5LD2B

Cryo-em structure of recbcd+dna complex revealing activated nuclease domain
Total Genus 294
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
294
sequence length
1170
structure length
1151
Chain Sequence
AETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQWLLLAERQMDEAAVFTIHGFCQRMLNLNAFESGMLFEQQLIEDESLLRYQACADFWRRHCYPLPREIAQVVFETWKGPQALLRDINRYLQGEAPVIKAPPPDDETLASRHAQIVARIDTVKQQWRDAVGELDALIESSGIDRRKFNRSNQAKWIDKISAWAEEETNSYQLPESLEKFTPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELGFDDMLSRLDSALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWHHQPETALLLIGDPKQAIYAFRGADIFTYMKARSEVHAHYTLDTNWRSAPGMVNSVNKLFSQTDDAFMFREIPFIPVKSAGKNQALRFVFKGETQPAMKMWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALLMNGDDARPVRASDISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETLEAQEMLWLLQAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDVVVEEFDGYRQIWRKRGVMPMLRALMSARNIAENLLATAGGERRLTDILHISELLQEAGTQLESEHALVRWLSQHILEPDSNASSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFITNFRVQEQAFYHDRHSFEAVLDLNAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLGVAPLVRRRGDKKGDTDVHQSALGRLLQKGEPQDAAGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDVSTAELNAKTLQRLPGDNWRVTSYSGLQQRXXXXXXXXXXXXXXXXXXXXPTLTPHQFPRGASPGTFLHSLFEDLDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLAYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFGGVIYLFLRGVDKEHPQQGIYTTRPNAGLIALMDEMFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism for nuclease regulation in RecBCD.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Hydrolase
molecule keywords RecBCD enzyme subunit RecB,RecBCD enzyme subunit RecB,RecBCD
total genus 294
structure length 1151
sequence length 1170
ec nomenclature ec 3.1.11.5: Exodeoxyribonuclease V.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00580 UvrD-helicase UvrD/REP helicase N-terminal domain
B PF12705 PDDEXK_1 PD-(D/E)XK nuclease superfamily
B PF13361 UvrD_C UvrD-like helicase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.486.10 Mainly Alpha Orthogonal Bundle PCRA; domain 4 PCRA; domain 4 5ld2B04
1.10.3170.10 Mainly Alpha Orthogonal Bundle Recbcd, chain B, domain 2 Recbcd, chain B, domain 2 5ld2B02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ld2B01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ld2B03
3.90.320.10 Alpha Beta Alpha-Beta Complex Lambda Exonuclease; Chain A Lambda Exonuclease; Chain A 5ld2B05
5F2EA 3CW2A 3UANA 3A36A 1J2JA 1G6OA 3LVRE 4W7SA 1Z6YA 4D4JA 4UNSA 3Q5EA 1RIFA 3CX6A 4NU0A 2VO1A 2ZANA 3ONWA 3SOPA 4ZDIA 1F6BA 2VF8A 2DYKA 2WAXA 4HAYA 5L3SB 4OQXA 1FX0B 1MRSA 2VP4A 2ZRCA 5FPSA 1SGWA 4N0EA 1OH6A 1XXHB 4RZ3A 4KV9A 4NYJR 2ZJ8A 3B1ZA 1VIYA 1HYQA 2CEAA 2FE4A 4OJKA 4TWZA 5KDLA 3V9PA 3R9IA 4QM6A 4NKRA 1ZNYA 5JLJA 5FBLB 1YZUA 4L9WA 2A2ZA 1TF2A 1GRRA 2VHJA 1E0KA 3TJZA 4KFUA 2ZAMA 1OW3B 1PLJA 2LWIA 2OHFA 4NTZA 4A2QA 1S3SA 3QG5A 3QXCA 4AKGA 1Q3TA 4Q9LA 1UPTA 4GI7A 2FEOA 4G5SA 3LLUA 2Q6TA 5EE9A 3UK6A 4ZI2A 2PH1A 1E9RA 2BMDA 4B6EA 2QP9X 2WMNB 4MYHA 2W83A 4Z8XA 5FOVA 1NG9A 5D3MB 2C2HA 1Z0KA 4P4UA 3W6OA 2QA5A 1GM5A 5CK4A 4JMPA 4ON9A 4E09A 4AG5A 3U60B 2WHXA 3BWDD 2IX3A 4IVQA 4PAOA 1N6KA 5G40A 3ZQ6A 3HYTA 2GEUA 2CK3A 2WIAA 3LRPA 4XWOA 1IY2A 2QMUA 4LX0A 2OBMA 3WMGA 2F43B 4DDTA 4PO8A 1CKEA 1N6HA 3U4QA 3ZZTA 1V5WA 1A1VA 3OF5A 4IEEA 1EK0A 4A8JA 4AYWA 5KYKA 2JLQA 4MA4A 3ADDA 1IONA 1UDXA 2PLFA 3L2OB 3L43A 4CVNA 3ZS8A 2JLYA 5LB2A 1HURA 3N5CA 4B32A 3NWJA 3GLHE 4M9SA 1ONBA 2JIZD 1JALA 1KMQA 3A1WA 3I4LA 2G1JA 1RRGA 2H5EA 4EDHA 2O8EA 2GBLC 5L3QB 1U98A 1L7VC 1MT0A 2NZJA 4QOSA 4LYJA 1N6RA 4Q5IA 3T1VA 4I1SA 4EPRA 3ZD6A 3ZQJA 1RYFA 1FMLA 4Q7MB 4C0JA 2HLDD 1XDBA 3D8BA 4LC1A 2IS4A 2XX3A 3KXIA 3AV0B 1CJMA 2AFIE 2X1VA 2QAJA 2OV2A 4RD1A 5ANRB 4WAUA 3KQHA 3VX4A 1TQ4A 4LV5B 1VHTA 3SYLA 2JJ1D 1G4AE 1SHKA 4V03A 1Q12A 4LJ5A 4PPQA 3ZIAD 3PUVA 1TF5A 2EWVA 4GBMA 4RFSB 2QPOA 1D2NA 1HQYE 3BE4A 3EZ9A 4RKFA 4OI1A 4F4CA 4LBWA 3UATA 4NYMQ 3AVVA 1SVSA 5TARA 4GZMA 5FTKA 1I4DD 2ZI4A 2W0MA 1WMSA 3GMTA 3CRMA 3THOA 4ZIRA 3B82A 2CCGA 1G9XA 2MMCA 3B13B 2IEZA 1S3GA 4YDSA 4BQSA 3LBIA 4Z1MA 3T61A 4C0BA 1XEFA 1EESA 1Z6XA 821PA 1S0UA 2WPDD 2PZGA 2V7QD 1XJ0A 2UKDA 4PSAA 3MMPA 4PHTA 2O0KA 2VP6A 3EASA 4Q4HA 1J7KA 1NMZA 4QGGA 2VBCA 3G0HA 5CIWA 1U99A 3THWB 1XWIA 4IXMA 2VP5A 3MLEA 1R8QA 1FTNA 3QKTA 1ESMA 2PMKA 3RLFA 5SZHB 3R7WB 1SVIA 1Q21A 2H16A 1TUIA 4PZZA 1NSFA 4TYQA 3K53A 4LRWA 3AKCA 2O8DA 4DBLC 4KHZA 4LDJA 4YLGA 5HCNA 4P0TA 1QBKC 2A5GA 2XB4A 4EFNA 4C7OB 4A2PA 1QHXA 3T1OA 2F3TA 3HYRA 3B60A 3SHWA 1H8HA 2CDNA 4I4LA 4EJSC 2AHOA 1XPUA 3RRMA 5AUPB 4DLUA 3UMFA 2AD5A 3OAAA 2ZE6A 3H84A 4EJSB 4C9BA 2GAOA 3I8SA 2ZRGA 2JLXA 3AVUA 4GP6A 1COWD 2A30A 4X8MA 3KKQA 1ZAKA 4A6XA 2RAPA 1Z0DA 5BN4A 1Z6GA 2GZDA 2CVHA 2ZRFA 4JL8A 4Q02A 3UMRA 3NG1A 1RYHA 4C4PA 2FNAA 1WBDA 4JVNA 3IIJA 3DKPA 1W4AA 2GDJA 5TXGA 1QVAA 4CEIB 1NF3A 5JSZA 1A2BA 2BDTA 1SZPA 4MRNA 2CHVA 2C78A 3SU8A 4C7OA 1VCNA 2AR7A 4LV8B 4NHOA 1XB2A 5ELXA 1II8A 4PC6A 1QDEA 2RGDA 1A82A 3DMNA 3Q8XB 2IA5A 5CJ2A 421PA 3GFOA 4DLZA 3ZLJA 1DPFA 1N6PA 2W6ID 2WSMA 4NYMR 2ZYWX 1JR6A 3W5JA 4RZ2A 2P5SA 1VHLA 4XTCS 3HPRA 4D0NA 2HT6A 1MABA 2H17A 3F0TA 1JR3D 3KKOA 4IOLA 4L9SA 4I99A 2FGKA 3K0CA 2P6UA 4MRRA 1GTVA 4DLSA 3IEUA 2IUSA 3B2EA 1OXSC 4LBZA 4Q4HB 4D0GA 4BFXA 3CH5A 3IHLA 5KNDA 2YINC 5BXQC 4P31A 1EFUA 3VR5A 1F2TB 2F7SA 2PT7A 2J0UA 2J9RA 4Q7KA 1PLKA 3ZS9A 2QBYB 2C98A 3GLGA 3SE0A 3DHWC 2I1VB 2VYFA 3LX8A 4HLUA 2MSEB 2WSSA 3VKGA 1GP2A 1MO5A 2X77A 1YR6A 2A5YB 3GJXC 3KJEA 1OXVA 5GJCA 4KLNA 3CPEA 1L4YA 4DHEA 2ZI9A 5LD2B 1AGPA 1R0YA 1E9AA 1G3MA 2CLCX 3T35A 1SQ5A 2JLSA 1R0ZA 2J3EA 1OPXA 2HCBA 4KVAA 2WKRA 4NCIA 4PZYA 4US1R 4XOIA 5CYOA 1VG1A 5J4VA 2V3CC 4D0LB 2PEYA 1E2KA 2J0VA 1B0UA 1XMIA 4V0ME 5GADl 3CBQA 5J47A 4OQMA 2DWQA 4IRUB 4KAXA 1RE0A 5B2ZA 1EFRD 1EX6A 5CDFE 4KITB 2O8BB 3CR8A 1UFQA 3JVUA 4AYXA 1QVRA 5JHGB 3QXHA 1G18A 4WVFA 1CBUA 2IYZA 2XNSA 3LW8A 3PEYA 1P61B 1U94A 3GQBA 3PR1A 1N6IA 1KJZA 4NL4H 4F38A 5FPTA 1KAOA 3W5IA 4M4SA 2BBWA 4EQ6A 1PVOA 2CJWB 3MG9A 4ARZA 4HAWA 2F1JA 2GBLA 3KTAB 2OCYC 2ZYUX 2FZLA 1VTKA 4PPNA 1OYYA 3ND9A 2JLZA 3MJHA 1LS6A 3KUCA 1JR3A 1KDOA 4CDGA 1Z08A 2VPPA 3NC0C 3CRRA 4LGMA 4QGHA 4DDWA 1N5KA 4M8NE 2GEVA 3IHWA 5FL3A 2MSDB 1JAIA 1KY2A 1UDWA 4DCTA 2CNWD 2ORWA 3CNLA 4MITA 2CL6X 5KHOC 1YZTA 3B78A 5GJVC 1VIAA 1CTQA 3GLGB 2AX4A 1DAMA 1HUQA 3AQ4A 4KCGA 1YJ5A 1K5DA 1KSGA 1L8QA 3RS4A 4Q9KA 4BUJA 3Q7PA 2H8KA 2KE5A 1ZM3A 3QE0A 3B8HA 3AVQA 3WYFA 3U7GA 1ZMXA 4KO8A 2FSIA 5HPYB 1OV4A 1KI4A 1G21E 1QHIA 1XTQA 3K9LA 3EPLA 2DCUA 3U3OA 1QHHA 1W7AA 2BKEA 4FMBB 1U9IA 3WMFA 5EJEA 2HV8A 1UBFA 3P20A 5F98A 3LBHA 2DFTA 1RFLA 3W6NA 3AVYA 5KNCA 2ATVA 4P4TA 2JLVA 1LVGA 1WDTA 3OESA 4QBIA 4B3XA 2J87A 2IXEA 4DLRA 3FHTA 4W5WA 3TNFA 2CL7X 2QTVB 1IN6A 2FFHA 3IGFA 4GDFA 1G5PA 3CPHA 2IYVA 2QPAA 4Q1AA 2DB3A 2G88A 2GK7A 2NG1A 3QVUA 4FMDB 2FSHA 5GJWC 3L0OA 2ZU6A 4OQLA 3TVTA 1U9IC 3LXRA 5FR2A 8OHMA 1FP6A 4RKEA 2IW3A 4E03A 4IFEA 2AFHE 2ZITA 4LHYA 4NP6A 3X2SA 1SVMA 2ZRMA 4BWYA 5JEEA 2XXAB 2QL6A 2C96A 1VYVA 2VLIA 1BOFA 2ZSBA 1G5RA 4KBGA 3RS3A 1W44A 2FV8A 4PO1A 1IN8A 3OIUA 1U0LA 1W4BA 1XZQA 3TSOA 5EP3A 2NGRA 3MFYA 5G53C 1QZXA 3AKYA 3VR3A 4XTRA 1ZM7A 2HYDA 2OBNA 1HTWA 1OE0A 2Q3FA 4TMXA 2CJWA 4ARZB 4Q03A 4CGZA 1D6JA 3BH6A 1BIFA 2NMVA 1BH2A 4ZCMA 3GJ8A 2EFEB 5JS7A 3BB1A 4B6FA 1YZQA 2FN4A 3BC1A 4MDEA 4TMWA 4D6PA 1GL7A 3CM0A 3GEEA 1E9CA 4QHSA 1JEDA 4B3BA 1G3QA 1SXJB 2HLDA 3E1SA 4U00A 2P3SA 2WJIA 1AS3A 3BS4A 4MKHA 3FKSD 2QAGB 1Z5ZA 3C7KA 2P67A 3BH7A 3REGA 3QY0A 5J4HA 3AKEA 2JJ1A 4Q4JA 2R6GA 4M1TA 4WZBE 3THXA 4MGZR 4AY2A 5FBVB 1E9BA 2C9CA 1S9DA 2NPFA 3SLPA 1Q0UA 2B6HA 1U90A 4F91B 1J8YF 1X1SA 1Z3IX 3SZRA 2CVFA 2QU8A 3P4XA 3CKLA 1AM4D 1NN1A 4IOMA 3GP8A 1AS0A 3C15C 1XF9A 3KUDA 4TSFD 2NOAA 4P32A 2EYQA 4C2TA 2J0SA 5FUWA 4Z1MD 1UEJA 5JI2E 3K70B 2P65A 1YVDA 4FWTA 2BMFA 2AWOA 3G82C 3A1TA 4IDQA 4JBWA 1LV7A 2PL3A 3K09C 4JIMA 4LJ4A 4URXR 3C4JA 1M7BA 3N70A 2VA8A 2GVDC 5CLQA 3TK1A 1XEXB 1GKYA 2R65A 1G19A 4GOJA 3ICEA 3KKNA 3T06B 3SFZA 1N2CE 2EFGA 3AF4A 4JZKA 4Q48A 3WHLA 2J1LA 4LWZA 1PUIA 1G7RA 1KTVA 3SYYA 2W6JA 2QM8A 1JR3E 1AKEA 3NDBB 4TLDA 1UM8A 4OQFA 3MWKA 1VCOA 2Z5FA 1EXMA 2HDNB 4AKHA 1KGDA 2QP4A 3OHMA 4JL6A 2BBTA 2FF7A 2DWPA 5DSZA 3U7EB 1LS1A 2C9OA 4JVSB 5AUOB 1IJEA 3SJAA 4M1SA 1G3UA 4JLDA 2ZRLA 1T5IA 1IXRC 3IPXA 1TAGA 5FUXA 4OK5A 4C0AC 1CJUC 1UKEA 1ZM4A 2AD1A 4BFVA 2QMOA 1CXZA 2W2TA 1SKYB 1UEIA 3EA0A 4ZCLA 3RS2A 2XTZA 4CW7A 1XXHE 2FFAA 2WOJA 2OLKA 2ZE7A 1CP2A 3I92A 1AIPA 2QN6A 1RJ9A 5FOTA 4CZ2A 4LSGA 5FBRB 2CMKA 3PUXA 3GLFE 1LY1A 4FCWA 5EE0A 4TLEA 1ZU4A 1ZC3A 4AWXA 3HR8A 3H4RA 1DBSA 4JKYA 1VPLA 3U6KA 4EPTA 5EE3A 4MYCA 5LB4A 2PCJA 2RGGA 4V0NA 3KKPA 4HSEA 3BGWA 4HAXA 3RVBA 1XTIA 1G7SA 3FTQA 2BKUA 2WJJA 4QHTA 4PPFA 4O3MA 3QXXA 2W6IA 1P7CA 1K5GA 3HDTA 1KJYA 2JLWA 4MYUA 1Q44A 1AQUA 4HB0A 1M8PA 1OB5A 1XTJA 4QBGB 2ERYA 4A6PA 4KLZA 1TU4A 2GNOA 4S35A 4N0DA 5CM8B 4LHWA 2VP2A 2QE7D 4JLMA 4XSHA 4EFMA 3IKJA 3EIQA 1CR1A 2IXFA 1KJWA 3VNVA 4B48A 3IQWA 1ZW6A 4URYR 1PV4A 1FL9A 3SC3A 2ECKA 4N1AA 5EP4A 3FOZA 1A7JA 3RABA 4BLTA 1RPZA 4A92A 3GFTA 1G4UR 2WM9B 3B5JA 1G3RA 1E96A 1E2EA 1VKJA 2V4ZA 1GIAA 2VSFA 2WJHA 4NBSA 4W5JA 5KDOA 3AF0A 2E87A 2JIZA 4URZR 3GJ4A 1ZCBA 2CLSA 5IHPA 4XVUA 1KK1A 3QIAA 5E7MA 5FL7D 4DEYA 4EUNA 4LI0A 2GVZC 1G8HA 3EPHA 2BJVA 4B43A 4B44A 3HJNA 1D9XA 2B7CA 2B8TA 4Y0AA 3VTKA 2WAYA 3L0PA 1NY6A 1RJ9B 1T0HB 1BMFD 2H57A 4DSUA 1Z0IA 5KO2A 5FOWA 3FHCB 2GJ8A 3KJHA 1OH8A 1GILA 1P2UA 5KSYA 2HYIC 4BEJA 2BV3A 1XP8A 2OZEA 3RC8A 3FYHA 3LW7A 3D3QA 1ETUA 5EXTA 4L16A 2GZAA 4LJ9A 4BZPA 4MH0R 4I1VA 2GKSA 1T0JB 3KFXA 4EFLA 2W00A 3QKSA 4TQAA 1KI6B 2ZRIA 3L0IB 1P75A 2ZI6A 4HZUA 3EWSA 3OEEA 3TLXA 3L0SA 3VMFA 1NRJB 1KDRA 1GKUB 2IF0A 1JEEA 1Y3AA 3BERA 1QHSA 3QBTA 4IKEA 1R8SA 4M21A 4P3YA 2PCLA 4DSTA 1N5LA 4UJ3A 4Q00A 3AKDA 4XD7D 2V6JA 4ZDWA 3GJ5A 4NMMA 1UF9A 2ZREA 3DZDA 2WJYA 1ZUNB 1R0WA 2RGNC 2BHRA 3A1SA 1ZD9A 5CM9C 121PA 4TL8A 4BFWA 4DRZA 2BIFA 2BEJA 2NO9A 4O0MA 4RVCA 3WP1B 2H92A 4QJ4A 4TL9A 2D7DA 1KKLA 1X1RA 2Y8EA 3QKSB 4H1UA 1Z8FA 5L3RA 2FJUA 3EC1A 5EE5B 3DOFA 2IYWA 4GOKA 3GEHA 1OLOA 2GJSA 2IF2A 4ACAA 4TYPA 2Z83A 4X8OA 5A4JA 3MGCA 1IHUA 4LJ7A 4CF7A 4PHGA 4ZPXA 3HU1A 3QI2A 4JVMA 1Z2CA 4F93B 2OCBA 3DM5A 4B3CA 5AJVB 4AK9A 3CRQA 1DEKA 4CEIA 4HB2A 5BYJA 2ZI7A 2ZYTX 3NHBA 3UMSA 3OE7D 4IJMA 5DE3A 3P26A 3U44B 1P62B 4JLKA 4Q4LA 4BE7B 4YMWA 3NH6A 3B1VA 1KKMA 2ZRPA 3DMDA 1D9ZA 3NHAA 1SKQA 3A8TA 3KQNA 1KHTA 3J81k 4EIWA 2J41A 4BFYA 4TL7A 5HCIA 2NO0A 1SXJA 4TZ0A 3ICQB 4TLAA 4V02A 4TTPA 1RRFA 1G7TA 3MWYW 2QP3A 2EU8A 3FB4A 3AUYA 3VKHA 1NIPA 2BVNA 3BBPA 3DKVA 1LW7A 3BOSA 5G3ZA 2WWIA 4BEBA 5M04A 1YZGA 2V55B 3LXXA 3CZQA 1ZD1A 1Z06A 4DUGA 2GF0A 5C46F 1XCPA 1C4OA 1ESNA 1HT2E 1N6LA 1L2TA 1Q1EA 1W5SA 3IUYA 4DB2A 1XTSA 2J0UB 1CJTC 1KK3A 2AKYA 4QKQA 4B2IA 1Z83A 2RH5A 4RSGA 3K70C 4R98A 1J70A 4R7ZA 2ZJYA 3BXZA 2C9YA 1W0JA 2DFKB 4G3XA 2GCOB 1KDPA 1W2HA 1AZTA 4LYFA 4BGDA 3IPYA 1F2UA 3L0AA 1SVKA 3CF2A 4WXRA 1GNPA 5KSPA 3GLHB 2JEOA 2YOFA 1OSNA 4RD2A 3U2QA 4FN5A 2WV9A 3VHLB 2OT3B 4KBFA 2IWHA 3VNUA 4A0RA 1CRPA 1X8LA 3CWQA 3Q5DA 1KY3A 3K09A 5EXXA 1XJQA 2RGBA 2LCFA 1E32A 2XJ9A 2JASA 3MCAA 3DDCA 1C1YA 3E70C 3OZXA 2PEZA 3RRNA 2QAGC 3X1YA 4I1UA 2O0JA 2Q0HA 4OL0A 3X1XA 1E4VA 2RGXA 2WSSD 2ZRHA 1NVVR 2X2FA 3TSZA 1GITA 1KI6A 2ZRBA 3GD7A 4YDHB 2HT1A 4UKDA 3SJCA 1VCMA 4B2LA 4IDNA 2FMXA 1AN0A 2PJZA 3CLVA 1G291 5SZKB 2FA9A 1NLZA 2CE2X 3BIFA 3WNDA 2JLRA 5TDHA 3EIHA 4PTLA 4L5BA 1PLLA 2W2VA 1TADA 3NEJA 1W5TA 3K0EA 1M34E 1UAAA 2R62A 2B7BA 2IHBA 1XCGB 2UZIR 1MH1A 2I4IA 2G9NA 2VEDA 3V00A 3NKVA 1MO4A 2GK6A 3N2IA 1E2DA 4BLPA 3IEVA 4B2PA 4WUZA 2CLDX 3BD9A 2VP0A 3EARA 4BFTA 3KFVA 3WP0A 2WIBA 2I1QA 4X8HA 1P72A 2BEKA 5FTMA 1E2GA 1NKSA 4MGIR 5J5CA 1GFIA 3RSLA 5JI3E 2ZE5A 1SULA 2OSBA 3CF0A 3P1JA 3ZH9B 2HXSA 4XWKA 2WVJA 3K8YA 3LDAA 3RWOA 5AJZA 4C2UA 5EXPA 4US0R 1XU4A 5FTNA 4BASA 3KKMA 3NVAA 4UNNA 4BRWA 5KSOA 1S2MA 4MGKR 3SZ5A 2RB4A 4PQFA 1GSIA 1E4YA 4DLYA 1F5NA 2QT0A 1FUKA 2NO6A 4I1OA 4FXPA 4OK3A 2NPIA 5DLQC 1B23P 5FPKA 3PUYA 4C3ZA 1E0AA 3WMEA 5AUQA 1P9RA 3A37A 4P4SA 3QEOA 2ODWA 4M9XA 1OIXA 1Z07A 1D2MA 4BFSA 4G5QA 3RRZA 1Q20A 4FD2A 3AVPA 5J4LA 3WXMA 5JCZA 3WBJA 2IBMA 1E9FA 3ND8A 4LHZA 3EWAA 3RS0A 1FQJA 2CE7A 3CB4A 1E1QD 1O87A 1NIJA 3O8DA 1NMYA 3AB3A 4C0LA 2KBFA 4Q4AB 1QHYA 4WXPA 3VKWA 1Y63A 1EFHA 2GEDA 3M6AA 3GLIB 3EPJA 4QRHA 2GILA 3A4MA 2HJVA 3QF4B 2OLJA 1EWRA 1XPOA 2X2EA 4CRWB 4QJ3A 2PX3A 2KWIA 4CYMA 4E22A 1IQPA 2IYQA 1W36D 4EPVA 3K0FA 5FPHA 1T9HA 1ZYUA 1W0KD 3B9QA 3Q85A 4B74A 2QUZA 1PUJA 2LKCA 1IN7A 2A5JA 2WJVA 4JLVA 4QL3A 2OUKA 5EE1A 4A4DA 4GZLA 1KI8A 1XZPA 1C9KA 4F92B 3UKDA 1TF7A 4FCVA 4DT1A 4NPHA 4FMCB 1TU3A 1G5TA 2MSCB 4EJSA 3K9HA 3R8FA 3CIOA 2OEPA 3SBDA 1J99A 1S1CA 4URUR 4YXWD 3IO3A 2B92A 1R10A 3A6PC 2BM0A 4LY6A 1E6CA 2R9VA 1VG9B 4ITRC 5DYGA 3QF4A 2DWOA 4FMDF 5FTJA 2YVUA 1A4RA 1W1WA 4HDCA 2EW1A 4A0GA 1N0UA 2OAP1 5L3QA 2CL0X 1KAGA 4ZO4A 1GVNB 1TL7C 4KXFB 4OKSA 2J7PD 2OFWA 4R71A 1CR0A 5IRCD 1H8HD 3EIEA 4Q1DA 2C8VA 1G8FA 1H65A 3FFAA 3FMOB 1ZUHA 2YV5A 1OXXK 4KODA 2F1IA 3PG5A 2FPMA 2ONKA 1OKKD 4PR0A 1TMKA 1GZSA 1R5OA 3I73A 3A58B 2YWGA 2R2AA 4BFZA 4M0LA 4Y0VA 3L82B 3AEZA 4EKDA 3AVOA 3PEUA 5EUMA 4A0FA 5LPNA 4JLBA 4G1UC 4NYIR 2SHKA 1QG4A 5F3WB 1ZCAA 2GF9A 3TRFA 3QF7A 3LX5A 2ZR9A 4LHVA 3U7HB 1R7RA 1XMSA 4UNRA 1OYWA 1WB9A 5FOSA 5JRJA 4M1KA 4PPGA 5DNYB 2ORIA 4GOXA 2TMKA 3FMFA 1CR4A 3KXKA 3KZ1E 4O2RA 5E95A 1LB1B 1OFTA 2F9MA 3C5HA 5FTLA 1VG8A 2OFXA 1XPRA 1YR9A 5HZHA 1MO6A 2Q9CA 5CJPA 4Q21A 3B1WA 2ZU0C 2HEIA 4YMSA 4DCVA 4NZYA 1FTSA 1X3SA 3GJ7A 2BWJA 1S9HA 1U0JA 2VTKA 4TQUS 2VF7A 2NQ2C 1DAIA 2QPTA 3EX7C 5JWRA 3QOFA 4GP7A 1P5ZB 1Z0JA 1CEEA 3NBZC 4KSCA 3QBVA 1E9EA 1VYUA 3PEVA 3W8NA 4A2WA 1DE0A 4PSKA 3U3JA 4TTRA 1IOZA 3FDIA 3L8YA 2R6CA 1RVDA 2F55A 4B71A 1E2NA 2O5VA 1AZSC 3T5DA 3IIMA 3BFVA 3K9NA 4QFMA 3KQLA 2GA8A 2ZRDA 3FWYA 4EPWA 2C99A 4KFTA 5K8IA 3KB2A 4KFRA 1MRNA 4RY2A 4TMZA 2FH5B 1DO0A 1Z0AA 2VRWA 2EFHB 2ZJ5A 2ODNA 3GFPA 2KBEA 2IC5A 4TZ6A 3K0CC 3EC2A 4GMDA 3C8UA 1XD8A 3AF2A 3FMPB 4NH0A 4RCZA 1T3HA 5TB5A 1GOTA 4ERNA 1P6XA 1YR7A 2FSGA 2IUTA 3AP1A 1CRQA 3MRSA 4QHYA 2Z0MA 2GXSA 1XD2B 5DYIA 1H8ED 1ZNWA 2EFCB 2QSZA 3LNCA 5DI3B 1KNQA 3TUZC 1NBMD 3TR0A 2FZ4A 2VHTA 5G41A 3I1FA 1ZU5A 4TYYA 3QKUA 1WXQA 1ODFA 1W0JD 1JB1A 1M7GA 1E79D 3DPUA 1U8YA 3CNOA 2JATA 2YWHA 4CT4B 4AKIA 1IXZA 1E2IA 2XTMA 5A0FA 1NVXQ 4HUTA 1SVWA 2Z6VA 3KXLA 2IXGA 4IDPA 4QNRA 2JA1A 3VR2A 3AP3A 2QE7A 2ZRAA 3TMKA 1YRBA 3CF6R 3O47A 3A4NA 4NCHA 1EFCA 5JWOA 3ZGXA 3K93A 5GJBA 4RD4A 2W0SA 2ASEA 2ZXUA 5P21A 3C14C 3MUFA 2XOKD 1XXHA 4BLSA 2G3YA 2O8CB 4POAA 5HZKA 4ZKDA 2FGJA 1JJ7A 4DB4A 1Q3HA 4KI0A 5L3VA 4K8OA 4ASUD 3QKRB 4DDVA 5JS8A 3UG7A 3KB1A 3U44A 2R44A 1ZVQA 4M1OA 1W49A 4LV6A 3P32A 1AQYA 1DAHA 1JQLB 4JVLA 3TQFA 5TV2A 4XH9B 1P9NA 2Q3MA 5L8VA 2EVWX 3FHOA 3H1TA 2D74A 2JDID 1W2GA 3ZVRA 2AN9A 3LQQA 1KSFX 2C77A 4IC1A 2PZFA 2QG6A 3DOEA 4JJZA 4OHYA 3MWLA 1KI2A 2O8BA 3MAAC 1E94E 4LJ6A 1DO2A 4PXAA 2UZ3A 4P33A 4HLDA 3R9XA 3AVWA 4M1YA 3PITA 4MRPA 1PJRA 4ZDJA 2RGCA 2QI9C 1E79A 3CX8A 2FPKA 5DGXA 4V0OA 1I2MA 3SQXA 1AK2A 3CH4B 4KYUA 1KYIA 3VR1A 4IDOA 4MUBA 1COWA 2ZS8A 1ANKA 1E3MA 4OHZA 2QRZA 1U0HC 2DFNA 3F5FA 1W0KA 3B1XA 4N3NA 4AI6A 2REOA 3LO5A 4TMTA 3QUSA 4LYAA 3X1DA 4CEJB 3X1WA 1T3SA 4UXHA 2Z4RA 1F2TA 1ZNZA 1P4SA 1IAQA 2C5LA 2CBZA 2BM1A 1GUAA 1OFIA 1T5LA 2NO7A 4II7A 4YMVA 2C04A 3SDZA 4AYTA 2G1KA 1IY1A 5AR1A 2IEYA 4B34A 4RD0A 4UXJA 5FH9A 3B1YA 1VG0B 4NE2A 4WZAE 1E69A 2E9SA 4TMKA 3SR0A 3TAHA 1TQ6A 4L15A 3SS8A 4PHHA 4DEXA 3FKSA 1EGAA 5KPJA 2VHQA 1TEXA 2WWGA 1GL6A 1Z22A 3EZ7A 3DEFA 1DAKA 4IVRA 4IOJA 4QNMA 5DO9A 4PO9A 3TUIC 3OIYA 3K1JA 3RAPR 2OCAA 2XNDA 2N42A 4G5GA 1CF4A 1SXJC 3GLGE 2GJAA 3A4LA 5CITA 5HKKA 4JLJA 1F48A 3SJZA 5EZ6B 4UXIA 5BW8A 2J59A 4JLAA 5AWFC 1LF0A 3GLFA 5BWMA 2VH5R 3CPJB 1NNEA 3E5HA 3LWNA 3CONA 4M1WA 5B58C 4D25A 3C5CA 4WZ6A 1IXSB 1GNRA 4OQNA 3WRXC 2OBLA 4S2EA 3PIRA 1OB2A 1HA3A 1OH5A 2D06A 2XZLA 2ODEA 5CDFA 3MD0A 1OXUA 1Q57A 1JXOA 2ZS9A 1SXJD 1S1MA 3CR7A 1QHNA 1CU1A 3K9GA 4DVGA 4V0KA 1M6NA 5C18A 3AVTA 5E7JA 4D26A 2HJGA 3QNUA 4GFDA 2IS6A 2F43A 4MDFA 2ZVPX 2QENA 3JVVA 3NIBA 1G8YA 2W6JD 1F60A 4ILEA 1G41A 4EPYA 1US8A 3TW4A 2IUUA 2GCNA 3S1AB 3AGQA 4QGAA 1LTQA 3LAWA 1CJVC 4JKIA 1X8KA 1SVLA 2ZETA 2GJKA 1MABB 4DCUA 4W5HA 2O0HA 5G3YA 2J7PA 3PUWA 2R8RA 1FZQA 1KSHA 1MO3A 5DISB 4TMVA 2VIIA 1YHNA 4G0NA 1TNDA 3R9WA 3AUXA 1FNNA 3IBYA 2DPXA 2ODBA 3CZPA 4FW9A 3OEHA 2AL7A 4TLCA 2IYSA 3CUEF 2G83A 3K0SA 1ELOA 1QHHC 2A3RA 3ZDQA 5DHFA 2FU5C 4PSVA 4M9ZA 2BJWA 2C95A 5KU1A 1YZLA 2VHUA 4A1FA 1DG1G 4LUCA 5K8UA 1R2QA 4LJAA 3RNLA 4RJLA 3THYA 5FL7A 1JJVA 5JJKA 1SHZA 1SXJE 4L8GA 4RFSA 1KO5A 2IYYA 2VQSA 4Q18A 1O3YA 1TUEA 3ADBA 4MQBA 3UIEA 1OHHA 2XGJA 1NKTA 2FPLA 2PLRA 4HYYA 5L3SA 3PENA 5B57C 3IILA 3UXMA 4IFBA 1D5CA 2VHCA 2FX3A 1G3IA 1GNQA 2IYTA 2V1UA 4GL2A 4BECA 2ZUBA 3P4YA 3TW8B 3CRVA 4TLBA 1NN3A 2YZ2A 4OBEA 1LF5A 3VU9B 4Q01A 4HUQA 1GWNA 3LBNA 1NMXA 1CIPA 4A9AA 1JI0A 3TH5A 1AGRA 1M1YE 1IN4A 4MYTA 1GRQA 2JAQA 4AG6A 1RRCA 1Z0FA 1YU9A 3AH8A 2GXAA 2IYXA 2ZJ2A 1T3LA 4NCNA 2GRJA 2N46A 5SZIA 2BMJA 5LD2C 2NO1A 1BYIA 3LV8A 3Q9LA 4GT1A 5A5GA 4ACBA 4NCJA 4RD6A 5FOUA 4IVPA 2XXAA 1FX0A 1U8ZA 4Q1CA 1KDTA 2N1BA 1IM2A 5DHAA 5E7IA 5IK2D 1W4CA 1T8UA 1QF9A 1XFAA 4RFVA 3UPUA 1FOEB 1S4QA 1BYUA 2YNMA 1LFDB 3ADCA 4NYJQ 1KO7A 1SKYE 1QG2A 1NG1A 2YJTD 1WF3A 3CNNA 4JT2A 2GHIA 4DLWA 1DARA 3TSWA 3EPKA 1E0JA 1N25A 1Q1BA 1HE1C 2IYUA 1WRBA 3Q72A 4PC3A 4IEIA 4FINA 3BH0A 4B73A 2D2EA 3EZ6A 2V6IA 1BS1A 1Z47A 1E1RD 1W36C 1G1MA 1R6BX 4H9GA 1VCIA 3FKQA 5FR1A 4KSBA 2D2FA 1EFRA 2OFOA 2ONJA 5DI3A 1YE8A 4NCKA 2OXRA 2GAAA 2GCOA 5SZJA 3IDQA 3ZVMA 4UNPA 1ZINA 5DH9A 3O8CA 5E4FA 4TT3D 4LC0A 1NBMA 3WHKA 2G6BA 2A5DA 1N5IA 4LOAA 1RZ3A 2PT5A 4TTQA 5H1YA 2QBYA 2NZ8A 3QVVA 5TY0A 2KI5A 3V4RA 2X19A 1RRPA 1WBBA 2X8AA 2WKPA 5JJLA 2FSFA 3OFND 3NDPA 3D7MA 3QXJA 4UQOA 4HZUB 5KNBA 3BRWD 1XJCA 2YWEA 4V0LA 5TVKA 5IK2A 2BBSA 3U7FB 3GJ0A 3AGPA 4PAQA 3O8RA 1ZJ6A 2KB0A 1G7CA 1OIWA 1I2DA 2IWRA 3HU3A 2O52A 4KVGA 1OIVA 1CS4C 2AXNA 2VSXA 4Q66C 3VX3A 4M2LA 3DVLA 1K6MA 4YXWA 1KZ7B 3B85A 1KZGB 2V7QA 4R5QA 1I4TD 4TQ9A 1FUUA 1N3BA 5JBQA 1P2TA 2J45A 5CIQA 3K0AA 1NL3A 4EQ6B 1RW4A 5D3QA 1JECA 1XX6A 4CT5A 3U4QB 5J40A 1DAEA 2ZE8A 3BORA 4LYHA 5HR5A 4OHWA 3H0KA 2QQEA 1KI1A 4DIEA 2XEXA 2ZRJA 3M4YA 1YRAA 3FMIA 4Z51A 1UBEA 1NI3A 1FW6A 1MOZA 1U81A 2RCNA 3HPQA 4G5OA 4JBYA 3KQUA 3CO5A 2GXQA 4QBFA 3AM1A 1VECA 1I4LD 1NP6A 3QXSA 4FMCF 3ZVLA 3PUZA 2AK2A 2FFQA 3QEJA 3ZIAA 1JPJA 1E2FA 4Z54A 2ZR7A 1ZRHA 2FEMA 3K0FB 4CIDA 3QPWA 4A8JB 1DAGA 1TQDA 4O2LA 3TQCA 5J4KA 1OKKA 2WICA 4PX9A 4JYCA 1E2MA 1M74A 2Z4SA 1GG2A 1TQ2A 1IJFA 1HT1E 2OAQ1 1NN0A 2ZR0A 4L4UA 4TN1A 4X8LA 1P2SA 4ESHA 3W8RA 4B3FX 4ZIRB 4F4IA 5FBQB 1NVUQ 3VHXA 3R20A 4DSNA 4DCSA 4B75A 2WPDA 3IBGA 3ASZA 3T15A 4M1MA 1Z6AA 3W3AA 4IOKA 4Q47A 4QM7A 3QPVA 2QORA 1XD2A 2P0EA 3I8XA 5J4YA 2D3WA 2GTPA 1AA9A 3CX7A 4JT4A 1Z29A 1UKVY 4CEJA 3KTAA 3W6PA 3M1IA 4NONA 3TR5A 1GKIA 3PJRA 3I3SR 5DN6A 4US2R 1EX7A 4QG7A 3RSOA 4D80A 4ZDKA 1KI7A 2OG2A 2EFDB 1ZM9A 5C4GB 5C1BA 2GXUA 2ZRNA 1G20E 1DAFA 1ZM2A 2CCJA 3MJRA 4DIDA 4WIAA 2ZROA 5EUQB 3I61A 1E2PA 4DT1B 1XNJA 1Q1QA 4FI3C 2Z43A 2ZQ5A 5CB8A 4MUAA 5AUNB 2IK8A 1AVQA 4ZKEA 1OFHA 2ZS7A 4ZCIA 1T4GA 2P6RA 3IQXA 3PVSA 4JL5A 5FFMA 1E0SA 5JFGA 3SQWA 3A1VA 4CEHA 3CRW1 1KOFA 2WWWA 1WCV1 3H86A 2BCJQ 2B21A 2D62A 2JJ2A 3HP1A 5AK0A 4W9MC 4U7DA 2ZUCA 4D82A 1M2OB 3BB3A 3EXAA 3QKRA 5IDVA 2V9PA 4RZXA 4AURA 1DADA 3FE2A 2G0TA 1OHHD 1BMFA 2CXXA 1E1QA 3JZAA 4Q7LA 3QJYA 2HUPA 3THYB 4YONB 2P5TB 3HU2A 4OI0A 4PC2A 2ZEJA 3RDPA 5D3MA 4A8JC 3LLMA 2D4HA 3TGPA 2ZYVX 4F4JA 1GDDA 5DI9A 1Q1ZA 5EQTA 2QAGA 4AKEA 5JMTA 3PV0A 3TBKA 5FPYA 3PEWA 4R2IA 4EPXA 3PFIA 2IYLD 3TKLA 1KIMA 1EWQA 1TPZA 2BOVA 2QGZA 4MGYR 1YZNA 2QEQA 3LY5A 2ZIAA 5KTYA 1P73A 1X86B 2GWHA 2WOOA 3KDSE 6Q21A 3V4FA 2PZEA 3FGNA 4IDHA 1NVWQ 2OM2A 3KL4A 3NEYA 4BLQA 2JGNA 3GJ3A 2PJRA 1NJFA 1UBCA 2RHDA 4O25A 2BBOA 3U61B 3NXSA 4H1VA 5F9HA 4BZQA 2WWFA 4Z8YA 4ZV4A 3EZ2A 4J0QA 2WWXA 1UBGA 2YOHA 1JPNA 3LD9A 3SFVA 1J8MF 1XTRA 1US8B 2V1XA 3CWZA 4HAUA 3WNBA 1U8AA 2YC4C 1NSTA 2XOKA 4DWJA 3ZYCA 2Q9BA 2QZ4A 2F6RA 4MKGA 2FDCA 5B64A 3LVQE 1QHGA 4BFUA 3ETLA 3QG1A 4JLPA 3RYTC 4HLQB 1YR8A 2B8WA 4Q1FA 3FVQA 2OILA 2JDIA 1E9SA 721PA 4Q9IA 3NBYC 1UADA 1XBTA 1XRJA 2FFBA 5JEDA 3VU9A 1PZNA 1ZNXA 2DY1A 2G77B 1D2EA 1R4AA 2GJ9A 3M0EA 4HLCA 5GVRA 1N6NA 3WY9A 4CEHB 5F9FA 3JZMA 1NY5A 2GZHA 2KJQA 2P2LA 4PQYA 3GJ6A 4C0KA 621PA 3C41J 4Q4AA 4LPSA 1WQ1R 4LHXA 1AJEA 3TE6A 3KJGA 3NBXX 5BQ5A 2WZQA 1HY3A 2DR3A 2V8OA 3R7WA 2ZSFA 1S96A 2BC9A 3Q7QA 4K81B 3PXGA 2ZJZA 2PBRA 4KJZA 4ABYA 3RANA 5EP1A 3THWA 4GSYA 1R5BA 1SVOA 4WBSA 4E07A 4A15A 3ECCA 1JAHA 3NC1C 3NTUA 3EW9A 2V54A 3T1TA 4Q1BA 3OFNA 4QJ5A 4A82A 5LDDC 4DCNA 4JJKA 5BN3A 5FI0B 1ZP6A 2GESA 3SNHA 1KO8A 1E2LA 4PANA 4B33A 2WTUA 1DTSA 4OHXA 4DZZA 2QTFA 4RZUA 4XWAA 3QQ5A 1TTTA 2QT1A 2IL1A 2KSQA 4AD8A 5GVSA 2F1HA 5KPDA 3FPAA 1KK2A 4OHVA 4HAZA 2EQBA 2R6AA 3AF3A 1DELA 1DS6A 1GRNA 4LJ8A 2WKQA 2QMHA 3GCGA 1MKYA 2A9KA 4JBXA 1XMVA 4DSOA 3WYGA 1BO6A 1G17A 2JLUA 2XSZA 1JNYA 1OF1A 2DBYA 4YMTA 2ZSAA 2RGAA 4YQFA 4HAVA 3QPUA 2ZRKA 1EFTA 5H70A 2J5XA 2EYUA 2Q21A 3HR7A 2RGNA 2YC2C 5BN5A 1XTKA 4C0SA 3UG6A 1WP9A 3UWOA 5EP2A 3ZZUA 4B76A 2BCGY 3N2EA 4B35A 1IY0A 4URWR 3RWMB 4KYIB 3VAAA 4C0HA 4KU4A 4OYHA 1TEVA 1GAJA 1OJLA 3K0AB 3A1UA 4HEJA 4HDQB 5CB6A 1IN5A 3NBFA 1DG3A 2YWFA 3EA5A 2MMGA 4LPKA 3EAQA 3EZFA 3MWJA 2YYZA 2QROA 2QRNA 3DO6A 4EAQA 1OT3A 4WA7A 1V43A 4D81A 5CK5A 3W90A 2CHGA 2GCPA 4QGFA 1OXTA 2L0XA 1NN5A 4V0MA 5JZVA 1E99A 5AJWA 2ZPTX 1RKBA 2QNRA 1FFHA 2AK3A 2JCSA 4XD7A 4DJTA 4OI2A 4JLNA 3B9PA 4ESVA 2OESA 2ZI5A 3LFUA 4HUQB 2WWYA 2RHMA 2OO7A 2ZUDA 1CR2A 2ANBA 1FP7A 4U02A 3SEAA 4BZXA 1II0A 2XJ4A 4YC7A 2I3BA 3WNCA 2XB2A 3I5XA 3Q3JB 1Z63A 1FNMA 5JJIA 1D8TA 4UJ5A 3ZJYA 2QQ0A 4XVRA 4PHFA 1G8PA 1XEXA 4IW3B 4DC9A 1K8RA 1OFUX 3IIKA 1F3OA 1FMJA 1P9WA 4HLUC 3AVXA 4JS0A 1F2UB 3G5UA 1DVRA 4PC1A 1GL9B 4Q7JB 1XEWX 1ZUIA 3I62A 3RHFA 3U3KA 2QTHA 1XCMA 3I72A 2HXYA 2RGEA 3MSXA 5JECA 2PX0A 3KQKA 4NYIQ 1A5TA 4FWIB 2W58A 3X1ZA 3W34A 4QC2A 3HWSA 3GLIA 2YKGA 3E2IA 5FBWB 3W9YA 1AKYA 2DHRA 2YOGA 3RRYA 2J46A 1N5JA 4TL6A 3THXB 4Q1EA 4GMXA 1ZIOA 4MKFA 1XD9A 3ASYA 2ZTSA 4YMUA 3ADKA 1IBRA 5BYKA 2Q9AA 4A0HA 1KO4A 2IS2A 4B47A 2DFLA 1NJGA 2IS1A 1S8FA 2A5FA 2JJ2D 3VQTA 1H8EA 5HE9A 5IF9A 2ZAOA 5JCPA 2O8FA 1HH4A 2AWNA 2Q3HA 3U3MA 2ANCA 1Z28A 4I81A 3F3YA 1CLUA 2K5UA 1HV8A 1R0XA 3SBEA 2FWRA 1W4RA 2EWWA 1N0WA 4GNKA 1YQTA 2XTNA 2ZJOA 4Q9JA 1A2KC 2FG5A 3D31A 3TUJC 1KI3A 5HE8A 2OCPA 4FIDA 4PC7A 2CK3D 5HTKA 3WYAA 2UVQA 3H4MA 2BMEA 1CULC 1DOAA 2QSYA 2O8EB 1RC8A 2F9LA 2G0NA 4WW0A 5DN6D 5H8WA 1Z6TA 2VP9A 3EG5A 4MRSA 4HZIA 5FUVA 4B3DA 3SJBA 4WOPA 4B3GA 2QMEA 1YKSA 3P27A 4D4KA 4OK6A 3DZ8A 1P60A 3SM4A 2REBA 4OJQA 2XAUA 4IXNA 3H2YA 4BPBA 5FOXA 1MV5A 3I5YA 1P3JA 4JSYA 2F3RA 2ZSEA 1Z2AA 1KK0A 4IHQA 4D4MA 4DLXA 4C30A 1CJKC 3RC3A 5TMPA 3T1QA 3U5ZB 3KJIA 2NIPA 4Q19A 2CNWA 2IYRA 4U5XA 1AS2A 4ASUA 5E3HA 2IT1A 4FCTA 4LZZA 4TYWA 3WRYC 1W36B 4M22A 2AXPA 3U3RA 1E1RA 4GRAA 1EG7A 5K8TA 3GPLA 2ZJBA 4A36A 1XEWY 5JWHA 2XZOA 2J7KA 1HQCA 1X6VA 1YZKA 3PCRB 3BFKA 4HI0E 3T5GA 1NLFA 1N6OA 1UKYA 1UKZA 3TVDA 3BFXA 1E98A 2P6NA 3DL0A 1T6NA 4M9QA 2HF9A 4UNQA 4URVR 4OI4A 1G6HA 3SI7A 2AKAB 5C4MA 5AJYA 3RS7A 4HATA 5CYPA 2F1RA 1T91A 1ZD8A 3S1AA 4HDOB 2XNDD 3BB4A 1G64A 1II9A 4XJXA 1W47A 3L8ZA 4KFSA 5K8LA 3UWKA 3T12A 5HKKD 5KDDA 3U6BA 4DKXA 3BJIC 1II8B 2ERXA 1JQJC 2NTYC 4MKIA 4XIGS 4F7WA 1BKDR 1LNZA 4TT3A 1JBKA 4C0QC 3QSYA 1FQKA 5JSZB 3I32A 3GEIA 3TIFA 3D6TB 2D7CA 3O8BA 3PQCA 2H1LA 2LKDA 3AP2A 2ZSDA 4Q9HA 1JXMA 3SHFA 5C2JB 4R2HA 3B6EA 2C03A 3GLHA 4G01B 2XITA 4Q4JB 4XSGA 2QM7A 4DLVA 1KMHB 1MR3F 2OXCA 5JHHB 4LCBA 1E9DA 2R6DA 1Q22A 5LBIA 221PA 2JJ8A 4TYNA 1R5NA 3F8TA 4HB4A 3FFBA 2A78A 2HCJB 3ZVNA 2ZI3A 2WWHA 2RKOA 5DIFA 4PZLA 2RMKA 1KMHA 1VMAA 5AJXA 1OH7A 4GPTA 1NLYA 4MRVA 4PAMA 4RCYA 3VR6A 3LQRA 2E1RA 4JYBA 4ZI3A 1W46A 1G8GA 2CHQA 2VSOA 3LH5A 3SN6A 1HEIA 3ZD7A 4NDZA 3RS5A 2PMDA 5KUTA 1P2VA 2CCKA 4QXAA 2YHSA 4R9UC 1L4UA 3REFA 2A7QA 2REXB 3ZZ0A 4AIIA 5JRZA 2QY9A 1NBME 1U2RA 3SYKA 4K46A 2O8DB 3OIWA 1N0VC 2HF8A 4LBYA 2J0QA 4RD3A 2O8FB 3BK7A 5EZ5A 2R6FA 1QHHB 1VDZA 3KX2A 4JSTA 3IO5A 2O8CA 4D4LA 2WJGA 1ZC4A 4BLRA 2W2XA 3LA6A 3GLFB 1M7HA 1NVVQ 3AF1A 1UJ2A 4HB3A 5FI1B 5H68A 3VR4A 2IHYA 4BRUA 1WE2A 3WBKA 2ATXA 3OAAD 1G16A 4JLOA 3OEHD 1T8TA 1ZIPA 2ZJAA 4LK2A 2GETA 4DDUA 3BAFA 1E2QA 2ZM5A 3OE7A 3C16C 2OE2A 1FPMA 5EXSA 5UKDA 1QRAA 3R8CA 1XMJA 5CLLA 3B7GA 3K70D 1TX4B 2ZVQX 3OEED 4DLTA 2FOLA 1ZBDA 1KI9A 521PA 2H18A 4PFSA 2QGNA 1E2HA 4PQRA 4DXAA 1KO1A 1HE8B 1KNXA 3OIVA 1J90A 3GLIE 2WBLC 3SZ4A 5KOYA 3VFDA 3W3ZB 3DM9B 4TSFA 4LBVA 1X8JA 4AC9A 5B30A 3QENA 2H7VA 3NH9A 5IT5A 1E2JA 1KSJA 2WMOB 4P4SB 4QBHA 4BLOA 4DUGD 2ORVA 4D2IA 4M53A 5FUYA 2XZPA 4E5UA 2VL7A 3SYNA 4G5RA 4LJYA 5KSZA 3T34A 3TAUA 1W48A 4XVQA 1VYTA 2XSZD 1WA5A
chains in the Genus database with same CATH superfamily
5F2EA 5LUAA 5AKLA 3A36A 3A14A 2XCSB 1J2JA 3LVRE 5ECGC 2HCTA 2YW2A 1H6BA 1RLUA 3OM8A 3DOCA 3I3OA 3UWSA 4D4JA 3G2NA 2C7QA 1PNTA 3M6UA 4DDKA 1ETHA 2IHZA 1Y81A 3F5SA 3ONWA 2AI1A 4NSNA 4YALA 4ZDIA 3I2YX 3PWZA 1H0HA 1QGED 5G0UA 4LJLA 2HTEA 2DYKA 1WEHA 3CUKA 3QUCA 3AOEC 3VDNB 4BQNA 3PQ4A 1P18A 1OT5A 2ZRCA 4A8PA 1MV8A 1I3OA 4FYPA 3DCJA 3LIIA 2NSHA 2P8JA 3FCYA 1OH6A 1H85A 3C6XA 4GPZA 4J6EA 1OX6A 5B4UA 5A62A 1LLDA 1QX4A 1IMJA 1YL5A 5E6SA 2ZJ8A 1YT5A 3OUTA 5JD5A 3EEQA 1HYQA 1YQ9A 4QVKA 2CEAA 2FE4A 3U49A 1EB8A 1LH0A 3ZU4A 2PD6A 5KAMA 3RU2A 2JG3A 1V5FA 2E4YA 3ZLTA 1UZUA 2NSJA 4NKRA 1ZNYA 2HFJA 3UK0A 3T4UA 5FBLB 2PD3A 3NDJA 5LXTF 2OFPA 4MA0A 1WETA 2R84A 3KIPA 1P0PA 3IVMA 4CKEA 5B58T 3MCTA 4C7MA 1E0KA 1GEGA 1ZWKA 3PCXA 1DUVG 3OD1A 2ZAMA 1OW3B 3UHAA 4JYMA 1PLJA 1E6EA 1S3SA 3N07A 3ZGLA 4WACA 4RMGA 1Z36A 4OB8A 4R1SA 2O59A 1XCJA 2WVHA 2Q6TA 3AWDA 2X2PA 5LZ5A 1S02A 4HFJA 1MQSA 4WOBA 2PWAA 4UZFA 1UQRA 2PS3A 1BGVA 3W6ZA 2WMNB 4D56A 2W83A 2XYHA 2G4VA 5FLEX 3W6OA 1A9YA 1Z5OA 3LHIA 5FNVA 3ENZA 2PKEA 3CE6A 3IFSA 1RR6A 4P8RA 4CL2A 3STXA 3B2QA 1T1IA 2C61A 3BWDD 3E3AA 3FOAA 3MGBA 2DBRA 1IIRA 2IX3A 1HPLA 3HKEA 1N6KA 3NJ4A 2JAPA 4KQCA 4NU8X 1VLZA 2WIAA 3A1DA 3AO0B 1ZRMA 3LRPA 3N86A 5DDIP 1PE0A 2VSQA 3KKEA 2O3SA 1SC6A 1YIOA 4I46A 3HJFA 3IA7A 4K9QA 1N6HA 4GYWA 5DBHX 5D3KA 4DJDC 4IBOA 2RGWA 4L7QA 2EKDA 3GRVA 4A8JA 1PJLA 1WNTA 2JLQA 4MA4A 4OL9A 1IONA 5L7TA 1EFAA 2VUSA 3EFOB 3D6HA 2WYVA 3Q8WA 4HQOA 2H9IA 4HWRA 4F2HA 3LT1A 1QV6A 2K87A 2BI7A 1ACMA 2AMFA 1QZUA 1EWTA 1JKJA 1ONBA 4GI3A 1JHDA 3WLAA 2OO5A 4LXYA 4NZ9A 4FDVA 1NR5A 4FSXA 4Y6GB 1MEJA 4OLAA 1Q50A 3M3DA 4OGLA 2G1JA 4PLPA 5AXBA 1BHJA 1D4OA 5L3QB 4FYIA 1GRCA 1L7VC 3LF2A 4GKBA 4PYLA 4QOSA 2VTVA 2IPXA 2WR8A 3CEHA 1DRVA 1T4MA 1V5GA 4I1SA 3ORHA 3AZOA 3OZ7A 5TC4A 3ZQJA 4EPRA 3ZD6A 2HLDD 1XDBA 1H9BA 4DTCA 3MCVA 3G7UA 4L51A 1GHTA 4MVCA 4XA8A 1UJ5A 4UCWA 3C6MA 1TQ4A 2RKWA 2PX2A 4LV5B 3LU1A 3OPYB 4R05A 4UC0A 5HKOA 2JJ1D 1DBQA 1G4AE 1SHKA 1H2FA 2I65A 4V03A 3VOBA 3M6WA 2HIHA 1S5PA 4DLLA 9LDBA 2EWVA 1U7XA 5ETJA 4RFSB 1CNEA 2G9VA 2QPOA 4CGYA 1HQYE 1YR1A 3OCCA 4ALJA 3PFKA 3PQ7A 4C20A 4G25A 1RD4A 3KLBA 1W30A 4ROTA 3R3JA 3WK4A 5JSUA 2B5VA 1N8KA 5D7NA 3RRFA 2ZI4A 1WMSA 2P9GA 2PRSA 3GMTA 3CRMA 1LCIA 2FPIB 3THOA 2MMCA 3B13B 3F9IA 4RY9A 2AQ8A 2IEZA 3EF3A 2XECA 2BFMA 4C0JA 2AEMA 2E37A 4BQSA 3IE1A 3UWDA 2H29A 4Z1MA 5KTKA 1RMQA 1XEFA 4IFIA 3WL8A 1WG8A 5BQPA 3S2ZA 1K5HA 3I9V6 1Y4AE 2NSLA 2WPDD 3SYRA 4BNLA 3O6VA 1YBMA 2PZGA 4WD3A 1G5QA 2UKDA 2V7QD 3R0IA 3M7IA 3AK4A 4BMXA 1LBQA 4GR9A 4B3JA 2I1LA 3IKVA 4I9FA 1NI5A 1IK6A 3LOQA 2VP6A 1PYDA 3P9QA 4IP0A 3EASA 1CY4A 4KLAA 4BKUA 3H9JA 4LGCA 3OEYA 1XMQB 3MLEA 1R8QA 2VXCA 2RGUA 3ZX5A 1P80A 1PV2A 1C3JA 2I7CA 2QQFA 1H5NA 4LY3A 3FNHA 3R7WB 1SVIA 1AG9A 1Q21A 3JV7A 1MHTA 4IIHA 2ZBEA 1TUIA 1I4WA 4FUQA 4TXJA 5JJCA 3IT1A 5TMEA 5KJ1A 3K53A 4YCBA 4DVJA 4HK4A 1N1GA 2IE0A 3AKCA 4J0HA 4DBLC 2O8DA 5IANA 1QBKC 1SVUA 2OD2A 3NEPX 4A2PA 1QHXA 1Y8ZA 2BFBA 3T1OA 1PG5A 1WR8A 2F3TA 3TB6A 1XR3A 2R1UA 1JHXA 2K7ZA 3H18A 3CSDA 3FPEA 4TQGA 3VKUA 3LUCA 3WE7A 3K1ZA 4ER3A 3JQ8B 5ILOA 2QRJA 3ROTA 4UTZA 4KR9A 4FR2A 3FPCA 4J3FA 5K3FA 2G1AA 2HMUA 3GZNB 1RABA 4MQFB 3SC2A 4IHAA 3A9RA 3SZ3A 3SQDA 1P6UA 3TCKA 1PFQA 3OAAA 4EJSB 2ZE6A 1XXLA 2ZTUA 3L8MA 3WGLA 5LQJA 4IJKA 1RMYA 5FNVF 1HBJA 3AVUA 3LPDA 1XDZA 4GRDA 4Z7JA 4I1RA 1Z8DA 5AHRA 5CH3A 1V4BA 5LKAA 5F1OA 2EDCA 2IH5A 4FYJA 1J00A 1EDBA 1KJNA 3FHLA 1PFGA 3PJEA 1UJMA 2WWVD 1I3CA 3V8PA 2XDWA 4C4PA 4IH1A 3PDIB 1WBDA 4JVNA 5KU7A 5HRUA 1FSSA 5LZ9A 1JGTA 1CQIB 3HUDA 4CEIB 1NF3A 3BQMB 2L2QA 2N0SA 1H1LB 1O95D 2D00A 2I6XA 2A1UB 2IIPA 3FG9A 2IW1A 3HBAA 1SZPA 3WGNA 3WKEA 4CT0A 5F7XA 2FCRA 2CHVA 4QE3A 5BSHA 5LIPA 3WWCA 3BZUA 3QNMA 1A2QA 2HIGA 4OB6A 421PA 5CJ2A 3L0DA 4DLZA 4LDPA 1DUSA 3NAMA 1HNWB 2FQYA 1EVIA 1ISFA 5HKAA 4NYMR 1I9CA 5KOJA 2ONCA 4EEXA 4BNJA 4RX1A 1D07A 2JD2A 2ZYWX 4EVRA 1JR6A 4GSLA 2P5SA 4RZ2A 5ALWA 1FU8A 4XTCS 4D0NA 3VXKA 4TKVA 2G9RA 1MABA 3F0TA 3UJ6A 4CL8A 4O5OA 1SCUB 2EKLA 3I2KA 2RI0A 1FBTA 3NYRA 3O1IC 1I6MA 3ZEIA 3EVBA 5EGSA 3DZFA 2ZPUA 1BJRE 1GQOA 5BVGA 4RFLA 1U2PA 2FMTA 4LBZA 1OXSC 4E6PA 4LRUA 3C1UA 4ODIA 2V45A 5CVTA 2PIDA 2YINC 2P9HA 2DT5A 4E5NA 5AI6A 2F7SA 4AJ4A 4FBMA 3S27A 2C8LA 1X94A 3RARA 4DGSA 1PLKA 4ZJZA 4P3OA 2XCRB 1WSBA 1ZIYA 3EGWA 3HXOA 2B0CA 3KEOA 4LDRA 2I1VB 3LX8A 1BRTA 3AHHA 3NHMA 4Z9AA 1GP2A 3U40A 4E46A 3K6KA 5IFLA 1JW9B 3CPEA 4YRZA 1JG4A 3GVCA 3I9JA 1XZHA 4HN9A 2JFBA 3AONB 1QPGA 1KEEB 4HYQA 3E23A 5F4ZA 4MKZA 3U16A 4O4JF 1AGPA 5FEMA 1EZ4A 3T35A 1SQ5A 2X1MA 4LCJA 4XOIA 1JFLA 1NQOA 1TVCA 2HCBA 3G5TA 4MS4A 1H2ZA 4G8CA 1VG1A 2EBHX 4MVJG 4LA4A 4D0LB 3OD5A 1E2KA 4PONA 1B0UA 1XMIA 4V0ME 5GADl 3NMUF 1PJ4A 1DIAA 4QYIB 1NC1A 2X0IA 3P9SA 3DT8A 4ARBA 3KQQA 3T9AA 1P1KA 4IRUB 4C3VA 4EW3A 5B2ZA 4NJMB 1EFRD 1EX6A 1EZ1A 2XA2A 5H02A 3CR8A 1UFQA 4PYIA 5JHGB 3HM9A 1RSZA 4E70A 4RTJA 2FPGA 2IYZA 4PS0A 2IEIA 3TMAA 1QP7A 3PEYA 1U1CA 1U94A 1M1XB 3GQBA 3PR1A 4GP9A 3RK0A 5KC8A 5J3JA 3OZVA 5JXJA 4D3DA 4RV4A 1G98A 5FPTA 4EHDA 4OMUA 2BBWA 2IZ7A 1A69A 1V25A 2CJWB 2NVWA 3JD2A 4EQ6A 5DLYA 3KTAB 2OCYC 3QVLA 4KKVA 4LRQA 3RBZA 4YCLA 1W85B 1VZ2A 4CG1A 4PPNA 4G5XA 4KZKA 2JLZA 4DR4B 1L5VA 2QYTA 2YUTA 4JI7B 3SHTA 1KDOA 2VPPA 3I5MA 1KBOA 1TKBA 4N6NA 1VE3A 4QGHA 5GY7A 1MDFA 1QO7A 4C01A 2NNLD 1D1QA 5FL3A 4MR7B 3JAWA 1JA9A 1FFEA 2AR9A 2D1TA 3ONDA 5DHQA 1JAXA 5KI6A 2V7UA 1Q0PA 2VK8A 4LFBB 4ZTZB 3PPWA 3PGA1 1A9XB 3CNLA 2N47A 3UCEA 1ZEMA 1BAPA 1KKUA 1FEZA 3KJXA 5EWJA 2CC2A 2IUFA 2ZKLA 3G5MA 3OKAA 4RVHA 5TY0A 4YT8A 5K0GA 1AMUA 4RPHA 1T9BA 1I7SB 5KQSA 3EZNA 3IKTA 1SBZA 1HUQA 2WU1A 1ZVKA 3AQ4A 4KCGA 3TXYA 4HAIA 2KMLA 2H4FA 1KSGA 1LC3A 4RVOA 3RS4A 2GN0A 1Z0ZA 4BUJA 2HQBA 2H8KA 2CZQA 4V2UA 3GK3A 3QE0A 3EAGA 3O95A 3GJSA 3AVQA 3R5JA 1ORDA 4NEHB 5EKTA 3LMKA 2PMEA 4EJ0A 2H2GA 2PRYA 4V0QA 2GPNA 2Q3EA 3RAJA 4ESEA 1KI4A 2NYRA 2QNBA 3BA6A 3UB4A 4BYMA 4KGXA 3LKVA 2YY7A 1AO3A 2J5BA 3U3OA 1JA1A 1I13A 3GWZA 1C14A 4ZGBA 2GM3A 3TFOA 3CJTA 1XRNA 3CEJA 1DFGA 1U9IA 1X80A 3EK2A 3QBDA 3ZV5A 1ATZA 4OUDA 2C00A 3JQFC 3LBHA 2RHWA 4CLRB 3IVXA 5AM0A 1CQPA 4LJSA 4CKWA 1WDTA 2F62A 4KN5A 2IXEA 2LDXA 1E6MA 1P29A 4W5WA 4WXMA 3SVZA 2CL7X 1N5OX 3TNFA 3PFCA 3IGFA 3ROPA 1G5PA 2YS6A 4GF5A 3DNFA 2QPAA 4Q1AA 1KQNA 5KTTA 2ZJ3A 2GK7A 2BDUA 3PQ6A 2BPOA 3IALA 3EEFA 2ZU6A 3T5CA 1BE8A 4P7BA 4C4SA 2ID9A 5TJHA 5AJHA 1IUNA 1LBIA 1VIVA 1CDZA 4Q3AA 3JARA 3CGGA 3UGQA 2IW3A 2YDXA 4DLAA 8OHMA 2HT1A 2AFHE 2ZITA 2ZRMA 4BS9A 4Z9YA 2VLIA 2A0UA 1G5RA 1I5OA 2E5LB 2FV8A 5J59A 2OCGA 4NATA 3OIUA 1W4BA 4QU0A 5CVUA 4ATNA 4DC0A 1ZJJA 3D9QX 4MI1A 3V80A 1QZXA 2R6ZA 3EYWA 4E32A 5JCXA 1FTWA 2HYDA 1K0UA 3H5AA 4TMXA 1P4GA 4MULA 5TVGA 4YAWA 4D92A 1A9OA 3WLHA 4CGZA 1QO9A 2Y0EA 2A94A 1Q2UA 3BH6A 3D1LA 4G07A 4RH1A 3EBOA 3VPXA 4ZCMA 5C32A 2YBEA 3NHUA 4B6FA 2AZXA 2A92A 2XRMA 5J1SB 2C2KA 3ZJ4A 4MDEA 3OZBA 3M6IA 1J2TA 3GEEA 3BREA 4QHSA 4G0UA 2OHJA 2HLDA 2AE2A 5KKCA 3UN1A 4BJ5A 2P3SA 1AS3A 5K5EA 3BWCA 3FKSD 2QAGB 1NU8A 1Z5ZA 2EF1A 4QFCA 5AKEA 5K4AA 4WLVA 5AESA 3A06A 3EEOA 5CVEA 4B6JA 2P4EA 4CUJA 1YASA 3FF1A 5JANA 3VZBA 5K03A 2J30A 3S8EA 1VDMA 2SKEA 2VZ9A 3AHEA 3O26A 1ZZEA 3X2EA 3AESA 5I4BA 1S9DA 4UHKA 1SK9A 3HSYA 3SM9A 2PX6A 3SZRA 1Z4OA 2FP4B 2OGSA 5HUHA 4G63A 2EX1A 2QU8A 3CKLA 1NN1A 1D4FA 4LG1A 3TOZA 5LDHA 2CYBA 1XT6A 1VSBA 3V7NA 2XNCA 3WGTA 3C15C 1XF9A 2X3UA 4E2FA 3OZSA 5FAKA 1IG3A 5A7FA 2NOAA 2H06A 4P32A 4C0XA 3P45A 1IATA 1MAAA 3S5JA 2J0SA 3H8SA 4HLCA 4Z1MD 3TGWA 5E6RA 3V3TA 5JI2E 3K70B 1ZGZA 5DEOA 2F4NA 1HF3A 4HNAB 3D4NA 3G82C 2AWOA 4XJVA 1RLIA 5CBKA 3R41A 4ZT3A 5IYZA 4KPYA 5AQEA 3TLEA 2O07A 4WK4B 1GFSA 2PANA 2JVJA 1R9NA 2VYQA 3KOOA 4URXR 2NU9A 3C4JA 3UEOA 4CMHA 1BROA 3U17A 1U3CA 3UHFA 4AMVA 1G19A 1DC3A 5GIPE 4JZKA 5ALSA 2Y05A 4Q48A 1A8HA 1KFJB 2VJQA 5AQ1A 5M5BA 1R0SA 4G65A 1FJXA 4LWZA 4MICA 3JAKA 4Z4FA 1PUIA 2SECE 4P80A 5C1DA 4QDKA 3F90A 3FKJA 3SYYA 3FWNA 3DYBA 3NDBB 3NYQA 4DR6B 1Y6FA 4C06A 1E5QA 1TUGA 2OCLA 3MJTA 2NZXA 2Z5FA 1R4NB 1EXMA 2IYNA 2Q7OE 4OHRA 2JGMA 4B0OA 1HTTA 4JL6A 2PRJA 1DIBA 1EBFA 2AYXA 4JJ6A 4LI3X 3GC6A 1LS1A 5EC8A 2G7MC 4PIPA 4TWAA 3LDUA 5A9SB 4XB1A 3UM9A 5F1PA 2QSUA 1LRJA 1TAGA 2HLHA 4OK5A 4DANA 1ZOOA 1GT6A 1UKEA 5ESXA 3F2IA 2GVNA 2NO5A 1ADYA 2QMOA 3TMYA 5CFOA 1MVOA 3V2UA 4PYRA 3RS2A 4OAOA 2EJUA 3U4CA 3H2KA 4C78A 2JH3A 1NW6A 2ZE7A 1R0LA 5D5HA 3L3BA 3IQZA 1E3LA 1RJ9A 5FOTA 4X66B 4QPJC 2CMKA 2WD7B 1OILA 3GLFE 1T9GR 4YR9A 4DLPA 1JR2A 5EE0A 3UXEA 1R4NA 3H4RA 3L7BA 1T0UA 1DBSA 2XZTA 2GBCA 3IR5A 3DG9A 4TWBA 4EPTA 1XZBA 4WBXC 3WA7A 2WHYA 3LC0A 1U1DA 1IB6A 3DL4A 3KKKA 4REQA 4TVOA 4YJHA 5IYZF 2IU0A 3BX1A 1B74A 3E81A 3U09A 1L0BA 3CSUA 2H5LA 4UOQA 1PSWA 3O82A 3OT4A 1TK9A 5DCYA 3WGOA 1QTNA 1I33A 2ECPA 2JHGA 3T7IA 2V5AA 3HNOA 4F1JA 1R15A 3EGVA 5BRJA 4OO3A 2WJJA 4CM7A 5ALUA 4HMOA 1NTRA 4PPFA 3TTVA 4IQGA 4X97A 3OCVA 5IZCA 5K6AA 1HE3A 1P7CA 2E18A 4X1KB 4LYDA 1V47A 5HM6A 1KJYA 3B1KA 3AI3A 3T5PA 1BQ4A 3U4GA 5BVHB 2WQZA 4RENA 4DQLA 1SD1A 4D44A 3VDQA 4HB0A 1H6CA 3THSA 1XTJA 3KEMA 1OB5A 1KVTA 4IINA 4KLZA 1QO0D 3NHRA 3DMTA 3CLUC 1J0EA 1XN1A 4S35A 1PFWA 4LHWA 5JYCA 2VP2A 4JJ7A 3H1PA 4UULA 3LE8A 3L8DA 4KIGA 2J3LA 4BLUA 2QE7D 3R1IA 4BRSA 2IH4A 1CR1A 4QDTA 4D9FA 2OM6A 1FFYA 5AXCA 3UMCA 2MSKA 3V1LA 1ZW6A 4URYR 5TS2A 1PV4A 1FL9A 2WJWA 5D51S 2XYGA 5EP4A 5IH3A 3FOZA 3F3MA 1Z0UA 2UYCA 1RAAA 3OJEA 5ILQA 5BP7A 2YJ4A 3FCCA 3HVJA 4FN4A 3FYUA 2B8EA 2IIQA 3DMTC 2PGJA 2BCEA 3F6EX 5LC1A 2ADMA 2PXXA 2AT1A 5C53B 1E96A 1HDZA 1VKJA 3SM3A 2C4WA 4LOLA 5FXMA 5U4XA 4F4DA 4RDXA 2HA7A 2WIDA 2JIZA 4ZZ0A 1QYCA 2B4KA 1ZCBA 2PGDA 2WEKA 3O3CA 4AMBA 2X8LA 5IHPA 2HB6A 3HU5A 1JWAB 1SBIA 4JYZA 3OA2A 1VKHA 3U37A 1IOLA 2ZIEA 2WP0A 4FSHA 4C1BA 4E15A 2BSQA 4Y6LA 4PCAA 2VTBA 3JQ9C 3NIWA 5HS6A 4KC0A 4Y0AA 4YWJA 2B8TA 2Y1CA 4ZTBA 4JX9A 2YUIA 2AN5A 3KYCB 3QA9A 2I67A 2K6GA 1A77A 1WXDA 2ODPA 2X9NA 4B7XA 3SF8A 1TD1A 1KZYC 1NULA 2H57A 2QSJA 2Z1DA 3ANTA 3KOMA 3WDMA 4DSUA 5K99A 1NR1A 2RH9B 1B7GO 2EHJA 2NZVG 1P2UA 2ZG6A 3KJZA 1R0RE 3PWTA 4UFNA 4BEJA 5KYGA 2GD2A 4UFPA 5ADWA 2Y6VA 2LTAA 1E3DA 1M8FA 5B1SA 1WZ2A 2GERA 4MI6A 1PZXA 3RC8A 1YJQA 3D3QA 3OPQA 5HP4A 1ISRA 1ETUA 1FCJA 4NBNA 2GZAA 4EL5A 4Y2SA 2VJLA 1U9ZA 2GKSA 1WMAA 4CIYA 1UJNA 5IM5A 1L3IA 1NJ5A 4TTAA 3W7BA 2QD1A 2GKOA 2I6GA 4I7EA 5KWJA 2WTNA 4L8WB 3TLXA 3L0SA 4ZTUB 3VMFA 2GCGA 1JEEA 1Y3AA 3LT2A 4NOKA 4W9RA 4OXYA 4I9GA 4DSTA 2Y1LA 1ZH0A 4FDAA 1LWNA 3NRBA 3TDKA 3AKDA 3P2EA 2QRPA 1YQWA 4J90A 7MDHA 2RH8A 1LNQA 1Z17A 3I6IA 2AN1A 1ZUNB 1R0WA 3BIXA 1ZD9A 3PA8A 4L27A 2X8JB 4MVJP 1V9CA 2VT6A 3DWEX 2DAPA 4BFWA 1K27A 2JBAA 3R7DA 3UW3A 2BIFA 5FP0A 1Z6QA 4CTOA 2Z9BA 3SZUA 3BCRA 4UBJA 1VMDA 1Z8FA 1YRYE 3ZHZA 4MCJA 3G1WA 3PQ2A 3DOFA 4W4TA 5AKGA 2PGLA 3B70A 4S3MA 3GEHA 4JI1B 2VYVA 1F06A 3WISA 3ZD9A 3NASA 2DM6A 1Z2DA 3G23A 4FX2A 1GSOA 1JT2A 1SIOA 3BD6A 4NMXB 3OJOA 3RVDA 5YASA 4YQYA 2QTAA 3NV9A 4HMQA 3SZGA 1B8UA 5JSHA 2OCBA 2QPLA 1WNFA 2QHXA 5ARBA 4AK9A 4AX8A 4QWWA 3VPDA 1W581 3KEFA 2I2AA 5BYJA 1FFWA 1PG2A 2V59A 4FS3A 4FZ3A 1J5EB 1XN4A 4XI9A 2JIBA 3M5PA 5CFLA 5KZMB 2JFGA 3FYSA 3HBLA 1WHSB 3QITA 4JLKA 4BE7B 3LTEA 2QJTA 4YMWA 3NH6A 3NTQA 3B1VA 4QTUB 2ZRPA 3DMDA 2EF0A 2ATEA 3DWFA 1D9ZA 1W4ZA 1L8LA 3H83A 3A8TA 4RVUA 4CTKA 3I9OA 3WYDA 4JBGA 4EIWA 3C1AA 2VDKB 4HDNB 5KEIA 1NYTA 4GDFA 1UMDB 3RC1A 4HADA 4RNCA 2ZYGA 5IEJA 1VLLA 2Q4RA 3E7XA 3JQ6A 4TTPA 2A7XA 3F3KA 2GX6A 3MWYW 1VB5A 2TYSB 4Q4CA 3GJQA 3AUYA 4G4JA 4WUTA 3FXAA 3RFUA 3DKVA 5M04A 1A4IA 2WWIA 4W1RA 3LXXA 2F3QA 4L5CA 3CZQA 4O8ZA 1L4GA 4DUGA 2IPAB 5C46F 1A3CA 3RSGA 2WUEA 3JPWA 4DB2A 3WQRA 4Q3OA 1XQ6A 1XTSA 4KX5A 3LA8A 1KK3A 4QKQA 1MIHA 4M36A 1Z83A 4DGQA 4E08A 1RKUA 1NUHA 1J70A 2NTEA 2HWYA 3BD8A 4R7ZA 4Y2TA 4ZPJA 4C7JA 4EB0A 1TUBA 2DFKB 3SAJA 1H6AA 2GCOB 3DTTA 2L42A 1PK7A 1M8GA 1JKJB 1IWOA 2ZUVA 3L0AA 3UHOA 1AUPA 1SCUA 1PTJA 3O2NA 5KSPA 1Q3KA 3VV2A 2ZYSA 3GLHB 3OWOA 4D3XA 1U8FO 2VJBA 1Z4KA 4YQZA 2OT3B 1XNQB 5IVHA 1N36B 3Q5DA 4K3VA 1KY3A 1JFSA 1USWA 5EXXA 2RC6A 4YAOA 4OA8A 2HADA 1TQ8A 1E32A 4U0KA 2JASA 3H7IA 3DDCA 2B4YA 2DUJA 4QBTA 4ZOLA 2WF6A 1ISHA 5TS3A 4LXXA 5L6LB 1LJLA 4ZT6A 5AK3A 3W2HA 2YJ5A 5WRFA 1U5BB 8GPBA 3K6SB 4ICIA 1T3TA 4GPAA 1Z7EA 1E4VA 1IRXA 4G8BA 4R1UA 2ZRHA 4S1TA 2X2FA 4F5EA 4FOTA 4F2GA 1GAEO 1S3FA 2RIPA 3NVMB 5DX0A 2CNKA 3A25A 1YR3A 2YHAA 4KBYA 1NV9A 1AN0A 2PJZA 1G291 3RCBA 5SZKB 1HOTA 3R3YA 1D6NA 4HDNA 4MPRA 4P5DA 3WNDA 1K7XB 1LC0A 3C3BA 4PSUA 3W9BA 5TDHA 1XHFA 2E55A 4AZ3A 1RQRA 5FI3A 4PTLA 1PJTA 5CT6A 1VI5A 4G8DA 5DCWA 4DBVO 1ZMTA 1W5TA 5IC4A 4NARA 1MA0A 5AW8A 1UAAA 5BR1A 1JWLA 1XCGB 3FTNA 3HJHA 2UZIR 3ISTA 4MXDA 4MIOA 4JZYA 2G9NA 4QTZA 3V00A 4IHJF 3W6UA 5KYUB 4FEGA 1AZWA 3RT1A 6REQA 3FPBA 2GK6A 2B99A 4BLPA 4G5FA 3GX1A 4P81A 2RHGB 4WUZA 3IAM1 5BSTA 1Y9AA 4WKOA 2AE1A 5C8YF 3D0RA 1SCNE 3KFVA 4XFKA 2WIBA 3TL3A 4M8IA 3ESCA 3VU1A 1P72A 1B0PA 4LNAA 3KAKA 1RYBA 4OLJA 1GFIA 1D09A 1YB7A 2YIVX 2ZE5A 4B6SA 5CVJA 3C7DB 1KR2A 2DKFA 1VC2A 2QLBA 2RG1A 1CR6A 1MN6A 3RWOA 1G20A 4FHFA 4C2UA 1ZN8A 2QUAA 5EXPA 4US0R 5FTNA 4BASA 3KHSA 4DCOA 4MGKR 1GARA 3SZ5A 2RG7A 3RUDA 4MS3B 2RB4A 5KJEA 2P75A 2ERCA 2H85A 3DBHA 2A88A 4AJIA 2B8JA 5C34B 1FUKA 2GB4A 2NO6A 4BAZA 1OGIA 4CQMB 4ZHQB 2C4UA 1PEYA 3Q9UA 3PUYA 1Z8NA 1NI4B 1WXWA 4AMZA 1L5KA 1VZ3A 3LI2A 3N2GA 2B37A 5IKEA 1Q16A 3A6LA 1RYMA 3KBBA 3MTGA 2W9XA 5ALYA 5T8KC 1QTIA 3FB1A 1K1EA 1YZVA 1ZKMA 3PEFA 4GDMA 4U63A 3RRZA 4GI1A 2Y0BA 3QW4B 4H17A 3DEKA 5JCZA 2B30A 1VKOA 3BMCB 3GRZA 4F11A 2Q1XA 4IO1A 3OOWA 3PCTA 3EWAA 3GFFA 4UU0A 3RS0A 2CE7A 3S2IA 1EDZA 4CN9A 2QXTA 4S0ZA 3EMBA 3O8DA 5GPBA 2RKBA 3AB3A 1ZD4A 4C0LA 5JTTA 1QHYA 2ZYDA 3H2HA 3VKWA 1EFHA 4MDHA 3EHDA 3DEJA 2CHUA 4PAWA 1OX5A 2HJVA 1RRMA 3IESA 1XPOA 5EZSA 2X2EA 2J3HA 3BCHA 3CLHA 2FR8A 4CYMA 7AT1A 2JD1A 3ER9A 1IQPA 1CSEE 2HRDA 2W4IA 3CMCO 4ND8A 1W36D 5FPHA 2Q1UA 1ZYUA 4BCCA 4IV0A 5DMXA 3B9QA 5EJ9A 4B74A 2QUZA 2Z8XA 1UKAA 4CKBA 1PUJA 3IP1A 1T1GA 3WL3A 5ERXA 4EF5A 4NBLA 1T13A 1U1GA 3QEBZ 3HN7A 4X1YB 4EEKA 3QV2A 5EE1A 4A4DA 1R6TA 2O8NA 1VQ1A 2HAEA 1DC5A 5IJ9A 5JMWA 2BM9A 2JVKA 3KAQA 3D8TA 3GYGA 1Z2EA 4RZHA 3WFJA 4BQOA 1JWBB 1TYDE 4MCAA 1VL5A 2BRUA 5FPQA 5BMVA 1U7WA 1G5TA 4I2NA 4I55B 2HHLA 4GC5A 3RS8A 3M32C 3E82A 2W8BB 2VXBA 4Q7QA 1OTYA 1OI3A 3CIOA 3GPBA 3BXEA 3KT8A 2OEPA 3R8FA 4R8LA 3RIYA 4YRGA 5K20A 2RHLA 3M1VC 3HEMA 3G9UA 4IUCS 4QEZA 4AY4A 2ZSHA 4URUR 3ZCTA 4EELA 2IPLA 1HT0A 3PIDA 2GTHA 1SOAA 3M83A 4P4LA 3ZI7A 1PFYA 1G66A 1VG9B 1X8XA 3EVZA 5DYGA 1USGA 4BNVA 3G1UA 3T1TA 4FMDF 5FTJA 5ALDA 4F06A 2EW1A 2GZ2A 2OAP1 4Y3UA 5DOVA 4RU1A 4OKSA 3VYUB 4KXFB 1LDYA 4N49A 2OFWA 4R71A 5CLHA 2VYVD 3ZGZA 4DMLA 1G8FA 1H65A 1K6IA 3L6CA 4JAVC 1CQJB 4DR2B 1E20A 2JHPA 3BDAA 3WOVA 1J23A 3JARB 1EKXA 1OXXK 2P9YA 2BKAA 2IDMA 3PG5A 1QK4A 2FPMA 1AUQA 3HG7A 5C1IA 3U7QA 3W7AA 2ONKA 5A3RA 3VU3A 3M9XA 3BGOS 1Z13A 3PYLA 3DKIA 3O8QB 3A58B 2YVAA 3EXIB 1EHCA 4H4DA 4Y0VA 3LQ2A 4X7PA 1YDFA 2PUTA 3TXXA 4IGKA 4WJZA 3PEUA 2RCYA 3KKLA 5LPNA 1W1IA 3CZ5A 3T0FA 5ARDA 5F3WB 1ZCAA 5BN5B 1W8DA 4CQMD 3L40A 2XTAA 4J4HA 1SFRA 2ZR9A 4FYWA 4WOCA 1XDUA 3DULA 3ZWXA 5JAPA 2Q2QA 4GE0A 3GCXA 4KMMA 4MPPA 5ESRA 5F2KA 2M1ZA 1WB9A 3L18A 1E8NA 2O5RA 3DZKA 3K1AB 5DNYB 2ORIA 2CD9A 5TEWA 1S8OA 4OGKA 3OLXA 3K0KA 1QPZA 3C5HA 5A4IS 5FTLA 3R9XB 4AROA 1QNLA 3TTTA 3M4XA 5HZHA 1XKXA 3L8CA 4INPA 2PGIA 3B1WA 4Q21A 1C81A 2I54A 4IY1A 3FYUC 4NZYA 4QOJA 5BSVA 3EAFA 2Z98A 1I6WA 4HD8A 2HMVA 3I2JA 4TQUS 4DV6B 3STUA 4YP5A 1NOIA 4O6VA 5ITZB 2DXIA 3L1KA 3LLSA 4A0SA 4B85A 1NONA 3BDIA 3NKFA 4WMLA 1PO7A 5H5JA 4DXDA 3NHKA 3PEVA 4A2WA 2BFPA 2R6HA 2B4QA 5BSKA 1OLXB 1PQWA 1TMGE 1REQB 1IOZA 4QSHA 5KVCA 1H4SA 1TAQA 1P2FA 1RHQA 4NLLA 4ALLA 4HQFA 5CT8A 4DR1B 3AEKA 3OP4A 3HJRA 4OXQA 4RHUA 3ZI4A 1C9DB 1H0KA 3FCSB 1ORTA 5JQGA 1ZMBA 2XMDA 2HO4A 1YH3A 2Q8QA 2DRIA 3K9NA 4QFMA 4EHFA 3KQLA 2GA8A 2Z1NA 3OTWA 2D5BA 2GLUA 5JDCC 3K4QA 3ZHUA 3KB2A 4TWIA 1QIGA 3GHHA 2FH5B 1ZHHA 2VRWA 1GYQA 2Y1FA 3AU8A 5A9RA 1F8YA 1Y1RA 3S28A 2ODNA 3GFPA 4RIEA 2J3DA 1VXRA 2YBDA 4H59A 1WUJS 2HMAA 3RVSA 5KIAA 3K0CC 2HDOA 6ADHA 4GMDA 3AF2A 5BR8B 3FMPB 2IXDA 3H6HA 4LDQA 3MOSA 1NXVA 2GPBA 3AP1A 3O21A 1I30A 3TRDA 3S0JA 3MTIA 2VPXA 2WD9A 2XR1A 1N3YA 1XD2B 2GXSA 2WZDA 1H8ED 1MOSA 1ZNWA 1IVYA 2JGJA 3O0TA 1C0KA 4QARA 4Y2JA 1N9ZA 3IAS6 1ECJA 5I47A 2WB2A 3BXXA 4F8JA 1D7AA 1U2DC 2W2OA 4YAUA 4XEUA 1YIDA 4FYVA 4GXTA 3W4KA 4TTSA 5EYPB 1SEPA 1XVAA 4BNKA 2I22A 5BUCA 1W0JD 3DAGA 1DBIA 4KACA 3W8DA 4BO3A 2I66A 4ZN6A 2GH1A 2JHAA 4HEA6 4LKRA 4YRLA 1QS0B 3DPUA 5H4GA 1MPTA 2GGSA 1U8YA 2YWHA 3NOXA 1DHRA 3WK5A 1K8ZB 3PXCX 4ZO9A 1IK4A 1VFPA 5T8KA 3ZJVA 3KOXA 5BV2P 3BQ9A 2C4HA 1IXZA 1CY6A 4TLMB 5A0FA 1Q0LA 3E58A 1YS1X 2Z6VA 3MS4A 1KVUA 4HAOA 4QNRA 3VR2A 3LM8A 1HLPA 3QMPA 6YASA 4M8LA 2ZRAA 3BJRA 3W5UA 2ILTA 1B6GA 2JHFA 4ZVMA 1JVSA 1YI8A 2G4LA 5F5NA 5L51A 4NCHA 4UOEA 2VTDA 3OM9A 5THKA 3W1EA 1KAEA 1SUBA 2QX4A 4GL4A 4GOMD 4NI5A 2XOKD 4NZMA 4CV0A 2YWCA 5JZ9A 5KSWB 3BEDA 4POAA 4D3FA 1L5NA 4YAGA 1C3XA 4BFLA 2R86A 2FGJA 2XT0A 4X93A 1Q3HA 2WM2A 4DWWA 5BYAA 5L3VA 2GD1O 1X9GA 4HNSA 2PUEA 4K8OA 3S5UA 2KM1A 3QKRB 2G5GX 2JIOA 1QE5A 4MR9B 1CFZA 2CMDA 1USIA 2MWMA 3HY6A 5ENVA 1P4JA 1ZVQA 2FCAA 1H1DA 1W49A 2GO7A 3E5MA 4P36A 1YB1A 1QKIA 1RQGA 4UCFA 2WQ7A 3IIIA 3QP9A 4XH9B 1P9NA 3RADC 2EVWX 4E12A 3M1YA 4EKNB 3FPJA 1RYYA 3LQQA 2C77A 3KQYA 2PZFA 2QG6A 2FY8A 2HD4A 2JAXA 4OHYA 2XVXA 3MWLA 1KI2A 3K96A 4LY9A 4PS1A 4BDSA 3FCEA 3MAAC 4O1HA 3D6VA 5U1PA 2VHWA 4B31A 4I5IA 4PXAA 3R9XA 3QVXA 4XEHA 2TRSB 3LVFO 4PTYA 4FT4A 5MFPA 3P96A 4IMJB 4FQ5A 4RIGA 1TZJA 2QI9C 2WC1A 1VGQA 4L0DA 2PXCA 3WLPA 3EPRA 5DGXA 1I2MA 1P8JA 1AK2A 4B7UA 2VNJA 3SQXA 1GTZA 3ZCQA 1IG0A 1ST3A 1QFMA 3DAHA 1COWA 4MUBA 2ZS8A 4U9IS 1ANKA 1RAGA 3RO7A 2FSVA 3DTYA 1ID8A 3IBCA 3JZFA 4AI6A 2REOA 2VATA 3LO5A 5DLDA 1GO2A 3DMGA 4GX1A 2UZ1A 2GMWA 3A4TA 4RANA <