5LDZA

Quadruple space group ambiguity due to rotational and translational non-crystallographic symmetry in human liver fructose-1,6-bisphosphatase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
311
Chain Sequence
PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Quadruple space-group ambiguity owing to rotational and translational noncrystallographic symmetry in human liver fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 311
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5ldzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ldzA02
1DK4A 5EQAA 1SPIA 1INPA 1DCUA 2Q74A 4GWUA 2FHYA 3KBZA 2WBBA 3RPLB 4GBWA 1FBDA 1NV7A 1FRPA 4GWYA 1NI9A 1G0IA 1KA1A 2R8TA 1AWBA 5I3SA 3B8BA 3RYDA 1YYZA 5T3JA 1FPBA 1K9ZA 3LUZA 2FIXA 2JJKA 1NV6A 4GWZA 1FPEA 4G61A 1DBZA 1FJ9A 1FPKA 1BK4A 1FPFA 4HE0A 4PTKA 3T0JA 3LV0A 1FPIA 1NV2A 2OX3A 5DW8A 5IZ3B 1NUXA 5ET8A 3RPLA 4H46A 5A5LA 2CZIA 1NUZA 2FVZA 1NV3A 4GX3A 4HXVA 1IMEA 1JP4A 1VDWA 1NUYA 3A29A 3KC0A 1CNQA 1NV1A 3IFCA 1FBPA 1LEVA 4GWSA 4I40A 2P3NA 1FBEA 2F3DA 2CZKA 1NV4A 2FIEA 1FBGA 1RDZA 1FBFA 2QVUA 5IZ3A 1Q9DA 2OWZA 2VT5A 4FBPA 1RDXA 1IMFA 2QVRA 3KC1A 1D9QA 3ROJA 5FBPA 2PCRA 2QVVA 5EYGA 3BIHA 4IR8A 2DDKA 1LBYA 4HE2A 4I3EA 1IMBA 2Q8MA 3BIGA 1XI6A 2HHMA 4GWWA 2BJIA 1IMCA 1FJ6A 1FPJA 4I3YA 1EYJA 4H45A 5IZ1A 1K9YA 1NUWA 1KZ8A 2FBPA 5ET7A 4HE1A 1RDYA 1FPDA 1G0HA 1FBHA 4O7IA 5ESYA 4GX6A 1QGXA 4AS5A 4N81A 1YZ0A 1YXIA 5EQ8A 3IFAA 2WEFA 1NV5A 3QMFA 4KXPA 5EQ7A 1NV0A 2CZHA 1EYIA 2WBDA 5EQ9A 2P3VA 5ET5A 4AS4A 2Y5KA 1FPGA 5F24A 1KA0A 3D1RA 4GWXA 5LDZA 1LBWA 5ET6A 1LBXA 1FTAA 2GQ1A 4GBVA 1LBZA 1LBVA 4GX4A 1EYKA 5EYHA 5J16A 1FPLA 2Y5LA 1IMDA 1IMAA 3FBPA 1FBCA 2QFLA 4QXDA 2F3BA 4MJOA 1FSAA
chains in the Genus database with same CATH superfamily
1B0LA 4X48A 2UVIA 2E0SA 1QKAA 4YB7A 1MY2A 3C32A 4JB7A 5BUUA 5CBSA 1K9ZA 1HSLA 2JJKA 4EQBA 3BFUA 1NV6A 2CMOA 2F6GA 4TLMB 1QUJA 1IXGA 2RKMA 1M5FA 3FV2A 1N3WA 3MSTA 1B3GA 1DTZA 2VD2A 4K3FA 1XS5A 4G68B 2FA7A 2OK2A 2XWOA 2XWKA 5IZZA 4MF3A 3KSXA 4ELOA 1LCFA 3S9NC 1UTBA 2XD2A 1Y1MA 3E13X 2V3TA 4I3EA 3O9PA 4C1TA 1PBPA 3FD3A 2XWIA 2WYPA 4NF5A 3VXCA 1A40A 2X7PA 2OJTA 1LAGE 4DXUA 3GZGA 4L17A 4OETA 1A8EA 3MVXA 3CHGA 1FPDA 1CE2A 2AL4A 4LZ5A 2UYFA 2WBDA 3A09A 3B7DA 3MPKA 4F3PA 4N13A 3IB0A 1DPEA 3SEYA 5B7DA 5F24A 1KA0A 5DEXB 1GVCA 1FTAA 2QMXA 2KLFA 1FTKA 4RNSA 4N91A 4TOZA 2PFYA 5I57A 4DI4B 2Y5LA 4G77A 4MJOA 4MNIA 2H9BA 5TP9A 5I7IA 2BJJX 1B5HA 1MDQA 3HFUA 1DOTA 1FQDA 2QMWA 5IM2A 2NOOA 3JV9A 4X1DA 4WKMA 4QFKA 4RXLA 4O7MA 3T0JA 1SDXA 1FPFA 1LBBA 2XX8A 4JVCA 5ISUA 2OX3A 3OSQA 2Q2CA 3HPIA 3IX1A 3TAJA 5LOMA 1M5BA 1MY0A 2MKZA 4OEUA 5IKBA 4FIMA 4PDDA 4KYSA 3R7XA 3T96B 3UIFA 3G3IA 3S9MC 4Q8RA 2F3DA 4JBZA 4BDNA 4XEQA 4PFYA 3KFMA 4DZ1A 2PVUA 4R73A 2DVCA 3IOTA 3QUFA 2Q8MA 2AL5A 1NNFA 3KBRA 4U4XA 3PPNA 1I6QA 2HHMA 4XKNA 2ZYMA 4R2BA 4F29A 5AA3A 3QYTA 1B40A 2VD3A 2A5SA 5F1QA 1N76A 5I59A 2FBPA 5H8QA 1RDYA 1OVTA 4MX6A 1B1HA 2RCAA 1IQ7A 3LSWA 3VFJA 3UA8A 2V4CA 1MH3A 4I62A 1GGGA 2ZNUA 4RPOA 1NFTA 1ZU0A 3S9LC 5H8NA 3SETA 3MC2A 1QW0A 3U8QA 3TQLA 1LFHA 4YAHX 4LA9A 2DOJA 3SESA 1R6ZA 4JDFA 4DDDA 1I69A 1A55A 2YPNA 4PCDA 3RPLB 2DVZA 4NX1A 1FRPA 4YMAA 1NI9A 1LFIA 2I49A 3ZKKA 3CSBA 1VFEA 1FPEA 1URDA 1NV2A 5IZ3B 1XVYA 1SYHA 2Y84A 5A5LA 5EYFA 1NV3A 4QHQA 1NH8A 4O3CA 2B3FA 1PC3A 2HAUA 3K02A 4PBQA 2ZYKA 1NNKA 1LEVA 3ZSFA 2FIEA 4IO3A 3I6VA 4OA4A 3S2VA 5I84A 1QVSA 3KC1A 5CM6A 1ELJA 2PFZA 3M3LA 1UTBB 3C9HA 3SEUA 2HXRA 4H8IA 2VHAA 3TDJA 4PFWA 1BTJA 1QUKA 3ILTB 4NF5B 4F3GA 3C33A 3H03A 1POY1 2HQ0A 3K4UA 1POTA 1OVBA 3RN8A 1QGXA 2UVHA 2QS4A 3HHGA 4ZEKA 3M8UA 4GD5A 5F7VA 2B4MA 2GFEA 1VFDA 2P3VA 2H4IA 4FEDA 3G3GA 4OHNA 4KCDA 1LBVA 1B46A 5J16A 1SQYA 3TQWA 4BDOA 2XA5A 1AOVA 4FORA 2DS9A 2FHYA 2REJA 2NWJA 1FBDA 4Q5TA 4JWOA 4IGRA 4H0WA 4EDPA 5TP9B 3RYDA 3BBRA 1DMBA 4Q0CA 3DP8A 3IJOB 5B70A 2ZZXA 5K2YA 3EHSA 3TCFA 3RQTA 3VDFA 5DTBA 3FXUA 3TTKA 2D5WA 2UVGA 3U92A 3OO6A 3HHFA 2F34A 5TPAB 1PB9A 3A3UA 2DQVA 3PUXE 2PMSA 3CRBA 5EHSA 1B7ZA 1FQAA 4PGNA 2PX1A 4OVJA 1R9LA 2QJEA 3N6TA 4OQOA 3IK6B 4PF8A 1PEBA 4P3LA 3I3VA 5L9SA 3FVNA 3FVOA 4ZEIA 1ZKBA 1SD3A 3IORA 1H43A 5H8SA 1B3LA 5CI5A 4F39A 2XXIA 4DXBA 3T9UA 1G0HA 4P47A 4R2FA 4ZECA 5I59B 1YXIA 4XKQA 3MP8A 1B7HA 2B65A 4P56A 3IB1A 3S9EA 5L8DA 4YMBA 2F78A 4GWXA 5ET6A 5KCJB 3PMXA 4MFIA 4IB2A 3K01A 4IO7A 2XXKA 4GOTA 1IMDA 2X7QA 1NMUA 2Q89A 1INPA 4ZE9A 1DCUA 5DEXA 4GWUA 4POWA 4OVQA 4O94A 1AWBA 1MXUA 3IJXB 1Z7ME 1SW2A 3LUZA 2FIXA 5CC2A 3PUYE 4IO5A 1FPKA 1OQHA 1SBPA 3WAEA 1NUXA 4XF5A 3H4ZA 1NUZA 2ZYNA 5EHMA 4F1UA 4JWXA 4GIZA 4NTLA 1FW0A 2DWJA 1CNQA 4BDRA 4QBAA 1FQCA 2W7YA 3IFCA 4GWSA 1M5EA 5L9MA 3CI8A 1FBGA 4RK2A 2OLBA 2OWTA 1A54A 1JVXA 4HTGA 3MVWA 2F7BA 3IOUA 3PPQA 4F22A 5EYGA 1MY3A 3K00A 2E1SA 1SW4A 1NH7A 1Z7NE 4KPTA 3SDFA 4N6DA 4NE4A 1SW5A 2PT2A 5ET7A 4QSCA 5ESYA 2OPDA 2LAOA 3SEXA 2WEFA 3TZAA 3K0VA 4FEBA 3TMGA 1NV0A 2HXWA 1EH3A 2QS3A 2O1MA 3CIJA 2XXTA 1YAEA 3T1BA 4GBVA 3K1PA 1MY4A 3KEIA 4MIJA 3FBPA 2O51A 5KDTA 3PPOA 1WDNA 4E0WA 1MM6A 3IOVA 4YICA 1B51A 3K6VA 1NV7A 3T22A 4JVDA 1A7LA 2QRYA 3B8BA 1PDAA 4GWZA 3RGYA 5DVFA 5DW8A 4NF8B 3RPLA 2ONSA 1B1XA 3PPRA 5ICTA 1US4A 5CMMA 2QL3A 2Y7IA 3EN3A 3C34A 5AA2D 4OVPA 1Y9UA 1MDP1 1NL5A 4WEDA 5CMCA 1ZTYA 2M8CA 4R74A 1EU8A 4THIA 5IZ3A 3PMWA 4KHZE 3N5LA 3ROJA 1GTKA 4BLAA 3C4MA 4KI0E 1Y3NA 4NQ8A 5I56A 2NUVA 4UACA 5H8FA 3H6UA 3FXBA 2OCUA 3MPLA 3KOTA 4I3YA 4ZZAA 3FATA 5A5XB 1USYH 4DIGA 2HFBA 4PE3A 4AS5A 2F97A 3KJ7A 3ONMA 4DE8A 2O1LA 3H3GA 4KR5A 3TYHA 3DM0A 4U2RA 3WAFA 1JQFA 3TTLA 3EHTA 2H98A 1PB8A 2KQZA 1KWHA 2ZYOA 4EQ9A 3V83A 1EYKA 5EYHA 5AA4A 3CR9A 5JK4A 1FPLA 1SYIA 4XKRA 3MUQA 2V3QA 1OLCA 4LATA 1ZIUA 2FNCA 3GXAA 3PV0E 4XTCQ 5CMKA 4OEVA 3V5AA 3H7MA 1FJ9A 5CRYA 4PTKA 3LV0A 4OMBA 1M5CA 3T66A 1NUYA 4R72A 1B4ZA 3TTRA 2PT1A 1H44A 3RY3A 1RDZA 2QVUA 2UVJA 5TPAA 3TTNA 3H6VA 4U4SA 1B05A 2PCRA 1J1NA 4RYAA 2DDKA 4HE2A 1P1QA 3TFLA 4H5FA 2DE2A 1OIBA 1LLSA 2P2AA 2HCAA 3KN8A 1EYJA 1AMFA 1TWYA 4IO2A 4MLVA 4PAIA 1TT1A 4FECA 2R6GE 4QFNA 1YZ0A 3Q28A 3IO6A 4KFQA 2OBGA 4DXCA 4KYDA 1USYE 3KGCA 2XXXA 2OPEA 3VE1B 3D1RA 3W15C 2I6EA 4PDHA 1FCKA 2OWSA 2I48A 1RYOA 1UTHA 4G8MA 3U72A 3O6GA 2XX9A 1N0TA 3THIA 1S50A 4HCWA 1SPIA 5KDTB 4OTEA 5KCJA 5DT6A 4YB6A 3GYYA 1KA1A 4OFJA 1D9YA 1HSEA 1T0KA 1LCTA 5CBRA 3U94A 5DVIA 2V3UA 3F11A 4RY1A 3HV1A 2FVZA 5AA1A 1IMEA 4O8MA 2ZMBA 4MAGA 3O97A 2ESNA 4RK9A 2RF1A 5IGAA 4XIGQ 5LTCA 2CZKA 3NOHA 1URGA 3SZPA 3G3KA 1MQGA 2VT5A 1PB7A 1LAXA 3GBAA 1B3FA 5JEIA 1MXWA 4X04A 3O29A 3PUZE 4WEPA 2HEUA 4GWWA 3FJMA 5I56B 1MQDA 5H8FB 2D3IA 4RJZA 4RPNA 5IZ1A 1YTVA 3LSFB 2CEYA 2DE3A 4OWDA 4NF4B 4HE1A 5K2XA 1D3KA 4U1ZA 4N81A 4OANA 5EQ8A 2UYEA 2XXQA 3FASA 3TELA 3QMFA 5KZTA 4PFUA 1OQGA 2DWIA 1DTGA 3I5OA 4FATA 1EZ9A 1B52A 4GWOA 4R75A 5ICQA 4OVSA 4TLLB 3LSXA 3LUYA 2G93A 4JWYA 3ECRA 3Q25A 2CEXA 4ELRA 5FHOA 1Q35A 4PFBA 1DSNA 4JVIA 5AA4B 1SVXB 3MP6A 1MPDA 1R1NA 3KBZA 2WBBA 3R26A 2H25A 2O7UA 2KR0A 2R9JA 2DXYA 4NF6A 1B5IA 5T3JA 1BKAA 2Y7PA 4G8HA 4BDLA 1BK4A 1FPIA 5ET8A 4H46A 3RT6B 1NKXA 1IXIA 4OESA 1JP4A 2RC7A 3E79A 1QKBA 2H5YA 2XXUA 5JTYB 4GFRA 4EXKA 3QUJA 3E78A 1NV4A 3VV5A 4AB5A 4NF8A 4BDMA 4EUOA 4ESXA 2F6PA 4PAFA 4U21A 2Q2AA 1XI6A 4MEVA 3HCQA 4PGPA 1B58A 1QULA 5FTHA 3Q27A 2WKYA 4JSOA 1MQJA 1KZ8A 1JVYA 4GF8A 4QSDA 3LSLA 1L5TA 1MXZA 4C0RA 2AIXA 3IFAA 4HS7A 3IL1B 1P1UA 4N17A 5FTIA 5A5XA 3ILUB 3QSLA 4XKPA 3PMVA 4YU0A 4G68C 2PBWA 1VE4A 4MNPA 1JNFA 4YKIA 1FBCA 2RCBA 5FHNA 1UTHB 3C36A 1D4NA 1WODA 4JXIA 4LONB 4E0XA 2DWAA 4YB5A 1QJMA 3UP9A 4LZ7A 3Q26A 1PBQA 1TXFA 2THIA 1IUDA 5HBCA 4NHBA 4P9KA 4LQ2A 3TKDA 4MLQA 1B2HA 2CZIA 3N94A 3OD7A 1WVJA 3KZGA 3PPPA 1BP5A 3A29A 3OO9A 3HO7A 3MZ1A 2V25A 4EXLA 5AA2A 1AH5A 2CZLA 4QFPA 3C31A 1Q9DA 1B3HA 4MCOA 1RDXA 3B6WA 4N8YA 4C1UA 2RC9A 2XHDA 2XX7A 1QUIA 1IIWA 2VPOA 4OYVA 2B4LA 3MVYA 4EF2A 3FGSA 3OO7A 1D9VA 2R71A 1DPPA 5EQ9A 1OLAA 3AXFA 5M2VA 2ZNSA 4X9TA 2L5VA 3PU5A 4ZE8A 5LDZA 1FTLA 1UIUA 2VGQA 1NNPA 1FQBA 1SI1A 2FYIA 3VXBA 2Y7KA 2F8DA 2ANJA 3LR1A 2I0CA 1DK4A 5EQAA 1B6HA 3KSJA 2DWHA 4GBWA 2XXRA 5J1DA 3QIMA 5L9OA 4F3SA 1G0IA 4I8CA 2R8TA 4WXJA 4U1OA 4BDQA 4DCXA 3JYRA 3K6XA 4NF6B 4HE0A 1O64A 3VLUA 4OERA 1MH4A 4HXVA 4NEDA 4AQ4A 3CFLA 2O6AA 3LBSA 4N6PA 4Q30B 3DP4A 3E4RA 4QF9A 3O2AA 2F5XA 2WX9A 4ISUA 1GR2A 1D9QA 4ECFA 3FVGA 4H1XA 4GRKA 5I58B 4ZDMA 3ODBA 3VLVA 1IXCA 4PP0A 3C35A 3M3KA 1AL3A 2PYYA 5DYHA 1B9JA 4MMPA 3IAZA 1K9YA 4N6KA 2Q88A 2F35A 4R6YA 1RKMA 2DSFA 3FVKA 3H6TA 3MJNA 3QAXA 1NV5A 1MPBA 2IEEA 1EYIA 4ELQA 2XXPA 2VOZA 1H76A 1O7TA 3K2DA 3L6GA 3MVZA 4PFTA 4NF4A 1FPGA 4QSEA 5BWJA 2ZZWA 1LB9A 4UABA 5HM4B 3IOWA 4X8RA 3B6TA 4ZS9A 4QRZA 3IO4A 2XD3A 1FQFA 1Y4CA 4EQ7A 2QPQA 1FSAA 2G29A 4PE5B 2XXYA 1IXHA 2XWVA 3B6QA 3RTFB 4NWCA 4ONYA 1YYZA 2NVUB 1FPBA 2YJPA 3CFXA 2ONKE 4G61A 1DBZA 3OEMA 3PUWE 3MWBA 3MZ9A 4EF1A 1JEVA 4YKKA 4GX3A 4IGTA 3TPAA 4YKJA 4H67A 4NMYA 3CFZA 2YLNA 3GBBA 3CSGA 3KC0A 1MPCA 4I40A 4N4UA 3PD9A 4R9FA 3K6WA 3N26A 1Y3PA 4ESWA 1IEJA 1XHYA 3ZKLA 4H6DA 5CMBA 1O63A 3FJ7A 5AE4A 1IMFA 5AA2B 4KYEA 1XT8A 1MQHA 4M4GA 4NAPA 1R9QA 3HSTA 2F7CA 1MRPA 1MG1A 4M1VA 4OVTA 5JTYA 3RT8A 2F7AA 2BJIA 1IMCA 3T9VA 1F9BA 2HZLA 2RINA 2O7IA 3UORA 3D4CA 1LSTA 3PTYA 3O66A 1YPNA 1MS7A 3MQ9A 1BLFA 1A8FA 2CZHA 3B50A 3H6WA 5ET5A 2QS1A 5IAIA 1MQIA 3IR1A 4PFRA 3T9HB 4MHFA 4P0IA 3MW0A 3KOSA 3P7IA 2P1SA 4XXUA 1B4HA 3DP6A 2OZZA 4X1BA 2I4CA 5I2KA 1II5A 4R6KA 1XOCA 4PQJA 3TUSA 2GRVA 3QK6A 1JW4A 4P11A 3CG1A 4H5GA 4U23A 3BFTA 2P0SA 1Y4TA 3S4UA 1M5DA 4RA1A 4OXVA 2RC8A 1P1WA 1ZMGA 5H8HB 4GVOA 4MBPA 2QS2A 4IO6A 4DLDA 3TTMA 3KN3A 4UA8A 3U93A 4Z7EA 4HW8A 1LAFE 3FXQA 3RLFE 3FXRA 4FAJA 1Y20A 4NN3A 1N7WA 1N3XA 2Y7WA 1XC1A 3FUZA 2NXOA 1S7YA 3KG2A 1VR5A 1N7XA 4P1EA 5DVJA 1FBPA 2P3NA 2O84X 2DYXA 1US5A 1FBEA 1B7UA 4MH5A 4ZZEA 1FBFA 3G3JA 4FBPA 2QVRA 1ZJLA 2Y7RA 3RNNA 4IR8A 3TCGA 3TEPA 2Q9TA 3HN0A 4F3BA 3BIGA 2DP8A 4OENA 2Z8EA 3U65A 3Q29A 2AYSA 4F19A 4I9DA 1NUWA 4NWDA 4PC9A 3QXMA 3DELB 4FE8A 3T9XB 1LB8A 3D4GA 4AS4A 4QFOA 2F36A 3PGFA 2Q8JA 2Y5KA 3V8XB 2HZKA 3K1MA 2GH9A 2Z8FA 1SI0A 5I2NA 3EQ1A 2O69A 2V84A 2QFLA 2D21A 4QXDA 4F18A 2V93A 3EHUA 2Q74A 2REGA 1AIVA 4JSDA 1OMPA 3EF7A 3U1OA 5ITPA 4MNCA 3EPEA 4N07A 1B3EA 4GLIA 1CB6A 1URSA 3OENA 2DXRA 3VVDA 4ZEBA 3FIRA 4H8JA 1H3DA 2A5TA 1UIVA 1MY1A 3JZJA 4YKPA 4N15A 1MXXA 2WYKA 2XXVA 3PUVE 2OWZA 3OSRA 2QVVA 3BIHA 4KD5A 1MXVA 1LFGA 2XXHA 2ALUA 3KJTA 4HCYA 4ZEDA 1LAHE 2ZNTA 3N6UA 4OZ9A 1LBCA 1RYXA 3FV1A 4FJPA 1N04A 2I4BA 3OXNA 5I58A 4KQPA 3UN6A 4O7IA 4DI3D 3MP1A 4PAKA 3R6UA 2I3VA 2Z23A 3O6HA 5I57B 1N84A 2ABHA 1B32A 1BIYA 2ONRA 1P1NA 4LQ5A 1XVXA 2GQ1A 4O3BA 1LBZA 4ZEFA 4R6HA 3E3KA 3MAMA 3USDA 1P1OA 1LGBC 3W9VA 4I1DA 2X26A 1H45A 4G2ZA 5I2KB 3OO8A 2B3BA 3G7WA 1VSOA 3K6UA 1B5JA 3KN7A 1I6BA 4H65A 3T93B 4NF0A 4IY6A 5ITOA 2Z8DA 4OFLA 1MM7A 3OEKA 3TCHA 2HPGA 4G68A 4O3AA 2GHAA 2Z22A 1TFAA 3ZS6A 3OELA 3MYUA 2I58A 1FQEA 4P8BA 4AB6A 3PD8A 2IA4A 3RPWA 4LUBA 4LZ8A 3E9XA 1SW1A 1IZ1A 5H8QB 1FTJA 4GL8A 1IMBA 4F2OA 1Q1KA 4G4PA 5TU0A 3OOAA 1JW1A 3MBPA 4N8GA 4GQOA 4F1VA 3UGWA 1FPJA 4XFEA 1IITA 4ELPA 5H8NB 3VVFA 1ANFA 2H99A 3M3FA 3O6IA 1NNTA 4ND9A 2ZZVA 1ZLQA 1FBHA 1UQWA 4GX6A 1A99A 4Z0IA 3DLNA 4POXA 1Y1ZA 4KXPA 4IO4A 1FTMA 2VP1A 4PETA 2I3WA 2XXWA 4F1YA 3IB2A 3GLBA 2HAVA 1LBWA 1LBXA 3SERA 3G3HA 4KCCA 3O28A 3K1NA 4TQUQ 1I6AA 4PFIA 1ATGA 1IMAA 1JW5A 3MZBA 5I2NB 4PF6A 2VPNA 3CG3A 2UXAA 1EZOA 4GWYA 4GXSB 1JEUA 4F31B 5I3SA 4DCYA 1YCJA 5FHMA 4LP2B 4IY5A 4OFOA 4QFLA 4U22A 4GL0A 5H8HA 1Y3QA 3SKPA 1VDWA 3FZVA 2I0BA 1EZPA 3RTWB 3V89B 1NV1A 3FJGA 2A5TB 4P0GA 3L6HA 4LN5A 1B0HA 2ZXTA 2O68A 1GV8A 1TFDA 3SEVA 5FBPA 4GXAA 3OMBA 3W9WA 1LBYA 2GHBA 3G3FA 1HSJA 3RUMA 1FJ6A 4OVRA 1P99A 4H45A 4R9GA 2DE4A 1FTOA 3EKIA 4NGUA 4YZZA 2QSXA 4P1LA 1MXYA 5EQ7A 4G8NA 3VVEA 5ELVA 1JETA 1ZBMA 4LVQA 3VLWA 1S9TA 5HPQA 3TODA 3UK4A 3A3CA 4GX4A 4F2QA 3SEWA 3CVGA 3H06B 4NG7A 2F3BA 3LC8A 5I5PA 4PBHA 3ISPA 3BKIB
chains in the Genus database with same CATH topology
1INPA 1DCUA 4GWUA 3KBZA 2WBBA 2KR0A 4OVQA 4O94A 1AWBA 5T3JA 1K9ZA 3LUZA 2FIXA 2JJKA 1NV6A 1FPKA 1BK4A 1FPIA 1NUXA 5ET8A 4NN3A 3MSTA 4XF5A 4H46A 1NUZA 4F1UA 1JP4A 3E79A 1CNQA 4P1EA 4QBAA 3IFCA 1FBPA 4GWSA 2P3NA 2XWOA 2XWKA 3E78A 1FBEA 5IZZA 1NV4A 1FBGA 1FBFA 4FBPA 2QVRA 5EYGA 4PAFA 4IR8A 4I3EA 2XWIA 2Q9TA 3BIGA 1XI6A 2WYPA 4MEVA 3U65A 4PGPA 4N6DA 4F19A 1NUWA 1KZ8A 5ET7A 4PC9A 3CHGA 1FPDA 5ESYA 3IFAA 2WEFA 1NV0A 4N17A 2WBDA 4AS4A 2Y5KA 5F24A 1KA0A 2HZKA 3T1BA 1FTAA 4GBVA 4N91A 4MNPA 2PFYA 4DI4B 2Y5LA 4MIJA 3FBPA 1FBCA 2QFLA 4QXDA 4MJOA 4MNIA 4F18A 4YICA 5I7IA 2Q74A 3HFUA 1NV7A 4JVDA 5IM2A 3B8BA 4MNCA 4GWZA 4O7MA 3T0JA 1FPFA 4JVCA 2OX3A 5DW8A 4NHBA 4P9KA 3RPLA 2CZIA 2MKZA 4PDDA 3A29A 4OVPA 2F3DA 4XEQA 5IZ3A 4N15A 2WYKA 1Q9DA 2OWZA 4MCOA 1RDXA 3ROJA 2QVVA 3BIHA 4N8YA 4NQ8A 2Q8MA 4HCYA 2HHMA 3FXBA 2VPOA 2B4LA 4I3YA 2FBPA 1RDYA 4PE3A 4MX6A 4O7IA 4AS5A 4DI3D 4PAKA 2V4CA 5EQ9A 4X9TA 2L5VA 5LDZA 2GQ1A 1LBZA 2KQZA 1EYKA 5EYHA 3W9VA 5JK4A 1FPLA 1DK4A 5EQAA 2V3QA 4PCDA 3RPLB 2DVZA 4GBWA 4NX1A 1FRPA 5J1DA 1NI9A 1G0IA 2R8TA 4NF0A 1FPEA 4HE0A 1FJ9A 4PTKA 3LV0A 1NV2A 5IZ3B 2HPGA 5A5LA 1NV3A 4HXVA 3MYUA 1NUYA 4P8BA 4PBQA 1LEVA 2FIEA 1RDZA 2QVUA 4OA4A 2F5XA 2WX9A 3KC1A 5CM6A 1D9QA 2PCRA 2DDKA 2PFZA 4HE2A 1IMBA 2HXRA 2DE2A 4N8GA 4F1VA 1FPJA 4XFEA 1EYJA 4MMPA 1K9YA 4N6KA 4PAIA 2ZZVA 1FBHA 4GX6A 1QGXA 1YZ0A 1NV5A 4KXPA 2B4MA 1EYIA 2P3VA 4PETA 1FPGA 3D1RA 4PDHA 1LBWA 1LBXA 2ZZWA 1LBVA 4UABA 5J16A 4PFIA 4X8RA 1IMAA 2XA5A 2QPQA 1FSAA 4HCWA 1SPIA 2XWVA 4PF6A 2VPNA 2FHYA 1FBDA 3GYYA 4GWYA 1KA1A 5I3SA 3RYDA 1YYZA 1FPBA 2ZZXA 4G61A 1DBZA 4GX3A 2FVZA 1IMEA 4O8MA 1VDWA 3KC0A 4MAGA 1NV1A 4I40A 4N4UA 5IGAA 5LTCA 2CZKA 3NOHA 4PGNA 4LN5A 3SZPA 2VT5A 4PF8A 1IMFA 5FBPA 4P3LA 4NAPA 3W9WA 1LBYA 4M1VA 4OVTA 4X04A 4GWWA 2BJIA 1IMCA 1FJ6A 4OVRA 4H45A 2HZLA 5IZ1A 2CEYA 2DE4A 2DE3A 4HE1A 3EKIA 4NGUA 4P47A 1G0HA 3PTYA 4N81A 4OANA 4YZZA 4P1LA 1YXIA 5EQ8A 3QMFA 4P56A 5EQ7A 2CZHA 3B50A 5ET5A 4PFRA 4MHFA 4GWXA 5ET6A 4OVSA 4GX4A 2CEXA 2XXKA 1IMDA 4NG7A 2F3BA 4PFBA 4JVIA 4PBHA 5I5PA 3ISPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DK4 A;  5EQA A;  1SPI A;  1INP A;  1DCU A;  2Q74 A;  4GWU A;  2FHY A;  3KBZ A;  2WBB A;  3RPL B;  4GBW A;  1FBD A;  1NV7 A;  1FRP A;  4GWY A;  1NI9 A;  1G0I A;  1KA1 A;  2R8T A;  1AWB A;  5I3S A;  3B8B A;  3RYD A;  1YYZ A;  5T3J A;  1FPB A;  1K9Z A;  3LUZ A;  2FIX A;  2JJK A;  1NV6 A;  4GWZ A;  1FPE A;  4G61 A;  1DBZ A;  1FJ9 A;  1FPK A;  1BK4 A;  1FPF A;  4HE0 A;  4PTK A;  3T0J A;  3LV0 A;  1FPI A;  1NV2 A;  2OX3 A;  5DW8 A;  5IZ3 B;  1NUX A;  5ET8 A;  3RPL A;  4H46 A;  5A5L A;  2CZI A;  1NUZ A;  2FVZ A;  1NV3 A;  4GX3 A;  4HXV A;  1IME A;  1JP4 A;  1VDW A;  1NUY A;  3A29 A;  3KC0 A;  1CNQ A;  1NV1 A;  3IFC A;  1FBP A;  1LEV A;  4GWS A;  4I40 A;  2P3N A;  1FBE A;  2F3D A;  2CZK A;  1NV4 A;  2FIE A;  1FBG A;  1RDZ A;  1FBF A;  2QVU A;  5IZ3 A;  1Q9D A;  2OWZ A;  2VT5 A;  4FBP A;  1RDX A;  1IMF A;  2QVR A;  3KC1 A;  1D9Q A;  3ROJ A;  5FBP A;  2PCR A;  2QVV A;  5EYG A;  3BIH A;  4IR8 A;  2DDK A;  1LBY A;  4HE2 A;  4I3E A;  1IMB A;  2Q8M A;  3BIG A;  1XI6 A;  2HHM A;  4GWW A;  2BJI A;  1IMC A;  1FJ6 A;  1FPJ A;  4I3Y A;  1EYJ A;  4H45 A;  5IZ1 A;  1K9Y A;  1NUW A;  1KZ8 A;  2FBP A;  5ET7 A;  4HE1 A;  1RDY A;  1FPD A;  1G0H A;  1FBH A;  4O7I A;  5ESY A;  4GX6 A;  1QGX A;  4AS5 A;  4N81 A;  1YZ0 A;  1YXI A;  5EQ8 A;  3IFA A;  2WEF A;  1NV5 A;  3QMF A;  4KXP A;  5EQ7 A;  1NV0 A;  2CZH A;  1EYI A;  2WBD A;  5EQ9 A;  2P3V A;  5ET5 A;  4AS4 A;  2Y5K A;  1FPG A;  5F24 A;  1KA0 A;  3D1R A;  4GWX A;  5LDZ A;  1LBW A;  5ET6 A;  1LBX A;  1FTA A;  2GQ1 A;  4GBV A;  1LBZ A;  1LBV A;  4GX4 A;  1EYK A;  5EYH A;  5J16 A;  1FPL A;  2Y5L A;  1IMD A;  1IMA A;  3FBP A;  1FBC A;  2QFL A;  4QXD A;  2F3B A;  4MJO A;  1FSA A; 
#chains in the Genus database with same CATH topology
 1B0L A;  4X48 A;  2UVI A;  2E0S A;  1QKA A;  4YB7 A;  1MY2 A;  3C32 A;  4JB7 A;  5BUU A;  5CBS A;  1K9Z A;  1HSL A;  2JJK A;  4EQB A;  3BFU A;  1NV6 A;  2CMO A;  2F6G A;  4TLM B;  1QUJ A;  1IXG A;  2RKM A;  1M5F A;  3FV2 A;  1N3W A;  3MST A;  1B3G A;  1DTZ A;  2VD2 A;  4K3F A;  1XS5 A;  4G68 B;  2FA7 A;  2OK2 A;  2XWO A;  2XWK A;  5IZZ A;  4MF3 A;  3KSX A;  4ELO A;  1LCF A;  3S9N C;  1UTB A;  2XD2 A;  1Y1M A;  3E13 X;  2V3T A;  4I3E A;  3O9P A;  4C1T A;  1PBP A;  3FD3 A;  2XWI A;  2WYP A;  4NF5 A;  3VXC A;  1A40 A;  2X7P A;  2OJT A;  1LAG E;  4DXU A;  3GZG A;  4L17 A;  4OET A;  1A8E A;  3MVX A;  3CHG A;  1FPD A;  1CE2 A;  2AL4 A;  4LZ5 A;  2UYF A;  2WBD A;  3A09 A;  3B7D A;  3MPK A;  4F3P A;  4N13 A;  3IB0 A;  1DPE A;  3SEY A;  5B7D A;  5F24 A;  1KA0 A;  5DEX B;  1GVC A;  1FTA A;  2QMX A;  2KLF A;  1FTK A;  4RNS A;  4N91 A;  4TOZ A;  2PFY A;  5I57 A;  4DI4 B;  2Y5L A;  4G77 A;  4MJO A;  4MNI A;  2H9B A;  5TP9 A;  5I7I A;  2BJJ X;  1B5H A;  1MDQ A;  3HFU A;  1DOT A;  1FQD A;  2QMW A;  5IM2 A;  2NOO A;  3JV9 A;  4X1D A;  4WKM A;  4QFK A;  4RXL A;  4O7M A;  3T0J A;  1SDX A;  1FPF A;  1LBB A;  2XX8 A;  4JVC A;  5ISU A;  2OX3 A;  3OSQ A;  2Q2C A;  3HPI A;  3IX1 A;  3TAJ A;  5LOM A;  1M5B A;  1MY0 A;  2MKZ A;  4OEU A;  5IKB A;  4FIM A;  4PDD A;  4KYS A;  3R7X A;  3T96 B;  3UIF A;  3G3I A;  3S9M C;  4Q8R A;  2F3D A;  4JBZ A;  4BDN A;  4XEQ A;  4PFY A;  3KFM A;  4DZ1 A;  2PVU A;  4R73 A;  2DVC A;  3IOT A;  3QUF A;  2Q8M A;  2AL5 A;  1NNF A;  3KBR A;  4U4X A;  3PPN A;  1I6Q A;  2HHM A;  4XKN A;  2ZYM A;  4R2B A;  4F29 A;  5AA3 A;  3QYT A;  1B40 A;  2VD3 A;  2A5S A;  5F1Q A;  1N76 A;  5I59 A;  2FBP A;  5H8Q A;  1RDY A;  1OVT A;  4MX6 A;  1B1H A;  2RCA A;  1IQ7 A;  3LSW A;  3VFJ A;  3UA8 A;  2V4C A;  1MH3 A;  4I62 A;  1GGG A;  2ZNU A;  4RPO A;  1NFT A;  1ZU0 A;  3S9L C;  5H8N A;  3SET A;  3MC2 A;  1QW0 A;  3U8Q A;  3TQL A;  1LFH A;  4YAH X;  4LA9 A;  2DOJ A;  3SES A;  1R6Z A;  4JDF A;  4DDD A;  1I69 A;  1A55 A;  2YPN A;  4PCD A;  3RPL B;  2DVZ A;  4NX1 A;  1FRP A;  4YMA A;  1NI9 A;  1LFI A;  2I49 A;  3ZKK A;  3CSB A;  1VFE A;  1FPE A;  1URD A;  1NV2 A;  5IZ3 B;  1XVY A;  1SYH A;  2Y84 A;  5A5L A;  5EYF A;  1NV3 A;  4QHQ A;  1NH8 A;  4O3C A;  2B3F A;  1PC3 A;  2HAU A;  3K02 A;  4PBQ A;  2ZYK A;  1NNK A;  1LEV A;  3ZSF A;  2FIE A;  4IO3 A;  3I6V A;  4OA4 A;  3S2V A;  5I84 A;  1QVS A;  3KC1 A;  5CM6 A;  1ELJ A;  2PFZ A;  3M3L A;  1UTB B;  3C9H A;  3SEU A;  2HXR A;  4H8I A;  2VHA A;  3TDJ A;  4PFW A;  1BTJ A;  1QUK A;  3ILT B;  4NF5 B;  4F3G A;  3C33 A;  3H03 A;  1POY 1;  2HQ0 A;  3K4U A;  1POT A;  1OVB A;  3RN8 A;  1QGX A;  2UVH A;  2QS4 A;  3HHG A;  4ZEK A;  3M8U A;  4GD5 A;  5F7V A;  2B4M A;  2GFE A;  1VFD A;  2P3V A;  2H4I A;  4FED A;  3G3G A;  4OHN A;  4KCD A;  1LBV A;  1B46 A;  5J16 A;  1SQY A;  3TQW A;  4BDO A;  2XA5 A;  1AOV A;  4FOR A;  2DS9 A;  2FHY A;  2REJ A;  2NWJ A;  1FBD A;  4Q5T A;  4JWO A;  4IGR A;  4H0W A;  4EDP A;  5TP9 B;  3RYD A;  3BBR A;  1DMB A;  4Q0C A;  3DP8 A;  3IJO B;  5B70 A;  2ZZX A;  5K2Y A;  3EHS A;  3TCF A;  3RQT A;  3VDF A;  5DTB A;  3FXU A;  3TTK A;  2D5W A;  2UVG A;  3U92 A;  3OO6 A;  3HHF A;  2F34 A;  5TPA B;  1PB9 A;  3A3U A;  2DQV A;  3PUX E;  2PMS A;  3CRB A;  5EHS A;  1B7Z A;  1FQA A;  4PGN A;  2PX1 A;  4OVJ A;  1R9L A;  2QJE A;  3N6T A;  4OQO A;  3IK6 B;  4PF8 A;  1PEB A;  4P3L A;  3I3V A;  5L9S A;  3FVN A;  3FVO A;  4ZEI A;  1ZKB A;  1SD3 A;  3IOR A;  1H43 A;  5H8S A;  1B3L A;  5CI5 A;  4F39 A;  2XXI A;  4DXB A;  3T9U A;  1G0H A;  4P47 A;  4R2F A;  4ZEC A;  5I59 B;  1YXI A;  4XKQ A;  3MP8 A;  1B7H A;  2B65 A;  4P56 A;  3IB1 A;  3S9E A;  5L8D A;  4YMB A;  2F78 A;  4GWX A;  5ET6 A;  5KCJ B;  3PMX A;  4MFI A;  4IB2 A;  3K01 A;  4IO7 A;  2XXK A;  4GOT A;  1IMD A;  2X7Q A;  1NMU A;  2Q89 A;  1INP A;  4ZE9 A;  1DCU A;  5DEX A;  4GWU A;  4POW A;  4OVQ A;  4O94 A;  1AWB A;  1MXU A;  3IJX B;  1Z7M E;  1SW2 A;  3LUZ A;  2FIX A;  5CC2 A;  3PUY E;  4IO5 A;  1FPK A;  1OQH A;  1SBP A;  3WAE A;  1NUX A;  4XF5 A;  3H4Z A;  1NUZ A;  2ZYN A;  5EHM A;  4F1U A;  4JWX A;  4GIZ A;  4NTL A;  1FW0 A;  2DWJ A;  1CNQ A;  4BDR A;  4QBA A;  1FQC A;  2W7Y A;  3IFC A;  4GWS A;  1M5E A;  5L9M A;  3CI8 A;  1FBG A;  4RK2 A;  2OLB A;  2OWT A;  1A54 A;  1JVX A;  4HTG A;  3MVW A;  2F7B A;  3IOU A;  3PPQ A;  4F22 A;  5EYG A;  1MY3 A;  3K00 A;  2E1S A;  1SW4 A;  1NH7 A;  1Z7N E;  4KPT A;  3SDF A;  4N6D A;  4NE4 A;  1SW5 A;  2PT2 A;  5ET7 A;  4QSC A;  5ESY A;  2OPD A;  2LAO A;  3SEX A;  2WEF A;  3TZA A;  3K0V A;  4FEB A;  3TMG A;  1NV0 A;  2HXW A;  1EH3 A;  2QS3 A;  2O1M A;  3CIJ A;  2XXT A;  1YAE A;  3T1B A;  4GBV A;  3K1P A;  1MY4 A;  3KEI A;  4MIJ A;  3FBP A;  2O51 A;  5KDT A;  3PPO A;  1WDN A;  4E0W A;  1MM6 A;  3IOV A;  4YIC A;  1B51 A;  3K6V A;  1NV7 A;  3T22 A;  4JVD A;  1A7L A;  2QRY A;  3B8B A;  1PDA A;  4GWZ A;  3RGY A;  5DVF A;  5DW8 A;  4NF8 B;  3RPL A;  2ONS A;  1B1X A;  3PPR A;  5ICT A;  1US4 A;  5CMM A;  2QL3 A;  2Y7I A;  3EN3 A;  3C34 A;  5AA2 D;  4OVP A;  1Y9U A;  1MDP 1;  1NL5 A;  4WED A;  5CMC A;  1ZTY A;  2M8C A;  4R74 A;  1EU8 A;  4THI A;  5IZ3 A;  3PMW A;  4KHZ E;  3N5L A;  3ROJ A;  1GTK A;  4BLA A;  3C4M A;  4KI0 E;  1Y3N A;  4NQ8 A;  5I56 A;  2NUV A;  4UAC A;  5H8F A;  3H6U A;  3FXB A;  2OCU A;  3MPL A;  3KOT A;  4I3Y A;  4ZZA A;  3FAT A;  5A5X B;  1USY H;  4DIG A;  2HFB A;  4PE3 A;  4AS5 A;  2F97 A;  3KJ7 A;  3ONM A;  4DE8 A;  2O1L A;  3H3G A;  4KR5 A;  3TYH A;  3DM0 A;  4U2R A;  3WAF A;  1JQF A;  3TTL A;  3EHT A;  2H98 A;  1PB8 A;  2KQZ A;  1KWH A;  2ZYO A;  4EQ9 A;  3V83 A;  1EYK A;  5EYH A;  5AA4 A;  3CR9 A;  5JK4 A;  1FPL A;  1SYI A;  4XKR A;  3MUQ A;  2V3Q A;  1OLC A;  4LAT A;  1ZIU A;  2FNC A;  3GXA A;  3PV0 E;  4XTC Q;  5CMK A;  4OEV A;  3V5A A;  3H7M A;  1FJ9 A;  5CRY A;  4PTK A;  3LV0 A;  4OMB A;  1M5C A;  3T66 A;  1NUY A;  4R72 A;  1B4Z A;  3TTR A;  2PT1 A;  1H44 A;  3RY3 A;  1RDZ A;  2QVU A;  2UVJ A;  5TPA A;  3TTN A;  3H6V A;  4U4S A;  1B05 A;  2PCR A;  1J1N A;  4RYA A;  2DDK A;  4HE2 A;  1P1Q A;  3TFL A;  4H5F A;  2DE2 A;  1OIB A;  1LLS A;  2P2A A;  2HCA A;  3KN8 A;  1EYJ A;  1AMF A;  1TWY A;  4IO2 A;  4MLV A;  4PAI A;  1TT1 A;  4FEC A;  2R6G E;  4QFN A;  1YZ0 A;  3Q28 A;  3IO6 A;  4KFQ A;  2OBG A;  4DXC A;  4KYD A;  1USY E;  3KGC A;  2XXX A;  2OPE A;  3VE1 B;  3D1R A;  3W15 C;  2I6E A;  4PDH A;  1FCK A;  2OWS A;  2I48 A;  1RYO A;  1UTH A;  4G8M A;  3U72 A;  3O6G A;  2XX9 A;  1N0T A;  3THI A;  1S50 A;  4HCW A;  1SPI A;  5KDT B;  4OTE A;  5KCJ A;  5DT6 A;  4YB6 A;  3GYY A;  1KA1 A;  4OFJ A;  1D9Y A;  1HSE A;  1T0K A;  1LCT A;  5CBR A;  3U94 A;  5DVI A;  2V3U A;  3F11 A;  4RY1 A;  3HV1 A;  2FVZ A;  5AA1 A;  1IME A;  4O8M A;  2ZMB A;  4MAG A;  3O97 A;  2ESN A;  4RK9 A;  2RF1 A;  5IGA A;  4XIG Q;  5LTC A;  2CZK A;  3NOH A;  1URG A;  3SZP A;  3G3K A;  1MQG A;  2VT5 A;  1PB7 A;  1LAX A;  3GBA A;  1B3F A;  5JEI A;  1MXW A;  4X04 A;  3O29 A;  3PUZ E;  4WEP A;  2HEU A;  4GWW A;  3FJM A;  5I56 B;  1MQD A;  5H8F B;  2D3I A;  4RJZ A;  4RPN A;  5IZ1 A;  1YTV A;  3LSF B;  2CEY A;  2DE3 A;  4OWD A;  4NF4 B;  4HE1 A;  5K2X A;  1D3K A;  4U1Z A;  4N81 A;  4OAN A;  5EQ8 A;  2UYE A;  2XXQ A;  3FAS A;  3TEL A;  3QMF A;  5KZT A;  4PFU A;  1OQG A;  2DWI A;  1DTG A;  3I5O A;  4FAT A;  1EZ9 A;  1B52 A;  4GWO A;  4R75 A;  5ICQ A;  4OVS A;  4TLL B;  3LSX A;  3LUY A;  2G93 A;  4JWY A;  3ECR A;  3Q25 A;  2CEX A;  4ELR A;  5FHO A;  1Q35 A;  4PFB A;  1DSN A;  4JVI A;  5AA4 B;  1SVX B;  3MP6 A;  1MPD A;  1R1N A;  3KBZ A;  2WBB A;  3R26 A;  2H25 A;  2O7U A;  2KR0 A;  2R9J A;  2DXY A;  4NF6 A;  1B5I A;  5T3J A;  1BKA A;  2Y7P A;  4G8H A;  4BDL A;  1BK4 A;  1FPI A;  5ET8 A;  4H46 A;  3RT6 B;  1NKX A;  1IXI A;  4OES A;  1JP4 A;  2RC7 A;  3E79 A;  1QKB A;  2H5Y A;  2XXU A;  5JTY B;  4GFR A;  4EXK A;  3QUJ A;  3E78 A;  1NV4 A;  3VV5 A;  4AB5 A;  4NF8 A;  4BDM A;  4EUO A;  4ESX A;  2F6P A;  4PAF A;  4U21 A;  2Q2A A;  1XI6 A;  4MEV A;  3HCQ A;  4PGP A;  1B58 A;  1QUL A;  5FTH A;  3Q27 A;  2WKY A;  4JSO A;  1MQJ A;  1KZ8 A;  1JVY A;  4GF8 A;  4QSD A;  3LSL A;  1L5T A;  1MXZ A;  4C0R A;  2AIX A;  3IFA A;  4HS7 A;  3IL1 B;  1P1U A;  4N17 A;  5FTI A;  5A5X A;  3ILU B;  3QSL A;  4XKP A;  3PMV A;  4YU0 A;  4G68 C;  2PBW A;  1VE4 A;  4MNP A;  1JNF A;  4YKI A;  1FBC A;  2RCB A;  5FHN A;  1UTH B;  3C36 A;  1D4N A;  1WOD A;  4JXI A;  4LON B;  4E0X A;  2DWA A;  4YB5 A;  1QJM A;  3UP9 A;  4LZ7 A;  3Q26 A;  1PBQ A;  1TXF A;  2THI A;  1IUD A;  5HBC A;  4NHB A;  4P9K A;  4LQ2 A;  3TKD A;  4MLQ A;  1B2H A;  2CZI A;  3N94 A;  3OD7 A;  1WVJ A;  3KZG A;  3PPP A;  1BP5 A;  3A29 A;  3OO9 A;  3HO7 A;  3MZ1 A;  2V25 A;  4EXL A;  5AA2 A;  1AH5 A;  2CZL A;  4QFP A;  3C31 A;  1Q9D A;  1B3H A;  4MCO A;  1RDX A;  3B6W A;  4N8Y A;  4C1U A;  2RC9 A;  2XHD A;  2XX7 A;  1QUI A;  1IIW A;  2VPO A;  4OYV A;  2B4L A;  3MVY A;  4EF2 A;  3FGS A;  3OO7 A;  1D9V A;  2R71 A;  1DPP A;  5EQ9 A;  1OLA A;  3AXF A;  5M2V A;  2ZNS A;  4X9T A;  2L5V A;  3PU5 A;  4ZE8 A;  5LDZ A;  1FTL A;  1UIU A;  2VGQ A;  1NNP A;  1FQB A;  1SI1 A;  2FYI A;  3VXB A;  2Y7K A;  2F8D A;  2ANJ A;  3LR1 A;  2I0C A;  1DK4 A;  5EQA A;  1B6H A;  3KSJ A;  2DWH A;  4GBW A;  2XXR A;  5J1D A;  3QIM A;  5L9O A;  4F3S A;  1G0I A;  4I8C A;  2R8T A;  4WXJ A;  4U1O A;  4BDQ A;  4DCX A;  3JYR A;  3K6X A;  4NF6 B;  4HE0 A;  1O64 A;  3VLU A;  4OER A;  1MH4 A;  4HXV A;  4NED A;  4AQ4 A;  3CFL A;  2O6A A;  3LBS A;  4N6P A;  4Q30 B;  3DP4 A;  3E4R A;  4QF9 A;  3O2A A;  2F5X A;  2WX9 A;  4ISU A;  1GR2 A;  1D9Q A;  4ECF A;  3FVG A;  4H1X A;  4GRK A;  5I58 B;  4ZDM A;  3ODB A;  3VLV A;  1IXC A;  4PP0 A;  3C35 A;  3M3K A;  1AL3 A;  2PYY A;  5DYH A;  1B9J A;  4MMP A;  3IAZ A;  1K9Y A;  4N6K A;  2Q88 A;  2F35 A;  4R6Y A;  1RKM A;  2DSF A;  3FVK A;  3H6T A;  3MJN A;  3QAX A;  1NV5 A;  1MPB A;  2IEE A;  1EYI A;  4ELQ A;  2XXP A;  2VOZ A;  1H76 A;  1O7T A;  3K2D A;  3L6G A;  3MVZ A;  4PFT A;  4NF4 A;  1FPG A;  4QSE A;  5BWJ A;  2ZZW A;  1LB9 A;  4UAB A;  5HM4 B;  3IOW A;  4X8R A;  3B6T A;  4ZS9 A;  4QRZ A;  3IO4 A;  2XD3 A;  1FQF A;  1Y4C A;  4EQ7 A;  2QPQ A;  1FSA A;  2G29 A;  4PE5 B;  2XXY A;  1IXH A;  2XWV A;  3B6Q A;  3RTF B;  4NWC A;  4ONY A;  1YYZ A;  2NVU B;  1FPB A;  2YJP A;  3CFX A;  2ONK E;  4G61 A;  1DBZ A;  3OEM A;  3PUW E;  3MWB A;  3MZ9 A;  4EF1 A;  1JEV A;  4YKK A;  4GX3 A;  4IGT A;  3TPA A;  4YKJ A;  4H67 A;  4NMY A;  3CFZ A;  2YLN A;  3GBB A;  3CSG A;  3KC0 A;  1MPC A;  4I40 A;  4N4U A;  3PD9 A;  4R9F A;  3K6W A;  3N26 A;  1Y3P A;  4ESW A;  1IEJ A;  1XHY A;  3ZKL A;  4H6D A;  5CMB A;  1O63 A;  3FJ7 A;  5AE4 A;  1IMF A;  5AA2 B;  4KYE A;  1XT8 A;  1MQH A;  4M4G A;  4NAP A;  1R9Q A;  3HST A;  2F7C A;  1MRP A;  1MG1 A;  4M1V A;  4OVT A;  5JTY A;  3RT8 A;  2F7A A;  2BJI A;  1IMC A;  3T9V A;  1F9B A;  2HZL A;  2RIN A;  2O7I A;  3UOR A;  3D4C A;  1LST A;  3PTY A;  3O66 A;  1YPN A;  1MS7 A;  3MQ9 A;  1BLF A;  1A8F A;  2CZH A;  3B50 A;  3H6W A;  5ET5 A;  2QS1 A;  5IAI A;  1MQI A;  3IR1 A;  4PFR A;  3T9H B;  4MHF A;  4P0I A;  3MW0 A;  3KOS A;  3P7I A;  2P1S A;  4XXU A;  1B4H A;  3DP6 A;  2OZZ A;  4X1B A;  2I4C A;  5I2K A;  1II5 A;  4R6K A;  1XOC A;  4PQJ A;  3TUS A;  2GRV A;  3QK6 A;  1JW4 A;  4P11 A;  3CG1 A;  4H5G A;  4U23 A;  3BFT A;  2P0S A;  1Y4T A;  3S4U A;  1M5D A;  4RA1 A;  4OXV A;  2RC8 A;  1P1W A;  1ZMG A;  5H8H B;  4GVO A;  4MBP A;  2QS2 A;  4IO6 A;  4DLD A;  3TTM A;  3KN3 A;  4UA8 A;  3U93 A;  4Z7E A;  4HW8 A;  1LAF E;  3FXQ A;  3RLF E;  3FXR A;  4FAJ A;  1Y20 A;  4NN3 A;  1N7W A;  1N3X A;  2Y7W A;  1XC1 A;  3FUZ A;  2NXO A;  1S7Y A;  3KG2 A;  1VR5 A;  1N7X A;  4P1E A;  5DVJ A;  1FBP A;  2P3N A;  2O84 X;  2DYX A;  1US5 A;  1FBE A;  1B7U A;  4MH5 A;  4ZZE A;  1FBF A;  3G3J A;  4FBP A;  2QVR A;  1ZJL A;  2Y7R A;  3RNN A;  4IR8 A;  3TCG A;  3TEP A;  2Q9T A;  3HN0 A;  4F3B A;  3BIG A;  2DP8 A;  4OEN A;  2Z8E A;  3U65 A;  3Q29 A;  2AYS A;  4F19 A;  4I9D A;  1NUW A;  4NWD A;  4PC9 A;  3QXM A;  3DEL B;  4FE8 A;  3T9X B;  1LB8 A;  3D4G A;  4AS4 A;  4QFO A;  2F36 A;  3PGF A;  2Q8J A;  2Y5K A;  3V8X B;  2HZK A;  3K1M A;  2GH9 A;  2Z8F A;  1SI0 A;  5I2N A;  3EQ1 A;  2O69 A;  2V84 A;  2QFL A;  2D21 A;  4QXD A;  4F18 A;  2V93 A;  3EHU A;  2Q74 A;  2REG A;  1AIV A;  4JSD A;  1OMP A;  3EF7 A;  3U1O A;  5ITP A;  4MNC A;  3EPE A;  4N07 A;  1B3E A;  4GLI A;  1CB6 A;  1URS A;  3OEN A;  2DXR A;  3VVD A;  4ZEB A;  3FIR A;  4H8J A;  1H3D A;  2A5T A;  1UIV A;  1MY1 A;  3JZJ A;  4YKP A;  4N15 A;  1MXX A;  2WYK A;  2XXV A;  3PUV E;  2OWZ A;  3OSR A;  2QVV A;  3BIH A;  4KD5 A;  1MXV A;  1LFG A;  2XXH A;  2ALU A;  3KJT A;  4HCY A;  4ZED A;  1LAH E;  2ZNT A;  3N6U A;  4OZ9 A;  1LBC A;  1RYX A;  3FV1 A;  4FJP A;  1N04 A;  2I4B A;  3OXN A;  5I58 A;  4KQP A;  3UN6 A;  4O7I A;  4DI3 D;  3MP1 A;  4PAK A;  3R6U A;  2I3V A;  2Z23 A;  3O6H A;  5I57 B;  1N84 A;  2ABH A;  1B32 A;  1BIY A;  2ONR A;  1P1N A;  4LQ5 A;  1XVX A;  2GQ1 A;  4O3B A;  1LBZ A;  4ZEF A;  4R6H A;  3E3K A;  3MAM A;  3USD A;  1P1O A;  1LGB C;  3W9V A;  4I1D A;  2X26 A;  1H45 A;  4G2Z A;  5I2K B;  3OO8 A;  2B3B A;  3G7W A;  1VSO A;  3K6U A;  1B5J A;  3KN7 A;  1I6B A;  4H65 A;  3T93 B;  4NF0 A;  4IY6 A;  5ITO A;  2Z8D A;  4OFL A;  1MM7 A;  3OEK A;  3TCH A;  2HPG A;  4G68 A;  4O3A A;  2GHA A;  2Z22 A;  1TFA A;  3ZS6 A;  3OEL A;  3MYU A;  2I58 A;  1FQE A;  4P8B A;  4AB6 A;  3PD8 A;  2IA4 A;  3RPW A;  4LUB A;  4LZ8 A;  3E9X A;  1SW1 A;  1IZ1 A;  5H8Q B;  1FTJ A;  4GL8 A;  1IMB A;  4F2O A;  1Q1K A;  4G4P A;  5TU0 A;  3OOA A;  1JW1 A;  3MBP A;  4N8G A;  4GQO A;  4F1V A;  3UGW A;  1FPJ A;  4XFE A;  1IIT A;  4ELP A;  5H8N B;  3VVF A;  1ANF A;  2H99 A;  3M3F A;  3O6I A;  1NNT A;  4ND9 A;  2ZZV A;  1ZLQ A;  1FBH A;  1UQW A;  4GX6 A;  1A99 A;  4Z0I A;  3DLN A;  4POX A;  1Y1Z A;  4KXP A;  4IO4 A;  1FTM A;  2VP1 A;  4PET A;  2I3W A;  2XXW A;  4F1Y A;  3IB2 A;  3GLB A;  2HAV A;  1LBW A;  1LBX A;  3SER A;  3G3H A;  4KCC A;  3O28 A;  3K1N A;  4TQU Q;  1I6A A;  4PFI A;  1ATG A;  1IMA A;  1JW5 A;  3MZB A;  5I2N B;  4PF6 A;  2VPN A;  3CG3 A;  2UXA A;  1EZO A;  4GWY A;  4GXS B;  1JEU A;  4F31 B;  5I3S A;  4DCY A;  1YCJ A;  5FHM A;  4LP2 B;  4IY5 A;  4OFO A;  4QFL A;  4U22 A;  4GL0 A;  5H8H A;  1Y3Q A;  3SKP A;  1VDW A;  3FZV A;  2I0B A;  1EZP A;  3RTW B;  3V89 B;  1NV1 A;  3FJG A;  2A5T B;  4P0G A;  3L6H A;  4LN5 A;  1B0H A;  2ZXT A;  2O68 A;  1GV8 A;  1TFD A;  3SEV A;  5FBP A;  4GXA A;  3OMB A;  3W9W A;  1LBY A;  2GHB A;  3G3F A;  1HSJ A;  3RUM A;  1FJ6 A;  4OVR A;  1P99 A;  4H45 A;  4R9G A;  2DE4 A;  1FTO A;  3EKI A;  4NGU A;  4YZZ A;  2QSX A;  4P1L A;  1MXY A;  5EQ7 A;  4G8N A;  3VVE A;  5ELV A;  1JET A;  1ZBM A;  4LVQ A;  3VLW A;  1S9T A;  5HPQ A;  3TOD A;  3UK4 A;  3A3C A;  4GX4 A;  4F2Q A;  3SEW A;  3CVG A;  3H06 B;  4NG7 A;  2F3B A;  3LC8 A;  5I5P A;  4PBH A;  3ISP A;  3BKI B; 
#chains in the Genus database with same CATH homology
 1INP A;  1DCU A;  4GWU A;  3KBZ A;  2WBB A;  2KR0 A;  4OVQ A;  4O94 A;  1AWB A;  5T3J A;  1K9Z A;  3LUZ A;  2FIX A;  2JJK A;  1NV6 A;  1FPK A;  1BK4 A;  1FPI A;  1NUX A;  5ET8 A;  4NN3 A;  3MST A;  4XF5 A;  4H46 A;  1NUZ A;  4F1U A;  1JP4 A;  3E79 A;  1CNQ A;  4P1E A;  4QBA A;  3IFC A;  1FBP A;  4GWS A;  2P3N A;  2XWO A;  2XWK A;  3E78 A;  1FBE A;  5IZZ A;  1NV4 A;  1FBG A;  1FBF A;  4FBP A;  2QVR A;  5EYG A;  4PAF A;  4IR8 A;  4I3E A;  2XWI A;  2Q9T A;  3BIG A;  1XI6 A;  2WYP A;  4MEV A;  3U65 A;  4PGP A;  4N6D A;  4F19 A;  1NUW A;  1KZ8 A;  5ET7 A;  4PC9 A;  3CHG A;  1FPD A;  5ESY A;  3IFA A;  2WEF A;  1NV0 A;  4N17 A;  2WBD A;  4AS4 A;  2Y5K A;  5F24 A;  1KA0 A;  2HZK A;  3T1B A;  1FTA A;  4GBV A;  4N91 A;  4MNP A;  2PFY A;  4DI4 B;  2Y5L A;  4MIJ A;  3FBP A;  1FBC A;  2QFL A;  4QXD A;  4MJO A;  4MNI A;  4F18 A;  4YIC A;  5I7I A;  2Q74 A;  3HFU A;  1NV7 A;  4JVD A;  5IM2 A;  3B8B A;  4MNC A;  4GWZ A;  4O7M A;  3T0J A;  1FPF A;  4JVC A;  2OX3 A;  5DW8 A;  4NHB A;  4P9K A;  3RPL A;  2CZI A;  2MKZ A;  4PDD A;  3A29 A;  4OVP A;  2F3D A;  4XEQ A;  5IZ3 A;  4N15 A;  2WYK A;  1Q9D A;  2OWZ A;  4MCO A;  1RDX A;  3ROJ A;  2QVV A;  3BIH A;  4N8Y A;  4NQ8 A;  2Q8M A;  4HCY A;  2HHM A;  3FXB A;  2VPO A;  2B4L A;  4I3Y A;  2FBP A;  1RDY A;  4PE3 A;  4MX6 A;  4O7I A;  4AS5 A;  4DI3 D;  4PAK A;  2V4C A;  5EQ9 A;  4X9T A;  2L5V A;  5LDZ A;  2GQ1 A;  1LBZ A;  2KQZ A;  1EYK A;  5EYH A;  3W9V A;  5JK4 A;  1FPL A;  1DK4 A;  5EQA A;  2V3Q A;  4PCD A;  3RPL B;  2DVZ A;  4GBW A;  4NX1 A;  1FRP A;  5J1D A;  1NI9 A;  1G0I A;  2R8T A;  4NF0 A;  1FPE A;  4HE0 A;  1FJ9 A;  4PTK A;  3LV0 A;  1NV2 A;  5IZ3 B;  2HPG A;  5A5L A;  1NV3 A;  4HXV A;  3MYU A;  1NUY A;  4P8B A;  4PBQ A;  1LEV A;  2FIE A;  1RDZ A;  2QVU A;  4OA4 A;  2F5X A;  2WX9 A;  3KC1 A;  5CM6 A;  1D9Q A;  2PCR A;  2DDK A;  2PFZ A;  4HE2 A;  1IMB A;  2HXR A;  2DE2 A;  4N8G A;  4F1V A;  1FPJ A;  4XFE A;  1EYJ A;  4MMP A;  1K9Y A;  4N6K A;  4PAI A;  2ZZV A;  1FBH A;  4GX6 A;  1QGX A;  1YZ0 A;  1NV5 A;  4KXP A;  2B4M A;  1EYI A;  2P3V A;  4PET A;  1FPG A;  3D1R A;  4PDH A;  1LBW A;  1LBX A;  2ZZW A;  1LBV A;  4UAB A;  5J16 A;  4PFI A;  4X8R A;  1IMA A;  2XA5 A;  2QPQ A;  1FSA A;  4HCW A;  1SPI A;  2XWV A;  4PF6 A;  2VPN A;  2FHY A;  1FBD A;  3GYY A;  4GWY A;  1KA1 A;  5I3S A;  3RYD A;  1YYZ A;  1FPB A;  2ZZX A;  4G61 A;  1DBZ A;  4GX3 A;  2FVZ A;  1IME A;  4O8M A;  1VDW A;  3KC0 A;  4MAG A;  1NV1 A;  4I40 A;  4N4U A;  5IGA A;  5LTC A;  2CZK A;  3NOH A;  4PGN A;  4LN5 A;  3SZP A;  2VT5 A;  4PF8 A;  1IMF A;  5FBP A;  4P3L A;  4NAP A;  3W9W A;  1LBY A;  4M1V A;  4OVT A;  4X04 A;  4GWW A;  2BJI A;  1IMC A;  1FJ6 A;  4OVR A;  4H45 A;  2HZL A;  5IZ1 A;  2CEY A;  2DE4 A;  2DE3 A;  4HE1 A;  3EKI A;  4NGU A;  4P47 A;  1G0H A;  3PTY A;  4N81 A;  4OAN A;  4YZZ A;  4P1L A;  1YXI A;  5EQ8 A;  3QMF A;  4P56 A;  5EQ7 A;  2CZH A;  3B50 A;  5ET5 A;  4PFR A;  4MHF A;  4GWX A;  5ET6 A;  4OVS A;  4GX4 A;  2CEX A;  2XXK A;  1IMD A;  4NG7 A;  2F3B A;  4PFB A;  4JVI A;  4PBH A;  5I5P A;  3ISP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...