5LDZA

Quadruple space group ambiguity due to rotational and translational non-crystallographic symmetry in human liver fructose-1,6-bisphosphatase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
331
structure length
311
Chain Sequence
PFDTDVNTLTRFVMEEGTGELTQLLNSLCTAVKAISSAVRKAGIAHKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-1,6-bisphosphatase 1
publication title Quadruple space-group ambiguity owing to rotational and translational noncrystallographic symmetry in human liver fructose-1,6-bisphosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 100
structure length 311
sequence length 331
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00316 FBPase Fructose-1-6-bisphosphatase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 5ldzA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5ldzA02
1NV0A 1NUXA 1G0IA 4H45A 1CNQA 2F3BA 1DK4A 1K9YA 1IMDA 3KC1A 3D1RA 1FPBA 1FBGA 1Q9DA 2R8TA 1EYKA 4GBWA 3BIHA 5T3JA 3KC0A 5IZ3A 1IMEA 1YXIA 3BIGA 1NI9A 3KBZA 1NV1A 1FPFA 2Y5LA 5F24A 2WEFA 2P3NA 1EYJA 1IMAA 2Q74A 2PCRA 4GWZA 2DDKA 4I3EA 4AS5A 1NV2A 2QVVA 4KXPA 2CZHA 2Q8MA 2CZKA 1IMCA 2F3DA 2OX3A 3A29A 4GX4A 5DW8A 2CZIA 1FJ6A 5IZ3B 1RDYA 4O7IA 2VT5A 1FSAA 1FRPA 5J16A 2OWZA 3B8BA 4FBPA 5EYGA 2FVZA 1K9ZA 1EYIA 4HE0A 1FPLA 1NV6A 3FBPA 1FPEA 5IZ1A 1FPKA 4I3YA 2Y5KA 1IMBA 3RPLA 5EQAA 1VDWA 1FPIA 1KA0A 1NV4A 2HHMA 1RDXA 4G61A 1JP4A 1FBCA 1SPIA 1KA1A 1YZ0A 4GWWA 4QXDA 1FBPA 1AWBA 1INPA 1D9QA 4IR8A 5I3SA 4GX3A 4AS4A 5ET8A 1FBHA 1NV7A 1QGXA 3IFAA 4I40A 3LUZA 3RPLB 5ET5A 1YYZA 3IFCA 4MJOA 1FPGA 5EYHA 3RYDA 1BK4A 1IMFA 1FJ9A 4N81A 4GBVA 2JJKA 5A5LA 5EQ9A 5LDZA 1KZ8A 4HE1A 5ET7A 4GX6A 1DBZA 1G0HA 1LBZA 1LBYA 5EQ7A 5EQ8A 1NV3A 3LV0A 1NV5A 2WBBA 5FBPA 4PTKA 2P3VA 1DCUA 1FPDA 1FTAA 4GWSA 1NUYA 4GWYA 1LEVA 3ROJA 1NUWA 4GWUA 2FBPA 3QMFA 2QFLA 5ET6A 1LBWA 1FBFA 4GWXA 1FPJA 3T0JA 2FHYA 5ESYA 1FBEA 1RDZA 2FIXA 4H46A 2FIEA 2WBDA 2QVRA 4HE2A 2GQ1A 2BJIA 1LBVA 2QVUA 1LBXA 4HXVA 1FBDA 1XI6A 1NUZA
chains in the Genus database with same CATH superfamily
5IAIA 1OLCA 2H9BA 5I2KB 3UN6A 1EZ9A 3PUYE 2E0SA 1GR2A 3UA8A 3RLFE 4N15A 2WYKA 4JWOA 4RY1A 5I57B 3RGYA 4DXUA 1IMAA 5L9OA 2DVCA 1MPBA 2ZZVA 4PDHA 2QPQA 4DCYA 4H5GA 1AMFA 1N84A 1A54A 4PFBA 3ODBA 1JVXA 1LCTA 2QJEA 2XXUA 1I69A 2B65A 3LSFB 2V84A 3R7XA 4OFOA 3QAXA 2HQ0A 1H44A 1MXVA 1MM6A 1RYXA 3E13X 1SPIA 4I8CA 5DEXA 2RC9A 1FBPA 2Y7PA 1N04A 4I40A 1RKMA 1Y4TA 1Y20A 2KR0A 4IO7A 1MY2A 4QFLA 4NTLA 3IAZA 4G2ZA 1FJ9A 4N81A 2F35A 5EQ9A 1USYE 5L9SA 1Y1ZA 3K1NA 4ND9A 5IM2A 2QMWA 1GV8A 2DE2A 1UTBA 2R71A 2QFLA 3K6UA 3WAEA 4NF6A 5ITOA 1FPJA 2VHAA 3OO9A 4LONB 3MQ9A 2Q2AA 4I62A 3KGCA 4WXJA 3GYYA 1SD3A 1SW1A 4U2RA 4NEDA 5B7DA 3TODA 3EHTA 4R6HA 1MY0A 3LC8A 1Q9DA 5CMBA 5JTYB 3RTWB 1YAEA 3MP6A 4KFQA 3PGFA 4R72A 1B7HA 1MXWA 1LCFA 2UXAA 4MHFA 4I3EA 3CVGA 4FATA 2A5TA 1XVXA 4BDQA 3KN7A 2I49A 3DP4A 1WDNA 4WKMA 4NWCA 1SQYA 4HE0A 3SDFA 3MP1A 3H3GA 3NOHA 1DTGA 1O63A 4YMAA 3FVOA 3MZBA 4GWWA 2ZYKA 1P1UA 4WEDA 1R9LA 3PPRA 4MF3A 3VLWA 5IZZA 3N26A 5ICQA 3TTMA 2WKYA 4MNIA 3MVWA 2QL3A 4MMPA 4P1LA 2JJKA 5A5XB 4ZEFA 2WX9A 4HE1A 3S9EA 1LBZA 2GHAA 3MWBA 2DWAA 3CFLA 2ZNTA 3QK6A 2Q88A 4X8RA 4GWYA 4ZEKA 3GBAA 4H8IA 4LZ5A 2P1SA 3ZSFA 4XKQA 2NVUB 3OXNA 4P11A 3PMXA 1LAFE 5JK4A 1POY1 3RQTA 2UVGA 4IGRA 3E79A 4N8GA 1XI6A 3HHGA 4DXCA 4NE4A 1G0IA 1MS7A 4OVQA 3FVGA 1MDQA 3KSXA 3EPEA 4MNCA 3KEIA 2IA4A 3KN3A 3MC2A 4I9DA 1N76A 5IGAA 4IO3A 4YAHX 2THIA 3Q29A 3C34A 3ZS6A 1NL5A 4G68B 3IR1A 4GX4A 1NFTA 4H8JA 4OZ9A 1NMUA 3KN8A 3U1OA 2OWSA 4DLDA 3IB2A 3RPLA 4EUOA 2BJJX 1FTKA 3JV9A 1QVSA 4QSCA 1YZ0A 2XX9A 2O6AA 2HXWA 5ET8A 2PVUA 4N4UA 1SW4A 5H8QB 4LQ2A 5IKBA 2UYEA 4DI3D 3SETA 4GBVA 2ZZXA 1PB9A 3QUJA 3TELA 5AA2A 1G0HA 1J1NA 4OYVA 4GIZA 1PC3A 4NF4A 2P3VA 3I5OA 1MG1A 2F6PA 1IEJA 3CFXA 5I58A 2NWJA 3T0JA 3IOWA 4P47A 2O84X 1II5A 3V89B 1B1XA 2AIXA 4OXVA 1TT1A 3G3GA 1SI0A 3LR1A 1B1HA 3GXAA 2A5SA 4OERA 1FPBA 2ABHA 1BKAA 4ZDMA 4TLLB 4YMBA 2V3QA 4THIA 1FPFA 5AA3A 3VVFA 2DWJA 4GQOA 1LFHA 4U4SA 1O7TA 3FIRA 1SBPA 2XXXA 4PFRA 3M3LA 2AYSA 4H1XA 3K2DA 3JYRA 4PBQA 4G4PA 4OA4A 1S9TA 2VD3A 3TZAA 4N07A 3SZPA 4ZECA 3H4ZA 4NF8A 3MJNA 4U21A 4TOZA 1NV4A 3T22A 1B0HA 1QW0A 1B4HA 1DPPA 1EH3A 5I5PA 2RCBA 4MFIA 3HFUA 5AA1A 1LFGA 4KQPA 4X1DA 2F7BA 4GRKA 1I6BA 1URGA 2V93A 4H6DA 1VFEA 3K00A 1R1NA 3QSLA 5ET7A 4U1ZA 4GF8A 1Y4CA 3FATA 1Y9UA 4NF6B 3K6WA 3FV1A 1NH7A 4OESA 1FTAA 1P1QA 4H67A 2VGQA 5HPQA 1BLFA 1US4A 2OLBA 1LAGE 4POXA 3C31A 2V4CA 2PMSA 2QVRA 1MQHA 3G3JA 3OSQA 3OELA 4UACA 3QIMA 1CNQA 1MY1A 4GXSB 1OVTA 4BDLA 3D1RA 1EZPA 2VPOA 5DTBA 2LAOA 1ZU0A 3FVKA 4KR5A 3H6VA 1P99A 5ITPA 5DT6A 2ZMBA 1N7XA 3UGWA 1JW4A 4KXPA 4OVJA 4U1OA 5AA2D 5FTIA 2XWVA 3UP9A 3C33A 1FQCA 2OWZA 1NH8A 3L6GA 3RT8A 4N91A 1CB6A 5CC2A 4LP2B 3K6XA 4PFUA 1N7WA 5AA4A 4KCDA 4PFTA 4H65A 3DELB 1CE2A 5I3SA 1H43A 1QGXA 3SEUA 1HSEA 1BK4A 4TLMB 3TDJA 2RF1A 2XXQA 1UTHB 3K4UA 4JXIA 4Q30B 2GH9A 2KLFA 4UA8A 1DBZA 3OSRA 3QYTA 4G68C 5EQ7A 3ONMA 4ELRA 3IOTA 4X9TA 1NUYA 3FVNA 4KI0E 3QMFA 3IX1A 4XFEA 4HW8A 2QRYA 5TPAA 3N5LA 3FJ7A 2XD3A 1ZLQA 4IY6A 2Z8EA 4PP0A 4P3LA 4HE2A 4NHBA 1NUZA 4MAGA 1NUXA 5KDTB 1IXIA 4F18A 2Z8FA 1IIWA 3U92A 1IUDA 2R8TA 4ECFA 4YKJA 4GBWA 1VFDA 3BIHA 1Y1MA 4EF2A 1D9VA 3BFTA 3FXRA 3RT6B 2CEYA 4K3FA 3Q26A 2P0SA 3TTKA 1QJMA 3KJ7A 3I6VA 4BDOA 1FSAA 5J16A 3O6IA 3IOUA 3B7DA 3FV2A 1IXHA 5EQAA 3CG3A 5TU0A 4YB5A 3MBPA 3O97A 4OEUA 3CFZA 4U22A 3HN0A 5KCJA 1TFDA 2H25A 4O3BA 4GX3A 4AS4A 2DE4A 1VSOA 4G77A 4DCXA 3LSLA 1FQBA 4PF8A 5AA2B 1NNFA 4EDPA 2XWIA 4ESWA 4ELOA 4OHNA 3W9VA 5LDZA 4TQUQ 4KYDA 3ILTB 4FIMA 5I58B 1H3DA 1B7ZA 3ROJA 3FASA 3DLNA 1LBWA 1B05A 3E4RA 3IJOB 2AL4A 2REGA 3FGSA 1FBEA 4LN5A 2QSXA 2FIXA 3TEPA 2ALUA 4C0RA 4IB2A 1DK4A 3E3KA 3SEXA 1MXYA 1LFIA 3H6UA 3EHSA 5I7IA 4N8YA 3PUXE 3L6HA 1UIUA 5IZ3A 4QBAA 4R73A 3CIJA 5K2YA 5F24A 1MH4A 2F5XA 1B7UA 2I48A 4NF0A 3A29A 1M5FA 4MIJA 2M8CA 3K0VA 3B50A 3MUQA 1LB8A 1N3XA 1RDYA 1FQEA 1IXCA 4GWOA 4P9KA 4FBPA 4OVTA 5IZ1A 5H8HA 1P1NA 2D5WA 3FZVA 3Q25A 1AH5A 4O7MA 2DS9A 2O51A 4R6YA 2PFZA 2F36A 4PFIA 1B3GA 3EN3A 4QSDA 3IFAA 5ET5A 3S9LC 1O64A 4OMBA 4OVRA 4Q5TA 4NMYA 1B5IA 5BWJA 4JWXA 1GGGA 5ICTA 1QUIA 4PGNA 3H6TA 2O68A 3VXCA 2V3UA 1DCUA 3UK4A 2DP8A 4XTCQ 3TUSA 1FCKA 1B3HA 3CI8A 3K01A 2X26A 2XXRA 2GQ1A 3M8UA 4PCDA 5I56A 2Y7IA 3SESA 4NG7A 1ZJLA 3AXFA 1A8FA 3F11A 1KWHA 3MZ9A 3KSJA 1BIYA 1NV1A 4Z0IA 2MKZA 3LSWA 4AS5A 4NN3A 4G8MA 4DDDA 4O94A 1N0TA 3TKDA 2NXOA 1B51A 4O7IA 2PT1A 3HO7A 1FRPA 4EXLA 2B3FA 4G8HA 5CBRA 4KCCA 2FVZA 4F39A 5AA4B 4QFNA 4NF5A 5TP9B 4ZE9A 3A3CA 3VFJA 2E1SA 4F2QA 1RDXA 3H06B 2I0BA 2XXIA 3W9WA 5CBSA 1VE4A 1FTLA 2VD2A 1ZBMA 3DM0A 3JZJA 4PAFA 4ZEDA 1B58A 1HSLA 4RK9A 1FTMA 1Y3PA 1YCJA 2F34A 2X7QA 2UVIA 3EHUA 4F2OA 3OO6A 3PD9A 4AQ4A 4R9FA 3LSXA 2QMXA 2ZYMA 5I2KA 5BUUA 4MEVA 4PAIA 2UYFA 2ONKE 2R6GE 4QFKA 3VE1B 3V83A 4MH5A 2FNCA 3PV0E 2XHDA 3ECRA 4IO6A 2XXVA 1SYHA 4I1DA 4P0IA 1ELJA 4PC9A 4XIGQ 3TQWA 2O1LA 3FD3A 2OBGA 2H4IA 3CSBA 1ZIUA 4BLAA 1QKBA 4FAJA 4MLVA 2I6EA 5M2VA 4EQ9A 2HPGA 4RJZA 3TTLA 3RY3A 3S9NC 2WYPA 4PAKA 4DI4B 2CMOA 2REJA 3GBBA 3Q28A 2OPDA 1HSJA 2HZLA 1LBBA 1DPEA 1MY4A 1FPKA 1OMPA 2F7CA 5KCJB 2ONRA 3PU5A 1JNFA 3H03A 2ZXTA 4QFPA 4LUBA 2P2AA 2VP1A 3BFUA 3SEYA 1H45A 3VXBA 3LUZA 3VLUA 3G3FA 4JSDA 1FQDA 2HAUA 3T93B 4ESXA 4UABA 5DEXB 1D4NA 3S4UA 3LV0A 3K6VA 1NV5A 3K1MA 2HEUA 1B3FA 2Q2CA 4PTKA 2YPNA 3KBRA 4LZ8A 4F3SA 4OQOA 4F22A 2DQVA 3OMBA 1D9YA 4OVPA 1F9BA 2HFBA 3G3IA 5EYFA 5JTYA 3TPAA 2QS4A 2Y7KA 4R6KA 1UTBB 4EQ7A 2XXKA 4XKRA 3KC1A 3C4MA 3TMGA 4ELPA 4POWA 3KFMA 5H8SA 4LQ5A 1UIVA 1IMEA 1ANFA 3KBZA 2YJPA 1POTA 4R9GA 4O3AA 4YU0A 4N6KA 2PBWA 4YB7A 2DOJA 4ZS9A 4P0GA 4YB6A 1GTKA 2ESNA 1XC1A 1ATGA 3U94A 2F8DA 1PEBA 2H5YA 2D21A 4OWDA 3PPQA 3TFLA 4QRZA 4M4GA 3IB0A 1UQWA 3FBPA 3OOAA 2Y5KA 1IMBA 4YICA 1FTOA 2A5TB 1SVXB 1BP5A 4LA9A 4ZEIA 1PBQA 2HHMA 1R9QA 2Z23A 2XXYA 5A5XA 3MYUA 4RA1A 5LTCA 3IO4A 2Y7RA 3D4GA 1B5HA 3CR9A 5EHMA 4N6DA 3ISPA 2DXYA 4EF1A 3W15C 4KYEA 3THIA 1JEUA 4Q8RA 2OPEA 4JWYA 1TXFA 1SDXA 1SW5A 3C9HA 1PDAA 1MXZA 4U4XA 3SEVA 3CG1A 3LUYA 5ESYA 1A40A 5I56B 2ZNSA 2RCAA 5H8FA 1XHYA 4C1UA 5L8DA 1B40A 1M5BA 1IZ1A 3PMWA 1LLSA 3QXMA 4KD5A 3H7MA 1I6QA 2I4BA 1K9YA 4IO4A 4ISUA 3QUFA 2F97A 4DE8A 3R6UA 1YXIA 2ONSA 2QS1A 1SW2A 4DIGA 2Y5LA 3PTYA 2WEFA 3EF7A 5CI5A 1RYOA 1SI1A 1A55A 1NV2A 1MY3A 1JW5A 2FA7A 3T1BA 5DW8A 3FXQA 4R75A 1LGBC 1NNKA 1N3WA 3B8BA 2HZKA 1K9ZA 3T9XB 4RPNA 3KG2A 3IK6B 5LOMA 4KYSA 3UORA 4NWDA 3U65A 5I59A 3E78A 3ZKKA 1URDA 3IB1A 1ZKBA 5H8NA 3EKIA 1PB7A 3MVZA 1D9QA 1NV7A 3RPLB 4LATA 1YYZA 2I3WA 2RC7A 4KHZE 1URSA 3V8XB 2XA5A 3O29A 2PFYA 4Q0CA 3MVXA 4RXLA 1LSTA 3G3HA 4H5FA 3TAJA 4NQ8A 3FUZA 3TTNA 1IITA 2OCUA 1B2HA 5CMCA 1QKAA 2I0CA 1FBFA 3C35A 3TTRA 4O8MA 2HCAA 4YKIA 3O28A 1XT8A 4C1TA 1VR5A 5CM6A 1OQHA 2DE3A 4NF4B 3P7IA 4EXKA 1QUJA 1TFAA 1YTVA 5DVIA 3B6TA 4OETA 1PB8A 1YPNA 4XKNA 2XXTA 1B6HA 3GLBA 3IO6A 1EYKA 5T3JA 4GLIA 4ZE8A 2O1MA 1MQIA 3O6GA 4DXBA 3LBSA 3O66A 1Z7ME 2DVZA 3VDFA 4AB5A 2DDKA 1NNTA 3PPPA 1XVYA 5ELVA 1OLAA 2HXRA 4R2FA 1L5TA 5FTHA 4F3BA 4GL8A 1A7LA 3T96B 5CRYA 1EU8A 1FPEA 4JVDA 2XX7A 2Q9TA 1MQGA 1FPIA 2NUVA 1KA0A 2PYYA 4GOTA 2OWTA 3PUWE 4F3GA 5FHMA 3T9HB 2UVHA 2V25A 4QXDA 4NX1A 1JVYA 4HCWA 3T66A 4OFJA 3IORA 4MX6A 3O6HA 2G93A 2Z22A 4NF8B 1FQFA 4OANA 1FQAA 2GHBA 3SKPA 5A5LA 2XD2A 2Y84A 4BDMA 3TCHA 1B3LA 1LAHE 4F31B 1NV3A 4BDNA 4GFRA 5FHOA 3A09A 1LEVA 4GD5A 2FBPA 1PBPA 4XEQA 4RNSA 2Y7WA 4QFOA 1FTJA 3PUVE 3OENA 4QF9A 2BJIA 2QVUA 4HXVA 2H98A 5K2XA 1JETA 3PPNA 4HS7A 4IO5A 1MPDA 3N6TA 2XWKA 4P56A 2IEEA 2KQZA 3E9XA 2HAVA 3I3VA 1Q35A 4IO2A 4IGTA 3PD8A 2XX8A 2DSFA 1NKXA 2P3NA 1OVBA 1BTJA 2PCRA 4RPOA 1H76A 3MVYA 2Q8MA 2CZKA 2F3DA 3C36A 4JBZA 4FEBA 5KZTA 2CZIA 1US5A 1QULA 1LAXA 2VT5A 2CZLA 3VVDA 1S50A 4YZZA 2XXPA 1NV6A 4FJPA 3U8QA 4I3YA 3K02A 4IY5A 4G8NA 3U72A 3IL1B 3V5AA 3TCGA 4L17A 3RNNA 4G61A 1JP4A 1UTHA 3DP6A 2O7UA 2ZNUA 1KA1A 1AIVA 4XKPA 1INPA 4IR8A 1OQGA 4PE5B 1P1WA 4U23A 5HM4B 4MJOA 1NNPA 1Y3QA 3A3UA 1FPGA 1M5EA 3RYDA 5I2NA 4PF6A 1IMFA 3B6QA 1B52A 4H0WA 5J1DA 3IOVA 3MAMA 2WBBA 3KZGA 4M1VA 1JEVA 2GRVA 4JSOA 1MPCA 4JVCA 5DYHA 4R2BA 5KDTA 5ET6A 5H8FB 1DMBA 3EQ1A 2I3VA 1M5DA 4X04A 3M3FA 3D4CA 4X1BA 3OEMA 2WBDA 1LBXA 4ELQA 4X48A 4RK2A 2DYXA 2DWHA 3RTFB 5FHNA 3PUZE 3ZKLA 2Z8DA 5TPAB 3T9UA 2XXHA 4YKPA 4LZ7A 5I84A 1A8EA 5F7VA 3M3KA 4PQJA 1P1OA 3H6WA 2Q74A 5I57A 1EZOA 4GL0A 1IMCA 2L5VA 3BBRA 1LB9A 4ZEBA 4P1EA 3FJMA 1IQ7A 4F3PA 3VV5A 3FJGA 5EYGA 2G29A 1DOTA 5B70A 5I59B 4NAPA 2ZYNA 1AOVA 1B0LA 4FE8A 5H8NB 1VDWA 2QS3A 2XXWA 1FBCA 3N6UA 4LVQA 1OIBA 4RYAA 2Q89A 4ONYA 4QHQA 4WEPA 2GFEA 1AWBA 1T0KA 1R6ZA 2O7IA 1WODA 3O2AA 3RPWA 4NGUA 1USYH 3FXBA 3SEWA 4R74A 4O3CA 1KZ8A 3GZGA 4GX6A 3U93A 2OJTA 2UVJA 3HPIA 1S7YA 5CMKA 4GWUA 3MPLA 1MM7A 4OENA 1DTZA 3IJXB 2FHYA 1RDZA 3USDA 3TCFA 4Z7EA 3C32A 1FW0A 1B9JA 4H46A 2FIEA 2QS2A 3RUMA 1TWYA 1WVJA 5CMMA 1B46A 1FBDA 1ZTYA 1NV0A 1M5CA 2YLNA 3CSGA 2I4CA 4OVSA 1B4ZA 2H99A 2F3BA 1IMDA 3S9MC 1FBGA 1AL3A 5ISUA 5EHSA 3KC0A 3HSTA 4GXAA 3FXUA 1NI9A 1IXGA 3HCQA 1EYJA 2VPNA 4E0WA 4MBPA 1DSNA 2QVVA 2CZHA 2VOZA 3Q27A 2OX3A 1B32A 2X7PA 5IZ3B 5JEIA 4HCYA 3K1PA 1EYIA 4MLQA 4FECA 4XF5A 3TQLA 2PT2A 1JW1A 4N6PA 2ZYOA 5H8HB 1JQFA 4ZZAA 1FBHA 2V3TA 3MW0A 3BKIB 4MNPA 1D3KA 4GVOA 1B3EA 3IFCA 2ANJA 5EYHA 1MH3A 1MQJA 4PETA 3CRBA 3WAFA 2B4MA 1B5JA 2DXRA 2F6GA 4FORA 3OO7A 5FBPA 1XOCA 3OD7A 3PMVA 4GWSA 3MZ1A 1NUWA 2RC8A 2RINA 4HTGA 3DP8A 4PFYA 2PX1A 3N94A 4GWXA 2ZZWA 2NOOA 2F78A 4PFWA 4F29A 1MDP1 4PDDA 3G7WA 3HHFA 5HBCA 2Q8JA 5DVJA 4FEDA 1GVCA 1LBVA 2XWOA 3MP8A 2OZZA 1A99A 4H45A 2W7YA 4F1VA 4JDFA 4DZ1A 4F1YA 2RKMA 4YKKA 2R9JA 3BIGA 2D3IA 1ZMGA 4BDRA 2B4LA 5DVFA 4GWZA 4N17A 5TP9A 4JVIA 4AB6A 4MCOA 4ZZEA 3SERA 2CEXA 3VLVA 4PBHA 1FJ6A 3TYHA 4G68A 4JB7A 3RN8A 3R26A 1FPLA 3MSTA 1MXXA 1I6AA 4QSEA 3OO8A 3KOTA 1MQDA 2FYIA 3OEKA 4N13A 3G3KA 1SYIA 3T9VA 4XXUA 3B6WA 2DWIA 1Y3NA 2O69A 2I58A 3ILUB 5I2NB 4NF5B 5F1QA 3CHGA 1Q1KA 1MXUA 3KJTA 3S2VA 4PGPA 5H8QA 4F19A 5L9MA 4P8BA 3MPKA 1QUKA 1LBYA 5EQ8A 5AE4A 3O9PA 2F7AA 2AL5A 3HV1A 1FPDA 4OFLA 1XS5A 4OTEA 3UIFA 1MRPA 3KOSA 3VVEA 4EQBA 4KPTA 2OK2A 3PPOA 4E0XA 4PE3A 1Z7NE 1LBCA 4F1UA 2B3BA 4OEVA
chains in the Genus database with same CATH topology
1CNQA 2XWKA 4P56A 3D1RA 4PC9A 2KQZA 2VPOA 4N15A 2WYKA 2P3NA 1IMAA 2PCRA 2HPGA 2ZZVA 4KXPA 4PDHA 2Q8MA 2QPQA 2CZKA 2F3DA 2WYPA 4PAKA 4DI4B 2XWVA 2CZIA 2VT5A 4PFBA 2HZLA 2OWZA 4YZZA 4N91A 1NV6A 1FPKA 4I3YA 4G61A 1JP4A 1SPIA 1KA1A 1FBPA 1INPA 4IR8A 5I3SA 1QGXA 4I40A 3LUZA 2KR0A 4MJOA 1FPGA 3RYDA 1BK4A 4PF6A 1IMFA 1FJ9A 4N81A 4UABA 5EQ9A 5J1DA 1DBZA 5EQ7A 3LV0A 1NV5A 2WBBA 4M1VA 4X9TA 4PTKA 5IM2A 1NUYA 4JVCA 2DE2A 3QMFA 2QFLA 5ET6A 4XFEA 4X04A 1FPJA 4OVPA 4P3LA 2WBDA 4HE2A 1LBXA 4NHBA 3GYYA 4MAGA 1NUXA 4F18A 2XXKA 3KC1A 2R8TA 1Q9DA 4GBWA 3BIHA 1IMEA 3KBZA 2CEYA 2Q74A 4N6KA 4MHFA 4I3EA 1IMCA 2L5VA 4P1EA 1FSAA 5J16A 5EYGA 4HE0A 3FBPA 4NAPA 2Y5KA 3NOHA 1IMBA 4YICA 5EQAA 1VDWA 2HHMA 1FBCA 4GWWA 3MYUA 1AWBA 5LTCA 4GX3A 4AS4A 2DE4A 4PF8A 5IZZA 4NGUA 3FXBA 4MNIA 2XWIA 4MMPA 4P1LA 4N6DA 3ISPA 2JJKA 3W9VA 5LDZA 1KZ8A 2WX9A 4HE1A 4GX6A 1LBZA 4X8RA 4GWYA 3ROJA 4GWUA 1LBWA 2FHYA 5ESYA 5JK4A 1FBEA 1RDZA 4LN5A 2FIXA 4H46A 2FIEA 3E79A 4N8GA 1FBDA 1XI6A 1NV0A 1G0IA 4OVSA 4OVQA 2F3BA 1DK4A 1K9YA 4MNCA 1IMDA 1FBGA 5I7IA 4N8YA 3KC0A 5IZ3A 4QBAA 5IGAA 1YXIA 1NI9A 2Y5LA 3PTYA 5F24A 2WEFA 1EYJA 2F5XA 2VPNA 4NF0A 1NV2A 2QVVA 2CZHA 2OX3A 3A29A 4MIJA 4GX4A 3T1BA 3B50A 5DW8A 5IZ3B 1RDYA 4P9KA 3B8BA 4FBPA 2HZKA 4HCYA 1K9ZA 1EYIA 4OVTA 5IZ1A 4XF5A 3RPLA 4O7MA 3U65A 3E78A 2PFZA 4PFIA 3EKIA 1YZ0A 1D9QA 5ET8A 4N4UA 1FBHA 1NV7A 3IFAA 4MNPA 3RPLB 5ET5A 1YYZA 3IFCA 4DI3D 5EYHA 4OVRA 4PETA 2XA5A 2PFYA 4GBVA 2ZZXA 2B4MA 4PGNA 1G0HA 5FBPA 2P3VA 1DCUA 4GWSA 4NQ8A 1NUWA 1FBFA 4GWXA 3T0JA 2ZZWA 4O8MA 4P47A 4PDDA 5CM6A 2DE3A 2GQ1A 1LBVA 2XWOA 4PCDA 4H45A 4NG7A 4F1VA 1FPBA 1EYKA 5T3JA 2V3QA 3BIGA 1NV1A 1FPFA 2DVZA 2B4LA 4GWZA 2MKZA 4N17A 2DDKA 4JVIA 4NN3A 4AS5A 4MCOA 4O94A 2CEXA 4PBHA 4PFRA 1FJ6A 4O7IA 2HXRA 4PBQA 1FRPA 4OA4A 2FVZA 1FPLA 1FPEA 3MSTA 3SZPA 4JVDA 2Q9TA 1FPIA 1KA0A 1NV4A 1RDXA 3W9WA 4QXDA 4NX1A 5I5PA 4HCWA 4MX6A 3HFUA 3CHGA 4OANA 4PAFA 4PGPA 4F19A 5A5LA 4P8BA 5ET7A 1LBYA 5EQ8A 1NV3A 1FPDA 1FTAA 1LEVA 2FBPA 4XEQA 4MEVA 4PAIA 2V4CA 4PE3A 2QVRA 2BJIA 2QVUA 4HXVA 4F1UA 1NUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV0 A;  1NUX A;  1G0I A;  4H45 A;  1CNQ A;  2F3B A;  1DK4 A;  1K9Y A;  1IMD A;  3KC1 A;  3D1R A;  1FPB A;  1FBG A;  1Q9D A;  2R8T A;  1EYK A;  4GBW A;  3BIH A;  5T3J A;  3KC0 A;  5IZ3 A;  1IME A;  1YXI A;  3BIG A;  1NI9 A;  3KBZ A;  1NV1 A;  1FPF A;  2Y5L A;  5F24 A;  2WEF A;  2P3N A;  1EYJ A;  1IMA A;  2Q74 A;  2PCR A;  4GWZ A;  2DDK A;  4I3E A;  4AS5 A;  1NV2 A;  2QVV A;  4KXP A;  2CZH A;  2Q8M A;  2CZK A;  1IMC A;  2F3D A;  2OX3 A;  3A29 A;  4GX4 A;  5DW8 A;  2CZI A;  1FJ6 A;  5IZ3 B;  1RDY A;  4O7I A;  2VT5 A;  1FSA A;  1FRP A;  5J16 A;  2OWZ A;  3B8B A;  4FBP A;  5EYG A;  2FVZ A;  1K9Z A;  1EYI A;  4HE0 A;  1FPL A;  1NV6 A;  3FBP A;  1FPE A;  5IZ1 A;  1FPK A;  4I3Y A;  2Y5K A;  1IMB A;  3RPL A;  5EQA A;  1VDW A;  1FPI A;  1KA0 A;  1NV4 A;  2HHM A;  1RDX A;  4G61 A;  1JP4 A;  1FBC A;  1SPI A;  1KA1 A;  1YZ0 A;  4GWW A;  4QXD A;  1FBP A;  1AWB A;  1INP A;  1D9Q A;  4IR8 A;  5I3S A;  4GX3 A;  4AS4 A;  5ET8 A;  1FBH A;  1NV7 A;  1QGX A;  3IFA A;  4I40 A;  3LUZ A;  3RPL B;  5ET5 A;  1YYZ A;  3IFC A;  4MJO A;  1FPG A;  5EYH A;  3RYD A;  1BK4 A;  1IMF A;  1FJ9 A;  4N81 A;  4GBV A;  2JJK A;  5A5L A;  5EQ9 A;  5LDZ A;  1KZ8 A;  4HE1 A;  5ET7 A;  4GX6 A;  1DBZ A;  1G0H A;  1LBZ A;  1LBY A;  5EQ7 A;  5EQ8 A;  1NV3 A;  3LV0 A;  1NV5 A;  2WBB A;  5FBP A;  4PTK A;  2P3V A;  1DCU A;  1FPD A;  1FTA A;  4GWS A;  1NUY A;  4GWY A;  1LEV A;  3ROJ A;  1NUW A;  4GWU A;  2FBP A;  3QMF A;  2QFL A;  5ET6 A;  1LBW A;  1FBF A;  4GWX A;  1FPJ A;  3T0J A;  2FHY A;  5ESY A;  1FBE A;  1RDZ A;  2FIX A;  4H46 A;  2FIE A;  2WBD A;  2QVR A;  4HE2 A;  2GQ1 A;  2BJI A;  1LBV A;  2QVU A;  1LBX A;  4HXV A;  1FBD A;  1XI6 A;  1NUZ A; 
#chains in the Genus database with same CATH topology
 5IAI A;  1OLC A;  2H9B A;  5I2K B;  3UN6 A;  1EZ9 A;  3PUY E;  2E0S A;  1GR2 A;  3UA8 A;  3RLF E;  4N15 A;  2WYK A;  4JWO A;  4RY1 A;  5I57 B;  3RGY A;  4DXU A;  1IMA A;  5L9O A;  2DVC A;  1MPB A;  2ZZV A;  4PDH A;  2QPQ A;  4DCY A;  4H5G A;  1AMF A;  1N84 A;  1A54 A;  4PFB A;  3ODB A;  1JVX A;  1LCT A;  2QJE A;  2XXU A;  1I69 A;  2B65 A;  3LSF B;  2V84 A;  3R7X A;  4OFO A;  3QAX A;  2HQ0 A;  1H44 A;  1MXV A;  1MM6 A;  1RYX A;  3E13 X;  1SPI A;  4I8C A;  5DEX A;  2RC9 A;  1FBP A;  2Y7P A;  1N04 A;  4I40 A;  1RKM A;  1Y4T A;  1Y20 A;  2KR0 A;  4IO7 A;  1MY2 A;  4QFL A;  4NTL A;  3IAZ A;  4G2Z A;  1FJ9 A;  4N81 A;  2F35 A;  5EQ9 A;  1USY E;  5L9S A;  1Y1Z A;  3K1N A;  4ND9 A;  5IM2 A;  2QMW A;  1GV8 A;  2DE2 A;  1UTB A;  2R71 A;  2QFL A;  3K6U A;  3WAE A;  4NF6 A;  5ITO A;  1FPJ A;  2VHA A;  3OO9 A;  4LON B;  3MQ9 A;  2Q2A A;  4I62 A;  3KGC A;  4WXJ A;  3GYY A;  1SD3 A;  1SW1 A;  4U2R A;  4NED A;  5B7D A;  3TOD A;  3EHT A;  4R6H A;  1MY0 A;  3LC8 A;  1Q9D A;  5CMB A;  5JTY B;  3RTW B;  1YAE A;  3MP6 A;  4KFQ A;  3PGF A;  4R72 A;  1B7H A;  1MXW A;  1LCF A;  2UXA A;  4MHF A;  4I3E A;  3CVG A;  4FAT A;  2A5T A;  1XVX A;  4BDQ A;  3KN7 A;  2I49 A;  3DP4 A;  1WDN A;  4WKM A;  4NWC A;  1SQY A;  4HE0 A;  3SDF A;  3MP1 A;  3H3G A;  3NOH A;  1DTG A;  1O63 A;  4YMA A;  3FVO A;  3MZB A;  4GWW A;  2ZYK A;  1P1U A;  4WED A;  1R9L A;  3PPR A;  4MF3 A;  3VLW A;  5IZZ A;  3N26 A;  5ICQ A;  3TTM A;  2WKY A;  4MNI A;  3MVW A;  2QL3 A;  4MMP A;  4P1L A;  2JJK A;  5A5X B;  4ZEF A;  2WX9 A;  4HE1 A;  3S9E A;  1LBZ A;  2GHA A;  3MWB A;  2DWA A;  3CFL A;  2ZNT A;  3QK6 A;  2Q88 A;  4X8R A;  4GWY A;  4ZEK A;  3GBA A;  4H8I A;  4LZ5 A;  2P1S A;  3ZSF A;  4XKQ A;  2NVU B;  3OXN A;  4P11 A;  3PMX A;  1LAF E;  5JK4 A;  1POY 1;  3RQT A;  2UVG A;  4IGR A;  3E79 A;  4N8G A;  1XI6 A;  3HHG A;  4DXC A;  4NE4 A;  1G0I A;  1MS7 A;  4OVQ A;  3FVG A;  1MDQ A;  3KSX A;  3EPE A;  4MNC A;  3KEI A;  2IA4 A;  3KN3 A;  3MC2 A;  4I9D A;  1N76 A;  5IGA A;  4IO3 A;  4YAH X;  2THI A;  3Q29 A;  3C34 A;  3ZS6 A;  1NL5 A;  4G68 B;  3IR1 A;  4GX4 A;  1NFT A;  4H8J A;  4OZ9 A;  1NMU A;  3KN8 A;  3U1O A;  2OWS A;  4DLD A;  3IB2 A;  3RPL A;  4EUO A;  2BJJ X;  1FTK A;  3JV9 A;  1QVS A;  4QSC A;  1YZ0 A;  2XX9 A;  2O6A A;  2HXW A;  5ET8 A;  2PVU A;  4N4U A;  1SW4 A;  5H8Q B;  4LQ2 A;  5IKB A;  2UYE A;  4DI3 D;  3SET A;  4GBV A;  2ZZX A;  1PB9 A;  3QUJ A;  3TEL A;  5AA2 A;  1G0H A;  1J1N A;  4OYV A;  4GIZ A;  1PC3 A;  4NF4 A;  2P3V A;  3I5O A;  1MG1 A;  2F6P A;  1IEJ A;  3CFX A;  5I58 A;  2NWJ A;  3T0J A;  3IOW A;  4P47 A;  2O84 X;  1II5 A;  3V89 B;  1B1X A;  2AIX A;  4OXV A;  1TT1 A;  3G3G A;  1SI0 A;  3LR1 A;  1B1H A;  3GXA A;  2A5S A;  4OER A;  1FPB A;  2ABH A;  1BKA A;  4ZDM A;  4TLL B;  4YMB A;  2V3Q A;  4THI A;  1FPF A;  5AA3 A;  3VVF A;  2DWJ A;  4GQO A;  1LFH A;  4U4S A;  1O7T A;  3FIR A;  1SBP A;  2XXX A;  4PFR A;  3M3L A;  2AYS A;  4H1X A;  3K2D A;  3JYR A;  4PBQ A;  4G4P A;  4OA4 A;  1S9T A;  2VD3 A;  3TZA A;  4N07 A;  3SZP A;  4ZEC A;  3H4Z A;  4NF8 A;  3MJN A;  4U21 A;  4TOZ A;  1NV4 A;  3T22 A;  1B0H A;  1QW0 A;  1B4H A;  1DPP A;  1EH3 A;  5I5P A;  2RCB A;  4MFI A;  3HFU A;  5AA1 A;  1LFG A;  4KQP A;  4X1D A;  2F7B A;  4GRK A;  1I6B A;  1URG A;  2V93 A;  4H6D A;  1VFE A;  3K00 A;  1R1N A;  3QSL A;  5ET7 A;  4U1Z A;  4GF8 A;  1Y4C A;  3FAT A;  1Y9U A;  4NF6 B;  3K6W A;  3FV1 A;  1NH7 A;  4OES A;  1FTA A;  1P1Q A;  4H67 A;  2VGQ A;  5HPQ A;  1BLF A;  1US4 A;  2OLB A;  1LAG E;  4POX A;  3C31 A;  2V4C A;  2PMS A;  2QVR A;  1MQH A;  3G3J A;  3OSQ A;  3OEL A;  4UAC A;  3QIM A;  1CNQ A;  1MY1 A;  4GXS B;  1OVT A;  4BDL A;  3D1R A;  1EZP A;  2VPO A;  5DTB A;  2LAO A;  1ZU0 A;  3FVK A;  4KR5 A;  3H6V A;  1P99 A;  5ITP A;  5DT6 A;  2ZMB A;  1N7X A;  3UGW A;  1JW4 A;  4KXP A;  4OVJ A;  4U1O A;  5AA2 D;  5FTI A;  2XWV A;  3UP9 A;  3C33 A;  1FQC A;  2OWZ A;  1NH8 A;  3L6G A;  3RT8 A;  4N91 A;  1CB6 A;  5CC2 A;  4LP2 B;  3K6X A;  4PFU A;  1N7W A;  5AA4 A;  4KCD A;  4PFT A;  4H65 A;  3DEL B;  1CE2 A;  5I3S A;  1H43 A;  1QGX A;  3SEU A;  1HSE A;  1BK4 A;  4TLM B;  3TDJ A;  2RF1 A;  2XXQ A;  1UTH B;  3K4U A;  4JXI A;  4Q30 B;  2GH9 A;  2KLF A;  4UA8 A;  1DBZ A;  3OSR A;  3QYT A;  4G68 C;  5EQ7 A;  3ONM A;  4ELR A;  3IOT A;  4X9T A;  1NUY A;  3FVN A;  4KI0 E;  3QMF A;  3IX1 A;  4XFE A;  4HW8 A;  2QRY A;  5TPA A;  3N5L A;  3FJ7 A;  2XD3 A;  1ZLQ A;  4IY6 A;  2Z8E A;  4PP0 A;  4P3L A;  4HE2 A;  4NHB A;  1NUZ A;  4MAG A;  1NUX A;  5KDT B;  1IXI A;  4F18 A;  2Z8F A;  1IIW A;  3U92 A;  1IUD A;  2R8T A;  4ECF A;  4YKJ A;  4GBW A;  1VFD A;  3BIH A;  1Y1M A;  4EF2 A;  1D9V A;  3BFT A;  3FXR A;  3RT6 B;  2CEY A;  4K3F A;  3Q26 A;  2P0S A;  3TTK A;  1QJM A;  3KJ7 A;  3I6V A;  4BDO A;  1FSA A;  5J16 A;  3O6I A;  3IOU A;  3B7D A;  3FV2 A;  1IXH A;  5EQA A;  3CG3 A;  5TU0 A;  4YB5 A;  3MBP A;  3O97 A;  4OEU A;  3CFZ A;  4U22 A;  3HN0 A;  5KCJ A;  1TFD A;  2H25 A;  4O3B A;  4GX3 A;  4AS4 A;  2DE4 A;  1VSO A;  4G77 A;  4DCX A;  3LSL A;  1FQB A;  4PF8 A;  5AA2 B;  1NNF A;  4EDP A;  2XWI A;  4ESW A;  4ELO A;  4OHN A;  3W9V A;  5LDZ A;  4TQU Q;  4KYD A;  3ILT B;  4FIM A;  5I58 B;  1H3D A;  1B7Z A;  3ROJ A;  3FAS A;  3DLN A;  1LBW A;  1B05 A;  3E4R A;  3IJO B;  2AL4 A;  2REG A;  3FGS A;  1FBE A;  4LN5 A;  2QSX A;  2FIX A;  3TEP A;  2ALU A;  4C0R A;  4IB2 A;  1DK4 A;  3E3K A;  3SEX A;  1MXY A;  1LFI A;  3H6U A;  3EHS A;  5I7I A;  4N8Y A;  3PUX E;  3L6H A;  1UIU A;  5IZ3 A;  4QBA A;  4R73 A;  3CIJ A;  5K2Y A;  5F24 A;  1MH4 A;  2F5X A;  1B7U A;  2I48 A;  4NF0 A;  3A29 A;  1M5F A;  4MIJ A;  2M8C A;  3K0V A;  3B50 A;  3MUQ A;  1LB8 A;  1N3X A;  1RDY A;  1FQE A;  1IXC A;  4GWO A;  4P9K A;  4FBP A;  4OVT A;  5IZ1 A;  5H8H A;  1P1N A;  2D5W A;  3FZV A;  3Q25 A;  1AH5 A;  4O7M A;  2DS9 A;  2O51 A;  4R6Y A;  2PFZ A;  2F36 A;  4PFI A;  1B3G A;  3EN3 A;  4QSD A;  3IFA A;  5ET5 A;  3S9L C;  1O64 A;  4OMB A;  4OVR A;  4Q5T A;  4NMY A;  1B5I A;  5BWJ A;  4JWX A;  1GGG A;  5ICT A;  1QUI A;  4PGN A;  3H6T A;  2O68 A;  3VXC A;  2V3U A;  1DCU A;  3UK4 A;  2DP8 A;  4XTC Q;  3TUS A;  1FCK A;  1B3H A;  3CI8 A;  3K01 A;  2X26 A;  2XXR A;  2GQ1 A;  3M8U A;  4PCD A;  5I56 A;  2Y7I A;  3SES A;  4NG7 A;  1ZJL A;  3AXF A;  1A8F A;  3F11 A;  1KWH A;  3MZ9 A;  3KSJ A;  1BIY A;  1NV1 A;  4Z0I A;  2MKZ A;  3LSW A;  4AS5 A;  4NN3 A;  4G8M A;  4DDD A;  4O94 A;  1N0T A;  3TKD A;  2NXO A;  1B51 A;  4O7I A;  2PT1 A;  3HO7 A;  1FRP A;  4EXL A;  2B3F A;  4G8H A;  5CBR A;  4KCC A;  2FVZ A;  4F39 A;  5AA4 B;  4QFN A;  4NF5 A;  5TP9 B;  4ZE9 A;  3A3C A;  3VFJ A;  2E1S A;  4F2Q A;  1RDX A;  3H06 B;  2I0B A;  2XXI A;  3W9W A;  5CBS A;  1VE4 A;  1FTL A;  2VD2 A;  1ZBM A;  3DM0 A;  3JZJ A;  4PAF A;  4ZED A;  1B58 A;  1HSL A;  4RK9 A;  1FTM A;  1Y3P A;  1YCJ A;  2F34 A;  2X7Q A;  2UVI A;  3EHU A;  4F2O A;  3OO6 A;  3PD9 A;  4AQ4 A;  4R9F A;  3LSX A;  2QMX A;  2ZYM A;  5I2K A;  5BUU A;  4MEV A;  4PAI A;  2UYF A;  2ONK E;  2R6G E;  4QFK A;  3VE1 B;  3V83 A;  4MH5 A;  2FNC A;  3PV0 E;  2XHD A;  3ECR A;  4IO6 A;  2XXV A;  1SYH A;  4I1D A;  4P0I A;  1ELJ A;  4PC9 A;  4XIG Q;  3TQW A;  2O1L A;  3FD3 A;  2OBG A;  2H4I A;  3CSB A;  1ZIU A;  4BLA A;  1QKB A;  4FAJ A;  4MLV A;  2I6E A;  5M2V A;  4EQ9 A;  2HPG A;  4RJZ A;  3TTL A;  3RY3 A;  3S9N C;  2WYP A;  4PAK A;  4DI4 B;  2CMO A;  2REJ A;  3GBB A;  3Q28 A;  2OPD A;  1HSJ A;  2HZL A;  1LBB A;  1DPE A;  1MY4 A;  1FPK A;  1OMP A;  2F7C A;  5KCJ B;  2ONR A;  3PU5 A;  1JNF A;  3H03 A;  2ZXT A;  4QFP A;  4LUB A;  2P2A A;  2VP1 A;  3BFU A;  3SEY A;  1H45 A;  3VXB A;  3LUZ A;  3VLU A;  3G3F A;  4JSD A;  1FQD A;  2HAU A;  3T93 B;  4ESX A;  4UAB A;  5DEX B;  1D4N A;  3S4U A;  3LV0 A;  3K6V A;  1NV5 A;  3K1M A;  2HEU A;  1B3F A;  2Q2C A;  4PTK A;  2YPN A;  3KBR A;  4LZ8 A;  4F3S A;  4OQO A;  4F22 A;  2DQV A;  3OMB A;  1D9Y A;  4OVP A;  1F9B A;  2HFB A;  3G3I A;  5EYF A;  5JTY A;  3TPA A;  2QS4 A;  2Y7K A;  4R6K A;  1UTB B;  4EQ7 A;  2XXK A;  4XKR A;  3KC1 A;  3C4M A;  3TMG A;  4ELP A;  4POW A;  3KFM A;  5H8S A;  4LQ5 A;  1UIV A;  1IME A;  1ANF A;  3KBZ A;  2YJP A;  1POT A;  4R9G A;  4O3A A;  4YU0 A;  4N6K A;  2PBW A;  4YB7 A;  2DOJ A;  4ZS9 A;  4P0G A;  4YB6 A;  1GTK A;  2ESN A;  1XC1 A;  1ATG A;  3U94 A;  2F8D A;  1PEB A;  2H5Y A;  2D21 A;  4OWD A;  3PPQ A;  3TFL A;  4QRZ A;  4M4G A;  3IB0 A;  1UQW A;  3FBP A;  3OOA A;  2Y5K A;  1IMB A;  4YIC A;  1FTO A;  2A5T B;  1SVX B;  1BP5 A;  4LA9 A;  4ZEI A;  1PBQ A;  2HHM A;  1R9Q A;  2Z23 A;  2XXY A;  5A5X A;  3MYU A;  4RA1 A;  5LTC A;  3IO4 A;  2Y7R A;  3D4G A;  1B5H A;  3CR9 A;  5EHM A;  4N6D A;  3ISP A;  2DXY A;  4EF1 A;  3W15 C;  4KYE A;  3THI A;  1JEU A;  4Q8R A;  2OPE A;  4JWY A;  1TXF A;  1SDX A;  1SW5 A;  3C9H A;  1PDA A;  1MXZ A;  4U4X A;  3SEV A;  3CG1 A;  3LUY A;  5ESY A;  1A40 A;  5I56 B;  2ZNS A;  2RCA A;  5H8F A;  1XHY A;  4C1U A;  5L8D A;  1B40 A;  1M5B A;  1IZ1 A;  3PMW A;  1LLS A;  3QXM A;  4KD5 A;  3H7M A;  1I6Q A;  2I4B A;  1K9Y A;  4IO4 A;  4ISU A;  3QUF A;  2F97 A;  4DE8 A;  3R6U A;  1YXI A;  2ONS A;  2QS1 A;  1SW2 A;  4DIG A;  2Y5L A;  3PTY A;  2WEF A;  3EF7 A;  5CI5 A;  1RYO A;  1SI1 A;  1A55 A;  1NV2 A;  1MY3 A;  1JW5 A;  2FA7 A;  3T1B A;  5DW8 A;  3FXQ A;  4R75 A;  1LGB C;  1NNK A;  1N3W A;  3B8B A;  2HZK A;  1K9Z A;  3T9X B;  4RPN A;  3KG2 A;  3IK6 B;  5LOM A;  4KYS A;  3UOR A;  4NWD A;  3U65 A;  5I59 A;  3E78 A;  3ZKK A;  1URD A;  3IB1 A;  1ZKB A;  5H8N A;  3EKI A;  1PB7 A;  3MVZ A;  1D9Q A;  1NV7 A;  3RPL B;  4LAT A;  1YYZ A;  2I3W A;  2RC7 A;  4KHZ E;  1URS A;  3V8X B;  2XA5 A;  3O29 A;  2PFY A;  4Q0C A;  3MVX A;  4RXL A;  1LST A;  3G3H A;  4H5F A;  3TAJ A;  4NQ8 A;  3FUZ A;  3TTN A;  1IIT A;  2OCU A;  1B2H A;  5CMC A;  1QKA A;  2I0C A;  1FBF A;  3C35 A;  3TTR A;  4O8M A;  2HCA A;  4YKI A;  3O28 A;  1XT8 A;  4C1T A;  1VR5 A;  5CM6 A;  1OQH A;  2DE3 A;  4NF4 B;  3P7I A;  4EXK A;  1QUJ A;  1TFA A;  1YTV A;  5DVI A;  3B6T A;  4OET A;  1PB8 A;  1YPN A;  4XKN A;  2XXT A;  1B6H A;  3GLB A;  3IO6 A;  1EYK A;  5T3J A;  4GLI A;  4ZE8 A;  2O1M A;  1MQI A;  3O6G A;  4DXB A;  3LBS A;  3O66 A;  1Z7M E;  2DVZ A;  3VDF A;  4AB5 A;  2DDK A;  1NNT A;  3PPP A;  1XVY A;  5ELV A;  1OLA A;  2HXR A;  4R2F A;  1L5T A;  5FTH A;  4F3B A;  4GL8 A;  1A7L A;  3T96 B;  5CRY A;  1EU8 A;  1FPE A;  4JVD A;  2XX7 A;  2Q9T A;  1MQG A;  1FPI A;  2NUV A;  1KA0 A;  2PYY A;  4GOT A;  2OWT A;  3PUW E;  4F3G A;  5FHM A;  3T9H B;  2UVH A;  2V25 A;  4QXD A;  4NX1 A;  1JVY A;  4HCW A;  3T66 A;  4OFJ A;  3IOR A;  4MX6 A;  3O6H A;  2G93 A;  2Z22 A;  4NF8 B;  1FQF A;  4OAN A;  1FQA A;  2GHB A;  3SKP A;  5A5L A;  2XD2 A;  2Y84 A;  4BDM A;  3TCH A;  1B3L A;  1LAH E;  4F31 B;  1NV3 A;  4BDN A;  4GFR A;  5FHO A;  3A09 A;  1LEV A;  4GD5 A;  2FBP A;  1PBP A;  4XEQ A;  4RNS A;  2Y7W A;  4QFO A;  1FTJ A;  3PUV E;  3OEN A;  4QF9 A;  2BJI A;  2QVU A;  4HXV A;  2H98 A;  5K2X A;  1JET A;  3PPN A;  4HS7 A;  4IO5 A;  1MPD A;  3N6T A;  2XWK A;  4P56 A;  2IEE A;  2KQZ A;  3E9X A;  2HAV A;  3I3V A;  1Q35 A;  4IO2 A;  4IGT A;  3PD8 A;  2XX8 A;  2DSF A;  1NKX A;  2P3N A;  1OVB A;  1BTJ A;  2PCR A;  4RPO A;  1H76 A;  3MVY A;  2Q8M A;  2CZK A;  2F3D A;  3C36 A;  4JBZ A;  4FEB A;  5KZT A;  2CZI A;  1US5 A;  1QUL A;  1LAX A;  2VT5 A;  2CZL A;  3VVD A;  1S50 A;  4YZZ A;  2XXP A;  1NV6 A;  4FJP A;  3U8Q A;  4I3Y A;  3K02 A;  4IY5 A;  4G8N A;  3U72 A;  3IL1 B;  3V5A A;  3TCG A;  4L17 A;  3RNN A;  4G61 A;  1JP4 A;  1UTH A;  3DP6 A;  2O7U A;  2ZNU A;  1KA1 A;  1AIV A;  4XKP A;  1INP A;  4IR8 A;  1OQG A;  4PE5 B;  1P1W A;  4U23 A;  5HM4 B;  4MJO A;  1NNP A;  1Y3Q A;  3A3U A;  1FPG A;  1M5E A;  3RYD A;  5I2N A;  4PF6 A;  1IMF A;  3B6Q A;  1B52 A;  4H0W A;  5J1D A;  3IOV A;  3MAM A;  2WBB A;  3KZG A;  4M1V A;  1JEV A;  2GRV A;  4JSO A;  1MPC A;  4JVC A;  5DYH A;  4R2B A;  5KDT A;  5ET6 A;  5H8F B;  1DMB A;  3EQ1 A;  2I3V A;  1M5D A;  4X04 A;  3M3F A;  3D4C A;  4X1B A;  3OEM A;  2WBD A;  1LBX A;  4ELQ A;  4X48 A;  4RK2 A;  2DYX A;  2DWH A;  3RTF B;  5FHN A;  3PUZ E;  3ZKL A;  2Z8D A;  5TPA B;  3T9U A;  2XXH A;  4YKP A;  4LZ7 A;  5I84 A;  1A8E A;  5F7V A;  3M3K A;  4PQJ A;  1P1O A;  3H6W A;  2Q74 A;  5I57 A;  1EZO A;  4GL0 A;  1IMC A;  2L5V A;  3BBR A;  1LB9 A;  4ZEB A;  4P1E A;  3FJM A;  1IQ7 A;  4F3P A;  3VV5 A;  3FJG A;  5EYG A;  2G29 A;  1DOT A;  5B70 A;  5I59 B;  4NAP A;  2ZYN A;  1AOV A;  1B0L A;  4FE8 A;  5H8N B;  1VDW A;  2QS3 A;  2XXW A;  1FBC A;  3N6U A;  4LVQ A;  1OIB A;  4RYA A;  2Q89 A;  4ONY A;  4QHQ A;  4WEP A;  2GFE A;  1AWB A;  1T0K A;  1R6Z A;  2O7I A;  1WOD A;  3O2A A;  3RPW A;  4NGU A;  1USY H;  3FXB A;  3SEW A;  4R74 A;  4O3C A;  1KZ8 A;  3GZG A;  4GX6 A;  3U93 A;  2OJT A;  2UVJ A;  3HPI A;  1S7Y A;  5CMK A;  4GWU A;  3MPL A;  1MM7 A;  4OEN A;  1DTZ A;  3IJX B;  2FHY A;  1RDZ A;  3USD A;  3TCF A;  4Z7E A;  3C32 A;  1FW0 A;  1B9J A;  4H46 A;  2FIE A;  2QS2 A;  3RUM A;  1TWY A;  1WVJ A;  5CMM A;  1B46 A;  1FBD A;  1ZTY A;  1NV0 A;  1M5C A;  2YLN A;  3CSG A;  2I4C A;  4OVS A;  1B4Z A;  2H99 A;  2F3B A;  1IMD A;  3S9M C;  1FBG A;  1AL3 A;  5ISU A;  5EHS A;  3KC0 A;  3HST A;  4GXA A;  3FXU A;  1NI9 A;  1IXG A;  3HCQ A;  1EYJ A;  2VPN A;  4E0W A;  4MBP A;  1DSN A;  2QVV A;  2CZH A;  2VOZ A;  3Q27 A;  2OX3 A;  1B32 A;  2X7P A;  5IZ3 B;  5JEI A;  4HCY A;  3K1P A;  1EYI A;  4MLQ A;  4FEC A;  4XF5 A;  3TQL A;  2PT2 A;  1JW1 A;  4N6P A;  2ZYO A;  5H8H B;  1JQF A;  4ZZA A;  1FBH A;  2V3T A;  3MW0 A;  3BKI B;  4MNP A;  1D3K A;  4GVO A;  1B3E A;  3IFC A;  2ANJ A;  5EYH A;  1MH3 A;  1MQJ A;  4PET A;  3CRB A;  3WAF A;  2B4M A;  1B5J A;  2DXR A;  2F6G A;  4FOR A;  3OO7 A;  5FBP A;  1XOC A;  3OD7 A;  3PMV A;  4GWS A;  3MZ1 A;  1NUW A;  2RC8 A;  2RIN A;  4HTG A;  3DP8 A;  4PFY A;  2PX1 A;  3N94 A;  4GWX A;  2ZZW A;  2NOO A;  2F78 A;  4PFW A;  4F29 A;  1MDP 1;  4PDD A;  3G7W A;  3HHF A;  5HBC A;  2Q8J A;  5DVJ A;  4FED A;  1GVC A;  1LBV A;  2XWO A;  3MP8 A;  2OZZ A;  1A99 A;  4H45 A;  2W7Y A;  4F1V A;  4JDF A;  4DZ1 A;  4F1Y A;  2RKM A;  4YKK A;  2R9J A;  3BIG A;  2D3I A;  1ZMG A;  4BDR A;  2B4L A;  5DVF A;  4GWZ A;  4N17 A;  5TP9 A;  4JVI A;  4AB6 A;  4MCO A;  4ZZE A;  3SER A;  2CEX A;  3VLV A;  4PBH A;  1FJ6 A;  3TYH A;  4G68 A;  4JB7 A;  3RN8 A;  3R26 A;  1FPL A;  3MST A;  1MXX A;  1I6A A;  4QSE A;  3OO8 A;  3KOT A;  1MQD A;  2FYI A;  3OEK A;  4N13 A;  3G3K A;  1SYI A;  3T9V A;  4XXU A;  3B6W A;  2DWI A;  1Y3N A;  2O69 A;  2I58 A;  3ILU B;  5I2N B;  4NF5 B;  5F1Q A;  3CHG A;  1Q1K A;  1MXU A;  3KJT A;  3S2V A;  4PGP A;  5H8Q A;  4F19 A;  5L9M A;  4P8B A;  3MPK A;  1QUK A;  1LBY A;  5EQ8 A;  5AE4 A;  3O9P A;  2F7A A;  2AL5 A;  3HV1 A;  1FPD A;  4OFL A;  1XS5 A;  4OTE A;  3UIF A;  1MRP A;  3KOS A;  3VVE A;  4EQB A;  4KPT A;  2OK2 A;  3PPO A;  4E0X A;  4PE3 A;  1Z7N E;  1LBC A;  4F1U A;  2B3B A;  4OEV A; 
#chains in the Genus database with same CATH homology
 1CNQ A;  2XWK A;  4P56 A;  3D1R A;  4PC9 A;  2KQZ A;  2VPO A;  4N15 A;  2WYK A;  2P3N A;  1IMA A;  2PCR A;  2HPG A;  2ZZV A;  4KXP A;  4PDH A;  2Q8M A;  2QPQ A;  2CZK A;  2F3D A;  2WYP A;  4PAK A;  4DI4 B;  2XWV A;  2CZI A;  2VT5 A;  4PFB A;  2HZL A;  2OWZ A;  4YZZ A;  4N91 A;  1NV6 A;  1FPK A;  4I3Y A;  4G61 A;  1JP4 A;  1SPI A;  1KA1 A;  1FBP A;  1INP A;  4IR8 A;  5I3S A;  1QGX A;  4I40 A;  3LUZ A;  2KR0 A;  4MJO A;  1FPG A;  3RYD A;  1BK4 A;  4PF6 A;  1IMF A;  1FJ9 A;  4N81 A;  4UAB A;  5EQ9 A;  5J1D A;  1DBZ A;  5EQ7 A;  3LV0 A;  1NV5 A;  2WBB A;  4M1V A;  4X9T A;  4PTK A;  5IM2 A;  1NUY A;  4JVC A;  2DE2 A;  3QMF A;  2QFL A;  5ET6 A;  4XFE A;  4X04 A;  1FPJ A;  4OVP A;  4P3L A;  2WBD A;  4HE2 A;  1LBX A;  4NHB A;  3GYY A;  4MAG A;  1NUX A;  4F18 A;  2XXK A;  3KC1 A;  2R8T A;  1Q9D A;  4GBW A;  3BIH A;  1IME A;  3KBZ A;  2CEY A;  2Q74 A;  4N6K A;  4MHF A;  4I3E A;  1IMC A;  2L5V A;  4P1E A;  1FSA A;  5J16 A;  5EYG A;  4HE0 A;  3FBP A;  4NAP A;  2Y5K A;  3NOH A;  1IMB A;  4YIC A;  5EQA A;  1VDW A;  2HHM A;  1FBC A;  4GWW A;  3MYU A;  1AWB A;  5LTC A;  4GX3 A;  4AS4 A;  2DE4 A;  4PF8 A;  5IZZ A;  4NGU A;  3FXB A;  4MNI A;  2XWI A;  4MMP A;  4P1L A;  4N6D A;  3ISP A;  2JJK A;  3W9V A;  5LDZ A;  1KZ8 A;  2WX9 A;  4HE1 A;  4GX6 A;  1LBZ A;  4X8R A;  4GWY A;  3ROJ A;  4GWU A;  1LBW A;  2FHY A;  5ESY A;  5JK4 A;  1FBE A;  1RDZ A;  4LN5 A;  2FIX A;  4H46 A;  2FIE A;  3E79 A;  4N8G A;  1FBD A;  1XI6 A;  1NV0 A;  1G0I A;  4OVS A;  4OVQ A;  2F3B A;  1DK4 A;  1K9Y A;  4MNC A;  1IMD A;  1FBG A;  5I7I A;  4N8Y A;  3KC0 A;  5IZ3 A;  4QBA A;  5IGA A;  1YXI A;  1NI9 A;  2Y5L A;  3PTY A;  5F24 A;  2WEF A;  1EYJ A;  2F5X A;  2VPN A;  4NF0 A;  1NV2 A;  2QVV A;  2CZH A;  2OX3 A;  3A29 A;  4MIJ A;  4GX4 A;  3T1B A;  3B50 A;  5DW8 A;  5IZ3 B;  1RDY A;  4P9K A;  3B8B A;  4FBP A;  2HZK A;  4HCY A;  1K9Z A;  1EYI A;  4OVT A;  5IZ1 A;  4XF5 A;  3RPL A;  4O7M A;  3U65 A;  3E78 A;  2PFZ A;  4PFI A;  3EKI A;  1YZ0 A;  1D9Q A;  5ET8 A;  4N4U A;  1FBH A;  1NV7 A;  3IFA A;  4MNP A;  3RPL B;  5ET5 A;  1YYZ A;  3IFC A;  4DI3 D;  5EYH A;  4OVR A;  4PET A;  2XA5 A;  2PFY A;  4GBV A;  2ZZX A;  2B4M A;  4PGN A;  1G0H A;  5FBP A;  2P3V A;  1DCU A;  4GWS A;  4NQ8 A;  1NUW A;  1FBF A;  4GWX A;  3T0J A;  2ZZW A;  4O8M A;  4P47 A;  4PDD A;  5CM6 A;  2DE3 A;  2GQ1 A;  1LBV A;  2XWO A;  4PCD A;  4H45 A;  4NG7 A;  4F1V A;  1FPB A;  1EYK A;  5T3J A;  2V3Q A;  3BIG A;  1NV1 A;  1FPF A;  2DVZ A;  2B4L A;  4GWZ A;  2MKZ A;  4N17 A;  2DDK A;  4JVI A;  4NN3 A;  4AS5 A;  4MCO A;  4O94 A;  2CEX A;  4PBH A;  4PFR A;  1FJ6 A;  4O7I A;  2HXR A;  4PBQ A;  1FRP A;  4OA4 A;  2FVZ A;  1FPL A;  1FPE A;  3MST A;  3SZP A;  4JVD A;  2Q9T A;  1FPI A;  1KA0 A;  1NV4 A;  1RDX A;  3W9W A;  4QXD A;  4NX1 A;  5I5P A;  4HCW A;  4MX6 A;  3HFU A;  3CHG A;  4OAN A;  4PAF A;  4PGP A;  4F19 A;  5A5L A;  4P8B A;  5ET7 A;  1LBY A;  5EQ8 A;  1NV3 A;  1FPD A;  1FTA A;  1LEV A;  2FBP A;  4XEQ A;  4MEV A;  4PAI A;  2V4C A;  4PE3 A;  2QVR A;  2BJI A;  2QVU A;  4HXV A;  4F1U A;  1NUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...