5LDZA

Quadruple space group ambiguity due to rotational and translational non-crystallographic symmetry in human liver fructose-1,6-bisphosphatase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
311
Chain Sequence
PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quadruple space-group ambiguity owing to rotational and translational noncrystallographic symmetry in human liver fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Fructose-1,6-bisphosphatase 1
total genus 100
structure length 311
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5ldzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ldzA02
2QFLA 3IFAA 5IZ1A 1EYJA 1CNQA 3BIGA 1K9ZA 1DK4A 4QXDA 3RPLB 5ESYA 2OX3A 1RDYA 2DDKA 1FBCA 1FSAA 3RYDA 1FBFA 3D1RA 4G61A 1NV0A 5IZ3B 1Q9DA 1K9YA 1NV1A 1FPDA 4IR8A 1IMCA 1RDZA 5LDZA 1LBYA 2F3DA 1D9QA 2CZIA 4KXPA 1NUZA 3IFCA 1NV6A 1NV5A 5I3SA 2Q8MA 1FJ6A 1AWBA 2HHMA 4GWYA 1KZ8A 2WEFA 5ET5A 1FPEA 5F24A 4GX4A 1FPLA 1FPGA 5EYHA 5EQ8A 1FJ9A 3B8BA 5EQAA 4GWSA 2R8TA 1FBHA 2QVRA 1KA1A 1VDWA 4HE1A 4MJOA 3LUZA 1FPJA 2FBPA 3A29A 1FPKA 3QMFA 1DCUA 2F3BA 5FBPA 2Y5KA 4I3EA 4FBPA 1XI6A 1FRPA 4H45A 4GBVA 1G0HA 1IMEA 2CZKA 2Y5LA 1YZ0A 2QVVA 1NUYA 1NV7A 4GBWA 4HE2A 5A5LA 3FBPA 1FBDA 1BK4A 1FTAA 2GQ1A 1LEVA 4N81A 2BJIA 1EYKA 4O7IA 4HE0A 1FBGA 2FHYA 2OWZA 5T3JA 3KBZA 3T0JA 1FPBA 2CZHA 1G0IA 1RDXA 2PCRA 1KA0A 1LBVA 1FPIA 4HXVA 1IMBA 1IMAA 1EYIA 5ET8A 1LBXA 3BIHA 2JJKA 4AS4A 4GWUA 1IMFA 1FPFA 3RPLA 2P3VA 1NV3A 1QGXA 1JP4A 4I40A 5DW8A 2P3NA 2WBBA 4H46A 5IZ3A 1IMDA 1NUWA 2VT5A 2FIEA 2FVZA 1NV4A 1NUXA 3KC1A 1LBZA 4GX3A 1FBPA 5J16A 2FIXA 5EYGA 1FBEA 3ROJA 1NI9A 4GWWA 5EQ9A 4PTKA 5EQ7A 5ET6A 2Q74A 3KC0A 4GX6A 1NV2A 2QVUA 4I3YA 1SPIA 4AS5A 2WBDA 1YXIA 1YYZA 4GWZA 3LV0A 1INPA 5ET7A 4GWXA 1DBZA 1LBWA
chains in the Genus database with same CATH superfamily
4TLMB 2RCBA 2XXVA 3OXNA 3BIGA 2CEYA 3VXCA 4BLAA 1AOVA 1RDYA 3ILTB 3TQLA 4NHBA 1M5FA 1URGA 1Y20A 5I5PA 1LB8A 3FJMA 1D4NA 1NV6A 5DEXB 4XIGQ 1BLFA 4BDRA 2B3BA 4X04A 3O6IA 5TU0A 3H6WA 5F24A 3FZVA 5CI5A 4GL8A 2RCAA 1XC1A 3CG1A 4X9TA 1FJ9A 1KA1A 2O84X 3SEUA 4R74A 3KSXA 3SERA 3HO7A 5H8QA 1FPJA 2FBPA 3VE1B 3PUWE 3K00A 1DSNA 1PB9A 4NF6B 1BK4A 1MY0A 1Y4TA 5KCJA 4GWOA 3V5AA 5ET8A 3C33A 4H67A 5L9SA 4GD5A 4OQOA 2XXPA 1OVTA 1B2HA 1B7ZA 4I9DA 1OLCA 4PDDA 3TYHA 4PF6A 2DOJA 3PMVA 3V8XB 3PPPA 3ROJA 2Q9TA 4GFRA 5AE4A 1RKMA 4AB5A 4U1OA 1GV8A 3JV9A 4ONYA 3IOUA 3VVEA 5I2KB 2ANJA 3GXAA 2ESNA 4PGNA 3C36A 4BDOA 5CC2A 1MXYA 2A5SA 4IR8A 4OVTA 4N13A 1A8FA 1AMFA 4P47A 3T22A 2I3WA 4KYEA 1BKAA 2UYFA 1LFGA 4GX4A 1FPGA 5AA4B 1MXXA 3SZPA 3K0VA 1Y9UA 1S7YA 3K6XA 2RC7A 4N91A 3HHGA 3RNNA 2QSXA 3LUZA 4GRKA 5I2NA 4KR5A 5M2VA 2CMOA 4U22A 4H0WA 3ODBA 1FQBA 3CFZA 1MY4A 4GBVA 2G93A 4NAPA 1TFAA 4GBWA 4HTGA 3FBPA 2GQ1A 1QUJA 4GVOA 4QSDA 3T0JA 2F34A 3TPAA 1FPBA 2V93A 4AQ4A 1TXFA 5JEIA 4POWA 5FTIA 4ZS9A 1QGXA 1H44A 1HSJA 4F3PA 2ALUA 1LB9A 5K2YA 4F29A 3BBRA 4MAGA 1FQFA 3KGCA 4JXIA 4GWWA 4F1VA 4RK2A 4TOZA 1MXUA 3GZGA 1JVYA 2WBDA 3TODA 5CMCA 1IEJA 1MQHA 3T93B 4KPTA 1TT1A 3H7MA 3OOAA 3D4CA 4PFWA 5K2XA 5JTYB 3T96B 4QSCA 1Y4CA 3MZ9A 2H99A 2F5XA 3RPLB 3I3VA 3A3CA 2DWAA 2E1SA 4R9GA 5AA3A 3HHFA 3MPKA 4G61A 3THIA 4QFPA 3OD7A 4PFUA 1IIWA 4JBZA 1RYOA 3EKIA 4YKKA 2DWJA 4XKNA 1EU8A 4P11A 1VSOA 3PGFA 3NOHA 2F6GA 4G8MA 1IQ7A 2M8CA 4QHQA 1DTZA 4H5GA 2R6GE 5TP9A 3QSLA 3SEVA 4NF0A 4O94A 3PU5A 4Q0CA 4BDQA 4EQ7A 3FVNA 1POY1 2GH9A 1FBGA 4NF5A 1P1QA 3Q28A 2OBGA 4XF5A 1BTJA 3OSRA 3OEKA 1LBXA 4G68C 3Q29A 5KZTA 1N7WA 1BIYA 4FEDA 1KWHA 4DXBA 4FEBA 2FVZA 3KOSA 5J16A 2XXXA 4LP2B 2D5WA 4EQ9A 4LUBA 1SVXB 4GX6A 4YB5A 4X1BA 1SPIA 1S9TA 1JW4A 1H45A 1IITA 4RY1A 4NN3A 1DBZA 2AL5A 3FXRA 4O3CA 1LLSA 4IO2A 1DK4A 3RT6B 1B7UA 2RINA 3C35A 3DP6A 3TUSA 1Q9DA 2XWIA 1MDP1 1GVCA 4LZ8A 4NF4A 5ELVA 5CBRA 1FTKA 2I0BA 3SETA 3H06B 2Q8MA 2VGQA 1MDQA 2DWIA 3L6HA 3IO6A 5ET5A 3E79A 1FPEA 1EH3A 4JSDA 2RC9A 5EQ8A 2VPNA 3DP4A 5KDTA 2B4MA 5HPQA 1ZTYA 4R73A 4DCYA 1MXWA 3SKPA 3M3FA 1LAHE 3EHSA 3CI8A 5H8HB 4DI4B 1JETA 2PT1A 2XXIA 1SW1A 4WEPA 2BJIA 4H1XA 4MHFA 4C1UA 4N6KA 1ANFA 1NKXA 4N8GA 1G0IA 2R9JA 4OETA 1RDXA 4JWYA 1O7TA 1LBVA 3IOTA 5I59B 3TTRA 2E0SA 3FGSA 3O9PA 3VFJA 1NV3A 2Y7KA 3KOTA 1MQIA 4R2FA 4FORA 4JVDA 4KYSA 4I8CA 2I3VA 1MY3A 4U23A 4X48A 4PTKA 1UIUA 1OMPA 2Q74A 4GXAA 4P0IA 2ZNTA 5IKBA 1D9YA 1DMBA 3U72A 4BDLA 4IO4A 3W9VA 4JVCA 3T9XB 3U94A 3HN0A 2AL4A 5B70A 2QJEA 1Y3PA 4RYAA 4KHZE 1CE2A 4PFYA 2UVIA 3U65A 2F36A 2XD3A 4YMAA 1LBYA 1IXHA 2RF1A 4R2BA 5DVIA 2O69A 5EYFA 4LONB 3E78A 1P1NA 1NMUA 3HV1A 3RTWB 3RT8A 1PB7A 4YB7A 1A40A 2ZZXA 3M3KA 2QVRA 4OTEA 2H25A 1A54A 5AA2A 3A09A 4NGUA 4EXLA 3O97A 2HCAA 3I5OA 4KCCA 4JSOA 2Y5LA 1I6AA 3PPOA 1FTAA 1B0LA 1F9BA 4R72A 4MLVA 5H8FB 4QFNA 3WAFA 4U2RA 4YZZA 4N8YA 4WXJA 3QUFA 1SI1A 4O3AA 3SEWA 3EHTA 1MQJA 1XOCA 3E3KA 4FJPA 1DOTA 4LZ5A 2THIA 4F31B 4TLLB 2JJKA 4IY5A 2G29A 3RPLA 4R6YA 5ISUA 3C31A 3TDJA 3MJNA 3QIMA 4GX3A 1MRPA 5ITPA 1FCKA 3LBSA 4P56A 2OPEA 5EQ7A 1P99A 2DVZA 1YPNA 1NV2A 3C9HA 3PTYA 2KQZA 4MNPA 1LBWA 1SW4A 3S9NC 2XD2A 1WODA 1K9ZA 1HSEA 3V83A 1LBBA 2PX1A 1OQGA 1JEVA 1FBFA 3IOWA 2YLNA 4OFOA 4PAIA 5IZ3B 3K01A 1SYHA 2DE3A 4NQ8A 4WKMA 1ZMGA 2P1SA 4PC9A 1LAFE 1FJ6A 5JTYA 2KLFA 5EYHA 1B5IA 4QSEA 2R8TA 4N6PA 4OHNA 2D21A 3O29A 2PMSA 1MPBA 1FPKA 3TKDA 3L6GA 4N6DA 1AIVA 1B46A 2XX8A 2OLBA 1PBQA 1M5DA 4MFIA 1B58A 3K1NA 3K4UA 5A5LA 1S50A 4HE0A 1YAEA 4QFLA 3KZGA 4OEVA 3CHGA 3MVXA 4F1YA 1OLAA 1IMAA 3D4GA 3UA8A 4AS4A 3GBAA 4EUOA 3TTMA 1UTBB 1QUIA 5I2KA 1NH7A 3IJOB 2F78A 3FJGA 4OZ9A 4HCYA 3DLNA 2ZYKA 2FIXA 1ZU0A 5EYGA 5FHNA 4WEDA 2NWJA 4ZDMA 1UTBA 4PF8A 3BFUA 3N26A 5DT6A 2QVUA 1OIBA 1ZIUA 2VP1A 5B7DA 2KR0A 4RK9A 5I57B 2AIXA 3IFAA 2F7CA 3RY3A 4XTCQ 4QXDA 4HS7A 3EF7A 5ESYA 1ZLQA 3G3JA 2VPOA 1K9YA 2LAOA 1XHYA 4LQ2A 2F3DA 4KXPA 1FQDA 3LR1A 3IFCA 3N5LA 1AWBA 2F6PA 4IGRA 1B4HA 3B6QA 4YB6A 4RNSA 3EHUA 1KZ8A 1M5BA 5DYHA 1MY1A 1M5EA 1Q1KA 3N94A 2XXUA 1N3XA 5H8SA 2L5VA 4OEUA 1OVBA 1P1OA 3VV5A 4H45A 3EQ1A 1MQGA 1A55A 1B52A 4RJZA 2QL3A 4NWCA 4ZEBA 1QJMA 1US4A 4F2QA 1Y3QA 1SD3A 2P3VA 3IB0A 3RTFB 1SYIA 3IJXB 3ISPA 4OVJA 4UACA 5ICQA 1MQDA 2DE2A 5ITOA 4AS5A 2D3IA 3VVFA 5FHOA 4OERA 4LATA 4UABA 4QFKA 4Z0IA 4GWXA 2YJPA 2A5TA 2CZLA 3LSFB 5H8NB 1B3EA 4M4GA 1CNQA 3O66A 3QXMA 4XXUA 2H9BA 2DDKA 4NF5B 3K1MA 3D1RA 2VD3A 2Q8JA 1LAXA 1LFIA 4MX6A 2I58A 3TFLA 2A5TB 5ICTA 1IMCA 3WAEA 2DS9A 5AA2B 1N76A 1OQHA 3MPLA 3UORA 3KN8A 3KG2A 1D9QA 3MC2A 1R1NA 4QRZA 3RQTA 1B40A 2X7PA 3TCHA 3HPIA 3T1BA 5EQAA 1IZ1A 4GWSA 2UYEA 2XWVA 1POTA 4MJOA 2Y7PA 3MBPA 3IOVA 2V84A 3K6VA 2Y5KA 4IY6A 5EHMA 1AL3A 5CMMA 1FTMA 3PUVE 2I6EA 2WKYA 3EPEA 5DVFA 1EYKA 5LOMA 3R7XA 2OWSA 4YKPA 3G3IA 1KA0A 3U8QA 1IMBA 1EYIA 4MH5A 4GOTA 3S9LC 4R75A 1N0TA 2XXHA 2F35A 4G8NA 5KCJB 3MVWA 4ZZAA 3KC1A 1UIVA 3IORA 2HZLA 4RXLA 1FBEA 3OO9A 2PT2A 2Q2CA 4G8HA 2CEXA 3VVDA 2ONSA 4KQPA 1YTVA 1N04A 2Q2AA 3S9EA 1PDAA 3B6WA 3P7IA 3TELA 3TEPA 1FQAA 2OZZA 3FUZA 4E0WA 4R6KA 2HHMA 2VHAA 3MVYA 1B51A 3KFMA 2FA7A 1IXCA 2V4CA 4ZE9A 1SW5A 2Y84A 1VFDA 3QAXA 3CFXA 3MP6A 2B4LA 3ZS6A 2XWKA 3H3GA 5IM2A 4G2ZA 2X7QA 3TTKA 3W9WA 4FAJA 3FV1A 3PPNA 1B4ZA 5AA4A 3E13X 3PUZE 5CMBA 4HE1A 1FTOA 3QUJA 5IGAA 4NF8A 1LGBC 1EZ9A 3OO7A 2QS2A 2QS4A 4FBPA 1ATGA 4TQUQ 3U92A 1B0HA 4NEDA 3T9HB 3FXUA 4MMPA 4F3BA 3QK6A 3OSQA 4N81A 2V3QA 4O7IA 4U21A 4NF8B 2QRYA 2V3TA 4PBHA 5CMKA 3G3GA 3BFTA 3KEIA 1FW0A 1LBCA 3FIRA 3M8UA 2QMWA 1IMDA 4F3SA 1LSTA 3CSGA 4IO5A 3CRBA 2FIEA 5H8HA 4PFIA 4EQBA 4ZZEA 1EZOA 4F18A 1R6ZA 1VFEA 3JZJA 3KC0A 4I62A 3MYUA 3B7DA 4IO6A 4DI3D 3CIJA 4PP0A 2AYSA 4MCOA 4YU0A 2PBWA 4PAFA 2BJJX 5LTCA 1NNPA 2QFLA 4DXUA 1XVYA 2HAVA 3BKIB 3Q26A 1LAGE 4PCDA 2ZZWA 3RYDA 2OCUA 1VE4A 1YCJA 2ABHA 4QFOA 2GFEA 3PD8A 4GLIA 1NUZA 4G77A 4IO7A 2HQ0A 1Z7NE 4QF9A 2OWTA 3MAMA 1WDNA 2PFYA 1QVSA 1QUKA 4OMBA 1TWYA 2Y7RA 4ZEFA 3A29A 2F8DA 3FXBA 4POXA 5DTBA 2F3BA 4GQOA 2PVUA 3RGYA 5L8DA 1H76A 2CZKA 3IX1A 1NUYA 3LSWA 4HCWA 3VLWA 2Z22A 3VLVA 4ZEIA 1IXGA 2IEEA 5KDTB 4H6DA 3VXBA 2MKZA 2PCRA 2F7AA 3G7WA 1TFDA 1IMFA 3DP8A 4P9KA 2UXAA 5HBCA 4EF2A 1WVJA 5I56B 3KJTA 3ZKKA 4BDMA 3TZAA 1A7LA 3QYTA 1NI9A 2Z8DA 2IA4A 3K6UA 4OA4A 3KBRA 2P2AA 1A8EA 2DP8A 4N4UA 1IXIA 4YAHX 4R9FA 3RLFE 1B9JA 4RPNA 5L9MA 3ZSFA 1B3LA 4MLQA 2Z8EA 4O8MA 5FTHA 3TQWA 3F11A 3TCFA 4PE3A 3Q27A 3OEMA 1BP5A 4N15A 2NUVA 3KN7A 3U1OA 1URSA 4PAKA 2XXYA 2O51A 1NNTA 4UA8A 2NXOA 5EHSA 2V25A 3MP1A 4XKRA 4MIJA 4DCXA 3PUXE 1SW2A 1P1UA 1US5A 3IB1A 3H6UA 1VR5A 4ND9A 1GR2A 2DQVA 5FBPA 2HXRA 1I6QA 3V89B 1FRPA 2PYYA 3OENA 1ZBMA 3MVZA 4GXSB 1NV7A 4HE2A 4OYVA 3PD9A 1I69A 1MH3A 2NVUB 3KBZA 3T9VA 3VLUA 2CZHA 1LCTA 3TCGA 4BDNA 3BIHA 1FPFA 2DSFA 2FNCA 4OANA 5CM6A 3CSBA 4N07A 3R26A 3HCQA 2VT5A 1LBZA 1NNKA 1FBPA 4F39A 1B1XA 1B3HA 3K1PA 3H6TA 1Y1MA 4NG7A 2I4BA 3FATA 4LZ7A 1ZKBA 4FE8A 5I57A 4FATA 4YICA 2B3FA 4OVSA 2DYXA 4ZECA 1M5CA 2XX7A 4N17A 1LFHA 4ELOA 4C0RA 4XKQA 1T0KA 5LDZA 3MZBA 4LVQA 3SESA 4Q8RA 1MXVA 5CRYA 4HW8A 4FECA 3FASA 3G3HA 3O6HA 4PQJA 3MQ9A 5H8QB 4GWYA 2QS3A 3FXQA 3G3FA 4ELQA 1XVXA 1USYE 1IUDA 1FBHA 4XFEA 1DCUA 3B50A 3H03A 4MEVA 4IB2A 1PC3A 1G0HA 2XXTA 1IMEA 4ESXA 4F22A 2QVVA 2B65A 3FD3A 4P3LA 2ZNSA 4F19A 2QMXA 3UP9A 1CB6A 4HXVA 2VOZA 5J1DA 1D9VA 5AA2D 3PUYE 1JP4A 5DW8A 2WBBA 4O7MA 1B3FA 4IO3A 4ZEKA 5EQ9A 2DE4A 2Z23A 5ET6A 3TTNA 2UVGA 2GHAA 3GYYA 4KCDA 4O3BA 1NFTA 4I3YA 4YKJA 1JEUA 1J1NA 3UGWA 4GL0A 1MM7A 4F3GA 3T66A 4PDHA 2ZYMA 1INPA 4OVPA 1MY2A 2XXQA 2I0CA 1RYXA 4E0XA 3OELA 1MPCA 4OENA 1ELJA 1SBPA 2Q89A 4L17A 1LCFA 3SDFA 3HSTA 3H6VA 3LUYA 2X26A 5BWJA 1QULA 1Q35A 5F1QA 5JK4A 3IAZA 2HFBA 2YPNA 2HZKA 3IB2A 2W7YA 4H8JA 1QW0A 5I59A 3ILUB 1NH8A 3MZ1A 3ONMA 1P1WA 5BUUA 1A99A 3T9UA 4DXCA 3E4RA 1VDWA 4PFRA 2OJTA 4G68B 2XXKA 3QMFA 2Y7IA 5I7IA 3O28A 3CR9A 1MH4A 1QKBA 4DDDA 4QBAA 3H4ZA 3LSLA 2H98A 3OMBA 1URDA 4RPOA 3W15C 1LEVA 5T3JA 5A5XA 5DVJA 1B6HA 1MM6A 4MNIA 5F7VA 2I48A 4R6HA 1DTGA 2O68A 3IK6B 3B6TA 2ZMBA 4I1DA 3ZKLA 2QPQA 1B32A 4H46A 4ECFA 5IZ3A 3HFUA 2F7BA 3RUMA 2WX9A 3VDFA 4NX1A 4NF4B 3PMWA 4PGPA 2XA5A 3MWBA 4JVIA 2HEUA 2GHBA 4THIA 1B1HA 4NMYA 1YYZA 2O1MA 2V3UA 4KFQA 1JNFA 3FJ7A 1Y3NA 2HAUA 4GWZA 5L9OA 5ET7A 4Q5TA 3GLBA 2DWHA 2I4CA 3GBBA 3CG3A 5IZ1A 4NTLA 1GGGA 2ONKE 1L5TA 3MSTA 4U1ZA 3S4UA 1FBCA 1FSAA 4EF1A 2HPGA 1DPPA 4ZE8A 4DIGA 1RDZA 1JW5A 4H65A 2CZIA 4RA1A 4JWOA 5I3SA 3TMGA 4JB7A 4DE8A 3PMXA 2NOOA 2FYIA 2UVJA 2OPDA 3E9XA 4F2OA 1GTKA 1N3WA 3ECRA 4KI0E 3A3UA 1JW1A 4JWXA 4P1LA 5FHMA 3C34A 2O6AA 3RN8A 3U93A 3CVGA 2HXWA 4NF6A 5CBSA 1PB8A 4IGTA 3O2AA 1Z7ME 2QS1A 4ESWA 2OWZA 1B5JA 1II5A 5I58B 4GIZA 3FVOA 3IR1A 3G3KA 4U4SA 3FVKA 3M3LA 1ZJLA 1UTHA 1XT8A 2PFZA 1SDXA 3OO6A 4GWUA 5IAIA 3R6UA 2GRVA 5IZZA 2ZNUA 3PPRA 1HSLA 3FV2A 1DPEA 1PBPA 1N7XA 2ZYOA 2WYKA 5I58A 4MNCA 3PV0E 2DXRA 3IL1B 4K3FA 1EYJA 4P1EA 3TTLA 4H8IA 2ZXTA 1NV0A 3N6UA 4LN5A 4PFTA 1NV1A 4KYDA 3Q25A 1FQEA 1PEBA 3DELB 1B5HA 4NWDA 2ONRA 4U4XA 3UIFA 4XKPA 2F97A 2WEFA 3DM0A 3CFLA 1FPLA 1NNFA 2XXRA 5HM4B 4LA9A 2DVCA 3FVGA 2O7IA 4OFLA 5H8FA 5DEXA 3B8BA 4YMBA 3S9MC 4P0GA 4F1UA 1I6BA 1UTHB 3I6VA 2XX9A 1MS7A 5AA1A 2ZYNA 3C32A 4ELRA 2I49A 4PBQA 4AB6A 4PE5B 3K02A 4ISUA 2R71A 3AXFA 2O7UA 2FHYA 2O1LA 2H5YA 1Y1ZA 5I56A 4P8BA 4H5FA 2RC8A 3MW0A 1FPIA 4OESA 2XWOA 3OO8A 4X1DA 3UK4A 4I40A 2P3NA 1FTJA 1B7HA 2RKMA 5I84A 4MBPA 1R9QA 3UN6A 3USDA 3RPWA 1N84A 4DLDA 2H4IA 4X8RA 2WYPA 1AH5A 1SQYA 1R9LA 4ZEDA 4M1VA 1EZPA 1JQFA 3JYRA 4OWDA 4NE4A 1YXIA 2Q88A 4OVQA 2OK2A 3KN3A 3N6TA 2VD2A 5I2NB 1O63A 4DZ1A 2OX3A 5A5XB 1NL5A 1XS5A 2DXYA 1QKAA 1FPDA 3PPQA 3SEYA 4Q30B 4PFBA 1NV5A 4MF3A 3S2VA 3MP8A 4G68A 1H3DA 4EDPA 1D3KA 4KD5A 2XHDA 2Y7WA 4EXKA 4JDFA 3LC8A 1H43A 5TP9B 4I3EA 1XI6A 1O64A 1MPDA 3KSJA 3EN3A 1MXZA 1YZ0A 2ZZVA 3MUQA 4XEQA 1JVXA 4YKIA 3IO4A 4ELPA 2Z8FA 3C4MA 1FBDA 1UQWA 1FQCA 1MG1A 2XXWA 3K6WA 4G4PA 5TPAA 4Z7EA 2REGA 5H8NA 3SEXA 3KJ7A 2UVHA 3LSXA 1SI0A 2REJA 3K2DA 5TPAB 1NUWA 1NV4A 1NUXA 1B05A 1FTLA 4OVRA 4C1TA 4FIMA 1B3GA 1USYH 4GF8A 4LQ5A 3TAJA 3O6GA 2P0SA 4PETA 4OFJA 3LV0A 4OXVA
chains in the Genus database with same CATH topology
5LTCA 4NN3A 2QFLA 3IFAA 5IZ1A 1EYJA 1CNQA 3BIGA 2CEYA 4YICA 3MSTA 4OVSA 1K9ZA 1DK4A 4QXDA 4P1EA 2F5XA 3RPLB 4O8MA 5ESYA 2OX3A 1RDYA 2DDKA 4PCDA 1FBCA 1FSAA 3RYDA 1FBFA 2ZZWA 3D1RA 4N17A 2HPGA 4G61A 4PAIA 4PGNA 4PE3A 4MX6A 1NV0A 5IZ3B 4LN5A 2VPOA 1Q9DA 1K9YA 2DE3A 2XWIA 2V4CA 4N15A 4NHBA 1NV1A 1FPDA 4IR8A 5I5PA 3U65A 1IMCA 4NQ8A 1RDZA 4OVTA 5LDZA 1LBYA 4PAKA 4PFBA 2F3DA 5JK4A 1D9QA 2CZIA 4KXPA 1NUZA 3E78A 4PC9A 3IFCA 1NV6A 1NV5A 5I3SA 2Q8MA 1FJ6A 2B4LA 3EKIA 4P47A 1AWBA 2HHMA 2XWKA 2HZKA 5IM2A 4GWYA 4MIJA 4X04A 1KZ8A 2WEFA 5ET5A 3E79A 1FPEA 5F24A 4GX4A 3NOHA 3W9WA 1FPLA 1FPGA 5EYHA 2PFYA 5EQ8A 3SZPA 2VPNA 4X9TA 1FJ9A 3B8BA 5EQAA 2ZZXA 3T1BA 4GWSA 2R8TA 2B4MA 1FBHA 2QVRA 1KA1A 4N91A 2XWVA 2L5VA 4PFRA 1VDWA 4HE1A 4MJOA 4XFEA 4P1LA 4F1UA 3LUZA 1FPJA 2FBPA 2XXKA 3A29A 5IGAA 3FXBA 1FPKA 3QMFA 1DCUA 2F3BA 4N6DA 5FBPA 4NGUA 2HXRA 2Y5KA 3B50A 4NF0A 4DI4B 4O94A 5I7IA 4I3EA 4FBPA 1XI6A 1FRPA 4H45A 4GBVA 4MEVA 1G0HA 4QBAA 1IMEA 2CZKA 4NAPA 2Y5LA 1YZ0A 2QVVA 1NUYA 2ZZVA 4PBQA 4XEQA 4HCWA 4MMPA 1NV7A 4GBWA 4HE2A 5A5LA 3FBPA 4P3LA 1FBDA 1BK4A 1FTAA 2GQ1A 1LEVA 4N81A 2BJIA 1EYKA 4O7IA 2V3QA 4MHFA 4HE0A 4F19A 1FBGA 2FHYA 2OWZA 5T3JA 4N6KA 3KBZA 4PBHA 4N8YA 4YZZA 3T0JA 4MNIA 4XF5A 1FPBA 2CZHA 1G0IA 4N8GA 4P8BA 1RDXA 2MKZA 3CHGA 2PCRA 1KA0A 1LBVA 1FPIA 4HXVA 1IMBA 1IMAA 5J1DA 1EYIA 5ET8A 1LBXA 3BIHA 2JJKA 4AS4A 2PFZA 2XWOA 4GWUA 1IMFA 1FPFA 3RPLA 4P9KA 2P3VA 1NV3A 1QGXA 1JP4A 4I40A 2QPQA 5DW8A 2P3NA 2WBBA 4O7MA 4H46A 4OANA 5IZ3A 3HFUA 4PAFA 5CM6A 1IMDA 4PDDA 2WX9A 4JVDA 4PF6A 1NUWA 2VT5A 2FIEA 2FVZA 1NV4A 1NUXA 3KC1A 1LBZA 4HCYA 4NX1A 4PFIA 4GX3A 4MAGA 1FBPA 5J16A 4PGPA 2FIXA 2XA5A 5EYGA 2HZLA 4OVRA 1FBEA 3ROJA 1NI9A 2WYPA 4P56A 4GWWA 4X8RA 5EQ9A 4PTKA 2DE4A 4JVIA 4F1VA 5IZZA 5EQ7A 5ET6A 4OA4A 4PF8A 4F18A 2CEXA 3ISPA 2DVZA 2Q74A 3GYYA 4M1VA 2Q9TA 3KC0A 4GX6A 2DE2A 1NV2A 4NG7A 4OVQA 3MYUA 2QVUA 4I3YA 1SPIA 4AS5A 2WBDA 1YXIA 1YYZA 4N4UA 4PETA 3PTYA 3W9VA 4JVCA 4GWZA 3LV0A 4PDHA 2WYKA 4DI3D 4MNCA 4MCOA 4UABA 2KQZA 1INPA 5ET7A 2KR0A 4MNPA 4GWXA 1DBZA 4OVPA 1LBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFL A;  3IFA A;  5IZ1 A;  1EYJ A;  1CNQ A;  3BIG A;  1K9Z A;  1DK4 A;  4QXD A;  3RPL B;  5ESY A;  2OX3 A;  1RDY A;  2DDK A;  1FBC A;  1FSA A;  3RYD A;  1FBF A;  3D1R A;  4G61 A;  1NV0 A;  5IZ3 B;  1Q9D A;  1K9Y A;  1NV1 A;  1FPD A;  4IR8 A;  1IMC A;  1RDZ A;  5LDZ A;  1LBY A;  2F3D A;  1D9Q A;  2CZI A;  4KXP A;  1NUZ A;  3IFC A;  1NV6 A;  1NV5 A;  5I3S A;  2Q8M A;  1FJ6 A;  1AWB A;  2HHM A;  4GWY A;  1KZ8 A;  2WEF A;  5ET5 A;  1FPE A;  5F24 A;  4GX4 A;  1FPL A;  1FPG A;  5EYH A;  5EQ8 A;  1FJ9 A;  3B8B A;  5EQA A;  4GWS A;  2R8T A;  1FBH A;  2QVR A;  1KA1 A;  1VDW A;  4HE1 A;  4MJO A;  3LUZ A;  1FPJ A;  2FBP A;  3A29 A;  1FPK A;  3QMF A;  1DCU A;  2F3B A;  5FBP A;  2Y5K A;  4I3E A;  4FBP A;  1XI6 A;  1FRP A;  4H45 A;  4GBV A;  1G0H A;  1IME A;  2CZK A;  2Y5L A;  1YZ0 A;  2QVV A;  1NUY A;  1NV7 A;  4GBW A;  4HE2 A;  5A5L A;  3FBP A;  1FBD A;  1BK4 A;  1FTA A;  2GQ1 A;  1LEV A;  4N81 A;  2BJI A;  1EYK A;  4O7I A;  4HE0 A;  1FBG A;  2FHY A;  2OWZ A;  5T3J A;  3KBZ A;  3T0J A;  1FPB A;  2CZH A;  1G0I A;  1RDX A;  2PCR A;  1KA0 A;  1LBV A;  1FPI A;  4HXV A;  1IMB A;  1IMA A;  1EYI A;  5ET8 A;  1LBX A;  3BIH A;  2JJK A;  4AS4 A;  4GWU A;  1IMF A;  1FPF A;  3RPL A;  2P3V A;  1NV3 A;  1QGX A;  1JP4 A;  4I40 A;  5DW8 A;  2P3N A;  2WBB A;  4H46 A;  5IZ3 A;  1IMD A;  1NUW A;  2VT5 A;  2FIE A;  2FVZ A;  1NV4 A;  1NUX A;  3KC1 A;  1LBZ A;  4GX3 A;  1FBP A;  5J16 A;  2FIX A;  5EYG A;  1FBE A;  3ROJ A;  1NI9 A;  4GWW A;  5EQ9 A;  4PTK A;  5EQ7 A;  5ET6 A;  2Q74 A;  3KC0 A;  4GX6 A;  1NV2 A;  2QVU A;  4I3Y A;  1SPI A;  4AS5 A;  2WBD A;  1YXI A;  1YYZ A;  4GWZ A;  3LV0 A;  1INP A;  5ET7 A;  4GWX A;  1DBZ A;  1LBW A; 
#chains in the Genus database with same CATH topology
 4TLM B;  2RCB A;  2XXV A;  3OXN A;  3BIG A;  2CEY A;  3VXC A;  4BLA A;  1AOV A;  1RDY A;  3ILT B;  3TQL A;  4NHB A;  1M5F A;  1URG A;  1Y20 A;  5I5P A;  1LB8 A;  3FJM A;  1D4N A;  1NV6 A;  5DEX B;  4XIG Q;  1BLF A;  4BDR A;  2B3B A;  4X04 A;  3O6I A;  5TU0 A;  3H6W A;  5F24 A;  3FZV A;  5CI5 A;  4GL8 A;  2RCA A;  1XC1 A;  3CG1 A;  4X9T A;  1FJ9 A;  1KA1 A;  2O84 X;  3SEU A;  4R74 A;  3KSX A;  3SER A;  3HO7 A;  5H8Q A;  1FPJ A;  2FBP A;  3VE1 B;  3PUW E;  3K00 A;  1DSN A;  1PB9 A;  4NF6 B;  1BK4 A;  1MY0 A;  1Y4T A;  5KCJ A;  4GWO A;  3V5A A;  5ET8 A;  3C33 A;  4H67 A;  5L9S A;  4GD5 A;  4OQO A;  2XXP A;  1OVT A;  1B2H A;  1B7Z A;  4I9D A;  1OLC A;  4PDD A;  3TYH A;  4PF6 A;  2DOJ A;  3PMV A;  3V8X B;  3PPP A;  3ROJ A;  2Q9T A;  4GFR A;  5AE4 A;  1RKM A;  4AB5 A;  4U1O A;  1GV8 A;  3JV9 A;  4ONY A;  3IOU A;  3VVE A;  5I2K B;  2ANJ A;  3GXA A;  2ESN A;  4PGN A;  3C36 A;  4BDO A;  5CC2 A;  1MXY A;  2A5S A;  4IR8 A;  4OVT A;  4N13 A;  1A8F A;  1AMF A;  4P47 A;  3T22 A;  2I3W A;  4KYE A;  1BKA A;  2UYF A;  1LFG A;  4GX4 A;  1FPG A;  5AA4 B;  1MXX A;  3SZP A;  3K0V A;  1Y9U A;  1S7Y A;  3K6X A;  2RC7 A;  4N91 A;  3HHG A;  3RNN A;  2QSX A;  3LUZ A;  4GRK A;  5I2N A;  4KR5 A;  5M2V A;  2CMO A;  4U22 A;  4H0W A;  3ODB A;  1FQB A;  3CFZ A;  1MY4 A;  4GBV A;  2G93 A;  4NAP A;  1TFA A;  4GBW A;  4HTG A;  3FBP A;  2GQ1 A;  1QUJ A;  4GVO A;  4QSD A;  3T0J A;  2F34 A;  3TPA A;  1FPB A;  2V93 A;  4AQ4 A;  1TXF A;  5JEI A;  4POW A;  5FTI A;  4ZS9 A;  1QGX A;  1H44 A;  1HSJ A;  4F3P A;  2ALU A;  1LB9 A;  5K2Y A;  4F29 A;  3BBR A;  4MAG A;  1FQF A;  3KGC A;  4JXI A;  4GWW A;  4F1V A;  4RK2 A;  4TOZ A;  1MXU A;  3GZG A;  1JVY A;  2WBD A;  3TOD A;  5CMC A;  1IEJ A;  1MQH A;  3T93 B;  4KPT A;  1TT1 A;  3H7M A;  3OOA A;  3D4C A;  4PFW A;  5K2X A;  5JTY B;  3T96 B;  4QSC A;  1Y4C A;  3MZ9 A;  2H99 A;  2F5X A;  3RPL B;  3I3V A;  3A3C A;  2DWA A;  2E1S A;  4R9G A;  5AA3 A;  3HHF A;  3MPK A;  4G61 A;  3THI A;  4QFP A;  3OD7 A;  4PFU A;  1IIW A;  4JBZ A;  1RYO A;  3EKI A;  4YKK A;  2DWJ A;  4XKN A;  1EU8 A;  4P11 A;  1VSO A;  3PGF A;  3NOH A;  2F6G A;  4G8M A;  1IQ7 A;  2M8C A;  4QHQ A;  1DTZ A;  4H5G A;  2R6G E;  5TP9 A;  3QSL A;  3SEV A;  4NF0 A;  4O94 A;  3PU5 A;  4Q0C A;  4BDQ A;  4EQ7 A;  3FVN A;  1POY 1;  2GH9 A;  1FBG A;  4NF5 A;  1P1Q A;  3Q28 A;  2OBG A;  4XF5 A;  1BTJ A;  3OSR A;  3OEK A;  1LBX A;  4G68 C;  3Q29 A;  5KZT A;  1N7W A;  1BIY A;  4FED A;  1KWH A;  4DXB A;  4FEB A;  2FVZ A;  3KOS A;  5J16 A;  2XXX A;  4LP2 B;  2D5W A;  4EQ9 A;  4LUB A;  1SVX B;  4GX6 A;  4YB5 A;  4X1B A;  1SPI A;  1S9T A;  1JW4 A;  1H45 A;  1IIT A;  4RY1 A;  4NN3 A;  1DBZ A;  2AL5 A;  3FXR A;  4O3C A;  1LLS A;  4IO2 A;  1DK4 A;  3RT6 B;  1B7U A;  2RIN A;  3C35 A;  3DP6 A;  3TUS A;  1Q9D A;  2XWI A;  1MDP 1;  1GVC A;  4LZ8 A;  4NF4 A;  5ELV A;  5CBR A;  1FTK A;  2I0B A;  3SET A;  3H06 B;  2Q8M A;  2VGQ A;  1MDQ A;  2DWI A;  3L6H A;  3IO6 A;  5ET5 A;  3E79 A;  1FPE A;  1EH3 A;  4JSD A;  2RC9 A;  5EQ8 A;  2VPN A;  3DP4 A;  5KDT A;  2B4M A;  5HPQ A;  1ZTY A;  4R73 A;  4DCY A;  1MXW A;  3SKP A;  3M3F A;  1LAH E;  3EHS A;  3CI8 A;  5H8H B;  4DI4 B;  1JET A;  2PT1 A;  2XXI A;  1SW1 A;  4WEP A;  2BJI A;  4H1X A;  4MHF A;  4C1U A;  4N6K A;  1ANF A;  1NKX A;  4N8G A;  1G0I A;  2R9J A;  4OET A;  1RDX A;  4JWY A;  1O7T A;  1LBV A;  3IOT A;  5I59 B;  3TTR A;  2E0S A;  3FGS A;  3O9P A;  3VFJ A;  1NV3 A;  2Y7K A;  3KOT A;  1MQI A;  4R2F A;  4FOR A;  4JVD A;  4KYS A;  4I8C A;  2I3V A;  1MY3 A;  4U23 A;  4X48 A;  4PTK A;  1UIU A;  1OMP A;  2Q74 A;  4GXA A;  4P0I A;  2ZNT A;  5IKB A;  1D9Y A;  1DMB A;  3U72 A;  4BDL A;  4IO4 A;  3W9V A;  4JVC A;  3T9X B;  3U94 A;  3HN0 A;  2AL4 A;  5B70 A;  2QJE A;  1Y3P A;  4RYA A;  4KHZ E;  1CE2 A;  4PFY A;  2UVI A;  3U65 A;  2F36 A;  2XD3 A;  4YMA A;  1LBY A;  1IXH A;  2RF1 A;  4R2B A;  5DVI A;  2O69 A;  5EYF A;  4LON B;  3E78 A;  1P1N A;  1NMU A;  3HV1 A;  3RTW B;  3RT8 A;  1PB7 A;  4YB7 A;  1A40 A;  2ZZX A;  3M3K A;  2QVR A;  4OTE A;  2H25 A;  1A54 A;  5AA2 A;  3A09 A;  4NGU A;  4EXL A;  3O97 A;  2HCA A;  3I5O A;  4KCC A;  4JSO A;  2Y5L A;  1I6A A;  3PPO A;  1FTA A;  1B0L A;  1F9B A;  4R72 A;  4MLV A;  5H8F B;  4QFN A;  3WAF A;  4U2R A;  4YZZ A;  4N8Y A;  4WXJ A;  3QUF A;  1SI1 A;  4O3A A;  3SEW A;  3EHT A;  1MQJ A;  1XOC A;  3E3K A;  4FJP A;  1DOT A;  4LZ5 A;  2THI A;  4F31 B;  4TLL B;  2JJK A;  4IY5 A;  2G29 A;  3RPL A;  4R6Y A;  5ISU A;  3C31 A;  3TDJ A;  3MJN A;  3QIM A;  4GX3 A;  1MRP A;  5ITP A;  1FCK A;  3LBS A;  4P56 A;  2OPE A;  5EQ7 A;  1P99 A;  2DVZ A;  1YPN A;  1NV2 A;  3C9H A;  3PTY A;  2KQZ A;  4MNP A;  1LBW A;  1SW4 A;  3S9N C;  2XD2 A;  1WOD A;  1K9Z A;  1HSE A;  3V83 A;  1LBB A;  2PX1 A;  1OQG A;  1JEV A;  1FBF A;  3IOW A;  2YLN A;  4OFO A;  4PAI A;  5IZ3 B;  3K01 A;  1SYH A;  2DE3 A;  4NQ8 A;  4WKM A;  1ZMG A;  2P1S A;  4PC9 A;  1LAF E;  1FJ6 A;  5JTY A;  2KLF A;  5EYH A;  1B5I A;  4QSE A;  2R8T A;  4N6P A;  4OHN A;  2D21 A;  3O29 A;  2PMS A;  1MPB A;  1FPK A;  3TKD A;  3L6G A;  4N6D A;  1AIV A;  1B46 A;  2XX8 A;  2OLB A;  1PBQ A;  1M5D A;  4MFI A;  1B58 A;  3K1N A;  3K4U A;  5A5L A;  1S50 A;  4HE0 A;  1YAE A;  4QFL A;  3KZG A;  4OEV A;  3CHG A;  3MVX A;  4F1Y A;  1OLA A;  1IMA A;  3D4G A;  3UA8 A;  4AS4 A;  3GBA A;  4EUO A;  3TTM A;  1UTB B;  1QUI A;  5I2K A;  1NH7 A;  3IJO B;  2F78 A;  3FJG A;  4OZ9 A;  4HCY A;  3DLN A;  2ZYK A;  2FIX A;  1ZU0 A;  5EYG A;  5FHN A;  4WED A;  2NWJ A;  4ZDM A;  1UTB A;  4PF8 A;  3BFU A;  3N26 A;  5DT6 A;  2QVU A;  1OIB A;  1ZIU A;  2VP1 A;  5B7D A;  2KR0 A;  4RK9 A;  5I57 B;  2AIX A;  3IFA A;  2F7C A;  3RY3 A;  4XTC Q;  4QXD A;  4HS7 A;  3EF7 A;  5ESY A;  1ZLQ A;  3G3J A;  2VPO A;  1K9Y A;  2LAO A;  1XHY A;  4LQ2 A;  2F3D A;  4KXP A;  1FQD A;  3LR1 A;  3IFC A;  3N5L A;  1AWB A;  2F6P A;  4IGR A;  1B4H A;  3B6Q A;  4YB6 A;  4RNS A;  3EHU A;  1KZ8 A;  1M5B A;  5DYH A;  1MY1 A;  1M5E A;  1Q1K A;  3N94 A;  2XXU A;  1N3X A;  5H8S A;  2L5V A;  4OEU A;  1OVB A;  1P1O A;  3VV5 A;  4H45 A;  3EQ1 A;  1MQG A;  1A55 A;  1B52 A;  4RJZ A;  2QL3 A;  4NWC A;  4ZEB A;  1QJM A;  1US4 A;  4F2Q A;  1Y3Q A;  1SD3 A;  2P3V A;  3IB0 A;  3RTF B;  1SYI A;  3IJX B;  3ISP A;  4OVJ A;  4UAC A;  5ICQ A;  1MQD A;  2DE2 A;  5ITO A;  4AS5 A;  2D3I A;  3VVF A;  5FHO A;  4OER A;  4LAT A;  4UAB A;  4QFK A;  4Z0I A;  4GWX A;  2YJP A;  2A5T A;  2CZL A;  3LSF B;  5H8N B;  1B3E A;  4M4G A;  1CNQ A;  3O66 A;  3QXM A;  4XXU A;  2H9B A;  2DDK A;  4NF5 B;  3K1M A;  3D1R A;  2VD3 A;  2Q8J A;  1LAX A;  1LFI A;  4MX6 A;  2I58 A;  3TFL A;  2A5T B;  5ICT A;  1IMC A;  3WAE A;  2DS9 A;  5AA2 B;  1N76 A;  1OQH A;  3MPL A;  3UOR A;  3KN8 A;  3KG2 A;  1D9Q A;  3MC2 A;  1R1N A;  4QRZ A;  3RQT A;  1B40 A;  2X7P A;  3TCH A;  3HPI A;  3T1B A;  5EQA A;  1IZ1 A;  4GWS A;  2UYE A;  2XWV A;  1POT A;  4MJO A;  2Y7P A;  3MBP A;  3IOV A;  2V84 A;  3K6V A;  2Y5K A;  4IY6 A;  5EHM A;  1AL3 A;  5CMM A;  1FTM A;  3PUV E;  2I6E A;  2WKY A;  3EPE A;  5DVF A;  1EYK A;  5LOM A;  3R7X A;  2OWS A;  4YKP A;  3G3I A;  1KA0 A;  3U8Q A;  1IMB A;  1EYI A;  4MH5 A;  4GOT A;  3S9L C;  4R75 A;  1N0T A;  2XXH A;  2F35 A;  4G8N A;  5KCJ B;  3MVW A;  4ZZA A;  3KC1 A;  1UIV A;  3IOR A;  2HZL A;  4RXL A;  1FBE A;  3OO9 A;  2PT2 A;  2Q2C A;  4G8H A;  2CEX A;  3VVD A;  2ONS A;  4KQP A;  1YTV A;  1N04 A;  2Q2A A;  3S9E A;  1PDA A;  3B6W A;  3P7I A;  3TEL A;  3TEP A;  1FQA A;  2OZZ A;  3FUZ A;  4E0W A;  4R6K A;  2HHM A;  2VHA A;  3MVY A;  1B51 A;  3KFM A;  2FA7 A;  1IXC A;  2V4C A;  4ZE9 A;  1SW5 A;  2Y84 A;  1VFD A;  3QAX A;  3CFX A;  3MP6 A;  2B4L A;  3ZS6 A;  2XWK A;  3H3G A;  5IM2 A;  4G2Z A;  2X7Q A;  3TTK A;  3W9W A;  4FAJ A;  3FV1 A;  3PPN A;  1B4Z A;  5AA4 A;  3E13 X;  3PUZ E;  5CMB A;  4HE1 A;  1FTO A;  3QUJ A;  5IGA A;  4NF8 A;  1LGB C;  1EZ9 A;  3OO7 A;  2QS2 A;  2QS4 A;  4FBP A;  1ATG A;  4TQU Q;  3U92 A;  1B0H A;  4NED A;  3T9H B;  3FXU A;  4MMP A;  4F3B A;  3QK6 A;  3OSQ A;  4N81 A;  2V3Q A;  4O7I A;  4U21 A;  4NF8 B;  2QRY A;  2V3T A;  4PBH A;  5CMK A;  3G3G A;  3BFT A;  3KEI A;  1FW0 A;  1LBC A;  3FIR A;  3M8U A;  2QMW A;  1IMD A;  4F3S A;  1LST A;  3CSG A;  4IO5 A;  3CRB A;  2FIE A;  5H8H A;  4PFI A;  4EQB A;  4ZZE A;  1EZO A;  4F18 A;  1R6Z A;  1VFE A;  3JZJ A;  3KC0 A;  4I62 A;  3MYU A;  3B7D A;  4IO6 A;  4DI3 D;  3CIJ A;  4PP0 A;  2AYS A;  4MCO A;  4YU0 A;  2PBW A;  4PAF A;  2BJJ X;  5LTC A;  1NNP A;  2QFL A;  4DXU A;  1XVY A;  2HAV A;  3BKI B;  3Q26 A;  1LAG E;  4PCD A;  2ZZW A;  3RYD A;  2OCU A;  1VE4 A;  1YCJ A;  2ABH A;  4QFO A;  2GFE A;  3PD8 A;  4GLI A;  1NUZ A;  4G77 A;  4IO7 A;  2HQ0 A;  1Z7N E;  4QF9 A;  2OWT A;  3MAM A;  1WDN A;  2PFY A;  1QVS A;  1QUK A;  4OMB A;  1TWY A;  2Y7R A;  4ZEF A;  3A29 A;  2F8D A;  3FXB A;  4POX A;  5DTB A;  2F3B A;  4GQO A;  2PVU A;  3RGY A;  5L8D A;  1H76 A;  2CZK A;  3IX1 A;  1NUY A;  3LSW A;  4HCW A;  3VLW A;  2Z22 A;  3VLV A;  4ZEI A;  1IXG A;  2IEE A;  5KDT B;  4H6D A;  3VXB A;  2MKZ A;  2PCR A;  2F7A A;  3G7W A;  1TFD A;  1IMF A;  3DP8 A;  4P9K A;  2UXA A;  5HBC A;  4EF2 A;  1WVJ A;  5I56 B;  3KJT A;  3ZKK A;  4BDM A;  3TZA A;  1A7L A;  3QYT A;  1NI9 A;  2Z8D A;  2IA4 A;  3K6U A;  4OA4 A;  3KBR A;  2P2A A;  1A8E A;  2DP8 A;  4N4U A;  1IXI A;  4YAH X;  4R9F A;  3RLF E;  1B9J A;  4RPN A;  5L9M A;  3ZSF A;  1B3L A;  4MLQ A;  2Z8E A;  4O8M A;  5FTH A;  3TQW A;  3F11 A;  3TCF A;  4PE3 A;  3Q27 A;  3OEM A;  1BP5 A;  4N15 A;  2NUV A;  3KN7 A;  3U1O A;  1URS A;  4PAK A;  2XXY A;  2O51 A;  1NNT A;  4UA8 A;  2NXO A;  5EHS A;  2V25 A;  3MP1 A;  4XKR A;  4MIJ A;  4DCX A;  3PUX E;  1SW2 A;  1P1U A;  1US5 A;  3IB1 A;  3H6U A;  1VR5 A;  4ND9 A;  1GR2 A;  2DQV A;  5FBP A;  2HXR A;  1I6Q A;  3V89 B;  1FRP A;  2PYY A;  3OEN A;  1ZBM A;  3MVZ A;  4GXS B;  1NV7 A;  4HE2 A;  4OYV A;  3PD9 A;  1I69 A;  1MH3 A;  2NVU B;  3KBZ A;  3T9V A;  3VLU A;  2CZH A;  1LCT A;  3TCG A;  4BDN A;  3BIH A;  1FPF A;  2DSF A;  2FNC A;  4OAN A;  5CM6 A;  3CSB A;  4N07 A;  3R26 A;  3HCQ A;  2VT5 A;  1LBZ A;  1NNK A;  1FBP A;  4F39 A;  1B1X A;  1B3H A;  3K1P A;  3H6T A;  1Y1M A;  4NG7 A;  2I4B A;  3FAT A;  4LZ7 A;  1ZKB A;  4FE8 A;  5I57 A;  4FAT A;  4YIC A;  2B3F A;  4OVS A;  2DYX A;  4ZEC A;  1M5C A;  2XX7 A;  4N17 A;  1LFH A;  4ELO A;  4C0R A;  4XKQ A;  1T0K A;  5LDZ A;  3MZB A;  4LVQ A;  3SES A;  4Q8R A;  1MXV A;  5CRY A;  4HW8 A;  4FEC A;  3FAS A;  3G3H A;  3O6H A;  4PQJ A;  3MQ9 A;  5H8Q B;  4GWY A;  2QS3 A;  3FXQ A;  3G3F A;  4ELQ A;  1XVX A;  1USY E;  1IUD A;  1FBH A;  4XFE A;  1DCU A;  3B50 A;  3H03 A;  4MEV A;  4IB2 A;  1PC3 A;  1G0H A;  2XXT A;  1IME A;  4ESX A;  4F22 A;  2QVV A;  2B65 A;  3FD3 A;  4P3L A;  2ZNS A;  4F19 A;  2QMX A;  3UP9 A;  1CB6 A;  4HXV A;  2VOZ A;  5J1D A;  1D9V A;  5AA2 D;  3PUY E;  1JP4 A;  5DW8 A;  2WBB A;  4O7M A;  1B3F A;  4IO3 A;  4ZEK A;  5EQ9 A;  2DE4 A;  2Z23 A;  5ET6 A;  3TTN A;  2UVG A;  2GHA A;  3GYY A;  4KCD A;  4O3B A;  1NFT A;  4I3Y A;  4YKJ A;  1JEU A;  1J1N A;  3UGW A;  4GL0 A;  1MM7 A;  4F3G A;  3T66 A;  4PDH A;  2ZYM A;  1INP A;  4OVP A;  1MY2 A;  2XXQ A;  2I0C A;  1RYX A;  4E0X A;  3OEL A;  1MPC A;  4OEN A;  1ELJ A;  1SBP A;  2Q89 A;  4L17 A;  1LCF A;  3SDF A;  3HST A;  3H6V A;  3LUY A;  2X26 A;  5BWJ A;  1QUL A;  1Q35 A;  5F1Q A;  5JK4 A;  3IAZ A;  2HFB A;  2YPN A;  2HZK A;  3IB2 A;  2W7Y A;  4H8J A;  1QW0 A;  5I59 A;  3ILU B;  1NH8 A;  3MZ1 A;  3ONM A;  1P1W A;  5BUU A;  1A99 A;  3T9U A;  4DXC A;  3E4R A;  1VDW A;  4PFR A;  2OJT A;  4G68 B;  2XXK A;  3QMF A;  2Y7I A;  5I7I A;  3O28 A;  3CR9 A;  1MH4 A;  1QKB A;  4DDD A;  4QBA A;  3H4Z A;  3LSL A;  2H98 A;  3OMB A;  1URD A;  4RPO A;  3W15 C;  1LEV A;  5T3J A;  5A5X A;  5DVJ A;  1B6H A;  1MM6 A;  4MNI A;  5F7V A;  2I48 A;  4R6H A;  1DTG A;  2O68 A;  3IK6 B;  3B6T A;  2ZMB A;  4I1D A;  3ZKL A;  2QPQ A;  1B32 A;  4H46 A;  4ECF A;  5IZ3 A;  3HFU A;  2F7B A;  3RUM A;  2WX9 A;  3VDF A;  4NX1 A;  4NF4 B;  3PMW A;  4PGP A;  2XA5 A;  3MWB A;  4JVI A;  2HEU A;  2GHB A;  4THI A;  1B1H A;  4NMY A;  1YYZ A;  2O1M A;  2V3U A;  4KFQ A;  1JNF A;  3FJ7 A;  1Y3N A;  2HAU A;  4GWZ A;  5L9O A;  5ET7 A;  4Q5T A;  3GLB A;  2DWH A;  2I4C A;  3GBB A;  3CG3 A;  5IZ1 A;  4NTL A;  1GGG A;  2ONK E;  1L5T A;  3MST A;  4U1Z A;  3S4U A;  1FBC A;  1FSA A;  4EF1 A;  2HPG A;  1DPP A;  4ZE8 A;  4DIG A;  1RDZ A;  1JW5 A;  4H65 A;  2CZI A;  4RA1 A;  4JWO A;  5I3S A;  3TMG A;  4JB7 A;  4DE8 A;  3PMX A;  2NOO A;  2FYI A;  2UVJ A;  2OPD A;  3E9X A;  4F2O A;  1GTK A;  1N3W A;  3ECR A;  4KI0 E;  3A3U A;  1JW1 A;  4JWX A;  4P1L A;  5FHM A;  3C34 A;  2O6A A;  3RN8 A;  3U93 A;  3CVG A;  2HXW A;  4NF6 A;  5CBS A;  1PB8 A;  4IGT A;  3O2A A;  1Z7M E;  2QS1 A;  4ESW A;  2OWZ A;  1B5J A;  1II5 A;  5I58 B;  4GIZ A;  3FVO A;  3IR1 A;  3G3K A;  4U4S A;  3FVK A;  3M3L A;  1ZJL A;  1UTH A;  1XT8 A;  2PFZ A;  1SDX A;  3OO6 A;  4GWU A;  5IAI A;  3R6U A;  2GRV A;  5IZZ A;  2ZNU A;  3PPR A;  1HSL A;  3FV2 A;  1DPE A;  1PBP A;  1N7X A;  2ZYO A;  2WYK A;  5I58 A;  4MNC A;  3PV0 E;  2DXR A;  3IL1 B;  4K3F A;  1EYJ A;  4P1E A;  3TTL A;  4H8I A;  2ZXT A;  1NV0 A;  3N6U A;  4LN5 A;  4PFT A;  1NV1 A;  4KYD A;  3Q25 A;  1FQE A;  1PEB A;  3DEL B;  1B5H A;  4NWD A;  2ONR A;  4U4X A;  3UIF A;  4XKP A;  2F97 A;  2WEF A;  3DM0 A;  3CFL A;  1FPL A;  1NNF A;  2XXR A;  5HM4 B;  4LA9 A;  2DVC A;  3FVG A;  2O7I A;  4OFL A;  5H8F A;  5DEX A;  3B8B A;  4YMB A;  3S9M C;  4P0G A;  4F1U A;  1I6B A;  1UTH B;  3I6V A;  2XX9 A;  1MS7 A;  5AA1 A;  2ZYN A;  3C32 A;  4ELR A;  2I49 A;  4PBQ A;  4AB6 A;  4PE5 B;  3K02 A;  4ISU A;  2R71 A;  3AXF A;  2O7U A;  2FHY A;  2O1L A;  2H5Y A;  1Y1Z A;  5I56 A;  4P8B A;  4H5F A;  2RC8 A;  3MW0 A;  1FPI A;  4OES A;  2XWO A;  3OO8 A;  4X1D A;  3UK4 A;  4I40 A;  2P3N A;  1FTJ A;  1B7H A;  2RKM A;  5I84 A;  4MBP A;  1R9Q A;  3UN6 A;  3USD A;  3RPW A;  1N84 A;  4DLD A;  2H4I A;  4X8R A;  2WYP A;  1AH5 A;  1SQY A;  1R9L A;  4ZED A;  4M1V A;  1EZP A;  1JQF A;  3JYR A;  4OWD A;  4NE4 A;  1YXI A;  2Q88 A;  4OVQ A;  2OK2 A;  3KN3 A;  3N6T A;  2VD2 A;  5I2N B;  1O63 A;  4DZ1 A;  2OX3 A;  5A5X B;  1NL5 A;  1XS5 A;  2DXY A;  1QKA A;  1FPD A;  3PPQ A;  3SEY A;  4Q30 B;  4PFB A;  1NV5 A;  4MF3 A;  3S2V A;  3MP8 A;  4G68 A;  1H3D A;  4EDP A;  1D3K A;  4KD5 A;  2XHD A;  2Y7W A;  4EXK A;  4JDF A;  3LC8 A;  1H43 A;  5TP9 B;  4I3E A;  1XI6 A;  1O64 A;  1MPD A;  3KSJ A;  3EN3 A;  1MXZ A;  1YZ0 A;  2ZZV A;  3MUQ A;  4XEQ A;  1JVX A;  4YKI A;  3IO4 A;  4ELP A;  2Z8F A;  3C4M A;  1FBD A;  1UQW A;  1FQC A;  1MG1 A;  2XXW A;  3K6W A;  4G4P A;  5TPA A;  4Z7E A;  2REG A;  5H8N A;  3SEX A;  3KJ7 A;  2UVH A;  3LSX A;  1SI0 A;  2REJ A;  3K2D A;  5TPA B;  1NUW A;  1NV4 A;  1NUX A;  1B05 A;  1FTL A;  4OVR A;  4C1T A;  4FIM A;  1B3G A;  1USY H;  4GF8 A;  4LQ5 A;  3TAJ A;  3O6G A;  2P0S A;  4PET A;  4OFJ A;  3LV0 A;  4OXV A; 
#chains in the Genus database with same CATH homology
 5LTC A;  4NN3 A;  2QFL A;  3IFA A;  5IZ1 A;  1EYJ A;  1CNQ A;  3BIG A;  2CEY A;  4YIC A;  3MST A;  4OVS A;  1K9Z A;  1DK4 A;  4QXD A;  4P1E A;  2F5X A;  3RPL B;  4O8M A;  5ESY A;  2OX3 A;  1RDY A;  2DDK A;  4PCD A;  1FBC A;  1FSA A;  3RYD A;  1FBF A;  2ZZW A;  3D1R A;  4N17 A;  2HPG A;  4G61 A;  4PAI A;  4PGN A;  4PE3 A;  4MX6 A;  1NV0 A;  5IZ3 B;  4LN5 A;  2VPO A;  1Q9D A;  1K9Y A;  2DE3 A;  2XWI A;  2V4C A;  4N15 A;  4NHB A;  1NV1 A;  1FPD A;  4IR8 A;  5I5P A;  3U65 A;  1IMC A;  4NQ8 A;  1RDZ A;  4OVT A;  5LDZ A;  1LBY A;  4PAK A;  4PFB A;  2F3D A;  5JK4 A;  1D9Q A;  2CZI A;  4KXP A;  1NUZ A;  3E78 A;  4PC9 A;  3IFC A;  1NV6 A;  1NV5 A;  5I3S A;  2Q8M A;  1FJ6 A;  2B4L A;  3EKI A;  4P47 A;  1AWB A;  2HHM A;  2XWK A;  2HZK A;  5IM2 A;  4GWY A;  4MIJ A;  4X04 A;  1KZ8 A;  2WEF A;  5ET5 A;  3E79 A;  1FPE A;  5F24 A;  4GX4 A;  3NOH A;  3W9W A;  1FPL A;  1FPG A;  5EYH A;  2PFY A;  5EQ8 A;  3SZP A;  2VPN A;  4X9T A;  1FJ9 A;  3B8B A;  5EQA A;  2ZZX A;  3T1B A;  4GWS A;  2R8T A;  2B4M A;  1FBH A;  2QVR A;  1KA1 A;  4N91 A;  2XWV A;  2L5V A;  4PFR A;  1VDW A;  4HE1 A;  4MJO A;  4XFE A;  4P1L A;  4F1U A;  3LUZ A;  1FPJ A;  2FBP A;  2XXK A;  3A29 A;  5IGA A;  3FXB A;  1FPK A;  3QMF A;  1DCU A;  2F3B A;  4N6D A;  5FBP A;  4NGU A;  2HXR A;  2Y5K A;  3B50 A;  4NF0 A;  4DI4 B;  4O94 A;  5I7I A;  4I3E A;  4FBP A;  1XI6 A;  1FRP A;  4H45 A;  4GBV A;  4MEV A;  1G0H A;  4QBA A;  1IME A;  2CZK A;  4NAP A;  2Y5L A;  1YZ0 A;  2QVV A;  1NUY A;  2ZZV A;  4PBQ A;  4XEQ A;  4HCW A;  4MMP A;  1NV7 A;  4GBW A;  4HE2 A;  5A5L A;  3FBP A;  4P3L A;  1FBD A;  1BK4 A;  1FTA A;  2GQ1 A;  1LEV A;  4N81 A;  2BJI A;  1EYK A;  4O7I A;  2V3Q A;  4MHF A;  4HE0 A;  4F19 A;  1FBG A;  2FHY A;  2OWZ A;  5T3J A;  4N6K A;  3KBZ A;  4PBH A;  4N8Y A;  4YZZ A;  3T0J A;  4MNI A;  4XF5 A;  1FPB A;  2CZH A;  1G0I A;  4N8G A;  4P8B A;  1RDX A;  2MKZ A;  3CHG A;  2PCR A;  1KA0 A;  1LBV A;  1FPI A;  4HXV A;  1IMB A;  1IMA A;  5J1D A;  1EYI A;  5ET8 A;  1LBX A;  3BIH A;  2JJK A;  4AS4 A;  2PFZ A;  2XWO A;  4GWU A;  1IMF A;  1FPF A;  3RPL A;  4P9K A;  2P3V A;  1NV3 A;  1QGX A;  1JP4 A;  4I40 A;  2QPQ A;  5DW8 A;  2P3N A;  2WBB A;  4O7M A;  4H46 A;  4OAN A;  5IZ3 A;  3HFU A;  4PAF A;  5CM6 A;  1IMD A;  4PDD A;  2WX9 A;  4JVD A;  4PF6 A;  1NUW A;  2VT5 A;  2FIE A;  2FVZ A;  1NV4 A;  1NUX A;  3KC1 A;  1LBZ A;  4HCY A;  4NX1 A;  4PFI A;  4GX3 A;  4MAG A;  1FBP A;  5J16 A;  4PGP A;  2FIX A;  2XA5 A;  5EYG A;  2HZL A;  4OVR A;  1FBE A;  3ROJ A;  1NI9 A;  2WYP A;  4P56 A;  4GWW A;  4X8R A;  5EQ9 A;  4PTK A;  2DE4 A;  4JVI A;  4F1V A;  5IZZ A;  5EQ7 A;  5ET6 A;  4OA4 A;  4PF8 A;  4F18 A;  2CEX A;  3ISP A;  2DVZ A;  2Q74 A;  3GYY A;  4M1V A;  2Q9T A;  3KC0 A;  4GX6 A;  2DE2 A;  1NV2 A;  4NG7 A;  4OVQ A;  3MYU A;  2QVU A;  4I3Y A;  1SPI A;  4AS5 A;  2WBD A;  1YXI A;  1YYZ A;  4N4U A;  4PET A;  3PTY A;  3W9V A;  4JVC A;  4GWZ A;  3LV0 A;  4PDH A;  2WYK A;  4DI3 D;  4MNC A;  4MCO A;  4UAB A;  2KQZ A;  1INP A;  5ET7 A;  2KR0 A;  4MNP A;  4GWX A;  1DBZ A;  4OVP A;  1LBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...