5LDZA

Quadruple space group ambiguity due to rotational and translational non-crystallographic symmetry in human liver fructose-1,6-bisphosphatase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
311
Chain Sequence
PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quadruple space-group ambiguity owing to rotational and translational noncrystallographic symmetry in human liver fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 100
structure length 311
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5ldzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ldzA02
3KC0A 1NV6A 4GBWA 4GWUA 3IFCA 4I3EA 2CZKA 1FBGA 1D9QA 4GX6A 2QVVA 4QXDA 2Y5KA 5ESYA 2FHYA 5A5LA 1LBYA 1FPBA 3LUZA 4GWYA 2WEFA 2Y5LA 5I3SA 1NI9A 3ROJA 5IZ1A 2CZIA 3QMFA 5EQ9A 2JJKA 4PTKA 1FSAA 2FBPA 1G0HA 4HE0A 1IMEA 1KA1A 2P3NA 5LDZA 1KA0A 1Q9DA 4GX3A 1XI6A 1G0IA 1LBWA 4IR8A 1YXIA 1DBZA 1NV3A 3A29A 2CZHA 2FIXA 2P3VA 1IMFA 5EYGA 5T3JA 1IMDA 1NUYA 1FBPA 1KZ8A 1NUZA 2HHMA 4GBVA 1SPIA 1YYZA 5EQ7A 1NV5A 1FBHA 3KC1A 1INPA 1DCUA 1DK4A 1K9ZA 5IZ3A 3BIGA 5ET5A 5EQAA 5J16A 4MJOA 2FVZA 1FPFA 2WBBA 4GWZA 1FRPA 3RYDA 1FBEA 1NUXA 1FPKA 2GQ1A 1QGXA 1CNQA 1VDWA 1RDZA 5F24A 4I3YA 5ET7A 1FPJA 1LBVA 4GWWA 4H45A 5FBPA 4FBPA 1IMCA 2R8TA 1FPEA 1FTAA 1FBCA 2F3BA 1AWBA 1FPGA 1NV0A 1IMAA 1NV7A 3FBPA 4I40A 2DDKA 5IZ3B 4AS5A 4HXVA 4O7IA 4H46A 1FPLA 4KXPA 1LBZA 2F3DA 2QVRA 1NV4A 2QFLA 4AS4A 2BJIA 1FBFA 1FJ9A 1NUWA 3RPLB 1YZ0A 4N81A 1JP4A 5EYHA 1FJ6A 5ET8A 1NV1A 3IFAA 3D1RA 5ET6A 3LV0A 2PCRA 1NV2A 4GWSA 2Q8MA 1FPDA 3BIHA 1IMBA 1K9YA 1FBDA 3B8BA 5DW8A 4G61A 5EQ8A 1BK4A 3T0JA 2OWZA 1FPIA 1RDYA 1LEVA 3KBZA 3RPLA 1EYKA 1RDXA 1EYJA 1EYIA 2QVUA 2VT5A 2OX3A 2Q74A 1LBXA 2WBDA 4GWXA 4HE2A 2FIEA 4HE1A 4GX4A
chains in the Genus database with same CATH superfamily
5DYHA 3O28A 3T1BA 4DI4B 3TFLA 2UVIA 4OVTA 4IO5A 5CI5A 4U22A 1DOTA 3K6VA 3FXRA 5KCJA 2DSFA 1GTKA 5CRYA 2ZYNA 4GXSB 2H4IA 2MKZA 1P1WA 3W9VA 1KA1A 1LBWA 1A8EA 3SEVA 4KCDA 3UK4A 4FECA 5T3JA 1VR5A 4FATA 4RJZA 1NV5A 3DLNA 2XXUA 4FE8A 3CSBA 3L6HA 1US5A 4OETA 3IORA 3U94A 3E9XA 4JXIA 4EQ9A 2OPDA 4PBHA 1LB8A 1NV7A 4IY5A 4QFNA 3OSRA 1LCTA 3VDFA 3W9WA 3EPEA 4P11A 2DE2A 3C31A 2BJIA 4N81A 1FJ6A 4LZ7A 2B4MA 4YZZA 2DWAA 3OO8A 4BDQA 1NL5A 1Y3PA 5L9SA 2I58A 2X7PA 1K9YA 3K6XA 2L5VA 4WKMA 3PV0E 1B05A 1MQDA 4FIMA 2O6AA 4N4UA 4N17A 3T0JA 3S9LC 5JTYB 4MEVA 2VT5A 4HE2A 1PC3A 3E79A 4I1DA 2V3UA 1PEBA 4GOTA 4I3EA 4BDRA 3WAFA 2P1SA 4XF5A 4IO4A 4R2BA 4ISUA 5BWJA 1MQHA 4G68A 3KN8A 4XKPA 5I3SA 1TFAA 1IEJA 3QMFA 3OD7A 2DP8A 4YKPA 4XKQA 3RTWB 1NKXA 3MP6A 3Q27A 2UVGA 4MCOA 4U4SA 2YPNA 1D3KA 2I48A 3PD9A 3Q29A 1JNFA 4H5GA 4LQ5A 2O51A 3RNNA 2V3TA 2VD2A 1MXZA 1JETA 3PGFA 3H06B 1IZ1A 4GD5A 4EUOA 4PFTA 4KHZE 3M3LA 5F24A 4O3BA 1MG1A 1UTBB 4I3YA 4H45A 2RCBA 1FBCA 3LC8A 4E0XA 1I6AA 4L17A 5H8QA 2O7UA 3JV9A 3HSTA 4GL0A 3FJ7A 2H98A 4OANA 4GQOA 4KPTA 1XHYA 4RYAA 2RCAA 4BLAA 3NOHA 5IGAA 2Y7RA 3P7IA 1USYE 3QIMA 2QS4A 3N26A 4ZZAA 1Q1KA 3QAXA 2DE3A 5BUUA 2XXPA 2Q74A 3TTRA 5FBPA 3PPRA 4PAIA 2F7BA 3VXBA 2PT2A 2KQZA 4X8RA 4R6KA 3S9EA 3K02A 1B58A 4TQUQ 3MBPA 4PTKA 2O84X 1OQGA 3FV1A 4IY6A 4O94A 5A5XA 1A40A 3SESA 2X7QA 3PD8A 3PMWA 4OEVA 1LBBA 3IL1B 1XVYA 2HHMA 4F31B 2F35A 2XA5A 3ONMA 2ZYOA 3GBBA 4RXLA 3MVZA 4F2QA 4GWZA 4Z7EA 3O2AA 1QGXA 4IO2A 4PCDA 4H65A 3TTLA 1IXIA 2F6PA 4X04A 2OBGA 1WODA 5TPAB 3PUYE 3I6VA 4F22A 2V93A 2R71A 1NFTA 1FTKA 4H8IA 4XKRA 4RA1A 2QMWA 3N6TA 1B3GA 5ET6A 3D1RA 1PBQA 1MY4A 4NWDA 1CB6A 2ABHA 2ZZVA 1D4NA 4XEQA 1LLSA 2F36A 4NF4B 2O1MA 3PMXA 1UTBA 4OESA 3HPIA 2H5YA 1EZPA 1RDXA 1B1XA 4MIJA 3OSQA 4MAGA 4JVDA 1B46A 2D21A 3MYUA 4HE1A 3K4UA 2I6EA 2PBWA 4R72A 2M8CA 4R9FA 2XXWA 4GWUA 4N6KA 1XVXA 4NMYA 3CI8A 1JW5A 1OMPA 4QXDA 2OWSA 4F3SA 1ZJLA 1IIWA 1O64A 4DIGA 1MQIA 3RT6B 1NI9A 4YB5A 1MM6A 1VFEA 3UORA 1FW0A 3RN8A 1MDQA 3OMBA 4PFBA 1FCKA 4PGPA 2HPGA 4NN3A 4H6DA 4F19A 3IR1A 3WAEA 1LFHA 5JTYA 3AXFA 4G77A 1UQWA 3OO7A 2P2AA 3G7WA 1FPFA 1FBEA 1FPKA 3I3VA 1P1OA 3QK6A 3TPAA 4JWYA 5FTIA 2I0BA 3S2VA 3CRBA 3OENA 4I40A 5CMBA 3K6UA 1FQFA 4IO7A 4OVSA 4NF8A 3LV0A 2Z8DA 5I2NA 1N7WA 1II5A 3KG2A 3G3HA 2Q9TA 1P99A 5EQ8A 2F8DA 1FTLA 4PF6A 3USDA 2OWZA 3SZPA 4QFKA 5H8SA 3CR9A 3F11A 5K2YA 1SI1A 5DVJA 3TTNA 3MZ1A 3T9HB 5H8QB 3FJGA 3KEIA 4ELRA 3S9NC 2FHYA 2A5TB 5B70A 2XXYA 4QSCA 4F2OA 4HS7A 3Q26A 1IXGA 3H6VA 1B7UA 4KYEA 2QS1A 2QJEA 4EXLA 4DCXA 3BFUA 2AL4A 1B3EA 1NV3A 3H6UA 1FBPA 4U1OA 3GLBA 1FBHA 3K1MA 2NOOA 5FHNA 3BIGA 2REGA 3QXMA 3TEPA 3N5LA 2GHAA 3V5AA 4QRZA 4LA9A 1FRPA 3MUQA 1A8FA 2I0CA 1O63A 4G68B 4U2RA 2I3WA 2B3FA 1EU8A 4N6PA 1B51A 4GVOA 4PF8A 3B7DA 4H67A 4O7IA 2QS2A 2HAVA 1LBZA 4OEUA 2KLFA 1NUWA 1QUIA 5H8NB 3DP8A 3SETA 5ET8A 5I56A 2ZZXA 1ZKBA 5A5XB 4F29A 4HCYA 1B2HA 3RTFB 1MXWA 4P1EA 4O3AA 1LAGE 4BDMA 4G8MA 3RT8A 3CG1A 1XC1A 1FQBA 2RKMA 4YKKA 5CM6A 3E13X 1SBPA 2A5SA 3QYTA 2XD3A 5H8HB 3SEYA 3FD3A 2DE4A 1Z7ME 3IFCA 3GZGA 5AE4A 2D3IA 4PFUA 1CE2A 1GR2A 4P1LA 5HM4B 2UXAA 4P56A 2GRVA 1UTHB 3T96B 1OVBA 5DT6A 5AA4B 5KDTA 1FSAA 1Y4CA 1NNPA 4NTLA 1Q9DA 2H9BA 4PE3A 5I59B 1DBZA 4YU0A 1RKMA 2XXVA 2OJTA 2HFBA 1ZIUA 3TELA 4OQOA 3V8XB 5ELVA 1KZ8A 3ILTB 1O7TA 1WVJA 1MY2A 3OO6A 1SVXB 1S50A 5HPQA 4QBAA 3HHFA 3HN0A 4Q30B 3DM0A 4NGUA 2ZXTA 4XFEA 2FVZA 3DELB 5AA2D 4N8YA 4YB7A 4LQ2A 4MBPA 5IKBA 2PMSA 1R1NA 2DWHA 3FZVA 4ZZEA 4M4GA 1R6ZA 4MX6A 5CC2A 1TT1A 2OK2A 1PDAA 1B5JA 3JZJA 4H46A 5I58A 4LN5A 3IJXB 1BLFA 2A5TA 1FBFA 3MAMA 2PT1A 1B40A 1I6QA 2HZLA 1NV1A 1LFGA 1N04A 2ZNSA 2VP1A 1A7LA 2DQVA 5ICTA 3C4MA 4O8MA 1JVXA 4HCWA 1LAFE 1RDYA 5DEXA 1AIVA 3FXBA 5I58B 4NG7A 2WBDA 2QPQA 2W7YA 3KGCA 2O7IA 5IAIA 4PDHA 4OFLA 4NF8B 5EYFA 5ISUA 2CZIA 2PFZA 2NWJA 2V84A 4OVPA 2B65A 3W15C 3GYYA 2XXKA 1G0HA 2HZKA 2P3NA 2E1SA 1FQEA 4MNIA 3TCHA 2VOZA 2CZHA 1NNKA 4O7MA 1N84A 4DI3D 1B0LA 4PFYA 2FA7A 4R75A 4GWOA 3CFLA 2QS3A 4JWOA 3R7XA 2E0SA 5KDTB 1H3DA 3D4GA 2XD2A 2VPOA 3IOUA 2DWJA 2F3BA 1AWBA 4UA8A 3FBPA 2F6GA 4ZEBA 4MH5A 5TP9A 4H1XA 3PUVE 2OPEA 4PGNA 4NX1A 3N6UA 4F39A 2PX1A 3PUXE 1FJ9A 1J1NA 4PQJA 1VE4A 3MVWA 4R6HA 3QSLA 3K0VA 3EKIA 2AL5A 4LZ5A 1FBDA 2KR0A 2XWIA 3B8BA 5DW8A 4HW8A 2Q88A 3S9MC 4F3BA 4LP2B 1QJMA 3Q28A 4MHFA 3HHGA 1AMFA 1B7HA 4XTCQ 3PMVA 1LCFA 3KC0A 2Z8FA 3MC2A 5I2KA 1B3LA 4KR5A 4ZDMA 1S9TA 1ATGA 1D9QA 4TLMB 3E3KA 3U8QA 2F78A 4N6DA 1LAXA 3N94A 2GH9A 4GL8A 3HFUA 1DSNA 2ZYKA 4PFIA 2FBPA 2V4CA 3G3IA 1JEVA 1IMFA 1IMDA 3LSXA 1BKAA 2IA4A 4QSDA 3C35A 3MW0A 5IZ3A 3K1NA 4C1UA 1IXHA 3K6WA 3TTMA 2WBBA 3PUZE 1M5FA 1QVSA 3QUJA 4R6YA 4YICA 3TDJA 4IGTA 3CFZA 5CMCA 1NV0A 3KFMA 3S4UA 3MZBA 4FEDA 3U92A 3HV1A 4F18A 4KXPA 2REJA 1GGGA 4RPOA 2Z22A 4QSEA 4H5FA 4P9KA 3M3FA 3O9PA 1R9LA 4WEPA 4YMAA 1T0KA 3R6UA 1ZMGA 4N91A 5I2NB 4G8NA 2XWVA 3DP6A 3TKDA 1MXUA 2GFEA 1KWHA 2XX9A 1USYH 4DLDA 4OFOA 1EYKA 2LAOA 2XX7A 3EHUA 1I6BA 3B6QA 3KJ7A 3H6WA 3B6TA 2UYFA 1FQDA 1EZOA 4PC9A 2NUVA 3PU5A 1FPBA 1PB9A 2FNCA 3IOVA 3IK6B 3T93B 2RC8A 3IJOB 4ZECA 1SYIA 1HSLA 1B4ZA 2GHBA 1Y1ZA 4JVIA 5LDZA 2I4BA 3SKPA 1POTA 3MZ9A 4F1YA 1Q35A 3CSGA 1YYZA 1MY0A 1SYHA 4NF5B 4OWDA 4C1TA 2OZZA 1IITA 1LFIA 2XX8A 4LONB 4IGRA 3LSLA 2UVHA 3M3KA 3MWBA 4GWWA 2NXOA 1FTAA 2CEYA 5KZTA 2F7AA 4ESWA 3C32A 2QFLA 3ZS6A 1YZ0A 1TXFA 4X1DA 1B5IA 2NVUB 2OCUA 2WX9A 1VFDA 5CBSA 3CG3A 1A55A 4U21A 1N3WA 4NF6A 4QFLA 5H8FA 2Q8JA 1M5DA 2Y84A 4U1ZA 1IXCA 3E4RA 3MJNA 4KD5A 1FQAA 2HEUA 3TTKA 3U65A 4DDDA 3BKIB 5F1QA 1MDP1 4LATA 1LBXA 3TYHA 4GWXA 1Y3NA 2FIEA 1QUJA 1D9VA 4Q5TA 4F3GA 4JWXA 4N07A 4JSDA 2DS9A 3OEMA 2Y5KA 2DVCA 5EHSA 3CVGA 4R74A 3CHGA 2Y5LA 3VV5A 3FVKA 2XXIA 5L8DA 3ROJA 5IZ1A 4R9GA 2RC9A 1M5BA 4IB2A 1MXVA 3CIJA 4EQ7A 4YAHX 1ELJA 3DP4A 1FTJA 3KN3A 3KOTA 4ZE9A 5EYGA 3U72A 2QMXA 1NH8A 1QW0A 4PBQA 4XKNA 1INPA 1DK4A 3PPNA 4NEDA 1ZBMA 2YJPA 5AA3A 4C0RA 3IB1A 5LTCA 4NAPA 3O66A 1JW1A 1NH7A 3ILUB 2OWTA 3H03A 3VFJA 4P3LA 2UYEA 4PETA 3VXCA 5IZ3B 3RLFE 1A99A 4PE5B 4M1VA 4I62A 3TCFA 5I56B 3IB2A 5H8NA 3ISPA 5L9OA 3FV2A 3FATA 3ZKLA 2XWOA 4QHQA 3VLVA 2DXYA 2Q2CA 4MLVA 1P1NA 3Q25A 4FAJA 4NQ8A 2DVZA 2Q89A 1YCJA 1MY1A 4H8JA 5IZZA 2OX3A 1MY3A 1LGBC 1VSOA 2CZKA 5A5LA 1AH5A 4LVQA 1Y3QA 4MF3A 2ONRA 2JJKA 4BDOA 1I69A 4OFJA 3CFXA 3FVOA 2XXHA 3T22A 1YPNA 5DVIA 3GBAA 3RGYA 2FIXA 1ANFA 4KQPA 4YKIA 5DTBA 4JB7A 3LUYA 1SPIA 5EQ7A 4ELPA 5K2XA 3HO7A 1OLCA 3IO4A 4GLIA 3FUZA 3A3CA 3OEKA 3FJMA 3UGWA 5J16A 4MJOA 3O6HA 4PP0A 5ICQA 1RDZA 5ET7A 3EF7A 1FPGA 2ZYMA 5FTHA 4MLQA 3K01A 4PFWA 3BBRA 4PFRA 2F3DA 1NV4A 5I57A 4YKJA 4Q8RA 3FVNA 3HCQA 3RPLB 4RY1A 2RINA 3EHSA 1IQ7A 1JVYA 5FHOA 2H25A 2AIXA 3SEXA 3BIHA 5H8HA 3FGSA 3LSFB 4GXAA 4MNPA 1ZTYA 3IOTA 3T9UA 4THIA 2G29A 1FPIA 1LAHE 1RYXA 3RPLA 4G2ZA 5I57B 4GX4A 1N7XA 4BDNA 1QUKA 4DXUA 3H6TA 2B3BA 4PAFA 2QVVA 2HXWA 2HCAA 2F34A 2WEFA 3T66A 3QUFA 1B9JA 4FJPA 1SD3A 3MPKA 4OVJA 4ZEKA 3UN6A 2UVJA 4HE0A 1TFDA 2F5XA 3RPWA 4MNCA 5DVFA 4IR8A 1FTMA 4RK2A 2WKYA 1QKBA 3IAZA 3U93A 1OIBA 3SEWA 3UIFA 2ONKE 4KYSA 5CBRA 3KC1A 2WYKA 1DCUA 3KN7A 5ET5A 1DTZA 3RYDA 5AA2A 2BJJX 1CNQA 1ZU0A 5KCJB 1VDWA 2I3VA 3MSTA 4NF6B 1GVCA 2OLBA 5F7VA 4X9TA 3FASA 4YB6A 4QFPA 4AS5A 4Q0CA 4HXVA 1SDXA 3C33A 4POWA 2DOJA 1N3XA 2ANJA 1WDNA 4LUBA 4UABA 2PCRA 4EQBA 1NV2A 4GWSA 1MQGA 4G4PA 5TPAA 3H7MA 4ESXA 1B7ZA 4NHBA 2PVUA 1YAEA 3V89B 4IO6A 5AA4A 3OO9A 1BK4A 3ZKKA 3PTYA 4JVCA 1JQFA 1LEVA 1P1QA 3KBZA 4I9DA 1JEUA 2R9JA 4BDLA 3ODBA 3C9HA 3LR1A 1NV6A 1L5TA 1SQYA 1N76A 1Y20A 2XXQA 1PB7A 2RF1A 2O68A 2Y7WA 1A54A 1MS7A 3O29A 3E78A 1DPPA 5L9MA 1AOVA 3VVFA 4GIZA 1B52A 4E0WA 5JEIA 2H99A 4QF9A 4WXJA 3TQWA 1MXXA 5B7DA 1G0IA 1URGA 3B50A 2O69A 1BP5A 3GXAA 5I5PA 3G3GA 2P3VA 4KYDA 4F3PA 4F1VA 5M2VA 2DXRA 3RY3A 4ECFA 3PUWE 2ZNTA 1SW1A 4WEDA 2XXTA 4U4XA 4R73A 1MRPA 1Y1MA 1XT8A 2ESNA 3KOSA 4EDPA 4H0WA 3UP9A 4HTGA 3D4CA 4EF2A 2V25A 4UACA 3T9VA 5I7IA 1FPLA 4YMBA 1TWYA 2QVRA 4NWCA 4AS4A 4DCYA 1URDA 5EYHA 3I5OA 3O6IA 4FORA 3IFAA 1OVTA 3MVYA 4XIGQ 2ZNUA 5H8FB 2RC7A 5I84A 4OENA 4P0GA 3RQTA 4G8HA 1DMBA 2WYPA 3G3JA 1MQJA 4AB5A 1Y4TA 3T9XB 2QVUA 2B4LA 4MMPA 3VE1B 1MM7A 3U1OA 2QL3A 3THIA 4R2FA 2ONSA 4GX6A 4N13A 4ZEDA 4N15A 3TMGA 4KCCA 1H43A 1EZ9A 1OQHA 3OXNA 2THIA 4P8BA 4NF5A 3OELA 1B32A 1H76A 1H45A 5AA1A 2Z8EA 1MXYA 1GV8A 4RNSA 1DPEA 4GBVA 1BIYA 5TU0A 1SW5A 1M5CA 3VLUA 4U23A 4XXUA 2VD3A 5ITOA 4OVQA 2GQ1A 1JW4A 2F7CA 4OA4A 3G3FA 4RK9A 1LBVA 1B5HA 3TQLA 4OVRA 2CMOA 2XHDA 2VPNA 2XXRA 1US4A 4DZ1A 4EF1A 3KJTA 2DDKA 2XXXA 3SEUA 1M5EA 1NNTA 2Q2AA 2R6GE 4FEBA 1FQCA 3KBRA 3IX1A 1S7YA 2PYYA 3TUSA 2DYXA 1BTJA 3IB0A 1LSTA 4P0IA 4ELQA 4OXVA 3TCGA 3EN3A 2Y7PA 2QRYA 4X48A 3KZGA 3V83A 2DWIA 4OZ9A 1QULA 2QSXA 2ZZWA 1PBPA 4ZE8A 2FYIA 1MPCA 1EYJA 4OMBA 1PB8A 4I8CA 4ONYA 1MH4A 4OHNA 4AQ4A 2F97A 3K00A 1N0TA 4JSOA 3LUZA 3SDFA 4GWYA 4JBZA 3FIRA 5ITPA 2PFYA 2D5WA 3PPOA 5EQ9A 2P0SA 4IO3A 4NF4A 1IMEA 4ELOA 3KSJA 4TOZA 1XI6A 1SI0A 1YXIA 3LSWA 3A29A 4RPNA 5AA2B 4KI0E 4LZ8A 1MPDA 3PPPA 1MPBA 1DTGA 4PAKA 5JK4A 1NUYA 3O6GA 1NNFA 4OYVA 3PPQA 1K9ZA 1F9BA 1Z7NE 2HXRA 3MPLA 3MP8A 4OERA 5DEXB 3EQ1A 3TZAA 4GF8A 4MFIA 3R26A 2VHAA 2O1LA 3VLWA 1QKAA 2XWKA 1FPJA 4JDFA 4FBPA 4GFRA 4F1UA 5J1DA 3SERA 2X26A 4NE4A 4DXBA 4EXKA 1JP4A 3UA8A 2Z23A 2I49A 1P1UA 2CZLA 2Q8MA 3B6WA 3FXUA 2ALUA 1IMBA 2ZMBA 1OLAA 4G61A 3H4ZA 3G3KA 1XS5A 3JYRA 2VGQA 3A09A 3FVGA 1HSJA 3VVEA 4DE8A 1B3HA 1EYIA 4G68C 4PDDA 1D9YA 4ZEFA 1XOCA 1LB9A 5TP9B 5EQAA 4GBWA 4AB6A 3M8UA 1IUDA 1FBGA 4KFQA 5ESYA 1LBYA 3C36A 5I59A 2G93A 3BFTA 5FHMA 3O97A 3A3UA 3MP1A 4QFOA 5HBCA 1UIUA 1YTVA 2I4CA 4X1BA 3IOWA 1UTHA 1FTOA 1KA0A 4GX3A 1MH3A 5CMKA 1R9QA 2HAUA 3K2DA 3TAJA 4P47A 2HQ0A 3ECRA 4N8GA 2Y7KA 4Z0IA 1RYOA 1HSEA 1NUZA 1ZLQA 2Y7IA 3C34A 5CMMA 4DXCA 4GRKA 1LBCA 4TLLB 3L6GA 1B6HA 3FXQA 1NUXA 1B4HA 1Y9UA 1IMCA 2R8TA 1FPEA 1H44A 1IMAA 1NMUA 3ZSFA 2V3QA 1AL3A 4POXA 3LBSA 1SW4A 4OTEA 5IM2A 1SW2A 4K3FA 3MVXA 3OOAA 3IO6A 3VVDA 3H3GA 2CEXA 3RUMA 3TODA 1URSA 3EHTA 1FPDA 2YLNA 2IEEA 1B0HA 4ZEIA 1POY1 5EHMA 3K1PA 4ND9A 4NF0A 3MQ9A 1UIVA 2AYSA 1B3FA 5LOMA 1EH3A 4O3CA 5I2KB 4ZS9A 3KSXA 1B1HA
chains in the Genus database with same CATH topology
3KC0A 1NV6A 4GBWA 2DE4A 4NG7A 4GWUA 3IFCA 4N6KA 4I3EA 4PAIA 4PAFA 3T1BA 4DI4B 2CZKA 1FBGA 4PC9A 1D9QA 4GX6A 4XF5A 4OVTA 2QVVA 4QXDA 2Y5KA 5ESYA 2FHYA 5A5LA 1LBYA 4PDHA 1FPBA 3LUZA 2KQZA 4GWYA 4X8RA 3CHGA 2WEFA 4N6DA 2Y5LA 5I3SA 4P1LA 2PFYA 1NI9A 4P56A 3ROJA 5IZ1A 2CZIA 2PFZA 4N15A 3E78A 3QMFA 5EQ9A 2JJKA 4PTKA 1FSAA 3HFUA 4OVPA 2MKZA 4PFIA 3GYYA 2FBPA 3W9VA 2XXKA 1G0HA 4HE0A 1IMEA 1KA1A 2P3NA 2F5XA 5LDZA 1KA0A 1Q9DA 2HZKA 4GX3A 4JVIA 2V4CA 4MCOA 1XI6A 1G0IA 1LBWA 4IR8A 4MNCA 1YXIA 4MNIA 1DBZA 3B50A 4P8BA 4P47A 4PFBA 1NV3A 4PGPA 3A29A 4N8GA 2CZHA 4O7MA 5I5PA 2FIXA 4DI3D 2P3VA 1IMFA 5EYGA 5T3JA 2HPGA 1IMDA 1NUYA 4PAKA 5JK4A 1FBPA 1KZ8A 1NUZA 2HHMA 4GBVA 1SPIA 1YYZA 5EQ7A 4F1VA 1NV5A 1FBHA 3KC1A 2WYKA 4NN3A 4PBQA 1INPA 1DCUA 1DK4A 1K9ZA 5IZ3A 2XA5A 4PE3A 4QBAA 4F19A 3BIGA 2HXRA 4NGUA 5ET5A 5EQAA 5J16A 4OVQA 5LTCA 4MJOA 4XFEA 2FVZA 1FPFA 2WBBA 4GWZA 1FRPA 3RYDA 4N8YA 1FBEA 1NUXA 1FPKA 2GQ1A 1QGXA 1CNQA 2VPOA 4NAPA 1VDWA 1RDZA 5F24A 4OA4A 4PCDA 2XWKA 4I3YA 5ET7A 3MSTA 1FPJA 1LBVA 4GWWA 4H45A 5FBPA 4PBHA 4MX6A 4FBPA 1IMCA 2R8TA 1FPEA 4OVRA 4P3LA 1FTAA 1FBCA 4YICA 2F3BA 1AWBA 1FPGA 2VPNA 2CEYA 4PETA 4X04A 1NV0A 4X9TA 1IMAA 1NV7A 4PF8A 4F1UA 2V3QA 3FBPA 4I40A 5J1DA 2DDKA 5IZ3B 4M1VA 4AS5A 4HXVA 4O7IA 3W9WA 5I7IA 4H46A 4F18A 1FPLA 4KXPA 4PGNA 4LN5A 4NX1A 2DE2A 4OANA 1LBZA 4PFRA 2F3DA 2QVRA 1NV4A 2QFLA 4AS4A 3ISPA 2BJIA 1FBFA 4OVSA 1FJ9A 1NUWA 3RPLB 1YZ0A 4N81A 1JP4A 5EYHA 1FJ6A 2B4MA 4YZZA 5ET8A 2HZLA 1NV1A 3IFAA 3D1RA 5ET6A 2XWOA 2CEXA 2ZZXA 3LV0A 2WX9A 4O94A 4UABA 2PCRA 4P9KA 1NV2A 4GWSA 4HCYA 2Q8MA 1FPDA 3BIHA 3EKIA 1IMBA 1K9YA 2ZZVA 4P1EA 2L5VA 4XEQA 1FBDA 2KR0A 2Q9TA 2XWIA 3B8BA 5DW8A 4NHBA 5IM2A 4G61A 4N91A 5EQ8A 4NQ8A 4MNPA 2DVZA 2XWVA 3NOHA 4N4UA 1BK4A 4N17A 5IGAA 4O8MA 3PTYA 4PF6A 3T0JA 4HCWA 2ZZWA 4JVCA 2OWZA 4NF0A 1FPIA 3SZPA 1RDYA 1LEVA 2WYPA 4MHFA 3KBZA 5CM6A 3RPLA 1EYKA 1RDXA 3FXBA 5IZZA 4MIJA 1EYJA 2DE3A 3U65A 1EYIA 4PDDA 4MAGA 4MEVA 4JVDA 2QVUA 2VT5A 2OX3A 2Q74A 1LBXA 2WBDA 4GWXA 4HE2A 2B4LA 2FIEA 4HE1A 2QPQA 3E79A 3MYUA 4MMPA 4GX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KC0 A;  1NV6 A;  4GBW A;  4GWU A;  3IFC A;  4I3E A;  2CZK A;  1FBG A;  1D9Q A;  4GX6 A;  2QVV A;  4QXD A;  2Y5K A;  5ESY A;  2FHY A;  5A5L A;  1LBY A;  1FPB A;  3LUZ A;  4GWY A;  2WEF A;  2Y5L A;  5I3S A;  1NI9 A;  3ROJ A;  5IZ1 A;  2CZI A;  3QMF A;  5EQ9 A;  2JJK A;  4PTK A;  1FSA A;  2FBP A;  1G0H A;  4HE0 A;  1IME A;  1KA1 A;  2P3N A;  5LDZ A;  1KA0 A;  1Q9D A;  4GX3 A;  1XI6 A;  1G0I A;  1LBW A;  4IR8 A;  1YXI A;  1DBZ A;  1NV3 A;  3A29 A;  2CZH A;  2FIX A;  2P3V A;  1IMF A;  5EYG A;  5T3J A;  1IMD A;  1NUY A;  1FBP A;  1KZ8 A;  1NUZ A;  2HHM A;  4GBV A;  1SPI A;  1YYZ A;  5EQ7 A;  1NV5 A;  1FBH A;  3KC1 A;  1INP A;  1DCU A;  1DK4 A;  1K9Z A;  5IZ3 A;  3BIG A;  5ET5 A;  5EQA A;  5J16 A;  4MJO A;  2FVZ A;  1FPF A;  2WBB A;  4GWZ A;  1FRP A;  3RYD A;  1FBE A;  1NUX A;  1FPK A;  2GQ1 A;  1QGX A;  1CNQ A;  1VDW A;  1RDZ A;  5F24 A;  4I3Y A;  5ET7 A;  1FPJ A;  1LBV A;  4GWW A;  4H45 A;  5FBP A;  4FBP A;  1IMC A;  2R8T A;  1FPE A;  1FTA A;  1FBC A;  2F3B A;  1AWB A;  1FPG A;  1NV0 A;  1IMA A;  1NV7 A;  3FBP A;  4I40 A;  2DDK A;  5IZ3 B;  4AS5 A;  4HXV A;  4O7I A;  4H46 A;  1FPL A;  4KXP A;  1LBZ A;  2F3D A;  2QVR A;  1NV4 A;  2QFL A;  4AS4 A;  2BJI A;  1FBF A;  1FJ9 A;  1NUW A;  3RPL B;  1YZ0 A;  4N81 A;  1JP4 A;  5EYH A;  1FJ6 A;  5ET8 A;  1NV1 A;  3IFA A;  3D1R A;  5ET6 A;  3LV0 A;  2PCR A;  1NV2 A;  4GWS A;  2Q8M A;  1FPD A;  3BIH A;  1IMB A;  1K9Y A;  1FBD A;  3B8B A;  5DW8 A;  4G61 A;  5EQ8 A;  1BK4 A;  3T0J A;  2OWZ A;  1FPI A;  1RDY A;  1LEV A;  3KBZ A;  3RPL A;  1EYK A;  1RDX A;  1EYJ A;  1EYI A;  2QVU A;  2VT5 A;  2OX3 A;  2Q74 A;  1LBX A;  2WBD A;  4GWX A;  4HE2 A;  2FIE A;  4HE1 A;  4GX4 A; 
#chains in the Genus database with same CATH topology
 5DYH A;  3O28 A;  3T1B A;  4DI4 B;  3TFL A;  2UVI A;  4OVT A;  4IO5 A;  5CI5 A;  4U22 A;  1DOT A;  3K6V A;  3FXR A;  5KCJ A;  2DSF A;  1GTK A;  5CRY A;  2ZYN A;  4GXS B;  2H4I A;  2MKZ A;  1P1W A;  3W9V A;  1KA1 A;  1LBW A;  1A8E A;  3SEV A;  4KCD A;  3UK4 A;  4FEC A;  5T3J A;  1VR5 A;  4FAT A;  4RJZ A;  1NV5 A;  3DLN A;  2XXU A;  4FE8 A;  3CSB A;  3L6H A;  1US5 A;  4OET A;  3IOR A;  3U94 A;  3E9X A;  4JXI A;  4EQ9 A;  2OPD A;  4PBH A;  1LB8 A;  1NV7 A;  4IY5 A;  4QFN A;  3OSR A;  1LCT A;  3VDF A;  3W9W A;  3EPE A;  4P11 A;  2DE2 A;  3C31 A;  2BJI A;  4N81 A;  1FJ6 A;  4LZ7 A;  2B4M A;  4YZZ A;  2DWA A;  3OO8 A;  4BDQ A;  1NL5 A;  1Y3P A;  5L9S A;  2I58 A;  2X7P A;  1K9Y A;  3K6X A;  2L5V A;  4WKM A;  3PV0 E;  1B05 A;  1MQD A;  4FIM A;  2O6A A;  4N4U A;  4N17 A;  3T0J A;  3S9L C;  5JTY B;  4MEV A;  2VT5 A;  4HE2 A;  1PC3 A;  3E79 A;  4I1D A;  2V3U A;  1PEB A;  4GOT A;  4I3E A;  4BDR A;  3WAF A;  2P1S A;  4XF5 A;  4IO4 A;  4R2B A;  4ISU A;  5BWJ A;  1MQH A;  4G68 A;  3KN8 A;  4XKP A;  5I3S A;  1TFA A;  1IEJ A;  3QMF A;  3OD7 A;  2DP8 A;  4YKP A;  4XKQ A;  3RTW B;  1NKX A;  3MP6 A;  3Q27 A;  2UVG A;  4MCO A;  4U4S A;  2YPN A;  1D3K A;  2I48 A;  3PD9 A;  3Q29 A;  1JNF A;  4H5G A;  4LQ5 A;  2O51 A;  3RNN A;  2V3T A;  2VD2 A;  1MXZ A;  1JET A;  3PGF A;  3H06 B;  1IZ1 A;  4GD5 A;  4EUO A;  4PFT A;  4KHZ E;  3M3L A;  5F24 A;  4O3B A;  1MG1 A;  1UTB B;  4I3Y A;  4H45 A;  2RCB A;  1FBC A;  3LC8 A;  4E0X A;  1I6A A;  4L17 A;  5H8Q A;  2O7U A;  3JV9 A;  3HST A;  4GL0 A;  3FJ7 A;  2H98 A;  4OAN A;  4GQO A;  4KPT A;  1XHY A;  4RYA A;  2RCA A;  4BLA A;  3NOH A;  5IGA A;  2Y7R A;  3P7I A;  1USY E;  3QIM A;  2QS4 A;  3N26 A;  4ZZA A;  1Q1K A;  3QAX A;  2DE3 A;  5BUU A;  2XXP A;  2Q74 A;  3TTR A;  5FBP A;  3PPR A;  4PAI A;  2F7B A;  3VXB A;  2PT2 A;  2KQZ A;  4X8R A;  4R6K A;  3S9E A;  3K02 A;  1B58 A;  4TQU Q;  3MBP A;  4PTK A;  2O84 X;  1OQG A;  3FV1 A;  4IY6 A;  4O94 A;  5A5X A;  1A40 A;  3SES A;  2X7Q A;  3PD8 A;  3PMW A;  4OEV A;  1LBB A;  3IL1 B;  1XVY A;  2HHM A;  4F31 B;  2F35 A;  2XA5 A;  3ONM A;  2ZYO A;  3GBB A;  4RXL A;  3MVZ A;  4F2Q A;  4GWZ A;  4Z7E A;  3O2A A;  1QGX A;  4IO2 A;  4PCD A;  4H65 A;  3TTL A;  1IXI A;  2F6P A;  4X04 A;  2OBG A;  1WOD A;  5TPA B;  3PUY E;  3I6V A;  4F22 A;  2V93 A;  2R71 A;  1NFT A;  1FTK A;  4H8I A;  4XKR A;  4RA1 A;  2QMW A;  3N6T A;  1B3G A;  5ET6 A;  3D1R A;  1PBQ A;  1MY4 A;  4NWD A;  1CB6 A;  2ABH A;  2ZZV A;  1D4N A;  4XEQ A;  1LLS A;  2F36 A;  4NF4 B;  2O1M A;  3PMX A;  1UTB A;  4OES A;  3HPI A;  2H5Y A;  1EZP A;  1RDX A;  1B1X A;  4MIJ A;  3OSQ A;  4MAG A;  4JVD A;  1B46 A;  2D21 A;  3MYU A;  4HE1 A;  3K4U A;  2I6E A;  2PBW A;  4R72 A;  2M8C A;  4R9F A;  2XXW A;  4GWU A;  4N6K A;  1XVX A;  4NMY A;  3CI8 A;  1JW5 A;  1OMP A;  4QXD A;  2OWS A;  4F3S A;  1ZJL A;  1IIW A;  1O64 A;  4DIG A;  1MQI A;  3RT6 B;  1NI9 A;  4YB5 A;  1MM6 A;  1VFE A;  3UOR A;  1FW0 A;  3RN8 A;  1MDQ A;  3OMB A;  4PFB A;  1FCK A;  4PGP A;  2HPG A;  4NN3 A;  4H6D A;  4F19 A;  3IR1 A;  3WAE A;  1LFH A;  5JTY A;  3AXF A;  4G77 A;  1UQW A;  3OO7 A;  2P2A A;  3G7W A;  1FPF A;  1FBE A;  1FPK A;  3I3V A;  1P1O A;  3QK6 A;  3TPA A;  4JWY A;  5FTI A;  2I0B A;  3S2V A;  3CRB A;  3OEN A;  4I40 A;  5CMB A;  3K6U A;  1FQF A;  4IO7 A;  4OVS A;  4NF8 A;  3LV0 A;  2Z8D A;  5I2N A;  1N7W A;  1II5 A;  3KG2 A;  3G3H A;  2Q9T A;  1P99 A;  5EQ8 A;  2F8D A;  1FTL A;  4PF6 A;  3USD A;  2OWZ A;  3SZP A;  4QFK A;  5H8S A;  3CR9 A;  3F11 A;  5K2Y A;  1SI1 A;  5DVJ A;  3TTN A;  3MZ1 A;  3T9H B;  5H8Q B;  3FJG A;  3KEI A;  4ELR A;  3S9N C;  2FHY A;  2A5T B;  5B70 A;  2XXY A;  4QSC A;  4F2O A;  4HS7 A;  3Q26 A;  1IXG A;  3H6V A;  1B7U A;  4KYE A;  2QS1 A;  2QJE A;  4EXL A;  4DCX A;  3BFU A;  2AL4 A;  1B3E A;  1NV3 A;  3H6U A;  1FBP A;  4U1O A;  3GLB A;  1FBH A;  3K1M A;  2NOO A;  5FHN A;  3BIG A;  2REG A;  3QXM A;  3TEP A;  3N5L A;  2GHA A;  3V5A A;  4QRZ A;  4LA9 A;  1FRP A;  3MUQ A;  1A8F A;  2I0C A;  1O63 A;  4G68 B;  4U2R A;  2I3W A;  2B3F A;  1EU8 A;  4N6P A;  1B51 A;  4GVO A;  4PF8 A;  3B7D A;  4H67 A;  4O7I A;  2QS2 A;  2HAV A;  1LBZ A;  4OEU A;  2KLF A;  1NUW A;  1QUI A;  5H8N B;  3DP8 A;  3SET A;  5ET8 A;  5I56 A;  2ZZX A;  1ZKB A;  5A5X B;  4F29 A;  4HCY A;  1B2H A;  3RTF B;  1MXW A;  4P1E A;  4O3A A;  1LAG E;  4BDM A;  4G8M A;  3RT8 A;  3CG1 A;  1XC1 A;  1FQB A;  2RKM A;  4YKK A;  5CM6 A;  3E13 X;  1SBP A;  2A5S A;  3QYT A;  2XD3 A;  5H8H B;  3SEY A;  3FD3 A;  2DE4 A;  1Z7M E;  3IFC A;  3GZG A;  5AE4 A;  2D3I A;  4PFU A;  1CE2 A;  1GR2 A;  4P1L A;  5HM4 B;  2UXA A;  4P56 A;  2GRV A;  1UTH B;  3T96 B;  1OVB A;  5DT6 A;  5AA4 B;  5KDT A;  1FSA A;  1Y4C A;  1NNP A;  4NTL A;  1Q9D A;  2H9B A;  4PE3 A;  5I59 B;  1DBZ A;  4YU0 A;  1RKM A;  2XXV A;  2OJT A;  2HFB A;  1ZIU A;  3TEL A;  4OQO A;  3V8X B;  5ELV A;  1KZ8 A;  3ILT B;  1O7T A;  1WVJ A;  1MY2 A;  3OO6 A;  1SVX B;  1S50 A;  5HPQ A;  4QBA A;  3HHF A;  3HN0 A;  4Q30 B;  3DM0 A;  4NGU A;  2ZXT A;  4XFE A;  2FVZ A;  3DEL B;  5AA2 D;  4N8Y A;  4YB7 A;  4LQ2 A;  4MBP A;  5IKB A;  2PMS A;  1R1N A;  2DWH A;  3FZV A;  4ZZE A;  4M4G A;  1R6Z A;  4MX6 A;  5CC2 A;  1TT1 A;  2OK2 A;  1PDA A;  1B5J A;  3JZJ A;  4H46 A;  5I58 A;  4LN5 A;  3IJX B;  1BLF A;  2A5T A;  1FBF A;  3MAM A;  2PT1 A;  1B40 A;  1I6Q A;  2HZL A;  1NV1 A;  1LFG A;  1N04 A;  2ZNS A;  2VP1 A;  1A7L A;  2DQV A;  5ICT A;  3C4M A;  4O8M A;  1JVX A;  4HCW A;  1LAF E;  1RDY A;  5DEX A;  1AIV A;  3FXB A;  5I58 B;  4NG7 A;  2WBD A;  2QPQ A;  2W7Y A;  3KGC A;  2O7I A;  5IAI A;  4PDH A;  4OFL A;  4NF8 B;  5EYF A;  5ISU A;  2CZI A;  2PFZ A;  2NWJ A;  2V84 A;  4OVP A;  2B65 A;  3W15 C;  3GYY A;  2XXK A;  1G0H A;  2HZK A;  2P3N A;  2E1S A;  1FQE A;  4MNI A;  3TCH A;  2VOZ A;  2CZH A;  1NNK A;  4O7M A;  1N84 A;  4DI3 D;  1B0L A;  4PFY A;  2FA7 A;  4R75 A;  4GWO A;  3CFL A;  2QS3 A;  4JWO A;  3R7X A;  2E0S A;  5KDT B;  1H3D A;  3D4G A;  2XD2 A;  2VPO A;  3IOU A;  2DWJ A;  2F3B A;  1AWB A;  4UA8 A;  3FBP A;  2F6G A;  4ZEB A;  4MH5 A;  5TP9 A;  4H1X A;  3PUV E;  2OPE A;  4PGN A;  4NX1 A;  3N6U A;  4F39 A;  2PX1 A;  3PUX E;  1FJ9 A;  1J1N A;  4PQJ A;  1VE4 A;  3MVW A;  4R6H A;  3QSL A;  3K0V A;  3EKI A;  2AL5 A;  4LZ5 A;  1FBD A;  2KR0 A;  2XWI A;  3B8B A;  5DW8 A;  4HW8 A;  2Q88 A;  3S9M C;  4F3B A;  4LP2 B;  1QJM A;  3Q28 A;  4MHF A;  3HHG A;  1AMF A;  1B7H A;  4XTC Q;  3PMV A;  1LCF A;  3KC0 A;  2Z8F A;  3MC2 A;  5I2K A;  1B3L A;  4KR5 A;  4ZDM A;  1S9T A;  1ATG A;  1D9Q A;  4TLM B;  3E3K A;  3U8Q A;  2F78 A;  4N6D A;  1LAX A;  3N94 A;  2GH9 A;  4GL8 A;  3HFU A;  1DSN A;  2ZYK A;  4PFI A;  2FBP A;  2V4C A;  3G3I A;  1JEV A;  1IMF A;  1IMD A;  3LSX A;  1BKA A;  2IA4 A;  4QSD A;  3C35 A;  3MW0 A;  5IZ3 A;  3K1N A;  4C1U A;  1IXH A;  3K6W A;  3TTM A;  2WBB A;  3PUZ E;  1M5F A;  1QVS A;  3QUJ A;  4R6Y A;  4YIC A;  3TDJ A;  4IGT A;  3CFZ A;  5CMC A;  1NV0 A;  3KFM A;  3S4U A;  3MZB A;  4FED A;  3U92 A;  3HV1 A;  4F18 A;  4KXP A;  2REJ A;  1GGG A;  4RPO A;  2Z22 A;  4QSE A;  4H5F A;  4P9K A;  3M3F A;  3O9P A;  1R9L A;  4WEP A;  4YMA A;  1T0K A;  3R6U A;  1ZMG A;  4N91 A;  5I2N B;  4G8N A;  2XWV A;  3DP6 A;  3TKD A;  1MXU A;  2GFE A;  1KWH A;  2XX9 A;  1USY H;  4DLD A;  4OFO A;  1EYK A;  2LAO A;  2XX7 A;  3EHU A;  1I6B A;  3B6Q A;  3KJ7 A;  3H6W A;  3B6T A;  2UYF A;  1FQD A;  1EZO A;  4PC9 A;  2NUV A;  3PU5 A;  1FPB A;  1PB9 A;  2FNC A;  3IOV A;  3IK6 B;  3T93 B;  2RC8 A;  3IJO B;  4ZEC A;  1SYI A;  1HSL A;  1B4Z A;  2GHB A;  1Y1Z A;  4JVI A;  5LDZ A;  2I4B A;  3SKP A;  1POT A;  3MZ9 A;  4F1Y A;  1Q35 A;  3CSG A;  1YYZ A;  1MY0 A;  1SYH A;  4NF5 B;  4OWD A;  4C1T A;  2OZZ A;  1IIT A;  1LFI A;  2XX8 A;  4LON B;  4IGR A;  3LSL A;  2UVH A;  3M3K A;  3MWB A;  4GWW A;  2NXO A;  1FTA A;  2CEY A;  5KZT A;  2F7A A;  4ESW A;  3C32 A;  2QFL A;  3ZS6 A;  1YZ0 A;  1TXF A;  4X1D A;  1B5I A;  2NVU B;  2OCU A;  2WX9 A;  1VFD A;  5CBS A;  3CG3 A;  1A55 A;  4U21 A;  1N3W A;  4NF6 A;  4QFL A;  5H8F A;  2Q8J A;  1M5D A;  2Y84 A;  4U1Z A;  1IXC A;  3E4R A;  3MJN A;  4KD5 A;  1FQA A;  2HEU A;  3TTK A;  3U65 A;  4DDD A;  3BKI B;  5F1Q A;  1MDP 1;  4LAT A;  1LBX A;  3TYH A;  4GWX A;  1Y3N A;  2FIE A;  1QUJ A;  1D9V A;  4Q5T A;  4F3G A;  4JWX A;  4N07 A;  4JSD A;  2DS9 A;  3OEM A;  2Y5K A;  2DVC A;  5EHS A;  3CVG A;  4R74 A;  3CHG A;  2Y5L A;  3VV5 A;  3FVK A;  2XXI A;  5L8D A;  3ROJ A;  5IZ1 A;  4R9G A;  2RC9 A;  1M5B A;  4IB2 A;  1MXV A;  3CIJ A;  4EQ7 A;  4YAH X;  1ELJ A;  3DP4 A;  1FTJ A;  3KN3 A;  3KOT A;  4ZE9 A;  5EYG A;  3U72 A;  2QMX A;  1NH8 A;  1QW0 A;  4PBQ A;  4XKN A;  1INP A;  1DK4 A;  3PPN A;  4NED A;  1ZBM A;  2YJP A;  5AA3 A;  4C0R A;  3IB1 A;  5LTC A;  4NAP A;  3O66 A;  1JW1 A;  1NH7 A;  3ILU B;  2OWT A;  3H03 A;  3VFJ A;  4P3L A;  2UYE A;  4PET A;  3VXC A;  5IZ3 B;  3RLF E;  1A99 A;  4PE5 B;  4M1V A;  4I62 A;  3TCF A;  5I56 B;  3IB2 A;  5H8N A;  3ISP A;  5L9O A;  3FV2 A;  3FAT A;  3ZKL A;  2XWO A;  4QHQ A;  3VLV A;  2DXY A;  2Q2C A;  4MLV A;  1P1N A;  3Q25 A;  4FAJ A;  4NQ8 A;  2DVZ A;  2Q89 A;  1YCJ A;  1MY1 A;  4H8J A;  5IZZ A;  2OX3 A;  1MY3 A;  1LGB C;  1VSO A;  2CZK A;  5A5L A;  1AH5 A;  4LVQ A;  1Y3Q A;  4MF3 A;  2ONR A;  2JJK A;  4BDO A;  1I69 A;  4OFJ A;  3CFX A;  3FVO A;  2XXH A;  3T22 A;  1YPN A;  5DVI A;  3GBA A;  3RGY A;  2FIX A;  1ANF A;  4KQP A;  4YKI A;  5DTB A;  4JB7 A;  3LUY A;  1SPI A;  5EQ7 A;  4ELP A;  5K2X A;  3HO7 A;  1OLC A;  3IO4 A;  4GLI A;  3FUZ A;  3A3C A;  3OEK A;  3FJM A;  3UGW A;  5J16 A;  4MJO A;  3O6H A;  4PP0 A;  5ICQ A;  1RDZ A;  5ET7 A;  3EF7 A;  1FPG A;  2ZYM A;  5FTH A;  4MLQ A;  3K01 A;  4PFW A;  3BBR A;  4PFR A;  2F3D A;  1NV4 A;  5I57 A;  4YKJ A;  4Q8R A;  3FVN A;  3HCQ A;  3RPL B;  4RY1 A;  2RIN A;  3EHS A;  1IQ7 A;  1JVY A;  5FHO A;  2H25 A;  2AIX A;  3SEX A;  3BIH A;  5H8H A;  3FGS A;  3LSF B;  4GXA A;  4MNP A;  1ZTY A;  3IOT A;  3T9U A;  4THI A;  2G29 A;  1FPI A;  1LAH E;  1RYX A;  3RPL A;  4G2Z A;  5I57 B;  4GX4 A;  1N7X A;  4BDN A;  1QUK A;  4DXU A;  3H6T A;  2B3B A;  4PAF A;  2QVV A;  2HXW A;  2HCA A;  2F34 A;  2WEF A;  3T66 A;  3QUF A;  1B9J A;  4FJP A;  1SD3 A;  3MPK A;  4OVJ A;  4ZEK A;  3UN6 A;  2UVJ A;  4HE0 A;  1TFD A;  2F5X A;  3RPW A;  4MNC A;  5DVF A;  4IR8 A;  1FTM A;  4RK2 A;  2WKY A;  1QKB A;  3IAZ A;  3U93 A;  1OIB A;  3SEW A;  3UIF A;  2ONK E;  4KYS A;  5CBR A;  3KC1 A;  2WYK A;  1DCU A;  3KN7 A;  5ET5 A;  1DTZ A;  3RYD A;  5AA2 A;  2BJJ X;  1CNQ A;  1ZU0 A;  5KCJ B;  1VDW A;  2I3V A;  3MST A;  4NF6 B;  1GVC A;  2OLB A;  5F7V A;  4X9T A;  3FAS A;  4YB6 A;  4QFP A;  4AS5 A;  4Q0C A;  4HXV A;  1SDX A;  3C33 A;  4POW A;  2DOJ A;  1N3X A;  2ANJ A;  1WDN A;  4LUB A;  4UAB A;  2PCR A;  4EQB A;  1NV2 A;  4GWS A;  1MQG A;  4G4P A;  5TPA A;  3H7M A;  4ESX A;  1B7Z A;  4NHB A;  2PVU A;  1YAE A;  3V89 B;  4IO6 A;  5AA4 A;  3OO9 A;  1BK4 A;  3ZKK A;  3PTY A;  4JVC A;  1JQF A;  1LEV A;  1P1Q A;  3KBZ A;  4I9D A;  1JEU A;  2R9J A;  4BDL A;  3ODB A;  3C9H A;  3LR1 A;  1NV6 A;  1L5T A;  1SQY A;  1N76 A;  1Y20 A;  2XXQ A;  1PB7 A;  2RF1 A;  2O68 A;  2Y7W A;  1A54 A;  1MS7 A;  3O29 A;  3E78 A;  1DPP A;  5L9M A;  1AOV A;  3VVF A;  4GIZ A;  1B52 A;  4E0W A;  5JEI A;  2H99 A;  4QF9 A;  4WXJ A;  3TQW A;  1MXX A;  5B7D A;  1G0I A;  1URG A;  3B50 A;  2O69 A;  1BP5 A;  3GXA A;  5I5P A;  3G3G A;  2P3V A;  4KYD A;  4F3P A;  4F1V A;  5M2V A;  2DXR A;  3RY3 A;  4ECF A;  3PUW E;  2ZNT A;  1SW1 A;  4WED A;  2XXT A;  4U4X A;  4R73 A;  1MRP A;  1Y1M A;  1XT8 A;  2ESN A;  3KOS A;  4EDP A;  4H0W A;  3UP9 A;  4HTG A;  3D4C A;  4EF2 A;  2V25 A;  4UAC A;  3T9V A;  5I7I A;  1FPL A;  4YMB A;  1TWY A;  2QVR A;  4NWC A;  4AS4 A;  4DCY A;  1URD A;  5EYH A;  3I5O A;  3O6I A;  4FOR A;  3IFA A;  1OVT A;  3MVY A;  4XIG Q;  2ZNU A;  5H8F B;  2RC7 A;  5I84 A;  4OEN A;  4P0G A;  3RQT A;  4G8H A;  1DMB A;  2WYP A;  3G3J A;  1MQJ A;  4AB5 A;  1Y4T A;  3T9X B;  2QVU A;  2B4L A;  4MMP A;  3VE1 B;  1MM7 A;  3U1O A;  2QL3 A;  3THI A;  4R2F A;  2ONS A;  4GX6 A;  4N13 A;  4ZED A;  4N15 A;  3TMG A;  4KCC A;  1H43 A;  1EZ9 A;  1OQH A;  3OXN A;  2THI A;  4P8B A;  4NF5 A;  3OEL A;  1B32 A;  1H76 A;  1H45 A;  5AA1 A;  2Z8E A;  1MXY A;  1GV8 A;  4RNS A;  1DPE A;  4GBV A;  1BIY A;  5TU0 A;  1SW5 A;  1M5C A;  3VLU A;  4U23 A;  4XXU A;  2VD3 A;  5ITO A;  4OVQ A;  2GQ1 A;  1JW4 A;  2F7C A;  4OA4 A;  3G3F A;  4RK9 A;  1LBV A;  1B5H A;  3TQL A;  4OVR A;  2CMO A;  2XHD A;  2VPN A;  2XXR A;  1US4 A;  4DZ1 A;  4EF1 A;  3KJT A;  2DDK A;  2XXX A;  3SEU A;  1M5E A;  1NNT A;  2Q2A A;  2R6G E;  4FEB A;  1FQC A;  3KBR A;  3IX1 A;  1S7Y A;  2PYY A;  3TUS A;  2DYX A;  1BTJ A;  3IB0 A;  1LST A;  4P0I A;  4ELQ A;  4OXV A;  3TCG A;  3EN3 A;  2Y7P A;  2QRY A;  4X48 A;  3KZG A;  3V83 A;  2DWI A;  4OZ9 A;  1QUL A;  2QSX A;  2ZZW A;  1PBP A;  4ZE8 A;  2FYI A;  1MPC A;  1EYJ A;  4OMB A;  1PB8 A;  4I8C A;  4ONY A;  1MH4 A;  4OHN A;  4AQ4 A;  2F97 A;  3K00 A;  1N0T A;  4JSO A;  3LUZ A;  3SDF A;  4GWY A;  4JBZ A;  3FIR A;  5ITP A;  2PFY A;  2D5W A;  3PPO A;  5EQ9 A;  2P0S A;  4IO3 A;  4NF4 A;  1IME A;  4ELO A;  3KSJ A;  4TOZ A;  1XI6 A;  1SI0 A;  1YXI A;  3LSW A;  3A29 A;  4RPN A;  5AA2 B;  4KI0 E;  4LZ8 A;  1MPD A;  3PPP A;  1MPB A;  1DTG A;  4PAK A;  5JK4 A;  1NUY A;  3O6G A;  1NNF A;  4OYV A;  3PPQ A;  1K9Z A;  1F9B A;  1Z7N E;  2HXR A;  3MPL A;  3MP8 A;  4OER A;  5DEX B;  3EQ1 A;  3TZA A;  4GF8 A;  4MFI A;  3R26 A;  2VHA A;  2O1L A;  3VLW A;  1QKA A;  2XWK A;  1FPJ A;  4JDF A;  4FBP A;  4GFR A;  4F1U A;  5J1D A;  3SER A;  2X26 A;  4NE4 A;  4DXB A;  4EXK A;  1JP4 A;  3UA8 A;  2Z23 A;  2I49 A;  1P1U A;  2CZL A;  2Q8M A;  3B6W A;  3FXU A;  2ALU A;  1IMB A;  2ZMB A;  1OLA A;  4G61 A;  3H4Z A;  3G3K A;  1XS5 A;  3JYR A;  2VGQ A;  3A09 A;  3FVG A;  1HSJ A;  3VVE A;  4DE8 A;  1B3H A;  1EYI A;  4G68 C;  4PDD A;  1D9Y A;  4ZEF A;  1XOC A;  1LB9 A;  5TP9 B;  5EQA A;  4GBW A;  4AB6 A;  3M8U A;  1IUD A;  1FBG A;  4KFQ A;  5ESY A;  1LBY A;  3C36 A;  5I59 A;  2G93 A;  3BFT A;  5FHM A;  3O97 A;  3A3U A;  3MP1 A;  4QFO A;  5HBC A;  1UIU A;  1YTV A;  2I4C A;  4X1B A;  3IOW A;  1UTH A;  1FTO A;  1KA0 A;  4GX3 A;  1MH3 A;  5CMK A;  1R9Q A;  2HAU A;  3K2D A;  3TAJ A;  4P47 A;  2HQ0 A;  3ECR A;  4N8G A;  2Y7K A;  4Z0I A;  1RYO A;  1HSE A;  1NUZ A;  1ZLQ A;  2Y7I A;  3C34 A;  5CMM A;  4DXC A;  4GRK A;  1LBC A;  4TLL B;  3L6G A;  1B6H A;  3FXQ A;  1NUX A;  1B4H A;  1Y9U A;  1IMC A;  2R8T A;  1FPE A;  1H44 A;  1IMA A;  1NMU A;  3ZSF A;  2V3Q A;  1AL3 A;  4POX A;  3LBS A;  1SW4 A;  4OTE A;  5IM2 A;  1SW2 A;  4K3F A;  3MVX A;  3OOA A;  3IO6 A;  3VVD A;  3H3G A;  2CEX A;  3RUM A;  3TOD A;  1URS A;  3EHT A;  1FPD A;  2YLN A;  2IEE A;  1B0H A;  4ZEI A;  1POY 1;  5EHM A;  3K1P A;  4ND9 A;  4NF0 A;  3MQ9 A;  1UIV A;  2AYS A;  1B3F A;  5LOM A;  1EH3 A;  4O3C A;  5I2K B;  4ZS9 A;  3KSX A;  1B1H A; 
#chains in the Genus database with same CATH homology
 3KC0 A;  1NV6 A;  4GBW A;  2DE4 A;  4NG7 A;  4GWU A;  3IFC A;  4N6K A;  4I3E A;  4PAI A;  4PAF A;  3T1B A;  4DI4 B;  2CZK A;  1FBG A;  4PC9 A;  1D9Q A;  4GX6 A;  4XF5 A;  4OVT A;  2QVV A;  4QXD A;  2Y5K A;  5ESY A;  2FHY A;  5A5L A;  1LBY A;  4PDH A;  1FPB A;  3LUZ A;  2KQZ A;  4GWY A;  4X8R A;  3CHG A;  2WEF A;  4N6D A;  2Y5L A;  5I3S A;  4P1L A;  2PFY A;  1NI9 A;  4P56 A;  3ROJ A;  5IZ1 A;  2CZI A;  2PFZ A;  4N15 A;  3E78 A;  3QMF A;  5EQ9 A;  2JJK A;  4PTK A;  1FSA A;  3HFU A;  4OVP A;  2MKZ A;  4PFI A;  3GYY A;  2FBP A;  3W9V A;  2XXK A;  1G0H A;  4HE0 A;  1IME A;  1KA1 A;  2P3N A;  2F5X A;  5LDZ A;  1KA0 A;  1Q9D A;  2HZK A;  4GX3 A;  4JVI A;  2V4C A;  4MCO A;  1XI6 A;  1G0I A;  1LBW A;  4IR8 A;  4MNC A;  1YXI A;  4MNI A;  1DBZ A;  3B50 A;  4P8B A;  4P47 A;  4PFB A;  1NV3 A;  4PGP A;  3A29 A;  4N8G A;  2CZH A;  4O7M A;  5I5P A;  2FIX A;  4DI3 D;  2P3V A;  1IMF A;  5EYG A;  5T3J A;  2HPG A;  1IMD A;  1NUY A;  4PAK A;  5JK4 A;  1FBP A;  1KZ8 A;  1NUZ A;  2HHM A;  4GBV A;  1SPI A;  1YYZ A;  5EQ7 A;  4F1V A;  1NV5 A;  1FBH A;  3KC1 A;  2WYK A;  4NN3 A;  4PBQ A;  1INP A;  1DCU A;  1DK4 A;  1K9Z A;  5IZ3 A;  2XA5 A;  4PE3 A;  4QBA A;  4F19 A;  3BIG A;  2HXR A;  4NGU A;  5ET5 A;  5EQA A;  5J16 A;  4OVQ A;  5LTC A;  4MJO A;  4XFE A;  2FVZ A;  1FPF A;  2WBB A;  4GWZ A;  1FRP A;  3RYD A;  4N8Y A;  1FBE A;  1NUX A;  1FPK A;  2GQ1 A;  1QGX A;  1CNQ A;  2VPO A;  4NAP A;  1VDW A;  1RDZ A;  5F24 A;  4OA4 A;  4PCD A;  2XWK A;  4I3Y A;  5ET7 A;  3MST A;  1FPJ A;  1LBV A;  4GWW A;  4H45 A;  5FBP A;  4PBH A;  4MX6 A;  4FBP A;  1IMC A;  2R8T A;  1FPE A;  4OVR A;  4P3L A;  1FTA A;  1FBC A;  4YIC A;  2F3B A;  1AWB A;  1FPG A;  2VPN A;  2CEY A;  4PET A;  4X04 A;  1NV0 A;  4X9T A;  1IMA A;  1NV7 A;  4PF8 A;  4F1U A;  2V3Q A;  3FBP A;  4I40 A;  5J1D A;  2DDK A;  5IZ3 B;  4M1V A;  4AS5 A;  4HXV A;  4O7I A;  3W9W A;  5I7I A;  4H46 A;  4F18 A;  1FPL A;  4KXP A;  4PGN A;  4LN5 A;  4NX1 A;  2DE2 A;  4OAN A;  1LBZ A;  4PFR A;  2F3D A;  2QVR A;  1NV4 A;  2QFL A;  4AS4 A;  3ISP A;  2BJI A;  1FBF A;  4OVS A;  1FJ9 A;  1NUW A;  3RPL B;  1YZ0 A;  4N81 A;  1JP4 A;  5EYH A;  1FJ6 A;  2B4M A;  4YZZ A;  5ET8 A;  2HZL A;  1NV1 A;  3IFA A;  3D1R A;  5ET6 A;  2XWO A;  2CEX A;  2ZZX A;  3LV0 A;  2WX9 A;  4O94 A;  4UAB A;  2PCR A;  4P9K A;  1NV2 A;  4GWS A;  4HCY A;  2Q8M A;  1FPD A;  3BIH A;  3EKI A;  1IMB A;  1K9Y A;  2ZZV A;  4P1E A;  2L5V A;  4XEQ A;  1FBD A;  2KR0 A;  2Q9T A;  2XWI A;  3B8B A;  5DW8 A;  4NHB A;  5IM2 A;  4G61 A;  4N91 A;  5EQ8 A;  4NQ8 A;  4MNP A;  2DVZ A;  2XWV A;  3NOH A;  4N4U A;  1BK4 A;  4N17 A;  5IGA A;  4O8M A;  3PTY A;  4PF6 A;  3T0J A;  4HCW A;  2ZZW A;  4JVC A;  2OWZ A;  4NF0 A;  1FPI A;  3SZP A;  1RDY A;  1LEV A;  2WYP A;  4MHF A;  3KBZ A;  5CM6 A;  3RPL A;  1EYK A;  1RDX A;  3FXB A;  5IZZ A;  4MIJ A;  1EYJ A;  2DE3 A;  3U65 A;  1EYI A;  4PDD A;  4MAG A;  4MEV A;  4JVD A;  2QVU A;  2VT5 A;  2OX3 A;  2Q74 A;  1LBX A;  2WBD A;  4GWX A;  4HE2 A;  2B4L A;  2FIE A;  4HE1 A;  2QPQ A;  3E79 A;  3MYU A;  4MMP A;  4GX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...