5LFNA

Crystal structure of human chondroadherin
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
324
Chain Sequence
CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chondroadherin
publication title Crystal structure of human chondroadherin: solving a difficult molecular-replacement problem using de novo models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 104
structure length 324
sequence length 324
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5lfnA00
5IJDA 2OMWA 1M0ZA 2O6SA 4Q62A 3ZYIA 4IM6A 2OMZA 4RCAB 4PERA 4V2DA 4UFRA 4ECNA 2RA8A 1D0BA 4R5DA 4CNCA 1M9SA 4L3AA 4Y61B 4AY9X 2ASSB 3E2JA 1FS2A 1PGVA 1DCEA 3C6NB 4FD0A 4U08A 4M7EA 2O6QA 4BSSA 3CVRA 4R09A 4RWTC 1XWDC 2OMTA 3KJ4A 3G3BA 5HZLB 5A5CA 3G04C 1P9AG 3WPIA 2V9SA 1DS9A 4Q3IA 3W3LA 4Z79A 2WFHA 4K17A 2OMXA 1H6UA 4CC4C 2UZYA 3OJAB 3PMHG 2A0ZA 1O6SA 4LSAA 4U09A 5GQRK 5GS2B 3UN9A 1OTNA 4Z94G 3O53A 4ARRA 4C2AB 3M19A 1FT8A 2O6RA 3VQ1A 3GOZA 4GT6A 2P1QB 3RW6A 5IYXC 4U7LA 2BNHA 2Z66A 5FTTB 2ELLA 4CILA 2P1MB 4R6JA 1QYYA 3E4GA 1IO0A 4J0MA 3ULVA 4PQ8A 1O6VA 4P91A 4GLPA 4NKHA 3G39A 4LI1A 1SQ0B 4QC0A 2Z81A 4KT1A 1XKUA 1O6TA 1W8AA 3A79B 4KNGA 4V2CA 1OZNA 2JE0A 3OJAA 4U06A 3TSRE 4FS7A 5CMNA 3WPFA 3UL9A 5AWAA 3E3ZA 4LSCA 1P8VA 3RIZA 2OMVA 4BV4R 3ULUA 1A4YA 1XCDA 4R0AA 2FT3A 1YRGA 4R5CA 3W3KA 3WPCA 4G8AA 1ZIWA 4I6JB 4KXFB 3W3NA 4PEQB 5IJBA 3ZYOA 3BZ5A 4QXEA 3WPEA 3RGXA 4YEBB 5GMFA 2UZXA 4LSXA 1P8TA 3REZA 4L3FA 4R6FA 2IFGA 1OTOA 2BEXA 3G3AA 1LTXA 2ID5A 5IJCA 2ASTB 3JB9j 2Z63A 3C6PB 2WQUA 2P1PB 5GMGA 4ECOA 4LXRA 3ULAA 2RR6A 4LI2A 1Z7XW 4QBZA 4AW4A 5B0NA 4H09A 2Z65A 2CA6A 4FMZA 2Z7XB 2WQWA 1KOOA 5B0TA 3WN4A 4OQTA 4WYKA 4TZHA 4R08A 1M9LA 5HDHA 2Q4GW 5AWBA 4Z64C 2WQVA 4ARNA 3C6OB 4M7EC 4PKIG 4C2BB 1XEUA 2JQDA 1OTMA 3CIGA 4J4LA 4Q3GA 3RGZA 4R6GA 3P72A 4LXSA 4CNMA 5GS0A 4FCGA 4CC4A 3RJ0A 4RCWA 3W3JA 1A9NA 2Z64A 1JL5A 3WPHA 3OGLB 4B8CD 4XOSA 2V70A 1WWLA 2Z82A 2P1OB 1FQVA 2Z62A 4CP6A 4R58A 4Z8GA 3WPGA 3WPBA 4BSUA 3W3MA 2V9TB 4HQ1A 5CMPA 3M18A 2Z7XA 3VQ2A 2Y5QA 3RFJA 1U0ND 3WPDA 1FO1A 1KOHA 4R07A 3ZYNA 2XOTA 3RFEA 5AZ5A 1G9UA 1K5DC 4MN8B 4Z61C 4NKGA 1OGQA 2WQXA 5GMHA 2R9UA 4BSRA 2XWTC 3O6NA 3DZEA 1XECA 3RFSA 3OGKB 4PSJA 5B4PA 3W3GA 4MQWX 4FHOA 1K5GC 3OGMB 4P8SA 3UL8A 5LFNA 4V2EA 3RW7A 4R6AA 1GWBA 4EZGA 4XSQA 3UL7A 2P1NB 4XGOA 3FXIA 2OMYA 4FDWA 1DFJI 1OOKG 2JE1A 3SB4A 5D3IA 1M10B 5AWDA 2OMUA 3G06A 4WP6A 5AWCA 3E6JA 3CIYA 3ZYJA 4LSXC 1H6TA
chains in the Genus database with same CATH superfamily
5IJDA 2OMWA 1M0ZA 2O6SA 4Q62A 3ZYIA 4IM6A 2OMZA 4RCAB 4PERA 4V2DA 4UFRA 4ECNA 2RA8A 1D0BA 4R5DA 4CNCA 1M9SA 4L3AA 4Y61B 4AY9X 2ASSB 3E2JA 1FS2A 1PGVA 1DCEA 3C6NB 4FD0A 4U08A 4M7EA 2O6QA 4BSSA 3CVRA 4R09A 4RWTC 1XWDC 2OMTA 3KJ4A 3G3BA 5HZLB 5A5CA 3G04C 1P9AG 3WPIA 2V9SA 1DS9A 4Q3IA 3W3LA 4Z79A 2WFHA 4K17A 2OMXA 1H6UA 4CC4C 2UZYA 3OJAB 3PMHG 2A0ZA 1O6SA 4LSAA 4U09A 5GQRK 5GS2B 3UN9A 1OTNA 4Z94G 3O53A 4ARRA 4C2AB 3M19A 1FT8A 2O6RA 3VQ1A 3GOZA 4GT6A 2P1QB 3RW6A 5IYXC 4U7LA 2BNHA 2Z66A 5FTTB 2ELLA 4CILA 2P1MB 4R6JA 1QYYA 3E4GA 1IO0A 4J0MA 3ULVA 4PQ8A 1O6VA 4P91A 4GLPA 4NKHA 3G39A 4NZRM 4LI1A 1SQ0B 4QC0A 2Z81A 4KT1A 1XKUA 1O6TA 1W8AA 3A79B 4KNGA 4V2CA 1OZNA 2JE0A 3OJAA 4U06A 3TSRE 4FS7A 5CMNA 3WPFA 3UL9A 5AWAA 3E3ZA 4LSCA 1P8VA 3RIZA 2OMVA 4BV4R 3ULUA 1A4YA 1XCDA 4R0AA 2FT3A 1YRGA 4R5CA 3W3KA 3WPCA 4G8AA 1ZIWA 4I6JB 4KXFB 3W3NA 4PEQB 5IJBA 3ZYOA 3BZ5A 4QXEA 3WPEA 3RGXA 4YEBB 5GMFA 2UZXA 4LSXA 1P8TA 3REZA 4L3FA 4R6FA 2IFGA 1OTOA 2BEXA 3G3AA 1LTXA 2ID5A 5IJCA 2ASTB 3JB9j 2Z63A 3C6PB 2WQUA 2P1PB 5GMGA 4ECOA 4LXRA 3ULAA 2RR6A 4LI2A 1Z7XW 4QBZA 4AW4A 5B0NA 4H09A 2Z65A 2CA6A 4FMZA 2Z7XB 2WQWA 1KOOA 5B0TA 3WN4A 4OQTA 4WYKA 4TZHA 4R08A 1M9LA 5HDHA 2Q4GW 5AWBA 4Z64C 2WQVA 4ARNA 3C6OB 4M7EC 4PKIG 4C2BB 1XEUA 2JQDA 1OTMA 3CIGA 4J4LA 4Q3GA 3RGZA 4R6GA 3P72A 4LXSA 4CNMA 5GS0A 4FCGA 4CC4A 3RJ0A 4RCWA 3W3JA 1A9NA 2Z64A 1JL5A 3WPHA 3OGLB 4B8CD 4XOSA 2V70A 1WWLA 2Z82A 2P1OB 1FQVA 2Z62A 4CP6A 4R58A 4Z8GA 3WPGA 3WPBA 4BSUA 3W3MA 2V9TB 4HQ1A 5CMPA 3M18A 2Z7XA 3VQ2A 2Y5QA 3RFJA 1U0ND 3WPDA 1FO1A 1KOHA 4R07A 3ZYNA 2XOTA 3RFEA 5AZ5A 1G9UA 1K5DC 4MN8B 4Z61C 4NKGA 1OGQA 2WQXA 5GMHA 2R9UA 4BSRA 2XWTC 3O6NA 3DZEA 1XECA 3RFSA 3OGKB 4PSJA 5B4PA 3W3GA 4MQWX 4FHOA 1K5GC 3OGMB 4P8SA 3UL8A 5LFNA 4V2EA 3RW7A 4R6AA 1GWBA 4EZGA 4XSQA 3UL7A 2P1NB 4XGOA 3FXIA 2OMYA 4FDWA 1DFJI 1OOKG 2JE1A 3SB4A 5D3IA 1M10B 5AWDA 2OMUA 3G06A 4WP6A 5AWCA 3E6JA 4NZTM 3CIYA 3ZYJA 4LSXC 1H6TA
chains in the Genus database with same CATH topology
5IJDA 2OMWA 1M0ZA 2O6SA 4Q62A 3ZYIA 4IM6A 2OMZA 4RCAB 4PERA 4V2DA 4UFRA 4ECNA 2RA8A 1D0BA 4R5DA 4CNCA 1M9SA 4L3AA 4Y61B 4AY9X 2ASSB 3E2JA 1FS2A 1PGVA 1DCEA 3C6NB 4FD0A 4U08A 4M7EA 2O6QA 4BSSA 3CVRA 4R09A 4RWTC 1XWDC 2OMTA 3KJ4A 3G3BA 5HZLB 5A5CA 3G04C 1P9AG 3WPIA 2V9SA 1DS9A 4Q3IA 3W3LA 4Z79A 2WFHA 4K17A 2OMXA 1H6UA 4CC4C 2UZYA 3OJAB 3PMHG 2A0ZA 1O6SA 4LSAA 4U09A 5GQRK 5GS2B 3UN9A 1OTNA 4Z94G 3O53A 4ARRA 4C2AB 3M19A 1FT8A 2O6RA 3VQ1A 3GOZA 4GT6A 2P1QB 3RW6A 5IYXC 4U7LA 2BNHA 2Z66A 5FTTB 2ELLA 4CILA 2P1MB 4R6JA 1QYYA 3E4GA 1IO0A 4J0MA 3ULVA 4PQ8A 1O6VA 4P91A 4GLPA 4NKHA 3G39A 4LI1A 1SQ0B 4QC0A 2Z81A 4KT1A 1XKUA 1O6TA 1W8AA 3A79B 4KNGA 4V2CA 1OZNA 2JE0A 3OJAA 4U06A 3TSRE 4FS7A 5CMNA 3WPFA 3UL9A 5AWAA 3E3ZA 4LSCA 1P8VA 3RIZA 2OMVA 4BV4R 3ULUA 1A4YA 1XCDA 4R0AA 2FT3A 1YRGA 4R5CA 3W3KA 3WPCA 4G8AA 1ZIWA 4I6JB 4KXFB 3W3NA 4PEQB 5IJBA 3ZYOA 3BZ5A 4QXEA 3WPEA 3RGXA 4YEBB 5GMFA 2UZXA 4LSXA 1P8TA 3REZA 4L3FA 4R6FA 2IFGA 1OTOA 2BEXA 3G3AA 1LTXA 2ID5A 5IJCA 2ASTB 3JB9j 2Z63A 3C6PB 2WQUA 2P1PB 5GMGA 4ECOA 4LXRA 3ULAA 2RR6A 4LI2A 1Z7XW 4QBZA 4AW4A 5B0NA 4H09A 2Z65A 2CA6A 4FMZA 2Z7XB 2WQWA 1KOOA 5B0TA 3WN4A 4OQTA 4WYKA 4TZHA 4R08A 1M9LA 5HDHA 2Q4GW 5AWBA 4Z64C 2WQVA 4ARNA 3C6OB 4M7EC 4PKIG 4C2BB 1XEUA 2JQDA 1OTMA 3CIGA 4J4LA 4Q3GA 3RGZA 4R6GA 3P72A 4LXSA 4CNMA 5GS0A 4FCGA 4CC4A 3RJ0A 4RCWA 3W3JA 1A9NA 2Z64A 1JL5A 3WPHA 3OGLB 4B8CD 4XOSA 2V70A 1WWLA 2Z82A 2P1OB 1FQVA 2Z62A 4CP6A 4R58A 4Z8GA 3WPGA 3WPBA 4BSUA 3W3MA 2V9TB 4HQ1A 5CMPA 3M18A 2Z7XA 3VQ2A 2Y5QA 3RFJA 1U0ND 3WPDA 1FO1A 1KOHA 4R07A 3ZYNA 2XOTA 3RFEA 5AZ5A 1G9UA 1K5DC 4MN8B 4Z61C 4NKGA 1OGQA 2WQXA 5GMHA 2R9UA 4BSRA 2XWTC 3O6NA 3DZEA 1XECA 3RFSA 3OGKB 4PSJA 5B4PA 3W3GA 4MQWX 4FHOA 1K5GC 3OGMB 4P8SA 3UL8A 5LFNA 4V2EA 3RW7A 4R6AA 1GWBA 4EZGA 4XSQA 3UL7A 2P1NB 4XGOA 3FXIA 2OMYA 4FDWA 1DFJI 1OOKG 2JE1A 3SB4A 5D3IA 1M10B 5AWDA 2OMUA 3G06A 4WP6A 5AWCA 3E6JA 3CIYA 3ZYJA 4LSXC 1H6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IJD A;  2OMW A;  1M0Z A;  2O6S A;  4Q62 A;  3ZYI A;  4IM6 A;  2OMZ A;  4RCA B;  4PER A;  4V2D A;  4UFR A;  4ECN A;  2RA8 A;  1D0B A;  4R5D A;  4CNC A;  1M9S A;  4L3A A;  4Y61 B;  4AY9 X;  2ASS B;  3E2J A;  1FS2 A;  1PGV A;  1DCE A;  3C6N B;  4FD0 A;  4U08 A;  4M7E A;  2O6Q A;  4BSS A;  3CVR A;  4R09 A;  4RWT C;  1XWD C;  2OMT A;  3KJ4 A;  3G3B A;  5HZL B;  5A5C A;  3G04 C;  1P9A G;  3WPI A;  2V9S A;  1DS9 A;  4Q3I A;  3W3L A;  4Z79 A;  2WFH A;  4K17 A;  2OMX A;  1H6U A;  4CC4 C;  2UZY A;  3OJA B;  3PMH G;  2A0Z A;  1O6S A;  4LSA A;  4U09 A;  5GQR K;  5GS2 B;  3UN9 A;  1OTN A;  4Z94 G;  3O53 A;  4ARR A;  4C2A B;  3M19 A;  1FT8 A;  2O6R A;  3VQ1 A;  3GOZ A;  4GT6 A;  2P1Q B;  3RW6 A;  5IYX C;  4U7L A;  2BNH A;  2Z66 A;  5FTT B;  2ELL A;  4CIL A;  2P1M B;  4R6J A;  1QYY A;  3E4G A;  1IO0 A;  4J0M A;  3ULV A;  4PQ8 A;  1O6V A;  4P91 A;  4GLP A;  4NKH A;  3G39 A;  4LI1 A;  1SQ0 B;  4QC0 A;  2Z81 A;  4KT1 A;  1XKU A;  1O6T A;  1W8A A;  3A79 B;  4KNG A;  4V2C A;  1OZN A;  2JE0 A;  3OJA A;  4U06 A;  3TSR E;  4FS7 A;  5CMN A;  3WPF A;  3UL9 A;  5AWA A;  3E3Z A;  4LSC A;  1P8V A;  3RIZ A;  2OMV A;  4BV4 R;  3ULU A;  1A4Y A;  1XCD A;  4R0A A;  2FT3 A;  1YRG A;  4R5C A;  3W3K A;  3WPC A;  4G8A A;  1ZIW A;  4I6J B;  4KXF B;  3W3N A;  4PEQ B;  5IJB A;  3ZYO A;  3BZ5 A;  4QXE A;  3WPE A;  3RGX A;  4YEB B;  5GMF A;  2UZX A;  4LSX A;  1P8T A;  3REZ A;  4L3F A;  4R6F A;  2IFG A;  1OTO A;  2BEX A;  3G3A A;  1LTX A;  2ID5 A;  5IJC A;  2AST B;  3JB9 j;  2Z63 A;  3C6P B;  2WQU A;  2P1P B;  5GMG A;  4ECO A;  4LXR A;  3ULA A;  2RR6 A;  4LI2 A;  1Z7X W;  4QBZ A;  4AW4 A;  5B0N A;  4H09 A;  2Z65 A;  2CA6 A;  4FMZ A;  2Z7X B;  2WQW A;  1KOO A;  5B0T A;  3WN4 A;  4OQT A;  4WYK A;  4TZH A;  4R08 A;  1M9L A;  5HDH A;  2Q4G W;  5AWB A;  4Z64 C;  2WQV A;  4ARN A;  3C6O B;  4M7E C;  4PKI G;  4C2B B;  1XEU A;  2JQD A;  1OTM A;  3CIG A;  4J4L A;  4Q3G A;  3RGZ A;  4R6G A;  3P72 A;  4LXS A;  4CNM A;  5GS0 A;  4FCG A;  4CC4 A;  3RJ0 A;  4RCW A;  3W3J A;  1A9N A;  2Z64 A;  1JL5 A;  3WPH A;  3OGL B;  4B8C D;  4XOS A;  2V70 A;  1WWL A;  2Z82 A;  2P1O B;  1FQV A;  2Z62 A;  4CP6 A;  4R58 A;  4Z8G A;  3WPG A;  3WPB A;  4BSU A;  3W3M A;  2V9T B;  4HQ1 A;  5CMP A;  3M18 A;  2Z7X A;  3VQ2 A;  2Y5Q A;  3RFJ A;  1U0N D;  3WPD A;  1FO1 A;  1KOH A;  4R07 A;  3ZYN A;  2XOT A;  3RFE A;  5AZ5 A;  1G9U A;  1K5D C;  4MN8 B;  4Z61 C;  4NKG A;  1OGQ A;  2WQX A;  5GMH A;  2R9U A;  4BSR A;  2XWT C;  3O6N A;  3DZE A;  1XEC A;  3RFS A;  3OGK B;  4PSJ A;  5B4P A;  3W3G A;  4MQW X;  4FHO A;  1K5G C;  3OGM B;  4P8S A;  3UL8 A;  5LFN A;  4V2E A;  3RW7 A;  4R6A A;  1GWB A;  4EZG A;  4XSQ A;  3UL7 A;  2P1N B;  4XGO A;  3FXI A;  2OMY A;  4FDW A;  1DFJ I;  1OOK G;  2JE1 A;  3SB4 A;  5D3I A;  1M10 B;  5AWD A;  2OMU A;  3G06 A;  4WP6 A;  5AWC A;  3E6J A;  3CIY A;  3ZYJ A;  4LSX C;  1H6T A; 
#chains in the Genus database with same CATH topology
 5IJD A;  2OMW A;  1M0Z A;  2O6S A;  4Q62 A;  3ZYI A;  4IM6 A;  2OMZ A;  4RCA B;  4PER A;  4V2D A;  4UFR A;  4ECN A;  2RA8 A;  1D0B A;  4R5D A;  4CNC A;  1M9S A;  4L3A A;  4Y61 B;  4AY9 X;  2ASS B;  3E2J A;  1FS2 A;  1PGV A;  1DCE A;  3C6N B;  4FD0 A;  4U08 A;  4M7E A;  2O6Q A;  4BSS A;  3CVR A;  4R09 A;  4RWT C;  1XWD C;  2OMT A;  3KJ4 A;  3G3B A;  5HZL B;  5A5C A;  3G04 C;  1P9A G;  3WPI A;  2V9S A;  1DS9 A;  4Q3I A;  3W3L A;  4Z79 A;  2WFH A;  4K17 A;  2OMX A;  1H6U A;  4CC4 C;  2UZY A;  3OJA B;  3PMH G;  2A0Z A;  1O6S A;  4LSA A;  4U09 A;  5GQR K;  5GS2 B;  3UN9 A;  1OTN A;  4Z94 G;  3O53 A;  4ARR A;  4C2A B;  3M19 A;  1FT8 A;  2O6R A;  3VQ1 A;  3GOZ A;  4GT6 A;  2P1Q B;  3RW6 A;  5IYX C;  4U7L A;  2BNH A;  2Z66 A;  5FTT B;  2ELL A;  4CIL A;  2P1M B;  4R6J A;  1QYY A;  3E4G A;  1IO0 A;  4J0M A;  3ULV A;  4PQ8 A;  1O6V A;  4P91 A;  4GLP A;  4NKH A;  3G39 A;  4NZR M;  4LI1 A;  1SQ0 B;  4QC0 A;  2Z81 A;  4KT1 A;  1XKU A;  1O6T A;  1W8A A;  3A79 B;  4KNG A;  4V2C A;  1OZN A;  2JE0 A;  3OJA A;  4U06 A;  3TSR E;  4FS7 A;  5CMN A;  3WPF A;  3UL9 A;  5AWA A;  3E3Z A;  4LSC A;  1P8V A;  3RIZ A;  2OMV A;  4BV4 R;  3ULU A;  1A4Y A;  1XCD A;  4R0A A;  2FT3 A;  1YRG A;  4R5C A;  3W3K A;  3WPC A;  4G8A A;  1ZIW A;  4I6J B;  4KXF B;  3W3N A;  4PEQ B;  5IJB A;  3ZYO A;  3BZ5 A;  4QXE A;  3WPE A;  3RGX A;  4YEB B;  5GMF A;  2UZX A;  4LSX A;  1P8T A;  3REZ A;  4L3F A;  4R6F A;  2IFG A;  1OTO A;  2BEX A;  3G3A A;  1LTX A;  2ID5 A;  5IJC A;  2AST B;  3JB9 j;  2Z63 A;  3C6P B;  2WQU A;  2P1P B;  5GMG A;  4ECO A;  4LXR A;  3ULA A;  2RR6 A;  4LI2 A;  1Z7X W;  4QBZ A;  4AW4 A;  5B0N A;  4H09 A;  2Z65 A;  2CA6 A;  4FMZ A;  2Z7X B;  2WQW A;  1KOO A;  5B0T A;  3WN4 A;  4OQT A;  4WYK A;  4TZH A;  4R08 A;  1M9L A;  5HDH A;  2Q4G W;  5AWB A;  4Z64 C;  2WQV A;  4ARN A;  3C6O B;  4M7E C;  4PKI G;  4C2B B;  1XEU A;  2JQD A;  1OTM A;  3CIG A;  4J4L A;  4Q3G A;  3RGZ A;  4R6G A;  3P72 A;  4LXS A;  4CNM A;  5GS0 A;  4FCG A;  4CC4 A;  3RJ0 A;  4RCW A;  3W3J A;  1A9N A;  2Z64 A;  1JL5 A;  3WPH A;  3OGL B;  4B8C D;  4XOS A;  2V70 A;  1WWL A;  2Z82 A;  2P1O B;  1FQV A;  2Z62 A;  4CP6 A;  4R58 A;  4Z8G A;  3WPG A;  3WPB A;  4BSU A;  3W3M A;  2V9T B;  4HQ1 A;  5CMP A;  3M18 A;  2Z7X A;  3VQ2 A;  2Y5Q A;  3RFJ A;  1U0N D;  3WPD A;  1FO1 A;  1KOH A;  4R07 A;  3ZYN A;  2XOT A;  3RFE A;  5AZ5 A;  1G9U A;  1K5D C;  4MN8 B;  4Z61 C;  4NKG A;  1OGQ A;  2WQX A;  5GMH A;  2R9U A;  4BSR A;  2XWT C;  3O6N A;  3DZE A;  1XEC A;  3RFS A;  3OGK B;  4PSJ A;  5B4P A;  3W3G A;  4MQW X;  4FHO A;  1K5G C;  3OGM B;  4P8S A;  3UL8 A;  5LFN A;  4V2E A;  3RW7 A;  4R6A A;  1GWB A;  4EZG A;  4XSQ A;  3UL7 A;  2P1N B;  4XGO A;  3FXI A;  2OMY A;  4FDW A;  1DFJ I;  1OOK G;  2JE1 A;  3SB4 A;  5D3I A;  1M10 B;  5AWD A;  2OMU A;  3G06 A;  4WP6 A;  5AWC A;  3E6J A;  4NZT M;  3CIY A;  3ZYJ A;  4LSX C;  1H6T A; 
#chains in the Genus database with same CATH homology
 5IJD A;  2OMW A;  1M0Z A;  2O6S A;  4Q62 A;  3ZYI A;  4IM6 A;  2OMZ A;  4RCA B;  4PER A;  4V2D A;  4UFR A;  4ECN A;  2RA8 A;  1D0B A;  4R5D A;  4CNC A;  1M9S A;  4L3A A;  4Y61 B;  4AY9 X;  2ASS B;  3E2J A;  1FS2 A;  1PGV A;  1DCE A;  3C6N B;  4FD0 A;  4U08 A;  4M7E A;  2O6Q A;  4BSS A;  3CVR A;  4R09 A;  4RWT C;  1XWD C;  2OMT A;  3KJ4 A;  3G3B A;  5HZL B;  5A5C A;  3G04 C;  1P9A G;  3WPI A;  2V9S A;  1DS9 A;  4Q3I A;  3W3L A;  4Z79 A;  2WFH A;  4K17 A;  2OMX A;  1H6U A;  4CC4 C;  2UZY A;  3OJA B;  3PMH G;  2A0Z A;  1O6S A;  4LSA A;  4U09 A;  5GQR K;  5GS2 B;  3UN9 A;  1OTN A;  4Z94 G;  3O53 A;  4ARR A;  4C2A B;  3M19 A;  1FT8 A;  2O6R A;  3VQ1 A;  3GOZ A;  4GT6 A;  2P1Q B;  3RW6 A;  5IYX C;  4U7L A;  2BNH A;  2Z66 A;  5FTT B;  2ELL A;  4CIL A;  2P1M B;  4R6J A;  1QYY A;  3E4G A;  1IO0 A;  4J0M A;  3ULV A;  4PQ8 A;  1O6V A;  4P91 A;  4GLP A;  4NKH A;  3G39 A;  4LI1 A;  1SQ0 B;  4QC0 A;  2Z81 A;  4KT1 A;  1XKU A;  1O6T A;  1W8A A;  3A79 B;  4KNG A;  4V2C A;  1OZN A;  2JE0 A;  3OJA A;  4U06 A;  3TSR E;  4FS7 A;  5CMN A;  3WPF A;  3UL9 A;  5AWA A;  3E3Z A;  4LSC A;  1P8V A;  3RIZ A;  2OMV A;  4BV4 R;  3ULU A;  1A4Y A;  1XCD A;  4R0A A;  2FT3 A;  1YRG A;  4R5C A;  3W3K A;  3WPC A;  4G8A A;  1ZIW A;  4I6J B;  4KXF B;  3W3N A;  4PEQ B;  5IJB A;  3ZYO A;  3BZ5 A;  4QXE A;  3WPE A;  3RGX A;  4YEB B;  5GMF A;  2UZX A;  4LSX A;  1P8T A;  3REZ A;  4L3F A;  4R6F A;  2IFG A;  1OTO A;  2BEX A;  3G3A A;  1LTX A;  2ID5 A;  5IJC A;  2AST B;  3JB9 j;  2Z63 A;  3C6P B;  2WQU A;  2P1P B;  5GMG A;  4ECO A;  4LXR A;  3ULA A;  2RR6 A;  4LI2 A;  1Z7X W;  4QBZ A;  4AW4 A;  5B0N A;  4H09 A;  2Z65 A;  2CA6 A;  4FMZ A;  2Z7X B;  2WQW A;  1KOO A;  5B0T A;  3WN4 A;  4OQT A;  4WYK A;  4TZH A;  4R08 A;  1M9L A;  5HDH A;  2Q4G W;  5AWB A;  4Z64 C;  2WQV A;  4ARN A;  3C6O B;  4M7E C;  4PKI G;  4C2B B;  1XEU A;  2JQD A;  1OTM A;  3CIG A;  4J4L A;  4Q3G A;  3RGZ A;  4R6G A;  3P72 A;  4LXS A;  4CNM A;  5GS0 A;  4FCG A;  4CC4 A;  3RJ0 A;  4RCW A;  3W3J A;  1A9N A;  2Z64 A;  1JL5 A;  3WPH A;  3OGL B;  4B8C D;  4XOS A;  2V70 A;  1WWL A;  2Z82 A;  2P1O B;  1FQV A;  2Z62 A;  4CP6 A;  4R58 A;  4Z8G A;  3WPG A;  3WPB A;  4BSU A;  3W3M A;  2V9T B;  4HQ1 A;  5CMP A;  3M18 A;  2Z7X A;  3VQ2 A;  2Y5Q A;  3RFJ A;  1U0N D;  3WPD A;  1FO1 A;  1KOH A;  4R07 A;  3ZYN A;  2XOT A;  3RFE A;  5AZ5 A;  1G9U A;  1K5D C;  4MN8 B;  4Z61 C;  4NKG A;  1OGQ A;  2WQX A;  5GMH A;  2R9U A;  4BSR A;  2XWT C;  3O6N A;  3DZE A;  1XEC A;  3RFS A;  3OGK B;  4PSJ A;  5B4P A;  3W3G A;  4MQW X;  4FHO A;  1K5G C;  3OGM B;  4P8S A;  3UL8 A;  5LFN A;  4V2E A;  3RW7 A;  4R6A A;  1GWB A;  4EZG A;  4XSQ A;  3UL7 A;  2P1N B;  4XGO A;  3FXI A;  2OMY A;  4FDW A;  1DFJ I;  1OOK G;  2JE1 A;  3SB4 A;  5D3I A;  1M10 B;  5AWD A;  2OMU A;  3G06 A;  4WP6 A;  5AWC A;  3E6J A;  3CIY A;  3ZYJ A;  4LSX C;  1H6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...