6LA 1SJWA 1E97A 4HM5B 4EV5A 4N6TA 1JKGB 2OQEA 3TDGA 3WA3A 3LTDA 1SIIA 4FMCA 4CCVA 3VSYA 1NO3A 2BMRB 3CC43 1VQL3 1Q42A 3T8NA 4LMIA 1EA2A 1JV2B 2XF3A 3LT8A 4FR9A 3U1WA 5IEPA 4N6MA 1Q864 1VQN3 3MG1A 2IMJA 2QGUA 3G16A 3GRDA 2XSHB 1S723 3NQZA 4WHAA 3F9SA 1HKXA 4L8PA 2GEXA 3RGRA 3HIGA 3JVCA 3CPW2 1R4CA 1VQ53 1E3RA 1YVBI 1SIHA 1ASKA 4WP5A 2QEX3 7STDA 3JUNA 4H3UA 1VQ83 4O02B 4HM3B 5AIFA 3QRDA 3K9MC 3F14A 1DVDA 1DVCA 2F86B 3FSDA 1C7HA 3DGOA 1OUNA 3IMAB 1U8CB 2GBXB 4EYCA 1AR0A 5TGNA 3ECFA 5AIHA 1IT7A 3KSED 3SOYA 1IVUA 1O7HB 3DM8A 1YHQ3 1YIJ3 3UL6A 2OOVA 3D9RA 1JN5A 3BNEA 3GZRA 3RDEA 1QAFA 1K9M4 3WDGB 1IK3A 1CQSA 1W01A 1CEWI 2K0MA 3S28A 3FG1A 2CFGA 1TFOA 1UUWB 1OCVA 4R9KA 3N54B 1RN7A 3G8ZA 5IW9A 3NBRA 5IEOA 4XDWA 1NWWA 2P38A 2JDIH 2W04A 4HM6B 4K1VA 2LQVA 4OUQA 3T8UA 3NM7A 1ULIB 3FZWA 2CC3A 3NM2A 4RBNA 1KC84 1RJOA 1TP6A 1EQKA 3CCM3 3PS8A 4L8OA 2P09A 1W00A 3EX9A 4L7KA 3T0UA 1RRLA 1ROAA 2BO9B 1KD14 4FMDA 3CME3 4HM0B 3DUKA 3PCSA 5IG0A 2HMNB 3LTAA 3NV0B 3PYJA 1WMOA 4HZBB 2E2VA 2CW9A 1UW1A 1HU9A 3LT9A 4GL6A 3KIIA 3CCJ3 3UJMA 4N6NB 3X41A 3JUQA 2CWUA 1W2B2 1PFPA 5FGOA 1W02A 3NHXA 3N9HA 1Q40B 3NQYA 2CG0A 3BLZA 2WGQA 4LZIA 1UI7A 2O9UX 2A15A 4HM2B 2QIYA 3CMA3 1JKGA 2CH9A 4BTYA 3FKAA 2CFWA 3WODG 4WWUC 3F7SA 5JPUA 3K0ZA 4MEIA 2RSXA 1IVVA 3FLJA 5ELUA 1VQ73 2CWVA 4XM4A 2GU3A 2YFIB 1YJN3 2WGOA 4X2HA 3PXMA 1NB5I 1K734 2RFRA 3STDA 4H61A 4FMAA 4OVMA 1CYUA 3J7Yd 2KXGA 3CD63 3U97A 3X3YA 3F8XA 1N9EA 4NHFA 1Q824 2XR8B 2Y73A 1M1K4 3H3HA 4J9AA 3SX1A 1J2BA 3EN8A 1UUVB 6STDA 2ML5A 3V92A 3I0YA 4HYZA 3EF8A 4QWTA 2MC8A 1WMNA 4R4KA 3HI7A 1OACA 1SQWA 3KN4A 5IERA 2XH9A 1KQS2 4U13A 3KFQC 1FGTA 3OV4A 3DGMA 5HGRA 1IV7A 3G713 4K1UA 3MKIA 4FCMA 5BXQA 3B8LA 2E2UA 4EXRA 1FGQA 3CCU3 3Q1CA 5D82A 4BTWA 4TX4A 3OWYA 1E3VA 3H51A 1AVLA 2BMQB 2OOVC 5CF2A 3JUOA 5CF1A 2CHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A90 A;  1CYV A;  4N6M A;  4N6N B;  3IMA B;  5LC6 A;  1G96 A;  5LC7 A;  4N6O B;  1PFP A;  1GD3 A;  4EYC A;  3LH4 A;  4IT7 A;  5ELU A;  1EQK A;  1FA3 A;  1N9J A;  1FUW A;  3PS8 A;  3KSE D;  1TIJ A;  3L0R A;  4N6V 0;  1NB5 I;  2W9P A;  3KFQ C;  1STF I;  1KWI A;  3PXM A;  3SVA A;  1IV7 A;  1N5H A;  3UL6 A;  3NX0 A;  2W9Q A;  3Q2P A;  1NB3 I;  1LXE A;  1ROA A;  2BO9 B;  1R4C A;  2OCT A;  4N6L A;  1CYU A;  1CEW I;  2KXG A;  4LZI A;  1A67 A;  4N6T A;  1YVB I;  3MWZ A;  1WNH A;  2O9U X;  4N6U A;  4ZM8 A;  5A0O B;  4TX4 A;  1N5P A;  1RN7 A;  1GD4 A;  1MNL A;  2CH9 A;  3PYJ A;  5EQL A;  3GAX A;  3UL5 A;  4CCV A;  5ELJ A;  3QRD A;  3K9M C;  1IV9 A;  3S67 A;  1DVC A;  1DVD A;  1M9G A;  1MOL A; 
#chains in the Genus database with same CATH topology
 3AGO A;  3GZY B;  3HX8 A;  2RGQ A;  2M7O A;  1YJW 3;  2BT3 A;  5KP3 A;  3KKG A;  5IEP A;  4G1M B;  1GD3 A;  1W6G A;  3CNM A;  1PYL A;  3PZW A;  1UCI A;  1RGK A;  1BNJ A;  3DMC A;  3GZB A;  2E2T A;  4RZM A;  5D81 A;  4MMX B;  2OQE C;  3OX9 A;  1FGM A;  3RGA A;  2GU1 A;  2V1L A;  1VQM 3;  1Z1S A;  3LTB A;  2BU4 A;  5CLK A;  1HYF A;  2SAR A;  1OHS A;  4KFF A;  3MWZ A;  1WNH A;  2HMM B;  2P05 A;  3NUV A;  3DXO A;  1JN5 B;  2IYJ A;  3SXX A;  1JBT A;  4FMB A;  1YGW A;  3CCQ 3;  1FGO A;  1IVW A;  1BAO A;  3EBT A;  3CCL 3;  1NDO B;  3ER7 A;  3JUM A;  2HMO B;  1IV9 A;  5G2G A;  2CX0 A;  1LQG C;  3FH1 A;  3WOE B;  3S5C A;  1MGW A;  1MOL A;  1WMP A;  1DMN A;  3B7C A;  1GYB A;  3D79 A;  4JRF A;  4AEQ A;  3NXJ A;  1T3B A;  1UI8 A;  9RNT A;  5LC7 A;  4X2O A;  1BRN L;  2YX9 A;  2P0M A;  1BNI A;  1LOW A;  5STD A;  1V58 A;  1YNV X;  1OGX A;  2WOF A;  2KF4 A;  4HKV B;  1FUS A;  3FG3 A;  1W6C A;  2YFJ B;  4RNT A;  4N3V A;  1BSD A;  3FF0 A;  1W4N A;  3A76 A;  2D42 A;  3CC7 3;  3EQQ B;  1OF5 A;  1W6Y A;  1D6Z A;  2BHM A;  1RN1 A;  2L4V A;  3KCH A;  4O2H A;  1ZGX A;  5DRV A;  1IQ8 A;  1D6Y A;  1TUH A;  4ZM8 A;  5A0O B;  1GSP A;  5EQL A;  3F7X A;  2GXF A;  1ZO2 A;  1RGH A;  5CXO A;  1LVN A;  2Z77 A;  3KSP A;  2K54 A;  3MG3 A;  4HBR A;  4RNZ A;  3X42 A;  5EVH A;  4CPK A;  1Q40 A;  1UCK A;  2C10 A;  3MG2 A;  4FCZ A;  1YIT 3;  1YJ9 3;  3B4O A;  1JBR A;  2XRX B;  4RNY A;  4EW5 A;  1I0V A;  2PNC A;  1N9J A;  3DY5 A;  2KAA A;  3V99 A;  1WTH A;  1WQL B;  1KWI A;  2ML6 A;  1BRJ A;  4XDV A;  2MF7 A;  1MWT A;  2AAE A;  3G0K A;  3A5E A;  5JBS A;  1OHO A;  3NX0 A;  4AKY A;  2KF6 A;  1VQP 3;  2KCD A;  1RLS A;  1LRA A;  3FGY A;  4XBT A;  1F8N A;  2RNT A;  3NV0 A;  1OF5 B;  7GSP A;  1T5Y A;  4I4K A;  3SYU A;  1FUT A;  3CC2 3;  1V57 A;  2GBW B;  1AY7 A;  3BNB A;  3BND A;  3OXA A;  4O3V A;  4PEJ A;  3O8Y A;  2WO0 A;  4HAA A;  2QA4 3;  3JUP A;  1US1 A;  2RCD A;  2HMJ B;  1RRH A;  5AI1 A;  1Q9E A;  4R80 A;  3K5T A;  1IT8 A;  1GOU A;  1DET A;  3LML A;  1ROV A;  2LYX A;  1AV4 A;  2UGI A;  3BB9 A;  4LSO A;  1PU4 A;  3LH4 A;  2Z6B A;  3EJV A;  5BU4 A;  1I2E A;  2FXT A;  3WA2 X;  1TIJ A;  1C54 A;  2BIR A;  1JB5 A;  2GEY A;  1B2U A;  1YI2 3;  4BU4 A;  3SLU A;  3MHE A;  1I3I A;  1Y4K A;  4ORL A;  1UCL A;  1D6U A;  3ROB A;  2PZV A;  1QJG A;  5I97 A;  5IG5 A;  5RNT A;  1EKM A;  2CWT A;  4NRE A;  5AYR B;  1TRP A;  4GSP A;  2ZDJ A;  1JB2 A;  4CDL A;  1PY3 A;  2KRT A;  5JPP A;  3MSO A;  3KE7 A;  3OWU A;  4N6U A;  4AKZ A;  5KP4 A;  3IJE B;  2W0Q A;  1OPY A;  5AEW B;  3CXC 2;  1NNV A;  1FGR A;  2F99 A;  1RHL A;  2BNG A;  1VZZ A;  1VQ6 3;  4Q53 A;  3S67 A;  1M9G A;  1EG9 B;  3CU3 A;  3MPH A;  3CPO A;  3FG4 A;  2Y74 A;  1G96 A;  1BNF A;  2UX0 A;  1A2K A;  4WFO A;  1LOX A;  1NU3 A;  1RCL A;  3AMO B;  1GMQ A;  2Z7A A;  1RGL A;  3WHO A;  1STD A;  4K61 A;  3SVA A;  5IG3 A;  1QVF 2;  2GSP A;  5AII A;  4HM8 B;  1DYU A;  2XFS A;  5IEN A;  1L5G B;  2STD A;  2L1S A;  1M90 4;  1O7M B;  1GY5 A;  2CK3 H;  3EN1 B;  2R4I A;  3UL5 A;  1N5P A;  2XSO B;  3GAX A;  4IPB A;  1JRQ A;  1RGE A;  1T2H A;  3NBJ A;  3CCV 3;  4LEH A;  5GSP A;  1QVG 2;  3AMO A;  3Q90 A;  1JNQ A;  1ZX2 A;  3ALA A;  4R9L A;  4J5K A;  3BNC A;  3NBB A;  1W7C A;  1LOY A;  3WOF B;  4IT7 A;  1FUW A;  2WOH A;  3B4P A;  3LXU X;  2ZL8 A;  1DMM A;  4N6V 0;  1TFK A;  2W9P A;  1STF I;  3CNX A;  1LNH A;  1N5H A;  2XFT A;  4JF8 A;  2CIU A;  3M8C A;  3OWS A;  2OTJ 3;  1B2M A;  3X3Z A;  1A67 A;  4HVN A;  4WYK B;  4K90 B;  3I55 3;  1RGC A;  7RNT A;  3G6E 3;  2CFL A;  3EB8 A;  1BSB A;  2CFD A;  3D3L A;  3FF2 A;  3ZFZ A;  4WYK A;  4EBG A;  3IPT A;  5ELJ A;  2O3O A;  3GWR A;  1RNT A;  3LTC A;  4KZ1 A;  3QK9 A;  1BAN A;  4EC6 A;  1B2X A;  5G1K A;  5CK6 A;  1A90 A;  3EBY A;  3CCR 3;  3EE1 A;  1CYV A;  1GY7 A;  3LYG A;  3RNT A;  3HZP A;  1U5O A;  4KVH A;  1RN4 A;  1MWR A;  1B21 A;  4GB5 A;  1OH0 A;  5DRE A;  4DKI A;  1NJI 4;  1K8A 4;  3HK4 A;  2F98 A;  2CX1 A;  3DGN A;  3EC9 A;  1ZS7 A;  1B27 A;  1BNS A;  3L0R A;  1O7N B;  4HM1 B;  1KSI A;  1AVK A;  2INX A;  3HII A;  2HOH A;  2W03 A;  2CKF B;  4NPB A;  4MMZ B;  1I2F A;  1BUQ A;  3Q3F A;  1RMS A;  1BRI A;  1GMP A;  3BIR A;  3SOA A;  1O7W B;  1VQK 3;  3DZL A;  3LOY A;  1S5A A;  3S29 A;  5EEO A;  2H0H A;  1MNL A;  2RBI A;  2HML B;  3I56 3;  1CH0 A;  2YFL B;  1Q81 4;  3UNL A;  3K7C A;  3LZA A;  1QAL A;  3F8H A;  2FGT A;  1B3S A;  4FCJ A;  5IF6 A;  1W2Z A;  1IQY A;  3N8B A;  3G4S 3;  1DMQ A;  2IUJ A;  4EV2 A;  2B1X B;  1IU7 A;  1GY6 A;  3S27 A;  3X3X A;  1BRS A;  1W5Z A;  2IA7 A;  4HM4 B;  3AHS A;  1Q7Y 4;  1V74 A;  5IG4 A;  1BNR A;  3OW2 2;  1M1X B;  1ISK A;  3PCR A;  5D83 A;  1NB5 I;  1O7P B;  3X40 A;  2P0X A;  2SBL A;  2I9W A;  1GS3 A;  2D1W A;  3WR2 A;  4LGQ A;  4O8S A;  1JBS A;  3F40 A;  4IIA A;  1T2I A;  5G1L A;  1GD4 A;  4KFE A;  1VQO 3;  2W6J H;  3KZT A;  4ILF A;  2Z76 A;  4BTX A;  4HJL B;  1QAK A;  2W56 A;  3AGN A;  2BMO B;  4XBY A;  3D4A A;  2XEP A;  2XGL A;  4XB5 A;  1YGE A;  5AYS C;  2F4Y A;  4XBX A;  5M19 A;  5LC6 A;  2Q07 A;  1QMA A;  1I70 A;  4J8T A;  4N6O B;  2CFK A;  1AQZ A;  3EHC A;  4R1K A;  4STD A;  1BRH A;  5AIG A;  5FW5 A;  3VF1 A;  2W56 B;  1OGZ A;  1FA3 A;  2HMK B;  1A2V A;  6RNT A;  1VQ4 3;  1K28 A;  1OHP A;  4HOH A;  8CHO A;  4HZ9 B;  1RKY A;  1N8R 4;  3Q2P A;  2W9Q A;  3AHW A;  1LXE A;  1MGR A;  1JB4 A;  3UB1 A;  2OTL 3;  3GZX B;  1R4Y A;  2R41 A;  3K63 A;  3E99 A;  3PGB A;  4MJD A;  4MMY B;  4HM7 B;  3MYT A;  3CCS 3;  1IVX A;  2CG1 A;  1TJD A;  5AEU B;  1BUJ A;  5BVB A;  2B24 B;  1IDP A;  3V98 A;  4LYL B;  1MWS A;  2IUK A;  2XGN A;  3VGN A;  1TU5 A;  1O7G B;  6GSP A;  1I0X A;  2JQ5 A;  3FCS B;  4KFD A;  3SED A;  2C11 A;  2FNQ A;  2W2C A;  3DGL A;  1LQM B;  1VQ9 3;  2H0I A;  1K41 A;  1SPU A;  4OK0 A;  5KP1 A;  1N8Q A;  1ULJ B;  2OWP A;  3WMD A;  3CCE 3;  1NB3 I;  2OCT A;  1IQX A;  2ZA4 A;  4N6L A;  1SJW A;  1VQQ A;  1E97 A;  4HM5 B;  4EV5 A;  4N6T A;  1JKG B;  2OQE A;  3TDG A;  3WA3 A;  3LTD A;  1SII A;  4FMC A;  4CCV A;  3VSY A;  1NO3 A;  1TRQ A;  2BMR B;  1I8V A;  3CC4 3;  5HOH A;  1VQL 3;  1Q42 A;  3T8N A;  4LMI A;  1EA2 A;  1JV2 B;  1BVI A;  2XF3 A;  3D5I A;  3LT8 A;  4FR9 A;  4N6M A;  3U1W A;  1Q86 4;  3MG1 A;  2J8X B;  1A2P A;  2IMJ A;  1EUI C;  3ZG0 A;  2QGU A;  3G16 A;  1LOV A;  3GRD A;  2XSH B;  1S72 3;  3NQZ A;  4WHA A;  3F9S A;  1GOV A;  1HKX A;  4L8P A;  2GEX A;  3RGR A;  1X1U A;  1BSA A;  3HIG A;  3JVC A;  1SAR A;  3CPW 2;  3ZG5 A;  2F5M A;  1R4C A;  1VQ5 3;  1BSE A;  4BL2 A;  1E3R A;  1YVB I;  1G0T A;  1HZ1 A;  1ASK A;  1SIH A;  2ZHX B;  4WP5 A;  4I5Q A;  7STD A;  3JUN A;  2QEX 3;  4H3U A;  1VQ8 3;  4O02 B;  4HM3 B;  5AIF A;  3QRD A;  3K9M C;  3F14 A;  1DVD A;  1DVC A;  2F86 B;  3FSD A;  1C7H A;  3DGO A;  1OUN A;  3IMA B;  1U8C B;  1RGA A;  2GBX B;  2C4B A;  4EYC A;  1AR0 A;  5TGN A;  3ECF A;  5AIH A;  1BGS A;  1IT7 A;  3KSE D;  3SOY A;  1B2Z A;  1IVU A;  1O7H B;  3DM8 A;  1YHQ 3;  1FZU A;  1YIJ 3;  1BNG A;  3UL6 A;  2OOV A;  3D9R A;  1JN5 A;  3BNE A;  3GZR A;  3RDE A;  1QAF A;  1K9M 4;  3WDG B;  1IK3 A;  1CQS A;  1W01 A;  1CEW I;  2K0M A;  3S28 A;  1RTU A;  3FG1 A;  2CFG A;  1TFO A;  1UUW B;  1OCV A;  2IY2 A;  4R9K A;  2KF3 A;  3N54 B;  1RN7 A;  3G8Z A;  5IW9 A;  3GSP A;  3NBR A;  5IEO A;  4XDW A;  1NWW A;  2P38 A;  2JDI H;  2W04 A;  4HM6 B;  4K1V A;  2LQV A;  4OUQ A;  3T8U A;  3NM7 A;  1ULI B;  1B2S A;  4BL3 A;  3FZW A;  2CC3 A;  3NM2 A;  4RBN A;  1KC8 4;  1RJO A;  1TP6 A;  2KF5 A;  1EEJ A;  1EQK A;  3CCM 3;  3PS8 A;  1BRK A;  1RGG A;  4L8O A;  2P09 A;  1W00 A;  3EX9 A;  4L7K A;  3T0U A;  1RRL A;  1BU4 A;  1ROA A;  2BO9 B;  1KD1 4;  2UUG C;  4FMD A;  3CME 3;  4HM0 B;  1UCJ A;  1YVS A;  3DUK A;  3PCS A;  5IG0 A;  2HMN B;  3LTA A;  3NV0 B;  3PYJ A;  1I2G A;  1WMO A;  1DE3 A;  4HZB B;  2E2V A;  2CW9 A;  1UW1 A;  1RGF A;  1BIR A;  1HU9 A;  3BU4 A;  3LT9 A;  3KII A;  4GL6 A;  3CCJ 3;  3UJM A;  3DGY A;  4GHO A;  4N6N B;  1GMR A;  1JZO A;  1RDS A;  3X41 A;  5M18 A;  1UUG B;  3JUQ A;  2CWU A;  3URP A;  1W2B 2;  1PFP A;  5FGO A;  1VQN 3;  1W02 A;  3NHX A;  1RNB A;  2AAD A;  3N9H A;  1Q40 B;  1BOX A;  3NQY A;  5BIR A;  2CG0 A;  1X1Y A;  1I3F A;  1UGH I;  2WGQ A;  3BLZ A;  4LZI A;  1UI7 A;  2O9U X;  2A15 A;  4HM2 B;  2QIY A;  3CMA 3;  1JKG A;  2CH9 A;  4BTY A;  3FKA A;  4KT3 B;  2CFW A;  5M1A A;  1JJ2 2;  4J5G A;  1G02 A;  1JZD A;  3WOD G;  4WWU C;  2H0G A;  2K3D A;  3F7S A;  5JPU A;  3K0Z A;  1RSN A;  4MEI A;  2RSX A;  1IVV A;  3FLJ A;  5ELU A;  1BNE A;  1UDI I;  1VQ7 3;  1RCK A;  2CWV A;  4XM4 A;  2GU3 A;  1X1W A;  2YFI B;  2WGO A;  4X2H A;  3PXM A;  1BSC A;  4BIR A;  1YJN 3;  1K73 4;  2RFR A;  3STD A;  4H61 A;  4FMA A;  4OVM A;  1IYY A;  3DH2 A;  1CYU A;  3J7Y d;  2KXG A;  2F5W A;  3HOH A;  1BRG A;  3CD6 3;  3U97 A;  3X3Y A;  3F8X A;  1N9E A;  4NHF A;  1Q82 4;  2XR8 B;  2Y73 A;  1M1K 4;  1TTO A;  1LNI A;  3H3H A;  4J9A A;  3SX1 A;  1J2B A;  3EN8 A;  1UUV B;  1FYS A;  2ML5 A;  1B20 A;  3I0Y A;  3V92 A;  4HYZ A;  3EF8 A;  6STD A;  1MWU A;  4QWT A;  2MC8 A;  1WMN A;  4R4K A;  3HI7 A;  1OAC A;  1SQW A;  3KN4 A;  5IER A;  1Q7H A;  1UGI A;  2XH9 A;  1KQS 2;  4U13 A;  3KFQ C;  1FGT A;  8RNT A;  3OV4 A;  3DGM A;  5HGR A;  1IV7 A;  3G71 3;  1FW7 A;  4K1U A;  3MKI A;  4FCM A;  1GOY A;  5BXQ A;  3B8L A;  2E2U A;  4EXR A;  1FGQ A;  4CJN A;  3CCU 3;  3Q1C A;  5D82 A;  4BTW A;  1X1X A;  2F56 A;  3OWY A;  4TX4 A;  1E3V A;  3D5G A;  3H51 A;  1AVL A;  2BMQ B;  2OOV C;  5CF2 A;  3JUO A;  5CF1 A;  2CHC A; 
#chains in the Genus database with same CATH homology
 3GZY B;  3HX8 A;  2RGQ A;  2M7O A;  1YJW 3;  2BT3 A;  5KP3 A;  3KKG A;  4G1M B;  1GD3 A;  1W6G A;  3CNM A;  3PZW A;  3DMC A;  3GZB A;  2E2T A;  4RZM A;  5D81 A;  4MMX B;  2OQE C;  3OX9 A;  1FGM A;  3RGA A;  2GU1 A;  2V1L A;  1VQM 3;  1Z1S A;  3LTB A;  5CLK A;  1OHS A;  4KFF A;  3MWZ A;  1WNH A;  2HMM B;  2P05 A;  3NUV A;  3DXO A;  1JN5 B;  3SXX A;  1JJ2 2;  1ISK A;  4FMB A;  3CCQ 3;  1FGO A;  1IVW A;  3EBT A;  3CCL 3;  1NDO B;  3ER7 A;  3JUM A;  2HMO B;  1IV9 A;  5G2G A;  3FH1 A;  3WOE B;  3S5C A;  2QA4 3;  1MOL A;  1WMP A;  1DMN A;  3B7C A;  1GYB A;  4JRF A;  4AEQ A;  3NXJ A;  1UI8 A;  5LC7 A;  4X2O A;  2YX9 A;  2P0M A;  5STD A;  1OGX A;  2WOF A;  4HKV B;  3FG3 A;  1W6C A;  2YFJ B;  4N3V A;  3FF0 A;  1W4N A;  3A76 A;  2D42 A;  3CC7 3;  3EQQ B;  1OF5 A;  1W6Y A;  1D6Z A;  2BHM A;  2L4V A;  4O2H A;  5DRV A;  1IQ8 A;  1D6Y A;  1TUH A;  4ZM8 A;  5A0O B;  5EQL A;  3F7X A;  2GXF A;  1ZO2 A;  5CXO A;  1LVN A;  2Z77 A;  3KSP A;  2K54 A;  3MG3 A;  4HBR A;  4RNZ A;  3X42 A;  5EVH A;  1Q40 A;  1YJ9 3;  2C10 A;  3MG2 A;  4FCZ A;  1YIT 3;  3B4O A;  2XRX B;  4RNY A;  2PNC A;  1N9J A;  3DY5 A;  3V99 A;  1WTH A;  1WQL B;  1KWI A;  2ML6 A;  4XDV A;  2MF7 A;  3G0K A;  5JBS A;  1VQP 3;  1OHO A;  3NX0 A;  4AKY A;  2KCD A;  3FGY A;  4XBT A;  1F8N A;  3NV0 A;  1OF5 B;  1T5Y A;  4I4K A;  3CC2 3;  3OXA A;  2GBW B;  3BNB A;  4O3V A;  3BND A;  4PEJ A;  3O8Y A;  2WO0 A;  3JUP A;  1US1 A;  2RCD A;  2HMJ B;  1RRH A;  5AI1 A;  4R80 A;  3K5T A;  1IT8 A;  3LML A;  1ROV A;  2LYX A;  1AV4 A;  3BB9 A;  4LSO A;  1PU4 A;  3LH4 A;  2Z6B A;  3EJV A;  3WA2 X;  2FXT A;  1TIJ A;  1JB5 A;  2GEY A;  1YI2 3;  3SLU A;  3MHE A;  1Y4K A;  4ORL A;  1D6U A;  3ROB A;  2PZV A;  1QJG A;  5I97 A;  5IG5 A;  1EKM A;  2CWT A;  4NRE A;  5AYR B;  2ZDJ A;  1JB2 A;  4CDL A;  2KRT A;  5JPP A;  3MSO A;  3KE7 A;  3OWU A;  4N6U A;  4AKZ A;  5KP4 A;  3IJE B;  2W0Q A;  1OPY A;  5AEW B;  3CXC 2;  2F99 A;  1FGR A;  2BNG A;  1VZZ A;  1VQ6 3;  4Q53 A;  3S67 A;  1M9G A;  3CU3 A;  1EG9 B;  3MPH A;  3CPO A;  3FG4 A;  2Y74 A;  1G96 A;  2UX0 A;  1A2K A;  4WFO A;  1LOX A;  1NU3 A;  3AMO B;  2Z7A A;  1STD A;  4K61 A;  3SVA A;  5IG3 A;  1QVF 2;  5AII A;  4HM8 B;  1DYU A;  2XFS A;  5IEN A;  1L5G B;  2STD A;  1M90 4;  1O7M B;  1GY5 A;  2CK3 H;  3EN1 B;  2R4I A;  3UL5 A;  1N5P A;  2XSO B;  3GAX A;  4IPB A;  1JRQ A;  3NBJ A;  3CCV 3;  4LEH A;  1QVG 2;  3AMO A;  3Q90 A;  1JNQ A;  1ZX2 A;  3ALA A;  4R9L A;  3BNC A;  3NBB A;  1W7C A;  3WOF B;  4IT7 A;  1FUW A;  2WOH A;  3B4P A;  3LXU X;  2ZL8 A;  1DMM A;  4N6V 0;  1TFK A;  2W9P A;  1STF I;  3CNX A;  1LNH A;  1N5H A;  2XFT A;  4JF8 A;  2CIU A;  3M8C A;  3OWS A;  2OTJ 3;  3X3Z A;  1A67 A;  4HVN A;  4WYK B;  4K90 B;  3I55 3;  3G6E 3;  2CFL A;  3EB8 A;  2CFD A;  3D3L A;  3FF2 A;  4WYK A;  4EBG A;  3IPT A;  5ELJ A;  2O3O A;  3GWR A;  3LTC A;  4KZ1 A;  3QK9 A;  4EC6 A;  5CK6 A;  1A90 A;  3EBY A;  3CCR 3;  3EE1 A;  1CYV A;  1GY7 A;  3LYG A;  3HZP A;  1U5O A;  4KVH A;  1NJI 4;  4GB5 A;  1OH0 A;  5DRE A;  1K8A 4;  3HK4 A;  2F98 A;  3DGN A;  3EC9 A;  3L0R A;  1O7N B;  4HM1 B;  1KSI A;  1AVK A;  2INX A;  3HII A;  2W03 A;  2CKF B;  4MMZ B;  1BUQ A;  3SOA A;  1O7W B;  1VQK 3;  3DZL A;  3LOY A;  1S5A A;  3S29 A;  5EEO A;  1MNL A;  2HML B;  3I56 3;  1Q81 4;  2YFL B;  3UNL A;  3K7C A;  3LZA A;  1QAL A;  3F8H A;  2FGT A;  4FCJ A;  5IF6 A;  1W2Z A;  1IQY A;  3N8B A;  3G4S 3;  1DMQ A;  2IUJ A;  4EV2 A;  2B1X B;  1IU7 A;  1GY6 A;  3S27 A;  3X3X A;  1W5Z A;  2IA7 A;  4HM4 B;  1Q7Y 4;  1V74 A;  5IG4 A;  3OW2 2;  1M1X B;  3PCR A;  5D83 A;  1O7P B;  3X40 A;  2P0X A;  2SBL A;  2I9W A;  1GS3 A;  2D1W A;  4LGQ A;  4O8S A;  3F40 A;  4IIA A;  1GD4 A;  4KFE A;  1VQO 3;  2W6J H;  3KZT A;  4BTX A;  2Z76 A;  4HJL B;  1QAK A;  2W56 A;  2BMO B;  4XBY A;  2XEP A;  2XGL A;  4XB5 A;  1YGE A;  5AYS C;  4XBX A;  5LC6 A;  2Q07 A;  1QMA A;  4N6O B;  4J8T A;  4STD A;  2CFK A;  3EHC A;  4R1K A;  5AIG A;  5FW5 A;  3VF1 A;  1FA3 A;  2W56 B;  1OGZ A;  2HMK B;  1A2V A;  1VQ4 3;  1K28 A;  1OHP A;  1N8R 4;  8CHO A;  4HZ9 B;  1RKY A;  3Q2P A;  2W9Q A;  1LXE A;  1JB4 A;  3UB1 A;  2OTL 3;  3GZX B;  3K63 A;  3E99 A;  3PGB A;  4MJD A;  4MMY B;  4HM7 B;  3MYT A;  3CCS 3;  1IVX A;  2CG1 A;  5AEU B;  5BVB A;  2B24 B;  1IDP A;  3V98 A;  2XGN A;  2IUK A;  3VGN A;  1TU5 A;  1O7G B;  2JQ5 A;  3FCS B;  4KFD A;  3SED A;  2C11 A;  2FNQ A;  2W2C A;  3DGL A;  1VQ9 3;  1K41 A;  1SPU A;  4OK0 A;  5KP1 A;  1N8Q A;  1ULJ B;  2OWP A;  3WMD A;  3CCE 3;  1NB3 I;  2OCT A;  1IQX A;  4N6L A;  1SJW A;  1E97 A;  4HM5 B;  4EV5 A;  4N6T A;  1JKG B;  2OQE A;  3TDG A;  3WA3 A;  3LTD A;  1SII A;  4FMC A;  4CCV A;  3VSY A;  1NO3 A;  2BMR B;  3CC4 3;  1VQL 3;  1Q42 A;  3T8N A;  4LMI A;  1EA2 A;  1JV2 B;  2XF3 A;  3LT8 A;  4FR9 A;  3U1W A;  5IEP A;  4N6M A;  1Q86 4;  1VQN 3;  3MG1 A;  2IMJ A;  2QGU A;  3G16 A;  3GRD A;  2XSH B;  1S72 3;  3NQZ A;  4WHA A;  3F9S A;  1HKX A;  4L8P A;  2GEX A;  3RGR A;  3HIG A;  3JVC A;  3CPW 2;  1R4C A;  1VQ5 3;  1E3R A;  1YVB I;  1SIH A;  1ASK A;  4WP5 A;  2QEX 3;  7STD A;  3JUN A;  4H3U A;  1VQ8 3;  4O02 B;  4HM3 B;  5AIF A;  3QRD A;  3K9M C;  3F14 A;  1DVD A;  1DVC A;  2F86 B;  3FSD A;  1C7H A;  3DGO A;  1OUN A;  3IMA B;  1U8C B;  2GBX B;  4EYC A;  1AR0 A;  5TGN A;  3ECF A;  5AIH A;  1IT7 A;  3KSE D;  3SOY A;  1IVU A;  1O7H B;  3DM8 A;  1YHQ 3;  1YIJ 3;  3UL6 A;  2OOV A;  3D9R A;  1JN5 A;  3BNE A;  3GZR A;  3RDE A;  1QAF A;  1K9M 4;  3WDG B;  1IK3 A;  1CQS A;  1W01 A;  1CEW I;  2K0M A;  3S28 A;  3FG1 A;  2CFG A;  1TFO A;  1UUW B;  1OCV A;  4R9K A;  3N54 B;  1RN7 A;  3G8Z A;  5IW9 A;  3NBR A;  5IEO A;  4XDW A;  1NWW A;  2P38 A;  2JDI H;  2W04 A;  4HM6 B;  4K1V A;  2LQV A;  4OUQ A;  3T8U A;  3NM7 A;  1ULI B;  3FZW A;  2CC3 A;  3NM2 A;  4RBN A;  1KC8 4;  1RJO A;  1TP6 A;  1EQK A;  3CCM 3;  3PS8 A;  4L8O A;  2P09 A;  1W00 A;  3EX9 A;  4L7K A;  3T0U A;  1RRL A;  1ROA A;  2BO9 B;  1KD1 4;  4FMD A;  3CME 3;  4HM0 B;  3DUK A;  3PCS A;  5IG0 A;  2HMN B;  3LTA A;  3NV0 B;  3PYJ A;  1WMO A;  4HZB B;  2E2V A;  2CW9 A;  1UW1 A;  1HU9 A;  3LT9 A;  4GL6 A;  3KII A;  3CCJ 3;  3UJM A;  4N6N B;  3X41 A;  3JUQ A;  2CWU A;  1W2B 2;  1PFP A;  5FGO A;  1W02 A;  3NHX A;  3N9H A;  1Q40 B;  3NQY A;  2CG0 A;  3BLZ A;  2WGQ A;  4LZI A;  1UI7 A;  2O9U X;  2A15 A;  4HM2 B;  2QIY A;  3CMA 3;  1JKG A;  2CH9 A;  4BTY A;  3FKA A;  2CFW A;  3WOD G;  4WWU C;  3F7S A;  5JPU A;  3K0Z A;  4MEI A;  2RSX A;  1IVV A;  3FLJ A;  5ELU A;  1VQ7 3;  2CWV A;  4XM4 A;  2GU3 A;  2YFI B;  1YJN 3;  2WGO A;  4X2H A;  3PXM A;  1NB5 I;  1K73 4;  2RFR A;  3STD A;  4H61 A;  4FMA A;  4OVM A;  1CYU A;  3J7Y d;  2KXG A;  3CD6 3;  3U97 A;  3X3Y A;  3F8X A;  1N9E A;  4NHF A;  1Q82 4;  2XR8 B;  2Y73 A;  1M1K 4;  3H3H A;  4J9A A;  3SX1 A;  1J2B A;  3EN8 A;  1UUV B;  6STD A;  2ML5 A;  3V92 A;  3I0Y A;  4HYZ A;  3EF8 A;  4QWT A;  2MC8 A;  1WMN A;  4R4K A;  3HI7 A;  1OAC A;  1SQW A;  3KN4 A;  5IER A;  2XH9 A;  1KQS 2;  4U13 A;  3KFQ C;  1FGT A;  3OV4 A;  3DGM A;  5HGR A;  1IV7 A;  3G71 3;  4K1U A;  3MKI A;  4FCM A;  5BXQ A;  3B8L A;  2E2U A;  4EXR A;  1FGQ A;  3CCU 3;  3Q1C A;  5D82 A;  4BTW A;  4TX4 A;  3OWY A;  1E3V A;  3H51 A;  1AVL A;  2BMQ B;  2OOV C;  5CF2 A;  3JUO A;  5CF1 A;  2CHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...