5LIPA

Pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipase
molecule keywords TRIACYL-GLYCEROL HYDROLASE
publication title Structural basis of the chiral selectivity of Pseudomonas cepacia lipase
pubmed doi rcsb
source organism Burkholderia cepacia
total genus 114
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lipA00
2WHPA 3DJYA 4DMKA 1JKMA 1CUGA 3W06A 1GQSA 3C5VA 3QPCA 4BBZA 1G4HA 4KE8A 1R50A 3R3ZA 5AI8A 1ZGCA 3I6MA 3H19A 3WWOA 1CQWA 4F5ZA 2XUKA 3G0BA 4V2IA 3IUQA 2BUAA 1VA4A 1TKRA 2WFZA 2HA2A 5ALNA 2WKWA 5AM4A 5IH7A 3VJMA 4ITVA 2OCIA 1M33A 4C4XA 5HFNA 2XUDA 1U4NA 1SC9A 4AN0A 4X90A 5LP1A 4H18A 3ICVA 5AI5A 1XZKA 1ORWA 1HBJA 4Y2YA 1CUZA 4RNCA 2HA5A 3VISA 5A62A 2QZPA 3WJ2A 5AKGA 2Y6UA 1EI9A 1T2NA 4KYVA 5FKJA 3KXPA 3BJMA 3D2CA 2HU7A 2V96A 4QLAA 2HRQA 3STVA 1Y37A 4L9AA 5JALA 2CEKA 1LPPA 5ALWA 2VSQA 5CTAA 1XZAA 3D3NA 5AK6A 4Z49A 3C6ZA 3GZJA 2C4HA 3LLCA 5J3JA 3SK0A 1TCBA 3K9BA 4UHFA 3HZOA 1XZIA 3WL7A 1XRMA 3WQHA 4YK7A 3BF8A 3V1MA 1IUOA 3DNMA 3G9TA 4K6KA 1ACLA 1B6GA 4QDZA 5ALQA 3TJMA 3I6ZA 2VF2A 1THGA 4UFNA 5D7BA 1R4ZA 5FP0A 4FTWA 1QIHA 2XUOA 1YB6A 4ZGBA 3AINA 2WU4A 1FSSA 3RM3A 1Q83A 2C0QA 4AX4A 1VA5A 2DR0A 1ODTC 5LLSA 1HL7A 3R0VA 4EZIA 1LPOA 4ZWNA 1VOTA 4H0CA 3ESDA 5LZ9A 1RWQA 4J7AA 3KD2A 3CCCA 3C6BA 1EXWA 4MXDA 5DLPA 2VJCA 2CKMA 4Y9SA 5ALLA 1MN6A 5CT6A 4JEIA 1CLEA 1E5TA 4L3WA 3LIIA 1ZJ4A 1LPNA 1X2BA 1QO7A 3F67A 1XZDA 3I2GA 2WIKA 2CJPA 1WB6A 3IULA 3WKAA 1CV2A 2AJ8A 3IBTA 1JMKC 2VT7A 1H23A 1HDEA 3EIOA 1A8UA 3AIKA 3L1IA 2OPHA 4BAUA 3DLTA 3HYSA 4CIAA 3AJAA 4Q3KA 3VVLA 3H2KA 3N2ZB 4G8CA 3H0CA 5HKAA 2DQYA 4EY4A 3QITA 4B81A 2I03A 1X2EA 3IVMA 4UBMA 3WJ1A 4NZZA 2WFLA 2OGSA 5ALGA 1WPRA 5A2GA 1EK2A 2WU3A 4B6GA 3WA6A 3SX4A 3ZWQA 2QVBA 4QDUA 3I1IA 3ILSA 5IVIA 1OCEA 3GFFA 4C88A 2WHRA 5AOCA 1XZBA 4KRXA 5K3CA 3I6YA 4YPVA 1CFJA 2WIFA 3VDXA 2EDCA 2Y1KA 4JYPA 4X92A 2HDWA 4X93A 1EINA 2PSHA 4UHEA 4EA6A 3M83A 2IIVA 3PFCA 4H7DA 3B3QA 1XROA 2XUFA 4JH0A 5AKZA 3OOSA 5AK4A 2QR5A 1Q0RA 1Z68A 2XMSA 4DIUA 5ALYA 1VKHA 4CCYB 4G9EA 2GZRA 4I19A 1XZEA 3FNBA 4P08A 5A7FA 2XQIA 1CQZA 3ZLVA 1E8NA 4B80A 3FSGA 5JAUA 3HSSA 1YAHA 2OXEA 5AP9A 5C8XA 3QH4A 1E3QA 2ORYA 5JZSA 3FYUB 3QM1A 5JARA 5JD5A 5CBKA 2HU5A 1NU6A 5D6OA 1ZICA 4MEBA 2XUQA 3AFIA 1THTA 4WDQA 1AURA 4X7BA 1XRRA 1AMNA 4EUSA 2PSFA 4MQLA 4C87A 1CUXA 5DYYA 5F4ZA 3DQZA 5FOQA 4MJ3A 5BOVA 1FFEA 2UZ0A 5HKBA 5HQ3B 2ZYHA 3IIIA 4Q05A 4X94A 4KAJA 4X91A 2Z8ZA 2JGEA 1CIJA 3GELA 2C5GA 5KBYA 2RGUA 1PV1A 4AB1A 4IO0A 3H04A 2G63A 4CFSA 3EQ9A 3F8SA 1FFAA 1DX4A 2ES4A 1GPKA 5ALSA 1XQWA 3HLKA 1MX9A 2HA3A 5ALVA 3BWXA 3C6YA 2OCLA 3IB3A 3E1GA 3IUMA 3ED1A 3N0TA 4MYDA 2VJDA 3ESBA 5AOBA 2XUPA 4BC0A 1U2EA 1CUFA 4AMZA 5FPPA 2WG2A 3C8DA 3CXUA 4N8SA 2VEOA 1IZ8A 4DTCA 3WZLA 2WFMA 4UFPA 3DYIA 2O2GA 5EFZA 1XZHA 3MUNA 3V1KA 1CUBA 1BCSA 2WUFA 5AM0A 2YYSA 1ZOIA 3G0CA 1WB4A 1EVEA 3QZUA 2XI4A 1WB5A 3PE6A 2XUIA 2Z3ZA 3DYVA 4DGQA 2ZSIA 2HM7A 1BEEA 4QWMA 2RI6A 1XKLA 1AZWA 1U65A 1CEXA 1CRLA 1YASA 4H7KA 2WJ6A 3DD5A 4HXFB 4Y2XA 5HK8A 3BJRA 5AI4A 1ZD4A 1KU6A 4UBKA 1QIJA 2HIHA 1N5MA 1J1IA 1MT3A 1O6GA 3F9CA 4AO7A 2PVSA 3AZQA 5A71A 1HPLA 4F60A 1A8QA 3DL7A 2QXUA 2CUTA 2PKYX 3TEJA 4B83A 2WUGA 2AJDA 3WWPA 2G5TA 5HF6A 1K5PA 5ALPA 4ETWA 3S8YA 3BF7A 3G0DA 3WWEA 4U2BA 1H2ZA 2JBWA 4Y2UA 1EA5A 1U8EA 3BE8A 1B41A 5IVKA 1IMJA 1UOQA 2Q0XA 2RHTA 2NW6A 2BUCA 2G5PA 4ZI5A 1UOPA 4I4CA 3C43A 2XB6A 3QBJA 3FLEA 1CUYA 3H18A 4KACA 4OCZA 4W1PA 1JJFA 3AZPA 5ESRA 2QUAA 5FPQA 3STYA 3STWA 1LPMA 1SCKA 5LKAA 4HAIA 1BROA 5CW2A 3BDVA 1VLQA 5C8ZA 4OU4A 2P8SA 4CCWA 2HA4A 5CT8A 3OG9A 1CR6A 1JT2A 4NMWA 3HC7A 4Y2QA 3UUEA 5AKEA 4J0DA 3ZPXA 3C8HA 5ALEA 3W2TA 3SWWA 3SC2A 5AM2A 3WIBA 1ZD5A 5CMLA 4UHCA 1JI3A 4O08A 2HA7A 1XLUA 3FCXA 1FFDA 1GXSA 4F0JA 4UPDA 1TAHA 1JFRA 4PSDA 4U2EA 2JF0A 4JUIA 3HEAA 4KE6A 1GGVA 5HZGA 4BZZA 2JGMA 4IH4A 4BRZA 3G9UA 3V1LA 4QNNA 5AJHA 4BE4A 1TRHA 5ALZA 5ALRA 3AZOA 1CUAA 5JD6A 1L7AA 4TPKA 5CH5A 1EHYA 4X97A 1AGYA 1XZFA 2WJ4A 3PUIA 2HRRA 2B4KA 4CG2A 2WJ3A 2ZYRA 1E66A 2R11A 3I2FA 3PFBA 4P92A 4H7HA 5DYWA 1IUNA 2XMCA 1MJ5A 4OD0A 5JADA 2XMBA 5AM3A 2QUBA 4P93A 4CI9A 5AIAA 1W52X 3WMRA 4FDMA 4KAAA 3V48A 5AI6A 1WCYA 3FVRA 5LZ2A 3W05A 5SYNA 5JZBA 2WUEA 1YS2X 4H7EA 5CXUA 2GZSA 1SFRA 4PW0A 3CCBA 2Y2UA 1KU0A 3A2LA 4Q82A 1XZMA 4QDXA 3DS8A 1LPSA 2O7VA 4UBNA 3VXKA 3UMJA 2V98A 3R3VA 2HHAA 5JAHA 5FXMA 4OSEA 1WPXA 3FCYA 4FLEA 2QT9A 3CN7A 5CRIA 5AK5A 4DLNA 1A88A 1QFSA 4PQEA 2PM8A 1QGED 4BP9A 3BXPA 1WHSA 4E14A 1VE6A 1DT3A 3KSRA 1YCDA 4LYDA 4J0JA 4IQ4A 2CZQA 1IUPA 5T4HA 4W1SA 1GKLA 1DWPA 3BDIA 3ESAA 2PPLA 3G9ZA 1H2WA 4PV7A 2DHDA 1SOMA 1QTRA 1QE3A 4CG3A 5ALJA 1QTIA 2AJCA 4QWWA 4J03A 2WFLB 4B84A 1BN7A 2ZJ6A 4W63A 3FVTA 2H7XA 2ACKA 1JJIA 2C7BA 4EY7A 4WJLA 1WOMA 5T4EA 5K3FA 3ZLTA 5E4TA 2ZJFA 4GLBA 4B7ZA 4BDSA 1L7QA 2V9ZA 2C5FA 5DNUA 2JGFA 4ZRDA 2PU5A 4J0GA 2XDWA 5AKJA 2DQZA 3PI6A 5H3HA 4QZVA 2EEPA 4DM7A 2QS9A 4DSZA 5E4YA 1ETHA 1Y7IA 3WK9A 3DKRA 1EVQA 3WIOA 4U2CA 2H9YA 3WLAA 2VJAA 1CUCA 3NOXA 1EDDA 4BDTA 2BGRA 5C81A 3IUNA 1DQZA 4J3JA 5ALDA 3K2IA 4MWSA 2W22A 1XZJA 1HQDA 1N8SA 1TIBA 4WY5A 4N5IX 5EHXA 1NU8A 4K2AA 2XMGA 4LXGA 4BE9A 4XVCA 5ALKA 5K3AA 3FSGD 3R3WA 1ZI6A 1LBTA 3L1JA 4MQMA 3H17A 2GYWA 2Y2VA 2X76A 3ZLUA 3F96A 2I3ZA 4OPMA 2LIPA 3ANSA 2YXPX 2XUGA 3B5EA 2OCKA 1UWCA 2FUKA 3KWJA 4RE6A 1F8UA 4BATA 5AICA 3OURA 4UFOA 4CIBA 4NVRA 1CUHA 1QLWA 3NGMA 2C58A 5LZ7A 4X6YA 1AUOA 1CUJA 2PSDA 4JNCA 5EHNA 1GPNA 3QPDA 1CVLA 4Y2VA 1AX9A 4ARBA 1QIKA 4RGYA 4QEKA 3V1NA 4K5QA 4BC1A 1YA4A 2FX5A 4U2DA 1QIIA 5I8PA 1ZI8A 1JJBA 4WDRA 1CUVA 3LS2A 3G8YA 4ZV9A 1BN6A 3IA2A 5AKLA 1C7IA 2B61A 2WQZA 1AQLA 3IURA 2WIJA 2H7YA 3D4LA 3T52A 4KRYA 4IH9A 4C01A 3PF9A 5CH3A 2QJRA 2DHCA 4JYMA 3EF3A 2RONA 2OLEA 4AZ3A 3QYJA 4PSCA 5LIPA 4HTAA 3OPMA 4OB8A 4K6GA 1QJ4A 1QIFA 1LPAB 3HACA 2OG1A 3RK4A 4H7JA 2PL5A 4G1FA 2XUAA 4BTVA 3E4DA 2CMFA 2X5XA 4G5XA 4BRSA 5ALIA 2XLCA 1XZGA 2XMRA 5IKXA 5CT5A 1LPBB 2Z3WA 3O9VA 1BS9A 4W1QA 4TVKA 4BVKA 3K6KA 4PSUA 1G66A 3U0VA 1DTEA 2ECFA 3R3UA 4G4IA 4CCYA 4DNQA 3O95A 4FNGA 3WK8A 4EY6A 5CH8A 4YX9A 4U2FA 3E0XA 1UFOA 3M3DA 5EHQA 5LKRA 4MEAA 3GA7A 1CPYA 2XE4A 1LGYA 2Z5GA 5T4BA 3ESCA 5I9IA 1DT5A 4UBIA 1XRNA 1HKHA 4OYYA 2GYUA 2GYVA 1MAAA 4G8BA 3FYUA 5ALXA 1UZAA 1W1IA 3STXA 4GBGA 4EY5A 2HU8A 1R88A 1PJAA 4B0PA 2PU7A 2VT6A 4D9JA 2WLSA 4AZ0A 1LZKA 1XLVA 4HRXA 1VZ3A 4XJVA 4E46A 1HLGA 3WYDA 5D3KA 4FNMA 4N5HX 4GEGA 3WWCA 5HQ3A 1E8MA 3DOHA 1R1DA 4XIIA 2RAUA 4X6UA 1YS1X 1MX1A 2G4LA 4AO8A 5FLKA 4LHEA 3F97A 4PNZA 2BUBA 3AIOA 3H2IA 2I78A 1DWOA 5ALUA 4DMHA 3G9XA 5KWJA 3HJUA 3I2HA 4G4GA 3TRDA 3O4JA 1QOZA 1W6RA 1EH5A 4N8DA 3DOIA 4BYMA 2XQGA 5ALTA 2WTMA 5AHXA 1JU3A 4FFWA 1QONA 3D59A 5FV4A 4DMCA 5K3DA 2ROQA 2CBGA 1R9MA 1NX9A 2GBGA 3Q0TA 3IDAA 2JEYA 4AQDA 4X95A 1XRPA 3RLIA 3PF8A 4FBLA 3I1YA 1QO9A 4X6XA 4BVLA 1CUDA 3OM8A 2YH2A 1FFCA 4J0HA 2WHPB 2O7RA 1CUEA 5EI5A 3FAKA 4C4YA 3FYUC 3VJLA 2WUDA 2GBFA 1GPLA 4B0OA 2QMQA 5E2IA 3WZMA 2OQIA 2JGLA 3PUHA 1CUWA 4OUKX 3B12A 1Q0ZA 1J06A 2QXTA 2ZYIA 4XWGA 4FFVA 5AI0A 1F0NA 5FDFA 3PICA 4KE9A 4X00A 4P9NA 5EIAA 4ROTA 5IVDA 1UOOA 3G0IA 1A7UA 1N5RA 4FLFA 3S2ZA 3C70A 3L1HA 3OC0A 2ZYSA 4GDMA 1TCAA 2JGKA 3WKDA 1BEZA 3NWOA 1DWQA 2XQJA 3X3HA 1G5FA 5IVHA 3KWFA 1VZ2A 3VKFA 2RHWA 5AOAA 5CURA 5CT9A 1UKCA 1EB9A 4M0MA 2VAXA 4FOLA 2I3DA 2Y6VA 3ICWA 1CUSA 3A2NA 4LXHA 3M81A 2BCEA 1UT6A 1QZ3A 4LIPD 4AN1A 5JATA 5SYMA 2OGTA 4Y2SA 1K4YA 5BWBA 5DTJA 2HFKA 3DDUA 1R9NA 1SCIA 1JU4A 2QM0A 4EHBA 4AMYA 5YASA 4BAZA 4MYSA 1F0PA 2H1IA 1YB7A 4S0XA 4B82A 1S8OA 3QMVA 2WHQA 1ACJA 2OAEA 1PFQA 2XLBA 4B9EA 2CB9A 1USWA 4GXNA 4KR0A 1ZD3A 1P0QA 1C4XA 4K6HA 1MO2A 3R3YA 5AIBA 3H1AA 1XQVA 1CUUA 1QIDA 5JZ9A 1OILA 4FBMA 1ODCA 1XZLA 2ZSHA 3WKEA 4BB0A 4DSAA 2WIGA 4M0FA 4EBBA 2VJBA 3GBSA 4BAGA 4QDOA 1QFMA 3RARA 5K3FB 2JEZA 1XFDA 2DSNA 4WFIA 2JIDA 2O2IA 3I2KA 1EDEA 3T4UA 5AK3A 3O4IA 1P0IA 5BWCA 5KREA 6YASA 1UKBA 2WILA 4W9RA 4QA9A 3WWDA 2AXEA 2PBLA 3G02A 3EBLA 5JANA 3O4HA 3HI4A 4AO6A 1XLWA 4BCDA 1J2EA 4FWBA 1H2YA 2XUJA 3AIMA 4ZREA 2B20A 3U1TA 2VTVA 1W76A 2WG0A 3QMWA 1BRTA 3A2MA 2HA0A 5LZ8A 3D2AA 4ARAA 4A16A 5K5EA 4M0EA 2ACEA 1R3DA 2WM2A 1H2XA 2OQVA 2PSJA 1DU4A 4QE3A 4DMFA 2VAVA 2OGZA 5HF5A 5JIBA 1K63A 3QPAA 1Q84A 4FMPA 2WIDA 1BU8A 1L7RA 4OB7A 4HXGA 3VJKA 2K2QB 4AXBA 1UK8A 4Y7DA 4IH1A 1XQYA 1VJ5A 1ZIXA 2GBIA 5AH0A 3BL8A 1JMYA 5CXXA 5DNWA 4C6HA 1G42A 1ZI9A 4HZGA 4WY8A 4C89A 3WA7A 2QJWA 1DQYA 1TCCA 2XMDA 4WFJA 4X71A 1YSCA 1XZCA 5D3ZA 1MX5A 1O6FA 1TK3A 2OCGA 4UHHA 1W4LA 3LCRA 5HFAA 1AKNA 2VQ6A 1F6WA 2GBCA 4Q1VA 1WM1A 3FWHA 4FHZA 2B9VA 3JWEA 3STUA 1YA8A 2ZJ7A 3KOOA 1A8SA 2BAGA 5DJ5A 2BGNA 5HF8A 4H35A 3WL8A 5ALOA 3H2GA 1LLFA 5LYYA 3O9MA 1XRQA 3I28A 4GI1A 4OYLA 3FBWA 1X70A 4YASA 4HS9A 1RYYA 1UK6A 3ZV7A 3EQ8A 1GKKA 3R41A 3WK4A 4KAFA 4Y2RA 1H22A 4G8DA 1FJ2A 4EB0A 2XMQA 4X3CA 1ISPA 2HADA 1TQHA 4L0CA 3AUKA 4GW3A 3TGLA 5AM1A 3W9UA 3D5EA 1EDBA 5LZ5A 3YASA 4CG1A 2BJHA 1KEZA 2XT0A 4DNOA 1BCRA 3WK6A 1XRLA 3H2JA 3MVEA 4U2GA 5DNVA 3DL4A 2WSLA 2H7CA 5ALMA 5A7HA 4PF1A 5A7GA 2Z8XA 2EDAA 1VE7A 5CT4A 3FLBA 2D0DA 5DWDA 3CN9A 1MTZA 3QMMA 4BZWA 5ALFA 3H1BA 4Q34A 1OXMA 3OTQA 2YASA 4DNPA 3WYNA 4DNFA 1EX9A 3LIPA 2WG1A 3I2IA 2VATA 4Q3OA 4UUQA 4X85A 2DFPA 4N8EA 2ONCA 4PO3X 3C6XA 4EY8A 3P2MA 4RE5A 4J0CA 1ODSA 5K3BA 3FLAA 4BP8A 2V97A 3W04A 2D5LA 4FKBA 1WHTA 4HXEB 2XUHA 3IUJA 2E3JA 1UK7A 1QIMA 4GHWA 4LKOA 3R40A 3I2JA 2J4FA 4DYHA 4C4ZA 4WFKA 1VXRA 3EQ7A 2PUHA 5JAOA 4L72A 1I6WA 1ZIYA 5AKYA 3DKKA 1T4MA 3RKSA 1MPXA 3VVMA 5C7YA 2O2HA 5AI9A 1LNSA 4Y2PA 3ANTA 3C87A 4B9AA 1UK9A 5FUMA 3PDCA 5JD4A 5E4JA 5EHZA 5ISMA 3FYTA 4UHBA 5AKKA 2W6CX 4RPCA 3F98A 1C7JA 2XQFA 1BE0A 4A5SA 4F21A 2BFNA 4W1RA 1SCQA 2R8BA 3GUUA 4UBOA 5I7UA 1W75A 1GQRA 4H7FA 5HK9A 3JW8A 1YAJA 1N1MA 1ZJ5A 2HFJA 2AJBA 5JAPA 2QRUA 2J3DA 1DX6A 3C5WP 4J0IA 3A70A 1EK1A 4LXIA 4G9GA 1MNAA 2X8BA 5T4FA 1QIGA 4E11A 1UKAA 3ZI7A 1MU0A 2QTBA 1MAHA 4HRYA 5KWIA 3R3XA 1Y7HA 4GWLA 2FJ0A 4UBLA 3G0GA 3A6ZA 3M82A 4B85A 7YASA 1RP1A 2JGIA 5LZ4A 1IZ7A 2XMZA 2J3QA 2VA9A 2DHEA 4MWTA 4J0KA 4I3FA 1K6EA 2WTNA 3O0DA 2AJLI 3DEAA 4QLOA 2PSEA 1E89A 4H77A 2XQKA 2J4CA 1J07A 4KE7A 3D0KA 1P0MA 2QOEA 4BCBA 2IITA 5FRDA 3HXKA 5HF9A 1LBSA 3D7RA 3MGAA 4KJXA 1XQXA 4BTLA 1D07A 3AILA 3KDAA 5AKIA 2HA6A 3C45A 3E3AA 2IX9A 5AKHA 1ORVA 3LP5A 2ZVDA 4TGLA 1IVYA 4H7IA 4BVJA 1AC5A 2RIPA 5HCUA 5ALHA 5DYTA 1E8DA 1K8QA 3HRHA 1LZLA 4ZXFA 4OB6A 1GZ7A 4BCCA 1QIEA 1P0PA 3BIWA 3QVMA 5A6VA 4KEAA 5AO9A 5EIHA 5JYCA 4Q3LA 4IHAA 4HVTA 4FLMA 4INZA 1ZD2P 2QKYA 3W9BA 3O4GA 4A23A 3WK5A 4LYEA 5C8VA 1FFBA 4WCVA 1ZGBA 1CUIA 4Y2TA 3NUZA 2FJPA 4ZV7A 3MUOA 4UBJA 1VXOA 3V9AA 3D2BA 4XX1A 1EB8A 4E15A 4UHDA 3JYHA 1MNQA 4QDTA 4GECA 3FOBA 3WK7A 3DCNA 3HABA 2PX6A 3WKBA 5DTIA 2PUJA 2DCMA 1GT6A 5EIEA 4OU5A 4Y2JA 3Q8WA 5AKXA 2HL6A 1DINA 4NS4A 1XKTA 3GROA 1UXOA 2C0PA 4G4JA 5JASA 3WL5A 5K3EA 2JGJA 5EGNA 3WI7A 5BV7A 3G7NA 3STTA 2OAGA 3WKCA 3H2HA 2BKLA 5AM5A 3BIXA 1YR2A 3UUFA 3WL6A
chains in the Genus database with same CATH superfamily
1E1DA 4YRIA 4W5OA 4BU1A 4X8MA 4X24A 3DG9A 2Q62A 3DJYA 3LUHA 1WCXA 2CKDA 2H2DA 2J6CA 2IYFA 5JS2A 1PVOA 3TD2A 2G71A 3P27A 3RANA 3TRIA 1XJ5A 1NM5C 3GFTA 1I5OA 3I92A 4JI8B 3O03A 4XWYA 3AERB 1WF6A 4OF4A 1YB1A 16PKA 4R2MA 4WCDA 4DV5B 4ZAYA 2RMKA 1ZM9A 1FS4A 4HQLA 4TM8A 5KKAA 3SHOA 5I48A 4WBSA 1JG3A 3C16C 3NPMA 3MW8A 1W8DA 1M72A 2IUSA 3HYCA 4D8VA 1J6UA 1B0PA 3U60B 4DLLA 1HE2A 3ETHA 3KB8A 4I50A 3E7PA 4YCLA 3R3ZA 1ZOOA 2RC5A 5AI8A 3KPUA 4CQLB 1JIQA 1JEJA 2J6HA 4Q7MB 1EXNA 4CMAA 1F8XA 3RROA 2ZVJA 4OHFA 4LISA 3G0BA 2GNOA 3VVCA 3C5CA 3ND8A 4RY9A 4X8HA 3UPUA 3GHHA 2BTEA 2BUAA 4OJMX 5EWJB 1F51E 1RJGA 2BR3A 4R6WA 4BE7B 1NF3A 1DTWA 2OSVA 1K8ZB 1KH3A 1B8PA 3S7ZA 2GVDC 2WFZA 3PDHA 4PVDA 5JCOA 1YA6A 3SC6A 1A0OA 1NZFA 3HKCB 1HDIA 2Z4RA 3QUCA 3KQHA 1MHTA 3VJMA 2ZPTX 3MXOA 1QCYA 4M1WA 5LXTA 4JGGA 4RH1A 3NASA 2BMEA 2HTEA 2B2CA 5KSWB 5B3AA 4PX3A 1OSNA 3DMYA 1BMFD 2JLSA 4KIUA 4EEKA 1C3JA 4EITA 5F98A 1G0OA 3BD8A 2VSNA 3MS4A 1WUTA 3C7DB 3KHTA 2IHBA 1UWLA 2WKRA 3SPXA 1QXSA 4KPGA 4Q16A 1K6XA 2DWOA 2CFCA 1GGKA 5AW2A 3OFSA 1CUZA 4RULA 2VP6A 3MHTA 1TLTA 1XD9A 3IKMB 1ISHA 3KVYA 1GEGA 1UXGA 2NAFA 3QWHA 3O3OB 3K6SB 1PQPA 4FR2A 4Q21A 3ZYZA 4GPD1 5ARCA 1AS0A 2Y6UA 4KYVA 3MBOA 5FKJA 4IIGA 1PGQA 1X3SA 4MUAA 3CLSD 5F1OA 3BJMA 3LGSA 3D2CA 3WMXA 3AJ9A 3TFWA 1WV0A 4XI9A 4BO2A 1R6VA 3DDOA 2V7VA 2W6JA 2MJLA 1Y8AA 3C4VA 4CM3A 2V4MA 1RZVA 2GJ9A 2H0QA 4O0LA 3F7NA 1PI3A 1LPPA 4F8YA 3UHAA 2FK7A 2AC7A 2JAWA 1XZAA 3BA1A 1XZPA 2D8AA 5CVEA 3PNSA 1GL3A 4B3IA 5IDQA 4K03A 2F6RA 2MR6A 2XPCA 1D2NA 1ZU5A 3GBPA 3AJ8A 4O59O 5H68A 1K6JA 1YZ3A 1BW9B 1MQAA 3R75A 2WDPA 4HFJA 4J1TC 3AR6A 3UT5A 2D3WA 1NAHA 2V4ZA 3KZMA 2ZYTX 4WLVA 5D86A 5FQOA 4ZHSA 5CX1B 3LX8A 1UUFA 1U9YA 2UYQA 5K4AA 2EP7A 3VTZA 1VSTA 1XRJA 3DMRA 3M4ZA 1FNMA 1N2GA 2CUNA 1TCBA 2A5YB 2PDAA 1Y5RA 2XODA 4N65A 4ND2A 4R0NA 4BO7A 1PFYA 4U7TB 4R84A 1VP9A 1TECE 2GA8A 3FA2A 1MVNA 2BFMA 3GH1A 1L5HA 1T8PA 3T1HB 5IKOA 3MD9A 4PG7A 1VSQA 1XRMA 4EGJA 5E6RA 3SEZA 2H2HA 3AHDA 3IILA 5FQNA 3RBZA 3KJHA 1IOWA 2H92A 3BF8A 3SDBA 4RTSA 1J0CA 1DEHA 2YY6A 1RI4A 2FR8C 1ZH2A 2FSSA 2UZ4A 1B6GA 2HKIA 1Y8RB 4QDZA 4F11A 2VF2A 4ZICA 3E27A 3AHHA 3DAYA 3S28A 5FP0A 1WO8A 3R1IA 5DT2A 4KXNA 5DI3B 4TV9B 2X8LA 2WVJA 1YKFA 5FO1A 5IHXA 2YHIA 3DB2A 2W48A 2A94A 5IFLA 3NBXX 3ANXA 4I9HA 4X1YA 2QN1A 4L76A 1BKDR 4IILA 3RM3A 3IEMA 3RC2A 1Q83A 1XG5A 2E4AA 1FYDA 4MKHA 4MV7A 1KY2A 3AB8A 2XYQA 1PFWA 1NR1A 3VAAA 3JQ9C 2Y1FA 1JLHA 1KEEB 2ZCJA 1ODTC 3PPIA 4G41A 4ZODA 2Y0BA 3R0VA 4FUQA 4LF7B 3C3JA 1LPOA 1M6VA 4PC2A 4CMEC 1OX6A 1ZR2A 2IZ7A 1LDEA 4X7PA 1DHTA 4F4JA 3RIHA 5IHPA 4H0CA 5AJXA 3VU8A 3ERCA 4RZIA 1ZESA 1B16A 4J7AA 5LZ9A 3UMMA 3GJ3A 2R8PA 4QQRA 2QVCA 1DAHA 5BV1A 3H5OA 2PN1A 2BI4A 1GA6A 2FZVA 3ILVA 5B1SA 3ZQJA 4FM9A 1FXSA 3CRNA 4TWRA 4FILA 1NQVA 2APJA 3HCOA 3QKWA 3RJMA 3MGKA 5J47A 1IQPA 2F43A 5DSXA 2AOUA 4R7TA 3REFA 3V32A 1N0IA 3NUQA 1HM5A 4IP0A 1QRAA 1HXHA 3NHLA 1PT8A 5LVAA 3BBLA 2H1VA 4L3WA 1A97A 3S2FA 2HWXA 2UUOA 1ESZA 3LIIA 1ZJ4A 2CYAA 3JSXA 4DCSA 2R2AA 3F67A 1NLZA 2WIKA 1B0ZA 2ATCA 1WB6A 3QWAA 5A6SA 3RG8A 1V5GA 2O05A 3LDUA 3QKRB 4AUKA 1JMKC 1UM9A 5BR1A 3VV2A 2YC2C 1H23A 2QSUA 3PR3A 1HDEA 1JBKA 2P6NA 3EIOA 3KQLA 1Y89A 1TUIA 2QG6A 4CM1A 4C7XA 4BZPA 2GI4A 2KM1A 2VPXA 1D09A 4ECEA 4ZFNA 3PTAA 3L1IA 1CS0A 4NBKA 5B58T 5KB3A 1K88A 2LNDA 3KJZA 3EIUA 5IVPA 4DA7A 1EDOA 2MDTA 1XDBA 3HYSA 2XRFA 1C2YA 4A6XA 1UH5A 1W25A 3AJAA 2QIPA 4TRMA 4BU0A 4G5QA 3L7LA 3N2ZB 5CEEA 4YRBA 1NJ8A 3IBSA 3H0CA 4RQBA 2QY6A 2QBYB 1FTGA 2J0EA 2QMZA 2WNIA 3GGPA 4O4IB 4EY4A 4B81A 1ZM3A 4OA5A 2XWSA 4BKOA 2Z2ZA 1X2EA 1U5AA 3IVMA 1P9OA 1IG3A 1MV8A 3S70A 1YCHA 3LDGA 3WL4A 4EJ0A 1GDTA 3JQAB 4UBMA 3RREA 3RU7A 3WJ1A 4NZZA 4EEZA 2VDJA 3U80A 4LHYA 1U3CA 2CZCA 2QROA 4JLOA 4K87A 1K5HA 4RV4A 2CXTA 4TWBA 1M1ZA 4RGBA 2XCIA 2QMUA 4ABYA 2X6TA 1OJ7A 1K4MA 621PA 2IPAB 2WU3A 1W0KA 3G8DA 2DX7A 1E4OA 1SCUB 2XT6A 5JXJA 4DHEA 1RXEA 2PCJA 3IPAA 4I1RA 4BFYA 2OM2A 2QTVA 4B6GA 4D3XA 2EVWX 3WA6A 4FZJA 3SX4A 1SBIA 3ZCVA 3R5KA 4B6JA 3ZWQA 5EKXA 5LLTA 1EJ6A 4S35A 3EYWA 1XDZA 4KRFA 5LD2B 4EFLA 2GM3A 2CNDA 3P9XA 3QFSA 4RXMA 1H2EA 1K5GA 1N1DA 3TW8A 2YIDA 3GRRA 2NX2A 3OZVA 4JX9A 5AOCA 3W6OA 4WBNF 1E3LA 2ZRKA 2RHDA 4HLUC 3HVKA 4EA8A 1FDSA 3AETB 3FE2A 1UDAA 3X2FA 1ORIA 4HRVA 4HSEA 5JW6A 1FRFS 3BZWA 5LYJA 2ODTX 2HDWA 4X93A 1ATZA 4AW9A 1XCGB 3AP1A 2PSHA 3A6KA 2GJ4A 2R7AA 3FRIA 3M83A 4R9RA 4HNUA 1VB5A 5FOXA 3R7SA 1GYPA 3PFCA 4PZLA 1F2UB 4EARA 3LA6A 3IT1A 3AQ4A 4UOEA 2PCLA 3EWSA 4LYJA 4MIYA 1TTTA 1Q11A 3MWEA 3ISVA 1JWAB 1L8AA 1Y0BA 1QYCA 2FNAA 3OOSA 3OWHA 5ED0A 3RS7A 5KYWA 5KPDA 1Q0RA 4EVIA 4P3YA 1ZK4A 2I3GA 2HLNA 1Z2EA 1Z68A 2XMSA 3G9QA 1CVIA 5EJFA 3GPIA 3PDWA 1LC0A 1NVGA 1TZ2A 4DLPA 1JZQA 5CDHA 1ZMXA 1GP2A 3L4BC 4NFYA 5M34A 4ZU1X 4MWOA 5IMBA 4LGYA 1OYOA 4UMEA 4TL7A 4D4HA 3ZVLA 1YHNA 3DOCA 2E4UA 1WMAA 1WZCA 1O97C 4I1UA 1UQUA 5FNVF 3F7OA 2DUMA 2RCYA 3CSUA 4QG7A 5KJ6A 1V4BA 2YZ7A 3OCXA 1TM3E 1V6SA 2WJHA 4LRQA 4KXXA 2R44A 3KT0A 4UDYX 4Y1GA 5D85A 4BPBA 2IHTA 5JNRA 1AJEA 3CZ9A 3QTLA 2FKAA 3O8LA 4R68A 4B71A 4D3FA 1JSZA 4P08A 4E08A 3PYMA 3LG2A 4G5FA 4M87A 3MK31 5IWAB 2HCFA 5KSOA 1ULHA 1FZTA 2FE4A 1AZSC 1GCAA 1Q7BA 3PRHA 5HZMA 4BNDA 1HUQA 1GNVA 4I1VA 4QXPA 4U7JA 1EGQA 1W36B 1H66A 5F5NA 4YPOA 4TTIA 4UM7A 2HF9A 1NBHA 2H08A 2Q7XA 3CX3A 5AHOA 3C3AA 5E95A 4B80A 3OOEA 4AF6A 4DMMA 1XDDA 3HSSA 3KXLA 3LT5A 2J07A 2PUGA 2J0VA 1YAHA 1NKTA 5GPBA 1U7UA 3V5NA 2RHOA 5A05A 5GVSA 1MC1A 3D6AA 3ZQ6A 1QQ7A 1MVLA 2JD0A 2QTNA 2ZUUA 1H65A 5ECDA 2W8BB 1KVQA 1L4MA 1WCWA 2RH4A 3QM1A 4KV9A 1QP7A 2DRIA 5G1NA 1QZUA 5JDCC 4Y2HA 1ONPA 3UQZA 2HSWA 5CBKA 4WHMA 2HU5A 5D6OA 1ISIA 1TEHA 1A2QA 1KGDA 3LX4A 3R5XA 4DMLA 3OZXA 5FADA 4JUBA 2XUQA 4NMHA 5I7AA 2Q4TA 1FMTA 3UJBA 3DO5A 1S2LA 1G60A 3D43A 1OBCA 4DUGA 2DJIA 5LIRA 1R0XA 1ACMA 2QAGA 4CWAA 1ESMA 5KYYA 1XRRA 3C1TA 3MCZA 4ZO7A 3RHTA 1GTRA 3EGEA 2XADA 1S9HA 2ZT8A 5KSPA 2ESRA 3P0JA 1E0KA 1Y1PA 5DYYA 4TS9A 1KJ9A 3WRYC 4C87A 2GD0A 3MWFA 3VC1A 4F2PA 5BMVB 1WLSA 5FOQA 1RJ9A 2FN9A 1ZCZA 2HO4A 2CWWA 2LV8A 3QVKA 7ABPA 4L0QA 2FPGB 4BX9A 5BOVA 1FFEA 1NXPA 4JCCA 2Q7OE 4URVR 1C1DA 5HKBA 2V03A 1S2GA 1A4XA 1YR6A 2ZYHA 3QVWA 4DWVA 5HQ3B 3INTA 3WLMA 3WLJA 5EJ8A 2FW7A 4QO7A 4KAJA 4Q4JB 3GLHA 3VX3A 3KSDO 4PYMA 4IRMA 2JGEA 1GNLA 2FEKA 1PV1A 3HHPA 1I6MA 2HH9A 3LSTA 3MS2A 1E5LA 3B6IA 3QWFA 3PNBA 2ZAOA 1Y1KE 3Q5EA 4FMCF 2RGNC 4FQ5A 4OJTA 2G63A 4CFSA 5DI9A 1E2IA 1RI1A 3H5TA 5L4LA 1ZHFA 3FFXA 5ECWA 4Y1RA 3BSFA 3ROXA 3TSZA 3U7RA 3DLHA 3LQ4A 4JDPA 2FUCA 5AJZA 1GPKA 3EVFA 4X61A 3O7WA 3Q7QA 3KZOA 5PGMA 5TQ0B 3VHXA 1E9SA 2WQ7A 3JQEA 1NXXA 1P6XA 3LWZA 1XQWA 4HLQB 1PL8A 1T8WA 3BGIA 4FJ2A 4E4YA 1KJYA 4CLEA 4OM8A 4PY2A 1MX9A 2FQQA 3H0KA 1XVVA 2EBUA 3OICA 4LE1A 3KTFA 1XALA 5ALVA 3GCWA 2D54A 1OR8A 2DHQA 3OUTA 1SVKA 3ND5A 1W35A 4QC2A 1KIFA 3CLHA 3RWBA 2IEZA 3K71B 2DLCX 2VJDA 1UDCA 4ZOQI 1EUYA 1EFPB 3JRWA 3MMZA 4JWTA 3HZZA 3ZDEA 1KJ8A 1WDMA 5CA1F 4DB2A 2XUPA 3KEQA 3QFHA 4HX9A 1WWKA 4BC0A 5JJCA 3BJEA 1T9CA 4N3AA 4XYBA 2I8LA 3RC1A 1NVTA 2JFQA 5FPPA 1FTSA 1MEJA 5HCIA 2HJRA 3AXSA 2CVQA 4N41A 1NHGA 3FMFA 3ESZA 1AKVA 1GQFA 4D43A 3WZLA 2GEJA 2Z6VA 1TM2A 4NJMB 1I9GA 5DGTA 1QF7A 3E9YA 3F6EX 2EBWA 1CUBA 2ON6A 1GWNA 2D13A 3OOWA 4JJZA 3SXPA 5HUHA 1IEWA 1TJ4A 1U0EA 3WGOA 2QM7A 2YYSA 3TF5A 1T4CA 1ZOIA 1YRLA 2ZRGA 2GSWA 3CWZA 1HY3A 2DVMA 4II2A 2YYZA 1IDOA 1PL6A 3F49S 4RHTA 3WFJA 3FOEC 4Z4FA 3T0IA 4DR4B 1T3TA 1RM4A 2M32A 4S1PA 2Q0HA 2RSLA 3PE6A 3V8RA 2ZZMA 2LR0A 1XX6A 3FUUA 4F4UA 5CFZA 5C7IO 5KSZA 1KSGA 3VKGA 4HDSA 4DGQA 1VRWA 2CDCA 3C4JA 1AN9A 2D5CA 2C96A 3F9RA 4QWMA 3SSAA 3TSCA 2G5GX 2FPPA 2WT8A 3OOJA 4KKXB 5HJEA 3AKCA 1I1QB 1CEXA 2BEWB 2QTMA 1CRLA 3T9EA 4YR7A 1P9NA 1G8GA 4RIHA 2PA3A 3NWPA 1QV6A 2ORWA 1A8PA 1OWOA 4MS1A 1PT6A 3PFWO 3VHRA 4CN9A 4Y2XA 3DB1A 3WMFA 3UV6A 3LPAA 2WWWA 3N2GB 1U02A 1WVMA 3BJRA 2J41A 2PNFA 4OXNA 4WEOA 2X15A 4Z0PA 4P3OA 3SVZA 4Z4QA 3P9IA 3ZVMA 4IYRA 3PT9A 3ADDA 2I29A 1FP1D 2ZB3A 1QIJA 3ZHYA 4D9EA 4KO1S 3BDAA 5CIWA 2R97A 3CPEA 4GAEA 2HIHA 3W4JA 1N5MA 1R2QA 3ZTTA 1T43A 1LDBA 1M2EA 2DPMA 3F5QA 1FLAA 5IT0A 2O8BA 1KZ7B 1W85A 3OEED 4KDCA 1U0HC 2WY2D 1SRRA 2KBFA 4A6PA 3C14C 3I5AA 3F9CA 4AO7A 2C9DA 2XDAA 4ZEMA 4Z7JA 1Z7WA 3UT6A 4TKVA 2F1KA 4K9SA 5A71A 2YJGA 5CCEA 4E5KA 1Z2DA 1IQ0A 2OMEA 2WMDA 4NBWA 3WLPA 5B1DA 4C76A 2FWNA 2O0KA 3FNFA 1L4EA 2YYAA 2W2TA 1KORA 1L7VC 2AJDA 2I0FA 2WUGA 3ILXA 3Q3IA 3WWPA 4AIIA 2AR9A 4ISBA 1K5PA 4XGNA 4KQIA 3BF7A 4RDCA 3JU3A 3DZIA 3TIFA 1NTOA 1T3HA 2A9VA 2LGJA 3OQ6A 3UEOA 2O3RA 3WWEA 4BTEA 5K1ZA 3GGGA 1UBMS 3ZC3A 2IEBA 1NM5A 2Q3EA 4M1YA 3WGVA 2G4VA 3WHLA 4PBSA 4KPFC 4DSNA 2H06A 4MITA 1B41A 4KIWA 2Z4SA 4HJRA 4JKYA 1UC4B 1LLQA 3OT4A 3H13A 1VE5A 3IA7A 4RF2A 4IDEA 1K66A 3T1OA 1HDCA 1OXTA 1UMBB 2Q0SA 1W36C 3T9AA 1UZUA 4RTNA 2NW6A 2G5PA 3H4MA 4MQEB 4HGPA 3FMGA 3UN1A 1OBVA 3F4KA 3NHWA 1MV5A 1OX4A 4YUZA 5TMBA 5BYAA 3TN7A 1QE0A 4JP5A 3C43A 1GFIA 2RFLA 3EY9A 4ZAGA 4WSOA 3G5LA 3O8QA 2C4MA 2GB4A 2UXBB 2B78A 3SNHA 1ZHHA 1IXRC 2JFPA 4F6RB 2P6OA 3SHFA 2WU1A 3FTFA 3LXUX 4JQYA 4LXUA 2ZOSA 3DMFA 4DLUA 4KACA 5JVDF 5F3WB 1YJCA 1JHZA 4DR2B 1HE3A 1FYEA 1IPEA 3P52A 1E1KA 2VXCA 2I76A 1M2KA 2WSSA 3BB1A 3VR6D 1RS0A 4L50A 2IPXA 3STYA 2J6IA 1CY0A 3AEYA 1SCKA 2BFPA 4FYXA 2D5BA 4WXMA 2P1RA 1TFRA 1M34A 3C3WA 3X43A 3ZKWA 1JLSA 1P7CA 5C5DA 5LJIA 1TZJA 4IKOA 4XJXA 1JN0A 3R7FA 1K9SA 4Y67A 1IN5A 1QV7A 3L7BA 4MH0R 4TRRA 5CW2A 3ZGVA 1ID1A 3BDVA 1NYQA 1SD2A 1NV9A 2Z83A 1GZSA 4OU4A 4GMGA 2P8SA 4X90A 3TEMA 4XX0B 3K73O 4Q9HA 3RLFA 1SB8A 4I9UA 2JHPA 4L73A 2CY0A 1C9JA 2VHZA 2X0NA 3OG9A 3F7MA 4TMKA 1Y9ZA 3IHKA 3PKJA 3CUWA 3P2IA 5DGCA 1VRCA 5BXYA 5WRFA 4L27A 3U4DA 1QFYA 3OX1A 4JI7B 3I58A 1DDOA 3I3SR 3UFXB 1OE0A 3C8HA 3K7EA 3VA7A 3W2TA 2ZJ8A 3I37X 4HWRA 5DXFA 2XKBA 5AM2A 2O5VA 1P19A 2IUEA 5CMLA 3WIBA 1R6DA 3QUAA 1GTL1 3HWSA 3TNLA 4DANA 1AH2A 1BMDA 5GM2A 2H2IA 1C3OB 2YTZA 4O4LF 4PGFA 1L5LA 3N3BC 1DAMA 2V7XA 721PA 1RXCA 3U40A 5EXXA 7ADHA 2CLEB 5FNVA 4WE3A 1RWNA 5AVTA 2R5FA 3OJWA 5KTRA 2WYWA 4FSXA 1X7XB 1FFDA 2PKQO 1YULA 2VKQA 3OT1A 3ZV4A 1EESA 1GXSA 1ML4A 3D0OA 1ONBA 4UPDA 6NULA 3DLAA 4IR7A 4BXOB 4OBBA 3QKSB 4IJ6A 4GOKA 3JQ8B 2NLOA 3M2PA 4IIFA 3TNFA 4DSUA 4OFBA 4OK5A 4OXXA 4ZGWA 3I1FA 4PSDA 2G1KA 2XYGA 1D0VA 1SBCA 2IPNA 2JF0A 3K20A 4BOYA 3N2NA 4A27A 4K40A 5I7EA 3HEAA 4OXQA 2NU6B 3OPNA 2JGMA 3N2KA 2P9EA 2FR8A 5DHAA 2MCFA 3LQYA 1E79A 4XPIB 1B4DA 2JLZA 2FDCA 2Y1CA 2Y93A 1V11B 3CBGA 1JTVA 2CYCA 1A7KA 2FCRA 3G23A 3AWIA 2PGIA 2GTPA 3G5MA 4GICA 4RTQA 4DADA 1JX6A 4NESA 3QLTA 2P9ZA 4H6WA 4MUMA 4R41A 4Y6PA 2ZZKA 3DA8A 5FF9A 3V34A 1NJ1A 3TLJA 4D98A 2BGUA 1RXIA 2ZT6A 2WF7A 4BNLA 3N2YA 4F06A 1T5SA 4X97A 1DKRA 1KHHA 4RVNA 3R8XA 5LQKA 2QJTA 4P35A 4ZYVA 5AVKA 4EW6A 4MV5A 3GD5A 5HBRA 2I4LA 5BR4A 1NASA 3QVGB 3ZWPA 1YH3A 5B6IA 4ETMA 3JQ9A 2Q9AA 4ZHQA 8LDHA 4CKBB 4OHYA 3EZLA 2Y4NA 1HNXB 3SJBA 1XNHA 1E66A 1W49A 1Z83A 1Z74A 1KSFX 3DDZX 4QUBA 4CMEA 1KKUA 2R11A 3ZS9A 2VQEB 3R0QA 2RAPA 4H7HA 2CLOB 5DYWA 3CRQA 4F56A 4Z1MA 1IUNA 3WZ2A 3Q15C 1Y8ZA 1OH8A 3T95A 1KJQA 1RBYA 2ZE5A 4MV4A 5LOVB 3D2LA 1C3VA 1WTAA 4FYKA 4XB1A 1KZHA 2QUBA 4NFLA 5KYNA 3G1WA 3E9CA 3WMRA 4DMRA 4FDMA 3QHAA 3DTTA 3QV2A 4RYDA 1F2TA 3TQFA 3TSAA 3V48A 2O9JA 2BBWA 3M3PA 3W5BA 3HZHA 1RWOA 1AKQA 5IZCA 1ML3A 3DHNA 4BVBA 3W05A 5SYNA 2GCNA 2C03A 4MS3A 5TPZA 8OHMA 4PAMA 4DT1B 2GFIA 1YS2X 2F7SA 4BJ1A 5CXUA 2GZSA 1SBNE 2ZLBA 4HH0A 4V0KA 3BIOA 4QNMA 4QODA 4TT3D 1NJ5A 4HN4B 1WDLA 1UKEA 2H4YA 2XCLA 4N0MA 4NBUA 4RYLA 1FX0B 4I9NA 5CAEB 1FXUA 4JSYA 3TI9A 1MAWA 3WRVA 3MCUA 1TTHA 1Q0SA 5K0TA 2I4MA 1Q0UA 1USVA 4IJMA 2YIMA 3LC1O 3C24A 3M5CA 2D62A 1H3EA 1QGZA 2WI8A 1NQOA 1PBTA 2XWJI 2JHFA 3R3VA 1E1MA 2GOYA 3JZIA 1Z16A 2V59A 4NU5A 4QDKA 4U1RA 3U3MA 4PPNA 3F3MA 5FXMA 3Q1KA 1SHJA 4WV3A 4QGAA 4OSEA 2JVJA 5K51A 4CKWA 1WPXA 4LGVA 4J4TA 3H9UA 3AEUB 3AERA 1JKFA 3P7MA 1E1RA 4K8OA 1PZFA 1V16B 4FMBB 3CN7A 2B2NA 2W6IA 1D6NA 1A88A 2OHFA 1TE2A 3OZDA 3V1YA 3AHEA 3L04A 4K0RA 3DT8A 4BL5A 4JUDX 3BXPA 3M1AA 3QA3E 5E1BA 3KRTA 1F3LA 2KWIA 2ZYUX 1I30A 4X64B 1FRZA 4CQLA 4PYIA 1U6IA 4JLMA 3LC7O 4G0XA 4IOMA 3MJVA 1WXWA 2JB9A 1J2TA 4IRUB 1GHTA 2PH3A 4UVEA 5GAJA 1CJKC 3N53A 1GKLA 3CQ9A 3ESAA 4PTYA 3G9ZA 2AQHA 1PG5A 3A9TA 4E6EA 5TC4A 5JFTA 3K5PA 3GRKA 3G8BA 4BQOA 4LJYA 1TQ8A 3NRBA 1GTZA 2J7PA 4HEA1 5HKKA 1I7PA 2AGVA 2NT3A 2ZRLA 3BK2A 3M6XA 3H4IA 5ALJA 4DCPA 2QX7A 2COKA 2R25B 4HAVA 6Q21A 3NDJA 4IV5A 4HLUA 3LPLA 4KVGA 2DWUA 2JS7A 4M86A 3UOWA 2VL7A 4ZI2A 4CKCA 1NVKA 4MVJM 2OK8A 3HYTA 5DZSA 3EA0A 1B00A 1IBRA 1VP3A 2C2OA 1Q16A 3FVTA 2D0OB 4K6CA 1PEYA 1TVMA 2CCJA 1ZRNA 1VG9B 3ASVA 2D00A 1JHXA 2C7BA 3B6EA 4QQKA 4Z4CA 5BQFA 3THWB 1SZPA 2ZUDA 5EIWA 3WLEA 4RA6B 3EPRA 3KPYA 2VYVA 2P4UA 3LPMA 4HF7A 4YQEA 4B6FA 1DBRA 3OU6A 1CY6A 5KTKA 2W2PA 2ZJFA 1GGNA 1QUEA 2YNMD 2ZI9A 4WI1A 3DL2A 3O93A 3NT4A 2V9ZA 4EB8A 1WZEA 2JJQA 4GG1A 4GOLD 4ABTA 3QU5A 5SY4A 3X1ZA 3KOWA 1O94D 2DU8A 4UNRA 3EXG1 4S3MA 1AKEA 2VDLB 4JI6B 1JUDA 2JAQA 7AT1A 3JYPA 1SPBS 2PU5A 4NEHB 3H11B 4RLFA 3RS9A 2IHNA 1CF4A 1ZGZA 2Q21A 5AKJA 4UQPA 4UKDA 4JBLA 3M70A 2NXCA 3TZLA 3CT6A 3BB4A 3EAFA 1WV1A 2G08A 3UJDA 2P0AA 3L4BA 1Y6QA 3ML1A 1UFKA 3V42A 3SDZA 4F1JA 2P65A 4KXVA 4N3CA 4F85A 3DOUA 4MA5A 1Q1NA 4PLVA 2UUAB 2XTZA 1L8LA 2RCNA 3RT7A 3P9QA 4OQQA 3WK9A 1J8MF 2EWVA 3DKRA 4W5JA 2R47A 3BSYA 4RL6A 3PUWA 5LU9A 5E0KB 3NBKA 3DXFA 4OBEA 3LHIA 3CZRA 5K6AA 3ZHBA 4UVHA 1P6UA 4YC7A 5ICFA 1T10A 4ZC8A 5CX1A 2OXIA 1VKJA 3VDQA 4IEIA 1OW3B 3O31A 3K1ZA 1ZOLA 3PJDA 1ZHOA 4NYMQ 3O75A 4LJSA 4TKUB 1L6IA 3JTMA 3PNKA 1LK0A 5HQJA 4AN4A 1WSWA 1AZLA 3K9CA 4GZ6A 3WRXC 4ROSA 3B1KA 1H2AS 4UTPA 1T5TA 1QOPB 4I6GA 5BPFA 2PZJA 3TLKA 3GJQA 4ER5A 1ZR4A 4U4AA 2IW3A 4OI4A 3HSYA 5AVJA 2HN9A 5B53A 1TZKA 1DKMA 4DFDA 3HUEA 1OAOA 1I80A 2G83A 5BSWA 2ZSEA 5JDCA 1T1JA 1E6KA 4JC4A 1Y8RA 4LV6A 4BIMA 4B4KA 1HNNA 2JCBA 2RB4A 4UJ3A 4JXZA 2I2WA 4B35A 2I9PA 1M5TA 5FI0B 1SG0A 1DZIA 2HX1A 4BB6A 5BV8A 2CEAA 5JVDA 3GZNA 2A67A 5DI3A 1I5EA 1LNQA 2EP8A 1VJ0A 1PF7E 2X5NA 4V0SA 4ZQBA 4BE9A 4Z53A 1C0KA 3HADA 4LXTA 4B43A 4EJ6A 4J4BA 4P4LA 4JLJA 4H17A 4OX9B 2ZB2A 3LYAA 1YUMA 3GG2A 1E1QD 4RD0A 5FPTA 3WRYA 4HAXA 3M1IA 1EEHA 1G8HA 1ZI6A 4QREA 1LBTA 3GZ4A 3NYIA 3GPDG 1K2WA 2GYWA 2G7MC 1KEEA 2Y2VA 2XSZA 2CVHA 3ABOB 1F4LA 2XMPA 3RDPA 3AR4A 2X58A 3UCFA 2X76A 2X7JA 3F96A 1A96A 1W4RA 2G67A 3QPBA 5EZ5A 1AUXA 2F1JA 1GOTA 3F9IA 4NZNA 4U9IS 5EP2A 1LX7A 4ZVKA 2YXPX 5KTPA 2QGFA 3T5GA 4R1LA 1KPIA 4EPWA 3QMPA 5KOHB 1UWCA 3PVSA 4UCQA 2CLSA 1BVYF 2FW1A 4BN4A 3ZK8A 4D6XA 2RGNA 4I5IA 1NTRA 5DBIA 5F2EA 4FFNA 1RHRA 3WYFA 4M76B 4CIBA 3CLSC 4MVWA 2WFAA 1E7SA 4PG5A 3WDKA 1FS5A 1QLWA 3MGGA 1PYGA 4L7VA 4NOKA 5F73A 3IBYA 3RVSA 4EJSC 1MRSA 4OATA 4O4LA 1ZFNA 4DV1B 1DJNA 1DC8A 1A50B 4X6YA 4GKBA 2ERYA 1V5WA 4ZDJA 1DCTA 4A3SA 2PSDA 3QX3A 1JR4A 4IOKA 3O1LA 5E6UA 4PQFA 1GUZA 2RJNA 4LWPA 1CVLA 6REQB 2JA2A 3GF4A 1A8IA 5FTNA 3V2UA 1QAMA 3KKNA 2FG7C 4R2KA 1U80A 3VU9B 3TZQA 4MS4A 2JKZA 2NZ8A 2K7ZA 3K30A 4LYGA 3CEJA 2VHQA 5CIQA 4C3VA 3CNOA 1VLVA 1Q2XA 4HFRA 2Q3BA 3IO3A 3UY4A 1VIDA 4K5QA 5ANRB 4B8ZA 4BC1A 1Q12A 1YA4A 2O2ZA 2FX5A 3ILHA 4Q9KA 3SBXA 3K9NA 5DWVA 1QIIA 1XCJA 3U4CA 2YZ2A 1JJBA 3KM0A 2QBYA 4NCJA 4RFSA 1K6IA 3PGXA 3L6EA 2C3OA 4Q6BA 1TK2A 1XPUA 1OT5A 4F6CA 3ZI0A 4QUIA 4W5HA 5J2TF 3ZX4A 1FZQA 5AKLA 3IA2A 3WG9A 5KVCA 3PIIA 2XVAA 1JEQB 1BXZA 2JFZA 4IFTA 2WQZA 1M8FA 3IURA 1Y1QA 1RQXA 4QYMA 3ZN2A 1VJTA 1M1NA 4IIXA 2D7JA 4TLLB 3T52A 3OX4A 2ZGVA 1MVOA 4C01A 5CH3A 2F64A 3Q9SA 4WASA 2DHCA 1AKYA 2Q7DA 3TR6A 1VHJA 3WFIA 1EFDN 4B5KA 3RT9A 1SCUA 4WACA 4IDQA 1X7DA 2BDUA 1OFHA 2ZJ1A 2Z8YM 3II6X 1NL3A 3QYJA 4P84A 4FSDA 4I4TF 4OB8A 3SR0A 4K6GA 1X1RA 1X7GA 2JJ2D 4K26A 4CXMA 1ZVKA 5TVKA 4KGDA 4JT2A 1S2IA 4A8HA 4KWTA 3LPNA 2IHKA 4CT5A 4KR6A 3DZJA 2OG1A 4OOFA 2Z57A 4R0MA 5BORA 1L8QA 4ER0A 2QQ0A 3T3HA 1N3IA 1CJVC 4KCGA 1JR3A 3AETA 2CLHB 1KEPA 4PQRA 3VO8A 1CZNA 1YB2A 3GB9A 1L8OA 4AF7A 2PL5A 2YV3A 4G1FA 1O0SA 3DFKA 2P41A 1AUPA 3O3NB 2W00A 3NDIA 1GM5A 1XNQB 4A0SA 2BI7A 1VPTA 2ZIEA 5ILQA 3BA6A 5E2AA 4BTVA 2BC9A 3W77A 3C3DA 5TEWA 5T41A 2X5XA 3NVAA 3LYUA 3RUFA 4G5XA 1FDVA 1Y42X 3LRPA 3VR5H 1Z35A 1JVNA 4G65A 1B7GO 2FPXA 4BRSA 4IIHA 4Y1FA 5AUNB 5JDIC 2GN6A 4BX8A 4O4JA 1CHDA 1NNUA 4DBZA 1V6CA 2XMRA 4J91A 2Z5LA 3F2VA 2VR1A 4ZVRA 1FJHA 1LPBB 2NSLA 4BVGA 1P77A 1PKXA 1RRPA 3QLUC 3NHRA 4TVKA 4US0R 3Q6NA 5TS3A 4D4MA 1RP7A 1Q7RA 1YRHA 2FFQA 1H5UA 1LD3A 3T3PB 1AF4A 4UQLA 3BRCA 3D3EA 4PSUA 3UAWA 2LKDA 3D4IA 3U0VA 1DTEA 2FA9A 3ZZNA 3CKKA 2ECFA 2M6RA 1WOYA 1LBHA 1QQ5A 1CRQA 1UXJA 4CPDA 3O95A 1GQOA 3WK8A 1XMJA 2IYVA 4UHKA 4EY6A 2WP8J 3E22A 3M3DA 4YJKA 2VO1A 3B5JA 5EHQA 1D5WA 2OA0A 3IKLA 3OTOB 3RH0A 1CPYA 2XE4A 3FNGA 3NTXA 1D4FA 2COEA 1Z4LA 2VH2A 4PCLA 3RV4A 4TZ6A 1D1TA 2OLJA 3IV9A 4BECA 3EPHA 4Q47A 2Z4TA 2D59A 3FF4A 4BO4A 3LOPA 4YJGB 4V0ME 3EZYA 4UBIA 3MLBA 1XRNA 3FTEA 1P2GA 4PLPA 2NOAA 1BYIA 3I9JA 3UB4A 2UYCA 5FOSA 3JZMA 4HADA 2FWAA 3E4CA 1E2FA 3OEWA 4EFMA 5KZMB 3ZD6A 3JYLA 3HA7A 4OYYA 2GYVA 2W8BA 3HL0A 4LI3X 4MUEA 1ST2A 5ADWA 1JVSA 4LHSA 1W1IA 1XEAA 2WW8A 3STXA 3PGA1 4GBGA 3NV7A 5JE8A 4XRGA 1NUTA 5AW7A 3FCOA 2HU8A 1KSJA 3PLNA 1PJ3A 4EVQA 3GFPA 2EC5A 3ZGYA 1EWYA 1I4DD 1VJRA 1FXWA 3WBFA 8MHTA 5D3MB 3C2QA 2JJYA 1NXVA 5F7ZA 4IYJA 5EMLA 2Y67A 5FAXA 4WN3A 1I7LA 1ICEA 3E9EA 1JDBC 1JIUA 4A2PA 1NDUA 3NHZA 4HRXA 1TPZA 3E9DA 5EC8A 4WUTA 1LI7A 2NP7A 4E46A 1HLGA 2G0TA 5IU6A 4Q1CA 2CL5A 1RCUA 1XIVA 4CMHA 3IBGA 1PWZA 3EG5A 3KOYA 4NG5A 4WCFC 3WYDA 3AG5A 4D2IA 3ZQUA 4FNMA 4I50F 5EZQA 5KO2A 2PQ2A 2EZUA 2G0NA 2FPGA 1WUJS 4DDHA 4PINA 5J2UA 3DP7A 2IL1A 1TOAA 3TUIC 4BASA 5HQ3A 2AFIE 5L40A 2FVXA 4FCCA 3PX7A 1PEAA 1E8MA 1ZK3A 2VUIB 4OP2A 1RVDA 3SYKA 4CQMD 1R1DA 4X6UA 3VGJA 1X7HA 2Z9CA 1YS1X 4NBTA 1UAYA 2G4LA 3TBFA 5A0TA 4KL8S 4AO8A 1RT9A 3DMHA 4M46A 3CZCA 3GEDA 3TPCA 4CMIA 3PDJA 4IVQA 1OAKA 3V2HA 4MQ5A 5LDGA 2V3VA 1SOUA 1W44A 2B8TA 1FB5A 3H05A 2WM9B 2B7BA 4UTVA 4Q9IA 1DQNA 3LBAA 3T1NA 3BM5A 2DCUA 3CFYA 5G1PA 1UJCA 1PNTA 3GDFA 4C3OB 2YWCA 4CE6A 5SZHB 2ZULA 3ZNNA 1Z2OX 1MFZA 2B1GA 2I78A 4C20A 1L9XA 4LMPA 3DNFA 5TQ0A 2ZR8A 2H4JA 4DUPA 1YVDA 4PGAA 5KWJA 4RVCA 2PUCA 4M55A 3TUZC 4U00A 1KHTA 2QMOA 3GT7A 3P0IA 3WOVA 1NG9A 4LNAA 4Q9NA 2C2YA 3BAFA 4QQNA 1QOZA 3TRDA 4CM8B 2TMKA 3NP9A 1ABEA 4BQSA 2JC3A 1JFLA 3AVWA 5T8KC 4N8DA 4BYMA 5CFMA 5ALTA 2BL4A 2P1DA 2WTMA 3EEYA 4YCAA 3IHLA 4WKPA 1Y6RA 1SC1A 1EFPA 1W47A 3A1UA 4RK5A 3PRJA 1GKUB 1VJCA 3PHHA 5K3DA 3SC2B 4IHJF 2C04A 5AQEA 2GBGA 3OE4A 4G85A 3PXDA 4JT4A 3QVJA 3DVRX 2HEGA 4B3TB 4FGZA 4J7UA 4FBLA 2C07A 2C7VA 1BVUA 1VI2A 4X6XA 4YRAA 2B3TA 2Q5FA 3GEGA 1CUDA 1FNSA 3U4IA 1PRYA 4NJMA 3U9LA 3GK3A 4LF9B 3C0KA 4NHOA 4E5MA 2G9QA 1JLLA 2O20A 2OXFA 2JIZA 4F86A 4B6SA 3QF4A 1SBZA 4J0HA 2OFOA 2R6GA 1R16A 1CUEA 4MVJI 4FX5A 2WUDA 2GBFA 3E81A 4RM3A 1YF3A 3GLKA 2HJWA 4CU5A 5H7XA 1OTYA 1ISFA 4HP8A 1UMDB 4RDHA 1MQSA 2BFFB 2YFYA 2RB5A 3TZBA 3CS3A 5FNZA 2H2FA 5GQSA 3ZTWA 1WDTA 3FX2A 4HNHA 3RAJA 3WGUA 3WIEA 4BQQA 2JANA 1W6UA 3E05A 3B89A 4PONA 1N3YA 1RYDA 4EW2A 4S05A 5ICCA 2DYKA 1JH9A 3PUHA 2GUWA 2V0CA 3A1TA 2QV0A 5L7YA 4OUKX 1TMKA 3R0IA 4D6YA 3E9QA 3SQWA 3TTUA 1PZEA 4YLGA 1U0JA 5ULLA 4MLZA 4R9UC 2HB6A 1DARA 4MWBA 2ZYIA 4NZYA 4RPGA 4XWGA 4FFVA 4W5NA 1SC3A 1F0NA 3L92A 4PS0A 5FLYA 3SFZA 2FWIA 4LE0A 2VTBA 1ZUNA 1FYXA 2WE8A 2XVZA 2Y1LA 3HO8A 3N2GA 5EIAA 1JFFB 2GPBA 3HMQA 1NI4A 2A14A 2ZJ3A 3HMKA 2ORVA 2VDPB 2WZCA 4ZYTA 3CUSA 3DDCA 4LOLA 3N8HA 3ZU6A 4EJFA 4OFXA 1YMQA 1YE3A 2A4KA 1PLLA 1DPGA 4FEYA 3OPYA 5JHGB 5GZ3A 1UBOS 1T1EA 3UBMA 1X7ZB 2GS9A 3D7NA 3NQ41 5DMXA 1EXVA 3OFND 1GCGA 2OFPA 4D74A 3SE7A 1N8TA 2JGKA 2AFVA 3MS7A 4HNAB 3AUTA 1M0TA 4G5SA 4MA0A 4QHTA 1LDMA 1Z6QA 1FMFA 4D4KA 4PNEA 1G5FA 2YR0A 5IVHA 2B1QA 3IEUA 2CV2A 4Y9RA 5KVSA 2ZB4A 3GDWA 1J0BA 2VDNB 5LNK6 3HJHA 1PNOA 3R0ZA 2VDWA 4ZVLA 4BNZA 5CT9A 3UOAB 2VZLA 1ENOA 5TQVA 3ZDAA 3CLUD 5CVTA 1G16A 1X1BA 1RM5A 1Z9BA 2AUMA 2F62A 4MQFA 2I3DA 5EHIA 3DTVD 2R0QC 2I6TA 3GIWA 4KG7A 2P5YA 1U4OA 2PQ0A 4YT8A 3D4OA 4N3NA 3AR5A 3ESQA 3COPA 4YJFA 4WNCA 1UMBA 1ZY2A 2QTTA 5EKUA 4CGYA 5C4MA 1CUSA 1FUUA 3KBBA 4MGZR 3IV7A 3BWCA 1M54A 4GUDA 2ISQA 3M81A 4CKXA 5FWNA 3ZQKA 3BWMA 4JOQA 4JR1A 1ZZGA 3FLMA 4LIPD 3NU1A 5BR7A 2OB2A 1YDGA 1I3KA 3FKSD 2OGTA 5COQA 2ZRQA 4R8MA 5LWHA 2D0PB 3PA6A 4F6RA 2WHYA 2FUNB 2W2LA 4IY1A 2D8MA 3P5BA 4DJDC 2Y4OA 4GL2A 4MNTA 5JH7F 1R9NA 13PKA 2P2ZA 3FWPA 1HE1C 2B0CA 3VR5A 3ZG6A 5HHTA 1XI2A 4JK3A 3E1SA 1BVRA 4J16C 1H8EA 3OZRA 4Q19A 1F0PA 2XRYA 3B1FA 2H1IA 2WYVA 3PV0A 4GZ3A 3FB1A 3UMGA 2BGTA 4PE5B 1WHSB 2R6FA 2PLFA 1ACJA 2F00A 4YVFA 2G25A 2H2GA 5KU7A 3KQVA 3D02A 5HKLA 3ROKA 4HBGA 1RHMA 2BDTA 3H3FA 2WRZA 1PL0A 2HYDA 4FMDF 4J3FA 4P8RA 4WBXC 5JQGB 4H7PA 1MXFA 4H1HA 3UAOA 4LBWA 3PI7A 1K3FA 2GN4A 3A7DA 4QATA 4YAWA 1N2OA 4TVBA 4J4HA 1GGJA 3H1AA 2AYZA 3C8MA 5BSRA 5JV5A 4MQ6A 1CUUA 5ICGA 1MX3A 2MMGA 3BE5A 5KQLA 4HNVA 2HWWA 3CE6A 4QYXA 5EXTA 4QAQA 1R0YA 1IYZA 4P3NA 2C9BA 3D6UA 4ATNA 2P3OA 4IFEA 4ZRDA 4OSPA 5BSFA 4JYAB 3KJEA 3UFXA 3R23A 5EINA 3ZJUA 1Y4SA 1HTTA 2AG5A 2YBDA 3SMQA 3WKEA 5AVZA 3HK2A 5GOTA 1BQEA 2JIMA 4I1YA 4EF4A 4EBBA 1TM4E 2XB8A 1L5ZA 3RRNA 1C3OA 2R1TA 4MDYA 2VDKB 3ABZA 3I9MA 1Z5OA 3N0RA 2DEUA 1NONA 2Z6QA 2O0LA 2DSNA 4MX8A 5EZ6B 4W9MC 3D7MA 5K01A 5F1YA 2VDUE 2AZXA 1GGMA 1W4ZA 1CD5A 1OGIA 2CJWA 4FD2A 5CGQB 3THXA 1GQYA 4FT2A 1EVKA 2PR7A 2ENWA 4Z8XA 3ZEIA 5C4IA 2Y1OA 4NR0A 3OFKA 4B7AA 3B1YA 3WIVA 3W5DA 5KREA 2ZBGA 3EFEA 4BXOA 1WUYA 3QKSA 4LS3A 1YL6A 4FD3A 1JHVA 3ZBQA 6YASA 1ZXBA 3JQ8A 3K2EA 1LA2A 2WILA 3P9CA 2CBXA 1ENYA 3EUFA 4V3BA 2OAQ1 3UJ6A 4W9RA 2A33A 4J0QA 3WRXA 4QA9A 2I9KA 3E2MA 4MCAA 3PIRA 5IAEA 2AXEA 2C4TA 1KFKB 1RJFA 3RTCA 4YJ3A 3TB6A 5K2OA 3IQHX 3JTEA 1N2SA 3O4HA 1H2FA 3ZYCA 4DVJA 2LDBA 1NN5A 2WIAA 3HI4A 2P8JA 5BVGB 2Q3CA 1KYWA 4TYYA 3O8OA 2AC2A 1IM5A 4XPIA 1UP4A 2JLBA 2EOAA 3KR9A 5KTMA 4P22A 5EZYF 1U9JA 1JYSA 2AG8A 4YO8A 3O26A 1H2YA 3DE1X 2B69A 5B36A 1JAZA 1R18A 3GZTB 4XUEA 4C2TA 3CINA 4YO7A 4QBTA 1EFRD 4ZREA 5EIBD 3U1TA 1JE0A 1U6KA 2Q29A 4RY0A 1N34B 2WG0A 2J3KA 2FOIA 2F67A 3EZNA 4MARA 2WD7A 4I1PA 5BUZA 3L41A 4URUR 5LZ8A 2WP0A 2VWGA 5JSZA 1DXOA 1XVUA 4PIMA 2HDOA 3FRJA 3FDXA 2ZQYA 3ITDA 2AKAB 1I4WA 3RJ5A 3QVGA 4MV3A 4BQPA 2IHVA 2P9YA 1K7EB 2XWBF 3EG9B 5DGDA 4CKBA 2HMWA 5IUKC 4M9QA 3GJ6A 3W5HA 3GRVA 1ADYA 2PSJA 2BTOA 3CLKA 3QBVA 1DU4A 1BMFA 2ST1A 5CW1A 2FFRA 3EQ2A 5DTRA 1B0UA 1ST3A 2IJGX 2DWPA 3FRHA 4R5MA 4DG9A 3FYCA 1R8YA 2R7MA 3EXG2 4PVCA 4QE3A 1C8VB 3T3DA 5JZOA 2YN0A 3NEYA 5E38A 5IAAA 5K7SA 1A5TA 4MICA 5CB4B 1JLMA 1SWWA 2B83A 1XOIA 2X4DA 1MABA 4LRTB 5LOVA 2YW2A 5JIBA 3W9SA 2E7ZA 3W6ZA 3QPAA 1ZEMA 2IZZA 2RHBA 1PS8A 3WQSB 5CFPA 1E1LA 2NVWA 3F73A 1SD5A 5LQNA 1AQIA 3G6KA 1J21A 3CNQS 5AW8A 1G1AA 4ZOLF 3NEJA 4WZZA 3PHCA 4PICA 4YP1A 5J5CA 3V8BA 5JBQA 3GVXA 4W6ZA 4XM0A 4OB7A 3NORA 4DT1A 4FOSA 4QGGA 1Q91A 3KSUA 3ZJTA 1NVWQ 2Z1MA 1F0YA 3HJTA 4EG0A 1Z4PX 5HRAA 4BGVA 3BMNA 4GPIB 3PXEA 4WQMA 1CXZA 5FBQB 2VJOA 4AXBA 5CAEA 1FX0A 1UBTS 5GV8A 1JDUA 1T6YA 3TLZA 4C29A 1N2ZA 1IRIA 1RXUA 1R9JA 2AVNA 4JLUA 2CLMB 3ZY6A 4OI0A 2BFCB 3T7DA 3BL8A 4B32A 1JMYA 1DWUA 3RAFC 3S2UA 1G6HA 2G0AA 3TSWA 2YZKA 4X41A 2GO1A 3P1JA 3SEFA 3V3TA 1SU8A 4MLCA 5BNWA 4RTJA 3UATA 2ONKA 3QBDA 1XC7A 1DQYA 1TT7A 1ODJA 3S1AA 2V7BA 2RGEA 2AN1A 1YZQA 4QOHA 1SXGA 1U8UA 4OHCA 3ZHQA 5IAKA 1CE8B 3BQ9A 4AUNA 4G26A 4UCFA 1XZCA 3PGVA 1POWA 5D3ZA 2QVZX 2DT8A 4S24A 3WB9A 4YJ2B 2GEFA 1QBGA 3OECA 4BV3A 2EF1A 2HY7A 1V16A 3KKZA 1KS2A 1OFGA 5FWXA 2AI3A 4ZXPA 4JR2A 1JZTA 5BYBA 1BVHA 2ZRDA 3MELA 1ULTA 1NXOA 2JRLA 4Q3CA 3ACBA 3RTAA 1YK1A 1GSHA 2WWXA 1ENPA 3BMOB 2PY6A 3PCXA 4BZXA 3FDZB 1EFVB 5SZKB 4YR9A 1QS0A 5IH3A 2R6JA 2VQ6A 2PUFA 2GBCA 1LWOA 2PUWA 5LSAA 5FWYB 2F8SA 1OWLA 2B9VA 2OZKA 3DDWA 5JPIA 1KAEA 5IT9A 4N5LA 4G0WA 5H3LA 4INPA 2EWWA 2ZJ7A 3MJCA 2PZFA 4P32A 1A8SA 3AHCA 4Q37A 4RLSA 5GONF 2XHZA 5JWHA 2X0KA 3L0CA 1SZCA 1XL0A 4CT4B 5FL7A 3PPXA 1N7JA 1RHUA 3WL8A 1E69A 2X4IA 2XIJA 4XSVA 2OUIA 3CH4B 3H2GA 3TL6A 4TMZA 3RD5A 4F2HA 2J0QA 3EIWA 3ND7A 3RF7A 4D97A 4D42A 2AEFA 5DXAA 4Y6SA 1PNQA 4CUKA 5TIIA 2WWYA 5KI6A 1FFGA 1KA9H 4ZJZA 1P9LA 4KQMA 3OQIB 1F6DA 1W1WA 4PHHA 2PMEA 3PFHA 3A4IA 5J1TB 3ADOA 3AW8A 3A0RB 5HP4A 4YASA 1HX7A 1SK8A 5KWSA 4DR5B 4AT1A 1ZQ9A 4OY3A 3VKWA 3HWX1 1Q92A 2AQ8A 3EQ8A 4MV6A 5G3YA 3GHYA 2MU1A 3IRUA 3PJEA 4R4JA 3WK4A 2WJWA 1X9GA 2WWFA 1H22A 3PX3A 4G8DA 4AUEA 3PTLA 1N6IA 3JQQA 4JC8A 5JDIA 4JJEA 2XMQA 1JH8A 5E9WA 2CL7X 1ISPA 3AF5A 3UICA 2V7GA 4OXRA 1GPBA 4I2VA 4QM7A 1ITZA 3QTBA 4ER7A 4ZN6A 3IBFA 3T54A 3QLUA 4F9TA 1F7VA 3SQXA 1ONOA 1W9HA 3ORRA 3FY4A 3MTIA 2DTDA 3BXGA 1QVAA 1W5SA 3GEEA 3EGWA 4IMRA 3EGIA 2QYHA 2B3DA 2XXBA 3OMLA 1E3IA 1GNTA 3NIFB 3R6LA 4J2TA 5AM1A 1KE2A 1YL5A 1O89A 2BE7A 1HYEA 1N3LA 4B73A 5LZ5A 2RD2A 2JVIA 4MZXA 3ZOZA 1Z2PX 1JLKA 3NIDB 2RGRA 2XT0A 5DM70 4WFQA 5ICSA 3ORHA 4DNOA 1NGSA 1D2EA 1Z37A 1K7SN 5JZMA 2RE8A 5FLXA 1AG9A 2OWDA 4EG1A 1QRTA 4L5YA 1XRLA 3WK6A 2E4VA 2HMTA 4D0SA 1R0RE 5LP6C 2C7RA 3EN0A 2Z0MA 1TUBA 4LFBB 4IIBA 1R27A 2VSOA 1ZSYA 2F2TA 3FW1A 3OKAA 4YUWA 2J6BA 3TNDA 3DL4A 3CT4A 3UMSA 2J5XA 1P5RA 2WZDA 2GJ8A 5LQRA 1D8TA 3OKPA 2JD2A 3TM5A 3I72A 4G97A 2GN9A 5A7HA 3IOCA 2VHTA 4PF1A 5FWAA 1JHAA 1VE7A 4ZZ3A 3FLBA 4AJJA 1MOZA 4Q9LA 4ZYLA 3L7CA 3UC5A 3OOHA 4D5GA 2VPQA 3DULA 3IXQA 3QMMA 3LT2A 2H31A 4ND8A 3G5AA 1E2NA 1MG0A 3ELYA 5CR9A 3N39C 5ALFA 2PWAA 2GRAA 3H1BA 3KEMA 2WB4A 2PBFA 4EO4A 4DCJA 4EKDA 4AJKA 3C3XA 3KJNA 4EMTA 4BJ6A 2JFBA 2XYVA 5DX8A 1SVUA 3WYNA 3VHLB 2A1TS 3LZ6A 1P5ZB 2OORA 3UVEA 4K9LA 2IZ5A 2WG1A 2M1XA 3LCJA 4WZAE 2I33A 4NJEA 4KRGA 1X1DA 2GMWA 5KTSA 2X19A 1TIKA 2BT4A 3HSKA 4FR5A 2O2JA 3COSA 4UUQA 1B2RA 2JJMA 1GUFA 3AUYA 4F9FA 5DTQA 1ZPDA 3GA0A 2XYRA 3B2QA 3C6XA 3D6HA 4TZKA 3AHFA 4P5DA 1KMMA 4EY8A 4JC0A 3MTGA 3SG0A 3CJQA 5FPSA 4C03A 2PUAA 3OY7A 3OIWA 4RHYA 4X0EA 4UASA 2FMIA 2DWQA 4WCFA 1ODSA 4R1TA 4HMOA 3B53X 4ALMA 4IUDS 2FW9A 3MM4A 4KMMA 3DFMA 1BS1A 3IEPA 4JLVA 1VYTA 3IVRA 4RTRA 1I2AA 3W04A 5J4VA 2IPMA 3EGXA 1IN8A 2YXDA 1ZGAA 2DPYA 3VPDA 4P31A 1WHTA 3SIWA 4CMCA 1NVEA 4P81A 4YUXA 1JJ7A 3BTSA 4DXDA 1JU9A 4IWXA 5AMXA 1ISJA 3NWBA 1OY1A 3IUJA 1RWBA 1UK7A 5KOHA 1I14A 2VT3A 1TCVA 5LA6B 3LFHA 3EVTA 4DLVA 5EZSA 3HYRA 4J3NA 4AZ0B 2YNMC 4LKOA 2R5NA 4HDQB 3R40A 4PZZA 3V7NA 4HUQA 2CNLA 2QUZA 1F2VA 3VAYA 2WKPA 1O94C 3ROMA 2ZSFA 4C4ZA 5IABA 3VR6H 3WLFA 3M8KA 4PANA 3LF1A 2ZBUA 4PTLA 3ZW7A 4C6TA 5IWCA 3A6FA 2BMJA 1Z6TA 3GUCA 4P7KA 3VDRA 3TTYA 5BT8A 2RHGB 1WULS 3OIVA 2O6LA 3ZHVA 4NU6A 2PUVA 3VSBA 2AWOA 4FFBB 1GVNB 1T4MA 4TMYA 1T1SA 6REQA 4UREA 1UQRA 4OMUA 3JD0A 5T8KA 2PMFA 4CIDA 3A27A 4EKIA 5F21A 1GGEA 1XVTA 2QHXA 3ANTA 2ZI5A 3GLTA 3LRTA 5K99A 1E0AA 2EQBA 1M8GA 2F9MA 3L18A 3HDQA 5FEMA 2AYYA 4NIMA 3KVRA 1B14A 5HZKA 2F1IA 1LKZA 2AS0A 1JI0A 1LI5A 3P19A 1XTJA 2XGMA 2A5LA 3N6RA 1PQUA 4QXOA 1Z0FA 2QDKA 3ROTA 1M6WA 1KP2A 4RVSA 4PX5A 5HMLA 1L5QA 3SEQA 4QUHA 1REQB 2Q5HA 3H5VA 1SKAA 2YY7A 2XQFA 4WZBA 3ZXUB 3KDSE 4NECA 3GRPA 4W1RA 4AY2A 1SCQA 2WWIA 4PQGA 3GT3A 4NCXA 1IN7A 4ZVQA 3KTDA 3M6IA 1JEQA 1DUSA 4ZIRB 3U7FB 3HBJA 1DI0A 1UAAA 5AVRA 4AICA 3TLCA 3JALA 1QDEA 4KI0A 4PZAA 4DLBA 1PS0A 1TJYA 2C7QA 1Z18A 4Q7EA 3O8NA 4XA8A 4CV0A 1T3SA 2HJ9A 1LRLA 2VP5A 4E5YA 3A3YA 4CEIA 4JWKA 2OBBA 1ISMA 2QGZA 3THRA 1DX6A 3LQQA 1TTPB 3C5WP 1E2JA 1YJQA 3G3EA 4P7FA 1N3BA 1RRVA 4FYYA 2ZP1A 4FDLA 3KJIA 2X3FA 2V0NA 1BG6A 3O47A 3TNJA 1TD9A 4PLCA 4RK7A 4EY3A 1I7SB 3OLYA 2ZBVA 3GUYA 1V9LA 2ZW9A 1DOZA 3PQ2A 2V7PA 2QX8A 4JVNA 4IF6A 3OT5A 3RWMB 5FTKA 3KZNA 3BMQA 3TMYA 3R6DA 4K0KB 2JFNA 1QIGA 1YS4A 2NO5A 1NR7A 3HR4A 3TJRA 4MPTA 4UC0A 5GJCA 3DE0X 1KVUA 3U7HB 3ZDDA 1IXYA 1P3JA 1R8QA 4CL3A 2PLNA 3OF3A 3U4AA 2QL9A 2BKUA 1Y7HA 3WBJA 3OQNA 2DOKA 4OYHA 3WNDA 2LE0A 4CQMB 4HAYA 4K3UA 2VEDA 4W5QA 2CFOA 3RV3A 1IWPB 2D06A 3L5OA 1B0AA 5ER6A 5HEKA 3G79A 2CDBA 2F1HA 3QJGA 3DH0A 3RSFA 1OIVA 2CF6A 3M82A 4IIJB 4LJ4A 3IODA 5BNFA 1RP1A 4NZ9A 2XMZA 4AYXA 3LVRE 3U44B 4LPSA 3UK0A 2RHCA 2VA9A 4QASA 4N49A 5TMEA 1SOVA 5JISA 2OBMA 4JI5B 1Y4ZA 3ONNA 3DEAA 4GXTA 1UBUS 1WCIB 1C30B 2YCLA 5CNIA 2JG3A 2PSEA 3KQSA 4H77A 3F0TA 3GW8A 1GA4A 2XQKA 3P2YA 2J4CA 3GJ7A 1RC0A 4DCMA 3A9VA 4BFTA 4EWLA 1QVWA 1P0MA 2DSTA 5JSYA 3L4JA 3W7VA 1KDZA 4AJIA 1URPA 1QYDA 2ZIVB 5IF3A 4P38A 1QK5A 1SU7A 5HF9A 4HN2A 2OT3B 2PWPA 3M4XA 1JTFA 4BNIA 3RUDA 2C95A 4JL6A 4O29A 3E70C 3UHFA 1NZDA 3A28A 4BUJA 3MJTA 2PO5A 5J59A 2ARKA 1E6CA 1NBMD 2EFJA 3E9MA 2O07A 4U63A 2W70A 3X0DA 4HO1X 5AKHA 5GJVC 1PK8A 2H54A 4YJGA 1KFBB 1CERA 1MO5A 1QC5B 4JP1A 5T5QA 1WBDA 4KLNA 3DFZA 1IVYA 4NCHA 4BVJA 5BRNA 2DG2A 4CMBA 1YBAA 4KC0A 2WOJA 2W7TA 2IPOA 3DAOA 1XTIA 3GNSA 1U3GA 1IB0A 2NTNA 1NQTA 2GKOA 5HCUA 4G1CA 4BVHA 5GIPE 1E3MA 4AWAA 3T5AA 2FR1A 2NAPA 2IXFA 1QH1B 2ZAYA 5IT4A 4Q02A 1PV2A 1X42A 1QGUB 1Z6GA 4ZU3A 1G8MA 3KBOA 1B42A 4MAAA 4E5VA 3MUEA 2P9JA 3HRHA 3N0XA 1YJAA 4ZXFA 2W2MA 1HSZA 2UZAA 2FSUA 2QQFA 1VIMA 4IIDA 3DXXA 3PYXA 4J16A 3L7OA 1H5NA 4A92A 4HS4A 5LQSA 5KTOA 4P0PB 4PZYA 4F5DA 1TQDA 5DK6A 3G2QA 3QLEA 3LM8A 3W8DA 2P4SA 3DWFA 1YDFA 3M6WA 3BICA 5AO9A 5EIHA 1QRSA 4ILKA 1EJ0A 4BNJA 1N77A 5EFOA 4IHAA 4HVTA 3IAFA 2QN2A 4L4SA 5F9MA 5AVXA 5CBPA 5LCXA 1E9AA 1PFUA 1YJXA 1DSSG 5F64A 2A88A 3PUKA 2EV9A 2QKYA 5KKNB 4XH9B 5HBGA 1DAEA 4GWGA 3O8RA 1HK7A 1U3FA 2WF8A 3O4GA 3VOTA 1PHPA 3IKTA 2P7HA 1NUAA 1FFBA 5BSVA 2ZDGA 1NVFA 1P1KA 1AQNA 3QLJA 3WLNA 1KH2A 2VH5R 4Y2TA 4BO9A 1PTJC 4XDGA 3HM2A 4CFZA 1MAUA 4M0CA 4LW8A 5FIUA 5BUQA 2BYTA 1TEZA 3NUZA 1GV1A 5CDFA 1II0A 1FRQA 3L8GA 3OZ7A 4K9DA 2H5EA 3K0FA 2P40A 1GU1A 1Z33A 3KE9A 1Z3IX 1X7YB 2FLWA 3MUOA 3PNYA 4W8HA 4YCJA 4CKEB 3PQ6A 4JD5A 1EB8A 1W5EA 4G09A 2VNJA 3OEEA 2FEMA 2WUWE 3H9GA 4UHDA 5COAA 5I8ZA 4OLAA 4QDTA 2I2XB 2IXBA 3GLFB 4M0PA 4MKGA 3HJGA 3M6FA 2PX6A 3WKBA 1KOGA 5A4MS 4ZT7A 1RC1A 2AXNA 2JASA 2BWJA 3ZU3A 4OU5A 3BULA 4JJIA 4NFHA 4Y2JA 4EDFA 5AKXA 4PYKA 4BFXA 1CYDA 1I0ZA 4CM8A 5LMNB 2HL6A 3OH8A 2MT9A 4RHFA 1VLZA 4GOJA 2JVKA