5LIPA

Pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the chiral selectivity of Pseudomonas cepacia lipase
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Lipase
molecule keywords TRIACYL-GLYCEROL HYDROLASE
total genus 114
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lipA00
1O6GA 1XZAA 1YSCA 2RGUA 3C5VA 5ALUA 2W6CX 5DTJA 1SCIA 4C01A 4J7AA 5H3HA 1E89A 4LKOA 5ALGA 4Y2QA 2VT6A 4Y2YA 5EIAA 1IUOA 2WU4A 3FYUA 1JMKC 4G1FA 5E2IA 3I2JA 1P0MA 1QIEA 1U65A 4WY5A 3KWJA 2WG0A 2C5FA 4PSUA 2D0DA 1A7UA 2WKWA 4AMYA 4H7EA 4G8DA 1ACLA 3IUQA 2EEPA 4H18A 5CTAA 2WTMA 4AZ3A 4ZXFA 5AOAA 2XUQA 3HI4A 2QKYA 5CRIA 1QIIA 4PNZA 3AIMA 4K6GA 1QONA 1XZCA 1CQWA 2DHCA 4E15A 3IB3A 4BBZA 5BWCA 5AICA 5AKIA 2O7RA 1CQZA 3PDCA 4WJLA 1ZGCA 4UBKA 1K63A 5ESRA 2JGJA 5AKZA 1G66A 1T4MA 3U0VA 5CT4A 2H7CA 3R3UA 3S2ZA 3DS8A 2Y2UA 5EHXA 5ISMA 5ALWA 3BF8A 3K6KA 1O6FA 2B4KA 5C8ZA 3R41A 3DKRA 4UPDA 1ZI8A 1BCRA 4BAZA 1IUNA 1TCAA 3B12A 3GUUA 4UBIA 3GA7A 5A7FA 1QOZA 4Q05A 3JW8A 4KE6A 3D2BA 4OU5A 1H2YA 2H7YA 3DD5A 5I9IA 3O95A 1QFMA 1R9MA 2PKYX 1KU6A 5YASA 3H1AA 4JYMA 4UHHA 1ZI9A 4FNMA 4IO0A 3H04A 3N0TA 1GT6A 1VXRA 5JAOA 4JUIA 3BIXA 3C43A 3AILA 1ZI6A 4FLMA 1GXSA 4B9EA 5IVDA 2OXEA 3I2GA 4WFIA 4DLNA 5CXXA 1QJ4A 5CT6A 3L1JA 2X8BA 4C87A 1E3QA 5ALNA 2RHWA 3BIWA 4BTLA 5AI5A 1QIDA 2GBIA 4U2EA 4JYPA 2XMGA 1LZKA 4NZZA 2QMQA 1HKHA 4GBGA 3D2AA 5HF9A 1QIHA 1A8UA 4EUSA 3GELA 2O7VA 2PBLA 4QDXA 3WLAA 1D07A 1CR6A 4X71A 5JZ9A 2OLEA 3QM1A 4PF1A 1NU8A 3BDVA 4MQLA 3IUMA 2PVSA 2ROQA 5AKLA 2I03A 1QGED 1BU8A 2JIDA 2HADA 3I1YA 4OB6A 1VA5A 4XIIA 1XZJA 5D3ZA 3UUEA 1GQRA 1CLEA 1JU3A 5F4ZA 4L3WA 3KDAA 5BWBA 2PSHA 5AK4A 5KWJA 4FLEA 2WM2A 1YCDA 1CUHA 1R50A 3IDAA 3AIKA 4G4JA 3EQ9A 4DNQA 1P0IA 3WYNA 5LP1A 4AN0A 3C8HA 2VEOA 5LKRA 2HA2A 1T2NA 1MJ5A 5HFAA 2EDCA 1JFRA 3OM8A 1FFEA 1J07A 1IMJA 4LXHA 3ZLTA 4FTWA 1TQHA 2HU7A 2QT9A 1DQYA 4UBJA 4BRZA 1DWQA 1LZLA 3O4JA 5LZ2A 3H17A 4A5SA 1HL7A 2BUAA 3WK4A 4QDUA 1YB7A 2ECFA 3C6YA 1JJIA 4YK7A 4ZI5A 2Z3ZA 5JADA 1E66A 3EBLA 3AZPA 1EINA 1W75A 2VJCA 4G9GA 2YXPX 4LHEA 4BRSA 1FSSA 3K2IA 4HAIA 4P92A 7YASA 2XUFA 4E11A 4U2CA 3E1GA 1N8SA 1RYYA 3O4HA 4BVKA 4Y2RA 3OTQA 2BUCA 5HKBA 1EXWA 4WFKA 4TVKA 2OQVA 3C87A 4K6KA 5BOVA 3KOOA 1EK2A 4G4GA 3WYDA 3R40A 3WL5A 3HC7A 2WHPB 1B41A 1XZDA 5AI4A 5DNWA 1E8MA 5A7HA 4X6XA 3FYUC 3STUA 2B20A 1W4LA 1QIGA 4Q82A 4EZIA 1CUFA 5K5EA 3QH4A 2XMBA 3V9AA 1ZICA 4B82A 4FBLA 2PX6A 2HRQA 4MWTA 1XQYA 1UOQA 5AK6A 3E0XA 4FKBA 1QTIA 4DSAA 2C0PA 1BROA 1WM1A 1VZ3A 3R3XA 1XZEA 4CG3A 4F21A 4X6YA 5EHNA 4W1SA 1XRNA 4EY4A 3V1LA 3JWEA 1DX6A 2QTBA 3K9BA 1GQSA 3WZLA 4BC1A 4DGQA 5D3KA 1LPOA 3QMMA 5ALMA 1XZHA 1GKKA 4BAUA 4Q1VA 2J3DA 3FCYA 3WZMA 4KE9A 4OUKX 1ISPA 4B80A 3QVMA 2VJBA 1FFCA 4OB7A 1EDDA 5ALPA 3VJLA 1K5PA 3H2JA 2CMFA 3WIBA 3IURA 4L72A 2G5PA 5JAUA 1EDBA 4J0JA 4FHZA 4JNCA 1ZIXA 5DTIA 1WPRA 1AURA 2QUBA 3BF7A 2ZSHA 3D0KA 1SOMA 2WFZA 3I6YA 5ALTA 2XI4A 3EQ8A 4WCVA 3CN9A 2BFNA 4CIBA 5LZ7A 3Q8WA 4G4IA 2W22A 1XQWA 2AXEA 1VE6A 3FCXA 4UBOA 5EFZA 3VJKA 3WK7A 4J0IA 2ZJFA 4N8EA 3DCNA 4UFPA 4AQDA 1UWCA 3EF3A 2XUGA 4G5XA 3DQZA 3R3ZA 1BN6A 4X94A 4MQMA 5ALIA 2PSEA 4BP9A 5LLSA 4HXGA 4RE6A 4DMHA 4L0CA 4EHBA 5JD4A 3WKCA 5AKEA 3WKAA 1WB6A 5AKKA 4C89A 5ALRA 3FSGA 1THTA 4M0MA 3DYVA 4ROTA 1UKAA 4ZREA 4YX9A 4B6GA 3RARA 2YYSA 1YAJA 2JF0A 2BGRA 3BWXA 3R3YA 5AH0A 2WJ6A 1MX9A 2XMDA 3PE6A 2XUHA 4OYLA 5ALQA 3I2IA 3FYUB 1QIKA 3V1KA 3O4IA 3OC0A 5IVIA 5BV7A 1CUDA 5FUMA 4L9AA 2CBGA 4E46A 4QEKA 2EDAA 5K3BA 3UMJA 4UHDA 5HKAA 3DNMA 2QRUA 4FOLA 1CPYA 3PUIA 2WFLB 1MAHA 4U2BA 2XUIA 3WJ2A 1LPPA 3IUJA 1YB6A 5HFNA 5DYWA 4BZZA 2ZYHA 1UK8A 3PF8A 4OSEA 2V9ZA 4FDMA 4GWLA 3UUFA 5T4FA 1UXOA 3HYSA 3WKEA 1E8DA 1XZLA 1UOOA 4Q3LA 4J03A 2WUFA 1XZKA 4AO6A 1CUVA 3G9XA 4Y2PA 4LXGA 4C4XA 4NS4A 1QE3A 4BDTA 2ES4A 3KXPA 1CUUA 1BEZA 1HLGA 2CKMA 2OG1A 3LIPA 4TPKA 5T4EA 5HF8A 3M81A 3W9UA 1C7JA 1QO9A 3AZQA 3NWOA 4DMCA 2Y6VA 3C5WP 3KWFA 3DL7A 3L1HA 2DSNA 4HXFB 5KBYA 4LYEA 4W1PA 3GZJA 4H7JA 3D5EA 4KRXA 3A2LA 1NU6A 3B5EA 5K3EA 2XUKA 2XUAA 1ODTC 4AB1A 4PW0A 4UBMA 2CEKA 4JEIA 1X2EA 1G4HA 3T52A 5D7BA 5CW2A 4HXEB 2JGFA 2WIFA 1RWQA 1MU0A 2HIHA 5CT8A 3CCCA 3G0IA 4BDSA 4KE7A 3H0CA 2XQJA 4HVTA 1USWA 4H77A 2WFMA 1XZGA 3NOXA 5JASA 2WG2A 1JMYA 1GZ7A 1P0PA 2FJ0A 4EB0A 2X76A 2XQIA 4DIUA 4BCCA 3OOSA 3EQ7A 3RKSA 4A23A 5JAHA 2WIGA 5C81A 3P2MA 4ZRDA 2FUKA 2FJPA 3G0GA 5LZ5A 2OAGA 1XQXA 5ALSA 4Q34A 2GBGA 1XRRA 5AM0A 3IUNA 5ALVA 3GROA 2OCGA 5DYTA 2WU3A 5K3FA 1H2XA 1UKBA 5AKJA 3RK4A 1QLWA 2DCMA 4B0PA 3ICWA 3WJ1A 1VZ2A 1Q0RA 3LIIA 5AOCA 2G63A 5AIAA 1B6GA 3STYA 3M3DA 4MEBA 1R9NA 2GZSA 5LZ8A 4F60A 3IULA 3HACA 4J0KA 2CZQA 2H9YA 4W9RA 4MYDA 3E3AA 2I78A 3MUOA 4ARBA 2AJCA 1CUXA 5HCUA 5D6OA 4X95A 4U2FA 2QM0A 4KE8A 5ALHA 1XLUA 2BJHA 4CCWA 1ORWA 2E3JA 4EA6A 4FFWA 2HDWA 5AJHA 2XQFA 3BDIA 1MPXA 4QDOA 1JT2A 4B83A 2YH2A 2LIPA 3V1MA 4TGLA 3FSGD 1G42A 2OCKA 3L1IA 3A2NA 1EX9A 1IZ7A 5CBKA 4X91A 4GECA 2VAXA 4RE5A 3DLTA 5IVHA 1DWPA 2P8SA 4KYVA 5E4TA 2XMSA 1E8NA 3LCRA 3G9ZA 5JD5A 5AO9A 3SWWA 1WB5A 4Y2TA 2ZJ6A 2PSFA 3GBSA 4GXNA 5DJ5A 3STVA 1XZBA 3ZPXA 4QZVA 3CN7A 5ALDA 1LPSA 1CUEA 4PO3X 1FFDA 1BE0A 2QJRA 1QIJA 1K4YA 4Y2SA 4P93A 3AINA 3X3HA 5EGNA 3O9VA 3BE8A 4B0OA 5A6VA 4I3FA 1CEXA 1OILA 4X85A 2DHEA 4DMFA 1X70A 5FOQA 1L7AA 2ZVDA 3V1NA 1ACJA 3ANSA 2VQ6A 5I8PA 3A6ZA 3HEAA 3WIOA 2QJWA 3STXA 5JAPA 1UOPA 3I6ZA 5FRDA 2WG1A 3H19A 4ETWA 3DYIA 1AGYA 3C8DA 1JJBA 4CFSA 1YAHA 5JZSA 4OU4A 4HZGA 4G8BA 2VA9A 1MNAA 2C5GA 4RPCA 5KWIA 2B61A 5AP9A 2QR5A 2WHQA 5FV4A 3O4GA 2BCEA 5AOBA 1Z68A 3TJMA 5HZGA 4BTVA 1R4ZA 1BS9A 3QPDA 2OPHA 5SYNA 3TRDA 4KJXA 4X3CA 4CIAA 1N1MA 3I28A 3D3NA 3ICVA 3I2FA 4ZGBA 3OG9A 5HF6A 4DMKA 2HA0A 3FVTA 2PU7A 5CH8A 4BVJA 2O2GA 3E4DA 3QPCA 4PSCA 1CV2A 1PFQA 1ZOIA 1XZFA 4H7FA 1YA8A 4DNOA 4QWWA 2DQZA 3VDXA 1UZAA 1BRTA 5AM5A 1DTEA 2WLSA 2ACKA 2O2IA 2X5XA 1AKNA 5FP0A 5EI5A 1K8QA 1LLFA 2ORYA 1J1IA 3FLAA 4IQ4A 4UBLA 1VKHA 5HQ3A 1GPNA 4H7IA 2HFKA 3WL8A 2VAVA 2BAGA 3PUHA 1DINA 1OXMA 5ALYA 5CH3A 2OGZA 4K5QA 5EHQA 1CUAA 2ONCA 3ILSA 4G8CA 2Z8XA 3Q0TA 3IIIA 3WKDA 3FYTA 4UFNA 3RLIA 4FLFA 2WHRA 2VT7A 2XUPA 1R1DA 4DYHA 5AIBA 4ITVA 5KREA 3G9UA 3WA6A 5IVKA 1EDEA 1U2EA 4HRXA 5K3AA 1YS2X 4IH9A 3M82A 3LS2A 4N5HX 1WPXA 5LYYA 1Y37A 3FLEA 4AZ0A 5DWDA 2QOEA 2CB9A 5IH7A 2R11A 1ZD5A 3H2KA 2VSQA 2OGTA 1WOMA 5ALLA 1MT3A 4Y2XA 1MTZA 2HL6A 2OCIA 5CMLA 4FFVA 4X7BA 3PI6A 4MYSA 2ZYRA 4BVLA 4YASA 5JD6A 4QLOA 2ZSIA 5CXUA 4AN1A 1P0QA 5A2GA 3AFIA 3C6ZA 5AKYA 4EY5A 1ZD2P 2VATA 4W63A 1AX9A 2AJLI 1H22A 1DX4A 4I4CA 1AQLA 2OQIA 4ZWNA 4MEAA 5AM2A 3QPAA 3TEJA 3T4UA 4GEGA 3W04A 4C4ZA 4DNFA 3WKBA 5AKGA 1LBSA 4HTAA 3WK8A 2D5LA 1L7QA 1LNSA 1HDEA 4C4YA 2PL5A 4WDQA 1F6WA 4XX1A 3QITA 3R0VA 1EVEA 2WSLA 4EBBA 1YS1X 3QBJA 2XMQA 2GZRA 4IH4A 4S0XA 1ZJ4A 4DTCA 3ZLUA 1TCBA 1VLQA 4PV7A 3H2IA 4KAFA 4NVRA 4QLAA 1U8EA 1VJ5A 1XRMA 1THGA 4FMPA 5K3FB 5FKJA 1N5RA 4UHBA 5T4BA 2XQGA 3S8YA 4UBNA 1TIBA 2OGSA 2WUDA 3ESDA 1C7IA 1DT3A 5AI0A 2H1IA 1TKRA 5K3DA 2PU5A 2XE4A 3DKKA 4Q3KA 4AXBA 4MXDA 4ZV9A 2JGEA 2WFLA 1WHSA 4W1RA 1DQZA 2QXTA 1DU4A 1PV1A 2WIJA 3R3VA 2J4CA 1N5MA 2RI6A 4KR0A 2O2HA 2AJBA 4EY7A 4RNCA 3SC2A 5FXMA 4QDTA 3IVMA 2FX5A 3WWDA 2HA7A 4P08A 3PF9A 5ALXA 4BC0A 5JIBA 3I2KA 3G0BA 3NUZA 1ZGBA 5AI9A 2HHAA 2GYVA 4D9JA 3BJRA 2WIKA 3FBWA 4FWBA 4OPMA 4QA9A 2QVBA 4J0CA 2Z5GA 4KAAA 4F0JA 1TAHA 5E4YA 1YR2A 2GBCA 1BN7A 2XQKA 1TCCA 4AO7A 4AX4A 4Z49A 1EH5A 3LLCA 4H7HA 4J0DA 3VKFA 2DHDA 3PICA 1SC9A 2PUJA 1DWOA 3F98A 5HK8A 4BB0A 1MX5A 5LZ9A 1GPLA 3ZI7A 1ZD3A 4UHCA 4MWSA 1HQDA 5HF5A 2HRRA 2HU8A 3H2GA 1JJFA 4H35A 5AKHA 1ZIYA 1JKMA 1MO2A 2GYWA 2J3QA 1A88A 4P9NA 4X92A 4CG2A 3FWHA 4U2GA 5AK3A 4X6UA 4QDZA 1Y7IA 5T4HA 1CUCA 1CUBA 4LIPD 1AMNA 3IBTA 1FJ2A 3DEAA 1CFJA 2JGIA 3D4LA 3QMVA 3HZOA 5AM1A 5FDFA 1GKLA 2NW6A 1AC5A 4AMZA 6YASA 5EIEA 4OCZA 4MJ3A 4XJVA 5JATA 1S8OA 3PFCA 2XMCA 4H7DA 4IH1A 4WDRA 3M83A 5DLPA 2PPLA 3DDUA 4ARAA 2QUAA 3MGAA 4UUQA 2WHPA 5E4JA 4EY8A 2JGLA 3ANTA 1LPMA 3H1BA 1EHYA 1PJAA 5CURA 3WK9A 5ALFA 3VJMA 2IITA 4QNNA 5C8VA 3HLKA 3ZV7A 1CUYA 3VISA 4ZV7A 1LPBB 3QYJA 1WB4A 4I19A 4F5ZA 4DNPA 1TK3A 3GFFA 3WA7A 1XQVA 5C7YA 3HSSA 4E14A 5CT5A 4GI1A 1ETHA 5AM3A 2PUHA 5C8XA 4J3JA 3OPMA 4B9AA 4X93A 5HQ3B 3WL7A 1EB9A 1DT5A 2WQZA 4GHWA 3ZLVA 4HS9A 1UK9A 4KEAA 2H7XA 3ZWQA 3VVMA 3V48A 3KD2A 2HA5A 2YASA 3I6MA 4BAGA 4NMWA 4BCDA 2JEZA 2JGMA 1BEEA 2OAEA 1WCYA 4J0HA 2QZPA 3F97A 5CH5A 1TRHA 3W9BA 5J3JA 2XMZA 2VJDA 1UKCA 4N8DA 1I6WA 3FAKA 2XT0A 1XRPA 2R8BA 4C88A 1R88A 3C6BA 1C4XA 2Y6UA 3G8YA 1UK6A 2WUGA 3SK0A 4H7KA 1RP1A 4CCYA 2G4LA 3D7RA 1XRQA 1CUSA 3FNBA 3HRHA 4JH0A 5JANA 1VE7A 2V97A 1H2ZA 3STTA 1M33A 1CUGA 4XVCA 2JEYA 3CXUA 1YA4A 1W76A 4BP8A 3W2TA 1XZIA 1W6RA 5DNUA 3F9CA 2HU5A 2Y2VA 2C58A 5FPPA 2AJ8A 3WL6A 2JBWA 1IUPA 3FLBA 1XZMA 4GDMA 4M0FA 3I1IA 3IA2A 3AJAA 1CVLA 3WWEA 5EHZA 1A8QA 1F0PA 4C6HA 4B7ZA 3QZUA 3BJMA 4CG1A 1HPLA 4X90A 4DSZA 2WUEA 1Q83A 5SYMA 3BL8A 3TGLA 4UHFA 1XLVA 2G5TA 1FFBA 3KSRA 2CJPA 1IVYA 3NGMA 1SCQA 4X97A 3AZOA 1H23A 5AI8A 5ALKA 1F0NA 1QZ3A 2WJ3A 3W06A 4LXIA 4EY6A 2HA6A 1W1IA 3D2CA 3YASA 2IIVA 1XROA 1AUOA 1FFAA 1ZD4A 1EB8A 5ALZA 3VVLA 1U4NA 2RIPA 3WMRA 1QIFA 1LBTA 1XKLA 3DOIA 4N8SA 1KEZA 2ZYSA 5AI6A 2VTVA 3D59A 5LIPA 5LKAA 2V96A 2WTNA 3EIOA 3W05A 2QXUA 1K6EA 1JI3A 2GYUA 1IZ8A 2WIDA 3MUNA 3MVEA 1LPNA 2HA4A 2RAUA 4BCBA 4M0EA 1ODCA 4DM7A 3HXKA 4KAJA 1NX9A 3O0DA 3VXKA 2RONA 1H2WA 5K3CA 2PM8A 1XRLA 4O08A 1BCSA 3CCBA 5AM4A 2B9VA 3HABA 5IKXA 2I3ZA 4J0GA 4B85A 3DL4A 1KU0A 3JYHA 2C0QA 4Q3OA 4PQEA 4KACA 4BYMA 1G5FA 1VA4A 1QFSA 1VOTA 2ACEA 4BE9A 4RGYA 5FPQA 4OD0A 4FNGA 2IX9A 3STWA 1CUWA 3WQHA 4PSDA 2I3DA 1MN6A 2BGNA 1EI9A 2ZYIA 4UFOA 5AKXA 2AJDA 1SFRA 1MX1A 2DQYA 2Z3WA 2PSJA 3H2HA 4IHAA 3F8SA 1A8SA 5DYYA 3WWOA 2GBFA 1LGYA 4LYDA 4W1QA 3A70A 5LZ4A 2VF2A 2RHTA 4B84A 2HFJA 1J06A 3WK5A 4BE4A 5ALJA 4V2IA 4AO8A 3H18A 1QO7A 1XKTA 3PFBA 1LPAB 3G0DA 1EK1A 1ORVA 2XUDA 3G02A 1XFDA 3A2MA 1MAAA 2XUOA 1ZJ5A 4OB8A 1UT6A 3AIOA 4QWMA 1JU4A 4N5IX 4QE3A 1CUIA 5FLKA 4FBMA 5DNVA 2Z8ZA 3F96A 2HA3A 3O9MA 1YASA 3LP5A 3AUKA 3OURA 3R3WA 4K6HA 3WI7A 2XUJA 4BATA 2HM7A 4UHEA 1UFOA 2C7BA 5ALEA 2ZJ7A 4GW3A 3G7NA 5AK5A 5EIHA 4WY8A 1W52X 5HK9A 4YPVA 3G9TA 3B3QA 3ESCA 4KRYA 2WJ4A 3FOBA 2XDWA 2WILA 3RM3A 1ODSA 4GLBA 3ESBA 4BZWA 2K2QB 4Y7DA 3HJUA 1CUZA 1GPKA 3DJYA 4B81A 5JALA 3SX4A 2Y1KA 5CT9A 2XMRA 1EVQA 1L7RA 2V98A 3I2HA 2VJAA 1Q84A 1R3DA 2BKLA 3C45A 4Y2UA 3WK6A 4INZA 2XLBA 1Q0ZA 5A71A 1UK7A 1CIJA 4OYYA 3U1TA 1VXOA 4K2AA 1Y7HA 2QS9A 3C70A 2C4HA 3DOHA 1QTRA 3C6XA 1GGVA 1HBJA 5ALOA 3WWPA 5JYCA 4Y9SA 4G9EA 5A62A 2PSDA 3BXPA 3F67A 2Q0XA 3N2ZB 1OCEA 5JARA 4X00A 1X2BA 4CI9A 3ESAA 2JGKA 1WHTA 1XLWA 5AHXA 1E5TA 2XB6A 2J4FA 3G0CA 1EA5A 4HRYA 2OCLA 4XWGA 3ED1A 4A16A 2CUTA 2DR0A 5A7GA 2BUBA 5JZBA 1AZWA 3WWCA 3FVRA 1QIMA 4Y2VA 1MNQA 1CUJA 1F8UA 2XLCA 3QMWA 5I7UA 1J2EA 4CCYB 2UZ0A 1CRLA 1SCKA 4H0CA 4U2DA 4Y2JA 4WFJA 2DFPA
chains in the Genus database with same CATH superfamily
2AYZA 4CCAA 3DDNA 3WLAA 3SLRA 5DM60 1E1QA 2HZ7A 1NTOA 5FADA 4DLAA 3MMPA 2EQBA 2W6CX 4HQ0A 1SCIA 1G21E 1O97C 4YJGB 3GYGA 3L8EA 1EEXB 1GZ6A 3JATA 4N49A 5H3HA 4UCXA 5ALGA 1P29A 1V8ZA 1HURA 2B2NA 4Y2YA 5DGIA 2BGIA 1IUOA 2WU4A 4IOJA 1SC3A 1AS2A 3M49A 4NFHA 1STOA 2JFBA 3CB4A 3FYUA 2HQOA 4GBJA 2WF8A 2XTMA 5FFNA 4EJSB 4KMMA 3T35A 5E2IA 1AQIA 4V24A 4Q01A 3TQQA 4Y67A 2NO4A 4TRRA 1ZJJA 4XI9A 5L7WA 3OO0A 1U65A 4P4UA 2IV3A 2XKAA 4LUCA 5KOJB 3FRJA 2BFPA 3OIYA 2J3JA 4CKXA 1UF9A 1PS8A 5DGHA 5BW5A 2Y66A 4AMYA 1YVRA 5FBLB 1E79D 1PK9A 1T5HX 2GAFA 2Q29A 5L51A 4JYAB 3I83A 4KKVA 4XFDA 3IUQA 4P8RA 2OLJA 3QE3A 3NP7A 3DOCA 3OI7A 4H18A 5CTAA 3UXYA 4ACAA 5I7OA 3DBIA 5GONA 4AZ3A 2XRMA 1WL8A 3MB8A 3TRIA 5AOAA 3C3KA 4LRSB 4R5HA 1RJWA 2QKYA 5CRIA 1KRHA 3N53A 1DC6A 4BNHA 1TC2A 2FN4A 4YRPA 4ZGWA 1Y1TA 1ULTA 4RIFA 4DCSA 1JUDA 5BWNA 2GLUA 3QBDA 1XZCA 1EQUA 1Q2XA 4C20A 2LVBA 2RH8A 4JQSA 6ABPA 3IUYA 3K7EA 1IRXA 3ZWOA 1MOQA 4JA2A 1ZUNB 4L74A 1W73A 1NVMB 1VMIA 2NYVA 4KXLA 3IIKA 1KQ3A 1KTVA 4CI0B 1F9EA 1Y6FA 4UZSA 2X0IA 1V7PC 2F67A 1WAMA 1IG0A 4URXR 1M1YE 2QM8A 4G86A 1HNNA 3K0AB 3KSAC 2NO5A 5F76A 4P1ZA 1CQZA 3I5UA 1SCUA 2FP4B 3EGWA 2EGGA 2BYTA 4UBKA 4AIIA 4TSRA 5ECYA 1VHDA 4I81A 5E1DA 3PQ8A 4B35A 1NBEA 4CMHA 4NOJA 4UHJA 3UWMA 2O3JA 4GGOA 5AKZA 3TOSA 2CXQA 3HYNA 4G8JA 4JBXA 3SQWA 1EP2B 3WLLA 5CLJA 2YN2A 1YQQA 2RGCA 5CT4A 1SD5A 2M2IA 4KQWA 4G0YA 1SU4A 3QJ5A 3S2ZA 3P5BA 4EG0A 3DS8A 4HWKA 2XWPA 3RF6A 2CMKA 1EIZA 5ISMA 1L1EA 2FWIA 2W48A 1L5GB 4BX9A 2Z30A 4PLWA 2H2WA 5H1YA 3TTTA 1X7ZA 4L7VA 2BMWA 4KDFA 3QFRA 5CG2A 4RGVA 1PSWA 3L8ZA 3O5AA 4MO2A 2QL5A 5F3DA 3CUYA 3ZKAA 1S0UA 2VBIA 5F1YA 1DTSA 4TTQA 2UDPA 2PL9A 4IFIA 5CUQA 1IN7A 3EEOA 1XTUA 3OJWA 1ZRSA 5E6SB 5LMUB 4AROA 1GWNA 4K9PA 4F6CA 3DT9A 1ZK3A 3IVCA 3GPDG 1DC3A 4AJ4A 3KDPA 4I3GA 4OQEA 4UPDA 2F3RA 1QF7A 3NETA 5I5EA 3ZHUA 1TTTA 1CZLA 3DC7A 5FWXA 4DIBA 1PHPA 2NT4A 1PQPA 3BJIC 3GUUA 4DLXA 4DCMA 4AUNA 3UO8B 4Y6RA 4E88A 4F7WA 1NPYA 5FUQA 3R7NA 1QOZA 1DV1A 5DWQA 3WWYA 3N7TA 1WW2A 2GD2A 3JW8A 5IHPA 2D5BA 4I5FA 4OU5A 5LB4A 1H2HA 3IV6A 3O21A 4P83A 3UK2A 1U6JA 2C59A 5ADWA 3DSRA 3I3SR 3KOWA 1W5BA 4W5HA 3VOBA 4AQYB 3WLSA 5H02A 4GDFA 1CJTC 7REQA 2RJ3A 1J5PA 4O2BB 3F6PA 5EIOA 4FEAA 5TDHA 5CEJA 3Q6IA 2WNHA 4C4AA 5COBA 1UJMA 3QTTA 4R81A 2HJGA 2W6JD 4TQAA 4XJTA 3MELA 4M2LA 4DC0A 4FNMA 1U81A 3OLZA 3SZOA 1U0SY 2M1ZA 2G9QA 1GTRA 1N7GA 3N0TA 2I6SA 1H4QA 4YMLA 1M67A 3QE0A 1YS6A 5JCPA 2ZRJA 4M0PA 4NZPA 3TNLA 4DUPA 4E13A 1U3GA 3MWEA 3MWDB 2ZIFA 4GEKA 5A2QA 1HFJA 3L3BA 2IIQA 1EZ1A 4RELA 3VR0A 1ISGA 2NYRA 3BIFA 2Z1NA 1R18A 2IZ5A 2IP1A 3ETCA 4D4IA 3HUEA 4HZUB 2H8GA 1MO4A 3LTNC 5I45A 4L08A 1UBSB 1QHHA 3EDYA 3CURA 4WFIA 4I9UA 1LVGA 1VLHA 2C1XA 3B9PA 3GFBA 4EHLA 1YZQA 3T3PB 2WU8A 1BA3A 3DFUA 1W48A 3QQPA 4WXHA 2N1BA 3QQ5A 5IUNC 2YXNA 3GEEA 1QJ4A 5CT6A 3L1JA 4BQEA 5I48A 4DA7A 4DCPA 4LHXA 1A8IA 3NH6A 1V71A 2Y67A 4WUTA 1URPA 4BMNA 3ENQA 3ORHA 2F1JA 2X8BA 3DO6A 3HKDA 4ZT6A 3RADC 3RUPA 4L78A 2A9OA 4X61A 1VL6A 3BJEA 3LWBA 5ALNA 3BIWA 1PJ2A 3D3WB 3G1WA 4LNHA 3JATB 1YR1A 4PANA 4R2JA 4XD7A 1E9BA 3V8MA 1M8KA 2IUFA 1EZZA 3BDAA 3OP4A 4RQTA 1BXRB 5DHSA 3FB1A 5IBRA 1CYEA 3NKLA 1XL0A 4BUZA 4OI2A 3AHIA 3U5TA 3HDJA 2GNAA 2HK8A 4LGMA 2QMQA 1RWPA 1BE1A 3MMNA 3DV2A 3N0RA 4GBGA 4ZOCA 5G4KB 1U5BB 1NNLA 3KWLA 2EKDA 4P2GA 1B8PA 3BA1A 2RGRA 5CK4A 5TXGA 4EUSA 5KOHB 2F55A 2IHUA 1WD7A 1XD9A 1B8UA 4ZEXA 3QXCA 2HIMA 3UPDA 3AOEC 4CT4B 3Q8KA 2W6IA 2EOAA 4UAVA 2OZEA 2Q07A 1CR6A 3H0EA 3C5EA 2YV1A 3EPRA 2UUPA 3QI2A 4BEJA 3H6KA 5KTYA 1AHPA 2GN2A 3QM1A 5BYAA 3BDVA 4H15A 2JA2A 5KVCA 3ITDA 4MVJH 3RD5A 3X1JA 1S02A 2I03A 1QGED 4DMLA 3D8SA 1KZHA 4B31A 3GZNB 2XCTB 2ZKLA 3KPUA 1PLKA 2JIDA 5E9WA 3IPCA 3W5AA 3I1YA 1X38A 4ND2A 3CNEA 1XTKA 4NAUA 3WO0A 3GIWA 3JR7A 4OBWA 5A9SB 4Y9RA 5CG1A 2EFHB 1GLVA 2PZAA 2ZRHA 4N9WA 5ILQA 5A3JA 1CLEA 1DI0A 1X8LA 4JA0A 4JUDX 2GKOA 2O5CA 5F4ZA 5BWMA 1YOVA 2IYPA 2Q5HA 2VC2B 4PLTA 1CQJB 3RVKA 4C29A 3LD9A 1Y9EA 6REQB 1KPIA 1C0EA 4JI8B 1UINA 3H13A 1WDLA 1FJHA 2EFJA 4GOXA 3DAFA 1W9MA 1FNDA 2IYVA 3TPZA 3ZV4A 3PVCA 5KWJA 1AO0A 3KJFA 1A7JA 1RFLA 5IU6A 4LQ4A 4DEYA 5SY4A 4AJJA 2HHJA 3W5UA 5F5LA 1EGHA 1P7CA 3BMXA 1E64A 2WKRA 3AB8A 3LDUA 2IBTA 2UVPA 4BNWA 5A4FS 1ZOOA 2DKFA 5ED0A 2ZUTA 1P0IA 2MSDB 2ZBDA 2YY6A 4O4JA 1L5HB 3IT0A 4IIDA 2G4CA 3WYNA 2EP7A 1P74A 2E49A 1ZQ9A 3ESRA 5REQA 1U3WA 3TW8B 4DQVA 5B3LA 1KI6A 4QYSA 3MHPA 3TLXA 5J63A 1NUPA 1C0IA 2FPLA 1O4VA 4R1OA 2QD4A 5A4KA 4ZIRA 2JBAB 5HJ7A 1K8ZB 2VEOA 4PZLA 5A1TA 1T2NA 4JT8A 5HFAA 4FOOA 2EDCA 4IDOA 3E7FA 3HJNA 1PEDA 3HP1A 1FFEA 1M7BA 4MYHA 3JQBC 5LJLA 1E7MA 1GZSA 4LXHA 4PZCA 5HE8A 5KX5F 1WZIA 3PP8A 4FTWA 3I04M 3OZBA 3NAGA 1O0BA 4GKKB 3E2PA 2A9VA 2IE8A 3UGTA 3HVRA 1TA0A 1TQHA 4FONA 3H4IA 4RW0A 4GX5A 4ZIRB 2V6MA 5HTOA 1NVVR 2P68A 4HUQA 1QSGA 5JVDF 4L4XA 3HNOA 3J81A 1Z83A 1BC5A 3JYOA 5JD3A 4HDCA 1G3RA 2YZMA 4OHRA 5E3IA 5CLIA 3WX0A 5AUNB 5DNEA 3OCYA 4R2HA 4ZC8A 3EPKA 1SZJG 1WE2A 1EXDA 4QDUA 5H16A 1T9AA 3ZWYA 3ZV3A 2GZHA 4TTAA 3GJXC 4YMTA 2G4VA 4GMDA 1O1YA 2F62A 3BB4A 3DNFA 1BXRA 2Q4BA 2RBKA 3O74A 2HJHA 2JK1A 4LZOA 5E0OA 4EUHA 4GMKA 4L9SA 3UVEA 2RJNA 4HX2A 1DS6A 4PNHA 4C4PA 2JVJA 3TR0A 3WGLA 4D0SA 1FMCA 3L04A 3I9LA 2ZLBA 3HV0A 3LW7A 4W7HA 4IX1A 1FTSA 1FSZA 3FG9A 4FXOA 5JADA 5EESA 4ZU3A 1R8YA 4TLDA 4FKMA 1J39A 3TEMA 5E38A 2DTDA 5WRFA 3PS9A 2AG0A 1P5RA 3RJ5A 3MCWA 1KQGA 1X9GA 2VJCA 4UXIA 3VZSA 2HMAA 5K0EA 4L07A 4JJZA 2I55A 2YXPX 4TOIA 5DNAA 4LHEA 5DBEX 1FZTA 1ZC3A 4UULA 1TQ8A 4II2A 1FSSA 3JZAA 2O0JA 1Y6GA 1SVWA 5K4GA 4G0ZA 3V4OA 4WCFB 1BO6A 4C22A 3MCVA 5IUJC 1DEXA 1XDSA 2AZMA 1UZMA 2BFBA 3KLMX 1VCMA 1KXZA 2RG1A 3BS4A 2BE7A 3FB4A 4HTFA 4BKPA 1G16A 3PWKA 4IW3B 4BLRA 5MN4A 4B3TB 1IM2A 4Y2RA 1SQSA 1PVDA 2FG7C 3OTQA 4HAXA 1DBVO 1EPUA 1V5GA 4G2NA 4JVSB 2NACA 1RCTE 2PMBA 1FFYA 5DXFA 2QJTA 4KVFA 1DMRA 2Q1SA 4WGFA 1EBFA 1TCVA 1LH0A 3FUCA 4RORA 3B3JA 4EFMA 2JFZA 1VHWA 4INJA 2P27A 1Q21A 3AM5A 3ILYA 2WV7A 4K7JA 2PKQO 2J09A 3U44A 4AP6A 1NAHA 2ZIUB 3I0MA 1B41A 1PP4A 4NBTA 1XZDA 5AI4A 1X1CA 1W34A 4ACBA 1MB2A 3BIJA 3AKZA 4BKUA 3UOWA 2P3LA 2YWXA 4W7SA 2FVXA 1MJFA 4HAVA 2PL1A 3STUA 1W4LA 4V38A 1HV8A 4EHIA 4E0BA 2SKDA 2DQSA 2GLTA 4HP8A 1PWHA 3NVMB 2VPPA 1KQNA 5K5EA 4MICA 5BV2P 1H2BA 4NIMA 3SYNA 1NOIA 3ZW8A 4JB0A 2EV9A 2UZIR 3AUXA 3CVJA 4YCNA 4GE0A 1AD2A 5KSPA 3SPXA 1D2NA 3FPAA 2PV0A 1XDBA 4QG3A 2DQKA 2WWTA 4MWTA 3BGOS 2RBEA 3AOGA 4A8JA 3E0XA 4FKBA 3LSTA 3NX4A 2ORVA 4KYIB 2GZMA 1BKDR 1M6EX 4BZQA 3I92A 4REOA 3MZ0A 4A1OA 4EB3A 2IHJA 1GTMA 1WA5A 2X5KO 2XODA 5EE3A 1QBKC 3W1EA 2X8WA 1HDCA 3DC2A 2WMNB 2DECA 2GFHA 1O9BA 3WIVA 4II3A 1SULA 4ZO7A 1H66A 2G77B 3OQBA 2MHCA 5TQJA 1DKRA 1K3UB 2AN3A 4MQEB 2X6TA 3GVCA 2J9FA 3L7CA 5DTRA 1VMDA 4X6YA 5IEJA 1ULAA 1F7VA 1MQ8B 4Q7EA 2HSWA 4IIHA 5E7IA 4EY4A 5UKDA 5KSOA 2NNWB 2Q9BA 4J16C 4YQZA 3Q11A 2FRXA 1DXQA 3GDGA 3GJ6A 4HG2A 1K5DA 2QTBA 2EYQA 3VC3A 1NN5A 1BVYF 2Q5QA 5BNTA 4WL0A 2PQMA 4DGQA 3T1VA 4U5QA 1F4VA 1NUAA 1XHEA 1RVV1 5KJEA 5FQNA 1LPOA 3QMMA 5ALMA 2IZ1A 3HV2A 3P9KA 2ZAIA 3NIWA 2JJ1D 3O8QB 1A77A 1V47A 1LFDB 4MWBA 3K2BA 5FBZA 4BAUA 3VM6A 3WNDA 1DJOA 1XO1A 1U94A 5ELLA 5EPOA 4F4DA 2WF9A 3B1ZA 4YAFA 4K9LA 3H6HA 1I4TD 2BFAA 3AETB 4OUKX 5TVKA 2ZRKA 3PNVA 1MAVA 1HC7A 1VE5A 4ZVVA 5K0BA 4W5RA 1R0SA 4NYIQ 1FYXA 2YYAA 2XH8A 3SBXA 4B80A 1Z8HA 3IAAA 2ADFA 2CVFA 3QPWA 2FOIA 4XSHA 4JLBA 4OB7A 1UL1X 2FXIA 3OICA 1VSBA 3PX3A 4D9FA 5IC4A 1NP6A 2X86A 4PG6A 2UYYA 5KTPA 1K5PA 1JIVA 1OBCA 3SXUB 2O19A 2JH8A 4EG5A 1L7DA 3H2JA 1CSEE 2IEBA 3G6KA 3WIBA 1ODIA 5B4VA 1YZLA 4L72A 2QQFA 1JVSA 4BNUA 2YMMA 5JAUA 2QTFA 3EOAI 4HH4A 1RKXA 1FVXA 3FFTA 4HF7A 3WB1A 1P6UA 2QG6A 3ZD9A 2PRZA 4J0JA 4EKYA 4RWEA 3IHLA 1KIAA 3C1TA 1ZIXA 5BSRA 4PC7A 3SZGA 2GVNA 1YI0A 1NP7A 2J7KA 2XDQA 5JSYA 3NXSA 5FAKA 2EW8A 3PTAA 2VPIA 2QUBA 4IDCA 1B2LA 3JWIA 4BE7B 2OBMA 1IQUA 5C37A 3G0HA 2V4UA 2JFOA 3LTEA 3GRUA 2WFZA 2KQUA 2O2DA 1E2KA 7ADHA 3D6FA 1ZA1A 4TZTA 1SHJA 1I4EB 1GAEO 2OORA 4WCVA 1ETUA 3TG8A 5T57A 4QHYA 1EUCB 3RSZA 4HADA 4MW5A 3RYHA 1VHLA 5LZ7A 4QQKA 2J7PD 4UAUA 2J5RA 1E9VA 3Q8WA 1VFPA 4LPSA 3HO8A 4B47A 3KZNA 1B4DA 5JE8A 2W22A 1V41E 1U7UA 3A3PA 1GN9A 2QD5A 3IS3A 2V1UA 1ENYA 4XRRA 3QU4A 1KI2A 1XCGB 2AXEA 3N07A 1N9GA 3ER9A 4W8GA 1VE6A 3FCXA 4EP1A 5JC1A 4M1ZA 4IVPA 2W71A 2BLNA 2IE0A 3FUVA 2D3TA 3ZC3A 4PC3A 3RDPA 1ONOA 3I8OA 2XD4A 3TNDA 2GT1A 2ZM5A 1MFZA 4QXRA 3EVAA 3P20A 4GYJA 1MJGM 1W88A 4HI0E 5ARCA 3AF0A 1M1NA 2A1IA 2AUTA 3EF3A 3EXFA 2X1LA 3IP8A 3SNHA 2DLNA 1AQYA 4PLFA 4EW1A 3HPQA 3AI1A 3NIFB 4QUDA 2DPMA 3H42B 4IDGA 3GLFA 1UDCA 1BN6A 3GG9A 3WBJA 1OGJA 4MQMA 3DQQA 5ALIA 5EZYF 2PSEA 3VTAA 3SDBA 1Q74A 2V7QA 4Y3UA 4E7OA 5FEUA 1I2CA 4LHWA 4OI0A 4LDQA 2M6LA 5IN4A 4DMHA 2DLDA 1T9KA 5H4HA 2BISA 4BYGA 3ZYZA 1I3MA 2GVDC 5J5VA 4A36A 1FPMA 3WLTA 3WKCA 1B0UA 2XADA 4XM1A 1VKNA 4GP7A 4TRMA 4WZAB 5DN6D 3MB5A 1JDTA 4ZVNA 5CA1B 5ALRA 3U4IA 3PITA 3IKMB 3KYDB 3V8EA 3ZQUA 1THTA 1ZH2A 1G8PA 1YIAA 2E6UX 2R6ZA 3EXHA 3FPJA 3BSWA 3IAUA 3PRKE 1P75A 2I9PA 5TRTA 3PEVA 1JFFA 1KBOA 4IJVA 3DGFC 2WPDD 3C39A 3R6LA 2YYSA 2AOTA 3B8EA 1Z73A 2JF0A 3NKFA 1MA3A 1OI2A 1LXCA 1TOAA 2AK2A 3PGXA 1NDHA 1ABFA 3NDIA 4YJFA 4BLUA 1Y7TA 2IYAA 2X22A 4YS6A 4F8EA 2WJ6A 2CVHA 1ND6A 1M83A 1N6RA 3CRZA 4MLCA 1DDIA 5ALQA 1SA0A 2QL6A 3DHYA 1K1EA 3F90A 3FYUB 3RRMA 4YJ3F 1J2JA 1F0KA 4PVDA 2VBFA 3MLEA 5ADHA 4FQ5A 2I7TA 3E9RA 4QATA 3V3KA 3ECSA 3IUSA 1TJPB 3O4IA 2X23A 1J00A 3G79A 1VG0B 3LCJA 1OZAA 1U9JA 4C07A 5FUBA 3QLUA 1TZ2A 1H1DA 1NNUA 2DCUA 1SUPA 2MDTA 3QF4A 4OTZA 4ZODA 1D0SA 5JISA 2QBYB 2CBGA 1W85B 2X3FA 3EXHB 4GXQA 5JHGB 1OV6A 1WW8A 1U0BB 2QMZA 2VUUA 3O3CA 3VYSB 4YP9A 1D8AA 4FB5A 2XQVA 5K3BA 3UMJA 5KS2A 2O23A 4OXXA 1FNSA 3LBHA 2A1UA 4ENTA 2QRUA 4URHA 3RS4A 2Z9DA 3BFXA 3RTGA 3TBHA 3SIXA 4B46A 2Q9AA 3OHSX 3ZGNA 5IK2D 5JNUA 2OO7A 2ODWA 1MAHA 3SEZA 3CRQA 2X40A 2I2FA 4DN6A 1HK7A 2PZEA 4MW0A 4KP7A 3TW8A 3L7KA 5CDYA 4B6FA 1UDXA 2DY0A 2I8AA 3IUJA 3K73O 3GMSA 4PIMA 2FFRA 3GGOA 3GI1A 4MVJI 1V5IA 3H3FA 2Q6LA 3MA0A 2Z04A 4X7RA 3A1WA 3PX2A 3KE8A 1DIAA 2D1YA 3N74A 1KDVA 2G25A 3EF1A 1R5NA 3IQFA 4GWLA 1QRUA 3FTFA 5T4FA 5K8JB 3GA5A 4BX2A 1C29B 1L4UA 1ODKA 1UXOA 2MU1A 3AFMA 4ERXA 5J43A 1IIRA 2FG6C 2OP1A 3FPLA 4IOMA 5EJGA 4ROSA 1XZLA 3PGMA 1A4UA 3NV7A 4B1FA 4ZT3A 3OTOB 1WOYA 1UJ2A 3KR2A 4ND8A 1C2YA 5KQLA 4NP6A 2WWGA 4IJUA 4CLDA 3UW3A 2I7DA 5BSTA 1EBUA 3IQXA 1N3YA 4H0NA 5A5GA 1DO0A 3GP3A 1DJMA 2FR1A 1ZUWA 2BMFA 4AO6A 4CR7A 5JCJD 1G5IA 1CUVA 4HH1A 4QO7A 3FTEA 4J75A 4O4LF 4YJ2B 1K06A 4LXGA 3WRXA 2BR4A 2OV6A 2C2KA 2BKVA 2EKLA 2W2LA 4C4XA 3BMOA 5ELMA 1VLLA 2FMIA 4BDTA 3EHDA 4N3BA 2I3AA 3CVXA 3IYLW 1GLNA 2YR0A 5F52A 3QVXA 3WGJA 4DJ5X 1H1TA 3LCUA 3UICA 1JXAA 5EYPB 1U8AA 3FYCA 1SZDA 3LQKA 3VVCA 3C3DA 3RUFA 2H1CA 5CCXA 4HNAB 1HLGA 2AOWA 4ZVSA 2DERA 4TPKA 4ZDWA 4EITA 4GGMX 5T4EA 1GSAA 1N6NA 2XZTA 1L0BA 3W9UA 1O9GA 5B3AA 5J1SB 1QX3A 5E1BA 3CX7A 1L9KA 1XIVA 4DQXA 4DCGA 1GKYA 2ERCA 3AZQA 2E89A 3NWOA 3PEUA 2QTHA 3WLIA 3TUZC 1XP5A 2H48A 5A3VA 1KSHA 4AJPA 3IOYA 5EPUA 1BDMA 2BI7A 5CCDA 4HYEA 3MJ4A 1DTWB 4HDRA 4R31A 2ZM6B 3CJRA 1F60A 2QRMA 3JRWA 4BNLA 4AMBA 3KKKA 4IEIA 1GCGA 1TUEA 5B2ZA 3DL7A 1L4EA 1CW2B 3PYMA 4UD2A 4TZ0A 3FVWA 2PWBA 4H0FA 5CB6A 1ZUNA 2R7KA 2GPYA 4L5BA 4IDNA 4N3CA 3ZR4B 5KBYA 1ID8A 2HYDA 3C3MA 1KBQA 1N6KA 2F1OA 2LW7A 4CM9A 1H5QA 1T2EA 2ZR0A 1UJ6A 5C1PA 3BMNB 4RTOA 2I1LA 3LXRA 2P0EA 2DETA 2SKCA 2H59A 3GEMA 1IWOA 1ZD9A 2J9XB 4MB6A 2PKXA 4PTLA 1KOLA 1W6UA 3B6IA 1JHYA 4DG9A 1KYVA 3A2LA 1NU6A 3H11B 3RU3A 4GLOA 4LF9B 4Z9XA 4F04A 3I01A 1NBMA 3B5EA 1QHGA 1OY1A 1QANA 2P9QA 4G3XA 4UNNA 2XUKA 4ZAVA 2WP8J 4YRCA 1T0BA 1N75A 2CLDX 5KOIA 1AV7A 4PW0A 3AYZB 4TMWA 5B3JA 3RVQA 2GS9A 2CT8A 4OL9A 4A8TA 2CEKA 1O58A 2QBYA 2YHAA 3RAFC 4MW6A 4TXNA 1X2EA 1G4HA 3L5OA 3VU3A 5A04A 3GPLA 5FBQB 1YUMA 1Q1ZA 3IT2A 3PNOA 2NQTA 3LBIA 3L8DA 4H1HA 3VYTB 1XZNA 1D1QA 1NT4A 1TDJA 2J3HA 4CMEC 1K7EB 4RH1A 2JHCA 3SQOA 2O48X 3UCXA 1J8YF 3JY6A 5HOQA 4G65A 1J0XO 2WMYA 3OZAA 1NYQA 2JFVA 5FA8A 4ETMA 3BKWA 4JP2A 4RENA 5B6JA 2O2EA 3NFYA 3SF8A 1V2GA 2IYZA 2A9KA 2XQJA 3NP9A 4WXMA 3ZY4A 1EESA 1JP7A 1Z0AA 3V6LA 3C3YA 2Q5JA 3T1QA 1IH8A 2ZOSA 4H77A 3EDOA 1KRWA 2ZIEA 3NOXA 1QG4A 5BMVA 3EDRA 1U5CA 2WG2A 2D74A 4JP3A 1K08A 4X6LA 1JMYA 2QTNA 1P77A 2UVQA 1GZ7A 4R4JA 4CFYA 3LHSA 2QZ9A 5EL0A 4US2R 2WAYA 2FJ0A 2QGNA 1RM3A 5KTKA 2FP3A 3JS5A 4XIYA 2C8KA 2IS4A 5BVHA 2ATIA 3DVAB 2YDYA 1L5QA 2VWPA 4NU6A 3G7UA 4DIUA 4ZI7F 1GTG1 1CY2A 2EXXA 2WB2A 2KI5A 3GLRA 4A23A 4DS3A 5FTWA 2GCNA 2QUHA 2WIGA 3BRWA 3DV0B 3ELWA 4WOKA 1FDSA 4ER0A 4Y2HA 1N32B 1R0ZA 3P2MA 3CMMA 4ZRDA 4FHDA 3V55A 2QIOA 3FRHA 2FJPA 3G0GA 4LXXA 4YACA 2W2VA 1IXSB 4B4UA 1OYVA 3IR6A 2ODEA 4KXNA 2WNIA 5HGJA 4D57A 3SMQA 1XRRA 2WD7B 1T3HA 3GCWA 2GWRA 4JSTA 3CIFA 3IUNA 3NHBA 1JIXA 3A4MA 2WSSD 3FNFA 3PPYA 3HSKA 1YNOA 1WZEA 4HPXB 5KO2A 3J7TA 3PC7A 4Z0TA 5EQJB 4CV1A 5GMOA 3F5QA 3GROA 1XU7A 3RFVA 4EKDA 5KSYA 3LPLA 3P45A 2CLKB 2ZZKA 3BUSA 3D5TA 4YUAA 2P2NA 2WU3A 3I9V6 4IXMA 1VBFA 5CD1A 1JL3A 1H2XA 1RIIA 1LWOA 3RK4A 4BFCA 5JY6A 1WHTB 2G28A 4PS0A 4UNPA 1KYQA 4J4BA 1YRHA 3GPCA 1Z22A 2H4ZA 2ZJYA 3DR5A 1YCHA 3VKHA 3ZGVA 3DHNA 3NEAA 4IGAA 1JG7A 5AIAA 3T3IA 4FM9A 1MC5A 4YA6A 3UWSA 2ZXEA 5CD9A 1PZHA 1CR0A 3R75A 3FPFA 3K3PA 3UXEA 2EWVA 5LZ8A 4F60A 3FPSA 3BD7A 5CFOA 1E2UA 3I9V1 2CBXA 3T3GA 2H9YA 3TQRA 3BQ9A 4GPTA 1GAWA 4NSNA 2QI9F 3MT7A 3RC7A 1Z4KA 3CO5A 3N5KA 1JH9A 2I78A 4RVNA 1UAAA 5A0VA 1T3LA 2AJCA 1FXSA 2Y27A 3HB7A 4IIEA 5TARA 1CUXA 3KQSA 1FTWA 4J1QA 5HCUA 4M22A 1RLUA 5KSWB 4E1BA 2PBRA 5L53A 3J81k 5IX8A 2GRAA 3ZXIA 1I5EA 2ZUEA 3MJTA 5D5HA 2BJHA 2DE0X 1RHRA 1SIUA 3KSMA 4PRZA 2NO1A 3VDNB 2J07A 4F1KA 1U2GA 5DZSA 4EA6A 1LD3A 1SG0A 3OM1A 4FFWA 4LTNA 4YH1A 2WHEA 3ER8A 3WICA 3AEQA 4B45A 1G9SA 4JLWA 3IE1A 5AJHA 1EJ6A 2XQFA 4YDSA 4MYTA 1QYRA 3KFXA 1EHIA 5JH7A 1YR8A 3LT1A 3Q9NA 1JECA 2NTJA 4IRUB 4DSOA 3LOQA 3LRPA 3OF2A 1MJNA 3L1KA 4A0SA 2AOXA 3KP1A 3OX2A 3B9RA 3V1MA 3V4FA 4TGLA 2XNHA 3K6RA 5F3WB 1E94E 1Y5NA 4JLVA 1P9WA 1NQOA 2BM9A 2PH5A 5FLEX 3QXXA 1G42A 3DE5X 4FN4A 1I1NA 1VFNA 3AG5A 4DUZB 2Q2NA 3A2NA 1P4HA 1IZ7A 1F0YA 4FQ8A 4L1KA 1EFDN 2CXNA 4Q7MB 4DA8A 3NHFA 3WAGA 1JNYA 1VIYA 4W5JA 2YXEA 4ZVQA 3OCUA 3ZDAA 2YZKA 4X91A 3CZ5A 3CSSA 2PRSA 1IQRA 1SXJE 3E05A 3EZ6A 3QEMB 3VTKA 1DWPA 1YZKA 3BILA 2A14A 4BY9E 3IR5A 3DM9B 3FTQA 3QOWA 3GFRA 5K05A 1HUQA 1RWXA 4AN4A 1GU0A 5E4TA 2JAWA 2XMSA 1E8NA 3T1YB 3QE9Y 3F6RA 4YLEA 3LCRA 1PEYA 4TXJA 3M3PA 5BYJA 4J0FA 4L0MA 3BL6A 2E4YA 3L07A 3SWWA 4E08A 1WB5A 1UZUA 2BE9A 5KNCA 1N2BA 2QLLA 2ZI4A 2IU6A 4V0OA 2B3DA 3WDLA 4QFDA 2V7GA 4JC4A 3S5JA 1EFVA 3CHYA 2O59A 1SVMA 2XA9A 4GXTA 2DUMA 1FTNA 5C52B 5A4AA 1HQYE 1YQTA 1MABB 2ZUBA 3VNRA 3ZPXA 3VPFA 3NHZA 2P65A 4BWFB 1ZK0A 4QZVA 3TJZA 3MTGA 2A1TS 4J49A 4E2FA 2L0XA 2ZS7A 2CFIA 2GHIA 4KR3A 1YFJA 4IG4A 1RR6A 4EG3A 3DEIA 3B78A 1XEXB 4PZYA 4RMJA 3AINA 2BD0A 5GGYA 4A6PA 5CYPA 4JYCA 4BFYA 4BUCA 1KGSA 2XSZD 2ZI5A 4OHVA 3AKCA 5EGNA 3AFHA 3GP5A 4BO5A 4ESVA 4JBHA 5J40A 5A6VA 1ZP6A 3PLNA 5AD1A 3E9NA 3GN2A 4CGZA 1DKQA 3WRVA 4MVJA 5CAEA 3ZE0B 3UBTA 4OFZA 2JBAA 4Z1OA 1PGJA 2IXEA 4IAOA 3LX6A 2DHEA 4DMFA 1CVIA 5AVWA 2R44A 1L7AA 4EW2A 3KJZA 3V1NA 1ACJA 1QC5A 4ZGGA 4PWYA 4N0DA 3MEQA 4H6XA 1DPGA 2C2GA 3HU3A 1V1RA 1FW8A 3FNEA 2F17A 4RY0A 3MJSA 4WVLA 5D7NA 4LA4A 1BHJA 3D8TA 1RI5A 2KHZA 3OY2A 3HN6A 1NXOA 1ZIPA 3CG0A 2HMWA 4Z8XA 4PG4A 4CGYA 3STXA 1FYDA 2X42A 3GJSA 4TM7A 1FRFS 3H19A 5GONF 3BAFA 3FDIA 1TEXA 1DQNA 5BVGB 2IYXA 5JZSA 2Z6AA 4V0KA 1ZN2A 2R1VA 3B52X 2QVYX 4DCUA 4QTYA 3WGUA 4I8XA 5DOZA 1XUOA 2VA9A 4JJEA 4IKEA 2C5GA 1X87A 5DM1A 3WAJA 3HKDB 3DLHA 1VCIA 2B61A 2RE8A 2BSQA 3KQPA 2BEUA 3PQ2A 2ZWIA 3O4GA 3RHSA 4BMYA 2PS0A 1N2CB 4RSGA 4OQMA 5KDLA 5AOBA 5ICFA 1L4KA 5IXYA 1KY3A 4BTVA 1AJEA 1NV9A 3QTBA 4M0KA 3PNKA 3U2QA 5HOEA 4JC5A 4IXNA 3LYLA 2WMOB 3NBAA 3QP9A 5HIKA 2HV8A 4I50B 5SYNA 2C9DA 3RV4A 4X3CA 4M9QA 2H2HA 3KVOA 4BLWA 4CF6A 1ZVMA 4CIAA 3EF0A 3VHXA 2Z4RA 3QBVA 3HDGA 1SG6A 4RJ2A 1UMKA 5LA6B 2SCUA 3ICVA 4DDTA 2EJCA 2JLAA 3U31A 3JQ8A 1JFLA 3I2FA 3N70A 1A9SA 4FMCB 4R8VA 3OG9A 2AVNA 2EFCB 2IF0A 2M98A 1BXGA 2HB6A 2VRBA 2Y1WA 1M1UA 3H4VA 3KVNA 4NCIA 3D6VA 4P4LA 3VBCA 4ALIA 4U7PB 4NE9A 5CH8A 4N1AA 1E7QA 4WOJA 3WVNA 2YWFA 3E4DA 4PSCA 2DWUA 4CEJA 3HCPA 4XQEA 1CV2A 3KHUA 3KLPX 2J3IA 3AJ9A 2O50A 1XQ1A 3L7BA 3OEHA 1XZFA 1SO8A 1ZRMA 2OP0A 2QN7A 3T0FA 1YA8A 1UBNA 2AI3A 1L4LA 1N25A 2DQZA 4HDSA 1AM4D 3A25A 3DVAA 3GUZA 4BKQA 1L7EA 2FZEA 5SYAA 4BMSA 4YCMA 2FPGB 2PYDA 3THXA 2C4WA 5CVEA 5AM5A 4ZEMA 2WLSA 3ADOA 2ACKA 4X8MA 1FVHA 4AJHA 3F9IA 4WJZA 4XCXA 3WIEA 3U4DA 1BWPA 3U7GA 4YV1A 1CNFA 2HHHB 1AKNA 1E60A 3G5AA 2NVBA 1RPNA 4KLCA 2GFIA 3KSDO 4IQ4A 3RVJA 4UBLA 1VKHA 4K8OA 1VLVA 1GGEA 1TYBE 4E2WA 1GPNA 4H7IA 3D8NA 1T26A 2PLNA 2NT3A 4IDEA 1JIJA 1NFRA 1XDUA 1P81A 2BAGA 2QTRA 3FFWA 3Q5EA 4DLTA 5BSKA 2ZAMA 4KWHA 2IKSA 5SZJA 1CU1A 2PS3A 3KKNA 1NDUA 2P1RA 3MTBA 3M9XA 2JZOA 2X7HA 3CZMA 3OQPA 4B8ZA 1GAXA 2V7TA 4P32A 3BMOB 2B8TA 5TQ2A 2OSVA 1MR3F 3OFVA 5B7PA 5L3SB 3THYB 1IVNA 1KDTA 2VXOA 3LKVA 1XPUA 3PNSA 2F9FA 1CUAA 1GDHA 2DSTA 3MOSA 4D9GA 1QVAA 2ONCA 4DCTA 3ILSA 2IW3A 2RHBA 2QEQA 3GGGA 4KKXB 1LW7A 2Y68A 4LWZA 4RCZA 3UWPA 4XIJA 2BEKA 1JG6A 4K2HA 1DDGA 2FHPA 3WKDA 1Z47A 3FYTA 2Q5CA 1LF0A 4J29A 5LLTA 5K3SA 2I9KA 1WDWB 3W3AA 4LYHA 5F77A 2VT7A 4N41A 3K0FB 4AS3A 4HDOB 3A4TA 1V16A 3L6EA 3TFWA 3ZE8A 1T1JA 3GXBA 4L8YA 1C3EA 421PA 5EZSA 1NZJA 4RK6A 5KREA 4EF5A 1Z5VA 4QPDA 3SJ7A 1FS6A 3DONA 4Q4JA 3OQIB 2QRNA 1P44A 1T36B 2CLIB 3HLTA 2JI7A 3KZKA 3Q7PA 3UH0A 3ULKA 1L1FA 4AF8A 1G8MA 2B21A 5IVKA 1EDEA 3SP1A 2FDXA 3F3KA 3PHHA 4XASA 3EULA 1T2CA 3MQ4A 2QY9A 1X3SA 2FK8A 4NU5A 3D43A 1PTJC 3D7NA 3M5DA 5ES3A 3SYRA 3NPMA 3M82A 3ZGZA 3G89A 1UMDB 3W3ZB 4N5HX 2A94A 1SUWA 3VR3A 3BEDA 3AJ8A 2OZVA 4BN4A 5ADVA 1WPXA 3LMKA 3W5VA 3QBTA 1NBOA 2ZRPA 3JQGA 4D42A 1EG7A 4AZ0A 3IHWA 3UMGA 2QD1A 1YV9A 2ICAA 4KCGA 4OFXA 1OLXA 3D8RA 2R11A 3H75A 3V4ZA 5IM4F 3TGPA 1R5JA 2Z8YM 3A27A 5LP6C 1GADO 1Y8QB 2XVZA 2VSQA 4U8HA 1DNPA 2OGTA 3AC0A 3NG1A 4N7BA 1FOEB 1RHQA 1WWKA 2FPXA 3NRCA 5ALLA 1K6XA 3FYDA 5EJ2A 3WP0A 2HL6A 3UKOA 2FSHA 4ZALA 3W2IA 3ZGYA 5EUMA 4IDHA 2NU8A 4B6OA 3OA2A 4FFPA 5CMLA 3DD1A 4KODA 4MI6A 1WSDA 1P4JA 1JV2B 4X7BA 3ZWXA 2UUOA 5BV0A 3IEXA 2HCFA 4CIWA 2N0SA 3GRZA 3RVDA 4NPHA 1QQ7A 2P6UA 4UHKA 4ZZ3A 1GTL1 4KFUA 5AVVA 2VQEB 3PXDA 4QLOA 1RVDA 3OZVA 1KP3A 3ZHCA 1HLFA 2O3QA 1CRQA 3JPYA 3R9XB 1K3TA 4J7CA 2D00A 1J2RA 1L7PA 2P2ZA 3EEFA 3I8XA 1HNZB 2R00C 4I3HA 3E9YA 3O1LA 2W6PA 1Q7BA 4LRUA 2VI5A 1BJRE 4NI5A 2EJWA 2OR3A 2QUIA 3U7IA 2IV7A 4PPFA 4GSLA 2AJLI 4DBVO 1DX4A 1F2UB 1AQLA 1QRDA 2OQIA 3NBFA 5IDVA 4UVIA 4DY6A 4YAEA 3IMKA 3PR3A 4MEAA 5AM2A 5LOVB 1YIDA 3QPAA 4G25A 3T5MA 3IB6A 3PSHA 1H6CA 2XRYA 4XRGA 3UTDA 3E7WA 2FOXA 1P5HA 2P4EA 5EVCA 2MCFA 4YAGA 2FV8A 2XYPA 3W8EA 4DZZA 2BCJQ 4ZA2A 4EMUA 3LM8A 2BHLA 3GLFB 5LYJA 4MUGA 2Q1TA 2BKAA 1T2UA 2Z9CA 4LCEA 3JASB 1AUVA 3DE4X 2XT6A 2GXSA 4GO1A 4HTAA 4RY9A 3KCNA 3EZ2A 4EL5A 2D5LA 5GOZA 4DIMA 2HN9A 3Q72A 4IJWA 2C2YA 3VOAA 2ZK7A 3VC2A 2IUTA 1UQUA 1XDDA 4C4YA 2YWGA 1CRZA 4BO6A 3LOPA 3QITA 3CLRD 3VR5A 1A5SB 3QPUA 3R0VA 1JBEA 3BCRA 1EVEA 2TMDA 1M6NA 4P4SA 3KKEA 5E1OA 1T9CA 4EBBA 2IYEA 3UJ9A 1Z3CA 1J99A 3RC1A 1N6IA 3EG9A 3OQJA 2GZRA 2CLSA 4R2MA 5E4FA 4K9KA 4V0MA 1SELA 1KNXA 2TS1A 2QW0X 1VLQA 4PV7A 2WK1A 2A9JA 3FW1A 3H2IA 4KAFA 2PR2A 3TW4A 4KPYA 2YUTA 3P9NA 1LX6A 3Q12A 2NGRA 5D01A 3RSQA 1JDPA 4FILA 2PX2A 3RT9A 1IVSA 1Y34E 1XRMA 2C3PA 3I9FA 1PHRA 3V42A 3D6AA 5FKJA 1SCJA 3EH1A 1J23A 3NHPA 4UBNA 1WBBA 5D5QA 3GRVA 2XOKA 1JQLB 4C6TB 2AR9A 1OXXK 2YOGA 1W47A 3SBDA 3GJ7A 2XSZA 1DT3A 3NHYA 5BSUA 1QF6A 1H0SA 1KK3A 2HLPA 2NX2A 4QICA 3WNVA 5GJBA 3V8VA 4TN1A 2H1IA 4KPEC 4FI3C 4FT2A 3DFFA 4OHCA 1HR0B 4LXTA 4XD7D 4KIJA 4WKGA 4AZ0B 3LYAA 4IPTA 4JUBA 3ZTWA 1P60A 3TZCA 4F1JA 1BOOA 4MQFB 3MBIA 3QKSB 2XZDA 2VDWB 1J97A 3UB2A 1WCIA 5GP1A 1K68A 3HRIA 4IRMA 2EZUA 2IEAA 1IQ0A 2Q41A 3LFUA 4CFZA 1II9A 4RPKA 2CDNA 2JGEA 3FPKA 1OYOA 1A97A 3F71A 3IXQA 2OHJA 1HZZA 1O57A 3EUEA 4B8WA 1V5EA 1X3LA 2P2GA 2Y0DA 1XNGA 1RFGE 3U4HA 4U7WA 4DTIA 1ZUD1 3HKEA 2BMAA 1N5MA 4Y9TA 3S2GA 4E09A 4U6NA 1U98A 3I4CA 4M89A 4ZOAA 3T0IA 1QGAA 3CF4G 4EY7A 5CVTA 2XCLA 1S89A 4YCSA 4OQZA 4C0WA 2FZLA 2Q5OA 1T13A 5A03A 2GJ8A 4K86A 2NU9B 2P6PA 3CUSA 2F3PA 1PD0A 3O8OA 3TSYA 1AN0A 1OIWA 3ND9A 4AWAA 2HA7A 3K0FA 1Z4IA 4UPEA 1S01A 3NWEA 5DHUA 1Y1SA 1Z0DA 3ST7A 4F6RB 2EFEB 2JD1A 5ALXA 2HK9A 4KQJA 3L77A 1HZJA 1AK2A 3NUZA 1ZGBA 2I4IA 2ID7A 2OILA 2X2PA 3IP6A 3RQIA 4NH0A 3W5JA 4Z3KA 3F7OA 4DR1B 1DMSA 4KWCA 3BJRA 1DARA 1FVFA 3L7NA 2VAMA 4J1TC 2W2KA 2ZSFA 1IQPA 1ZCZA 5KVQA 3NBYC 5KSZA 3OHMA 4LXUA 4OPMA 3W1VA 5EE9A 4QA9A 3WGQA 3P26A 5COQA 3GVHA 1K7SN 3IERA 3EY9A 3FROA 1P2VA 1IONA 1XX6A 2GEFA 2DBRA 1FUIA 1U0OC 3GDWA 4G5GA 3CTPA 2XNSA 3D54D 3LP8A 4ND1A 3CGGA 1NVTA 1TAHA 1WQ4A 3LQ4A 3COWA 4JQYA 3WOVA 1TIKA 4RZ3A 5TR9A 3UHAA 5HZKA 4MUJA 3VX3A 4W8HA 1BN7A 2QTWB 1DXYA 3CLKA 4AMGA 8LDHA 2UZ4A 5THQA 3QX8A 4KQGA 4LN1A 3PNPA 1VJRA 3LSYA 5FJJA 3N28A 3SS7X 1OT3A 1YTUA 1D2CA 2YXLA 4YJGA 3GEIA 1SHZA 1Z74A 2DHDA 4N0EA 3R9KA 3VKFA 1R8JA 3VX4A 5KVVA 1DWOA 1NJGA 1J2YA 5HK8A 3RYCB 3ZY5A 2UXCB 1OXKB 1HEYA 3AUJB 1WUTA 4JSYA 1P9NA 2IU3A 2IXAA 4U5XA 1GPLA 2ODPA 1K7YA 3V8QA 2GO1A 5HF5A 3VV2A 3HHEA 3ENZA 3M6MD 3TFQA 1KJ9A 1A04A 2KB0A 2OUKA 1JLKA 2YZGA 3DYBA 3K30A 3TCKA 2CNOA 5KJFA 3WRXC 1G5QA 4B3XA 4EFDA 5HBRA 4A7PA 1GOTA 3QKWA 1YJXA 1JR2A 4QHSA 1VL8A 1HSOA 3DO5A 1JKMA 1YZVA 4LJ9A 5G53C 2RSLA 5FQOA 1MO2A 1N0HA 3HU2A 2W93A 2RHMA 4JYBA 3A32A 2DUUA 3MT9A 1A5ZA 3D64A 5ESDA 4QKQA 2XTNA 2A35A 3UAVA 2FPOA 4Z7QB 1A88A 4P9NA 4DCOA 3UJPA 2ET6A 2BELA 1NRXA 1QH8B 2C9MA 2L2QA 4I8IA 3SNKA 4CG2A 1RMYA 4U2GA 4EFLA 4HEHA 5EP3A 3GP8A 1Z26A 3OTIA 2W6NA 4YMWA 3QTLA 2C9YA 4LIPD 3OKPA 1ISFA 1P2SA 4LC9A 1E2JA 2PAAA 1VYHA 3DEAA 3IBTA 4HDQB 5CFZA 2H31A 1AKWA 5LP6F 5DYIA 1SBCA 3IXLA 1P91A 1EVIA 3KZXA 3SEAA 1CFJA 5JJBA 5L95A 4P7KA 2FZ4A 1JHPA 3D4LA 4Z9YA 3RFXA 3TIIA 1P5JA 1YBFA 4GNRA 4M8NE 3SKVA 3RPEA 2NW6A 5TQVA 5B6IA 4AMZA 1XMJA 6YASA 5EIEA 1RZUA 1JHZA 2O5EA 1W19A 4M21A 4D6YA 2YZ2A 4N40A 2R1VB 2P4UA 3ZOZA 4RD2A 4GAEA 3R5TA 3JZFA 4AM8A 3O2JA 4DQLA 1PW7A 3T95A 2CN1A 3NNDA 1ZNXA 2R86A 3TRKA 1A3CA 1CF4A 1TMYA 3M83A 3DH0A 4WUVA 3DDUA 4KWIA 2BIFA 2FCRA 2IY9A 1IFXA 4F3RA 2EZ8A 1WCV1 5ECWA 2H00A 3MGAA 1KY4A 3NIDB 4UUQA 1N4DA 1FLAA 3THWB 1G21A 4EY8A 2AFHE 2R97A 3D3KA 1Y7LA 3IAHA 3MMZA 4TMTA 4UDNA 2QX4A 4RL6A 4HVCA 1LPMA 1SC6A 2P3SA 4J4TA 4M1QA 4OLJA 1PT5A 1TKCA 2OESA 1EHYA 1T9ZA 1PJAA 1X7YB 5C3MA 1CS4C 1FXWF 3ASYA 1V4BA 3QRWA 2C5BA 3AEZA 3WBBA 4EF4A 1UBCA 4JBIA 5TQ0B 3ZQ6A 1TVEA 5B5SA 2FPWA 3KPJA 4B2PA 4KOEC 1NBME 1AKQA 1U28A 3LUDA 1DUVG 1Z34A 2H9AA 2JI4A 3VISA 4GMGA 4QD3A 1AKVA 4JU9A 3W9YA 4LCJA 3R5XA 1WB4A 3AP1A 4X1YA 4LF7B 2VLIA 5EFOA 4L73A 4LXYA 3SN6A 4F5ZA 3UQZA 5KUTA 2GSWA 2E4UA 1YZ3A 1H9AA 2IXGA 4HNVA 1ESNA 1ZBDA 2RCNA 1PVVA 4OEHA 1GG5A 1B00A 5FUVA 2H17A 3A36A 5JLAA 3RF7A 4AJOA 1SA0B 3BWEA 3JU3A 4FCWA 3HXQA 1YK0A 1HDOA 4FWIB 3CY6A 1AXEA 4XFKA 1XJ0A 4H1WA 2DWCA 1WY5A 3HA7A 3CLUC 3OKCA 4DV3B 1CXZA 2JKVA 2WINI 3N2YA 4RFVA 5G0VA 5H80A 3AL0C 1L5ZA 2AFIA 4QYMA 1RABA 4DEXA 2CJFA 2IUEA 2PUHA 3I4FA 4LV6A 4OKIA 3KE9A 3C3EA 9LDBA 2I67A 5G4LA 2FOLA 1OR8A 2RKBA 3OPMA 1GNQA 3QUSA 4LDNA 4R9RA 4RF3A 5AVZA 3TIVA 4LEIA 2VDNB 1VE9A 2EG9A 2POQX 4M8SA 4C21A 3FJ1A 5M29A 2GPWA 3T54A 3X43A 5HQ3B 2WU1A 2AC4A 1Z6TA 2C84A 3JQAB 1SXJC 3CO0S 1G5RA 3K1AB 4KFSA 1V45E 3OIWA 4BQFA 5ESWA 3TWOA 2BEWB 3DMGA 3T34A 3RU2A 1KYZA 1L5YA 1EM8B 2J6IA 3ZWQA 2NVOA 1U1IA 2Y0CA 3V48A 4HV4A 3KSBC 4CKBA 3KD2A 4WWHA 3ZDFA 1UJNA 4ZCQA 2AFRA 4D8VA 3AEKB 4LDZA 2WLTA 2VQSA 2IYTA 3WC4A 1U2RA 4QJ4A 1WCYA 4RZIA 3ZDYB 1VGQA 2O8FA 3H84A 4A0FA 2RC6A 3AP3A 3GFQA 2J59A 3SQNA 3EBPA 4I5IA 4PQGA 3D02A 5K8CA 4JL6A 1SOVA 1IY2A 1Z63A 1PL7A 2IIBA 3DDCA 2FW1A 1SHKA 5D2CA 4HAWA 2IYRA 4L22A 3OQVA 2I76A 2X2FA 1Q7CA 1PZNA 2G07A 4MUMA 4HQLA 5FI0B 2GAOA 4UXHA 5DASA 3F4LA 1XL1A 3ZI0A 3PL1A 5KOYA 3R3JA 4OOFA 4Q1CA 2L19A 4JLAA 1DJQA 3RKUA 2DKNA 3M8KA 1XRPA 5BQPA 3HGMA 4YJ3A 4P3XA 3OMXA 2J41A 2OC9A 1R0LA 3GFGA 4YJDA 1L5HA 3A6DA 1ENOA 2VT3A 1BFKA 3C6KA 2WUGA 1SU6A 4TTIA 1MO5A 1U5BA 3SK0A 4RA6A 4HFNA 3TQHA 4A0RA 5CB4F 2G4LA 5JC8A 1QGYA 3A6KA 4EB6A 4D0NA 1WW3A 1WVIA 2PR7A 1BYUA 4ZVLA 1LSUA 4J7UA 4KUEA 3VHLB 2O3UA 1H2ZA 3BXOA 2MR5A 3C98A 3HRKA 4JXJA 3VSDA 1M33A 2YHBA 1CUGA 3SLKA 2JEYA 1B16A 1CDZA 2G08A 4CKEB 1FQWA 3TQOA 3D4BA 4RTLA 2AK3A 1TVCA 3MAGA 1Z36A 4GX0A 3AJDA 3KTDA 4FOSA 4QTUB 4URZR 1YA4A 2A2ZA 1WV1A 1Y8QA 3TL3A 3QYAA 1JG4A 3SHOA 5BT8A 1IAVA 2RG7A 1JHRA 3T9CA 3QVOA 4DLSA 4MQUA 4F5DA 4ZQFA 3DOUA 3KEFA 4R05A 4FMDB 3CEJA 3G2LA 3QEOA 3I30X 3WGYA 1NXWA 1X7XB 4O4HB 1G18A 2XB2A 2WDZA 2J6BA 5DB4A 4A92A 1Y3DE 2C58A 5FPPA 4G89A 4RJKA 4MUYA 3WL6A 3IAM1 1M2VB 2W8BB 5A02A 5A9SA 2CB0A 1E9RA 4RJLA 1XZMA 2FW8A 2G17A 2YN0A 2ZSEA 3AUFA 4FJ1A 4HZUA 4IWNA 1T6BY 1UJ4A 2GBPA 4LOKA 3ZV6A 1OB5A 2G88A 5DI3B 2Q46A 1A8QA 4XYLA 3LXUX 4W5NA 2LPMA 1BH6A 2LBPA 2RK3A 4UMVA 3AWIA 3E35A 2CHFA 3HL0A 4UNSA 4D3ZA 4F11A 2G1UA 1Z82A 1HXHA 3FJYA 4GOMD 1OOEA 1QJCA 2EKQA 2GK3A 1DHRA 2WF7A 2AN9A 1EUZA 1QP8A 1VL2A 4GP6A 4US1R 3WB2A 2QTZA 4P38A 1AXGA 3NR2A 1JKIA 4DSZA 4FIZA 1NASA 2FFBA 1WABA 3EAGA 3IV7A 1QR2A 2CCJA 1H1LB 1C9NA 1NVKA 3IODA 2G5TA 3F74A 4A8JC 4GUAA 1FFBA 3CRNA 2UU9B 4BN5A 4XPIA 3H8SA 4N9QA 4GF5A 3W8NA 2OAQ1 2CMDA 2HNAA 2B78A 4FGUA 3ZK7A 1DGQA 2A3NA 4EI7A 2N46A 3R20A 4US0R 5H5JA 3MIZA 1QPZA 4K3UA 4TV9A 4M9XA 1OC2A 2I33A 5G2OA 4RCYA 1KSGA 5DK6A 2BZGA 4Y98A 4CQJA 4W99A 1QZ3A 5GAJA 3W06A 3ORYA 3TKAA 3BHNA 2BZSA 2ORWA 1UBUS 2ZE5A 5KQPA 1N1GA 3STHA 4ARZA 4YV0A 4F92B 1P3JA 2QI9C 3QI7A 3PLRA 3DBLB 2E2WA 3DMRA 4MVXA 2I91A 1E63A 4WSOA 3UK0A 1DWUA 1YB5A 2PUTA 2Q1YA 1FYWA 1N9ZA 5AHWA 3A4IA 3AYXB 3FBTA 4H59A 4H6PA 2Q3MA 4AFNA 5AVTA 1HT0A 4EQ6B 1NOKA 3ND8A 2FVYA 2NUTA 3VVLA 1Z6YA 2CL5A 4C7OB 2EBFX 4X8LA 2OVFA 3EARA 1KDOA 2RIPA 4GH5A 3QWHA 3WMRA 1UQRA 3B13B 2QJOA 3CKYA 4QO8A 5FO0A 4BOYA 3MRVA 3EMBA 1JJVA 3VC7A 4EJ6A 3K53A 4B3DA 5HM8A 4N8SA 5IARA 1KEZA 1U1CA 4I4TB 4R3WA 1IJKA 1DOHA 4F9FA 1A96A 1E3WB 2E48A 3GRPA 3P7MA 1UBEA 3P96A 3D5QA 4MKFA 3OFKA 1C5KA 3HYLA 4O5AA 5B1YA 2E5LB 2WTNA 2FLWA 1U0JA 4YBZA 3VH3A 4OMFG 3KT6A 3EFHA 3MFYA 3MPUA 4RAQA 4WA8A 4ZT4A 4MVJE 3WE7A 1RACA 1JGTA 2IOYA 4XDYA 1OHHD 3ICCA 4G85A 4ES6A 3BXZA 2PH3A 1XK6A 2C99A 4GMHA 5IHXA 4AMUA 2ABWA 1C8KA 4YB8A 5JS2A 1Q5PA 1WLYA 4CT5A 3U19A 2BBTA 1ECPA 3F5FA 1DKMA 4LGVA 4HWGA 5IJZA 2IS2A 3HKBA 2IPNA 4KTVE 1E77A 1UKVY 4MWCA 3NOOA 1SBHA 3HJTA 4AICA 1GV0A 1GP2A 5KVSA 4DM7A 4M0EA 3CE6A 5FI1B 2KLBA 4KAJA 2FWBA 1YUNA 4N18A 5GQSA 3NFRA 3OJFA 2CLMB 3P9ZA 2HY7A 2GJKA 3LKBA 4EPVA 4YAWA 4O08A 1XCLA 3BXXA 3RJZA 2P35A 1LRJA 1YNSA 4A6DA 4B44A 3PJDA 1DTWA 1PGOA 4GSKA 1YBHA 3ANMA 1U0TA 4YLYA 3PYXA 1B74A 4AS1A 5F1PA 4G41A 2DJ5A 4ZO4A 5EZ6B 3KG2A 4MR7A 5DV9A 2CXPA 4NE7A 2FA9A 4G1UC 3CTMA 4TTRA 2QX8A 1DHTA 2JFYA 4I1VA 4LE0A 4Z53A 1FDVA 3ZYCA 1Q0QA 1M10A 3VKVA 3TKYA 3E9QA 1COWA 3OPXA 5SV2A 3BT7A 2A4MA 1GZHB 3LC2O 4HN9A 3QNUA 2G8LA 1JHQA 4M7WA 4JBWA 3RSFA 3UAZA 4BO8A 4BE9A 5BOSB 5LQDA 3DW3X 4NJMB 2PGAA 4OD0A 4FNGA 5FTJA 4B74A 1Y1RA 1XKXA 2IX9A 2DU8A 4JSRA 1LLQA 1OTHA 3D3QA 1CUWA 2WI8A 3W8FA 1CVRA 1DCFA 3ZXYA 2KWIA 1RYBA 3HCOA 2JB9A 4PSDA 5BN3A 5KYTA 3E23A 5DW3A 1NN1A 1L7BA 5DO9A 2HR1A 2QMEA 1VBKA 4UMDA 2A92A 4LJ7A 2VDPB 2FMUA 3C8MA 2GM3A 1RRMA 1B26A 4Q1BA 3WMEA 3OCCA 1EI9A 4UFOA 4Q9JA 3ORSA 1QKIA 4DQUA 3O38A 1V1RB 4IEFB 1OI3A 3C4VA 1SFRA 1D1PA 4AJIA 4DT1A 5C80A 1D3AA 1PR2A 3EA0A 1KVRA 3CGWA 1Y48E 2PCJA 1TZJA 1BDHA 4CTKA 3TN7A 1ULBA 4PCAA 2I2BA 4RF4A 4D0RA 1KGDA 4RZHA 5CPFA 2YL2A 3T6KA 4DRZA 4TUYA 5AJYA 4NOMA 1A8SA 3OHPA 4FEYA 3QW2A 5DYYA 2GN6A 2AL7A 1P6QA 1XQ6A 1U0FA 2VSFA 3NAMA 4O2AB 1GILA 1M73E 3WWOA 3BORA 4LYDA 3UB4A 3ZHSA 2ZB4A 2COUA 3A70A 3JASA 2VF2A 4J91A 4IF6A 4ZARA 3TAUA 1TYAE 3WLKX 1PEKE 2KJQA 1ECGA 5ALJA 3KKPA 4F06A 3V9PA 5I8ZA 3M6XA 1SY7A 3ECCA 4FDUA 1QO7A 4BV3A 3OMLA 1RWOA 5K0SA 5AXBA 1W1WA 3HB5X 5CPBA 2AMLA 3C85A 1RYMA 1NE2A 1ECJA 2HPZA 5I9BA 4JI5B 1WIWA 3SZRA 4POOA 4P4TA 4DR6B 2BKXA 5JSHA 1JIQA 3PHIA 1GG8A 3PGJA 3AX6A 4MX8A 5E9JA 3U39A 5SZHB 4A73A 5JFTA 1LPAB 1E3LA 4YRTA 2AB0A 3QX3A 3A6HA 1Q95A 1E1LA 1YB2A 1Y81A 2BH2A 3JQFA 1CY7A 4BO0A 1U0GA 3SIPA 1YOVB 5GJVC 2C4UA 1FP7A 1ZMTA 4R9VA 5DNDA 1CULC 3K8YA 4JBGA 3EPJA 4GUDA 4QWMA 3RVBA 1T0IA 1TF5A 1W9HA 2OD7A 1N2SA 3I4LA 3OZUA 5TB5A 4O3MA 4RKYA 1CUIA 4RD6A 1X92A 5FLKA 8AT1A 5DNVA 4GPAA 5AUQA 3NPAA 5ICEA 2HDNB 4YQYA 4QUEA 3CEPB 1P4AA 2IHNA 1I3NA 4O2LA 3EW7A 4JDPA 1U7ZA 2OVBA 3RTDA 4BVEA 1J9EA 1R6BX 1E0SA 2I2AA 1OAAA 1FE8A 4EHDA 5A4IS 1EUQA 3TX6A 1LBEA 1OZHA 1ENZA 2WD7A 2GWHA 5EUQB 3TVDA 5IPFA 2HMYB 1UFOA 1Z25A 3EZNA 4MP6A 2NZXA 2ZJ7A 3U3RA 1CYDA 2BDEA 4Q6WA 3IAS6 5JXIA 1BJKA 2RARA 3KUCA 2QHXA 5LYJF 1TU3A 1PF7E 2C57A 2KMLA 1WUKS 3M70A 4JFRA 4K9RA 1ZK4A 4CQLB 4ECEA 4PNEA 3GBPA 3HKCA 4RX1A 2PD6A 3QVKA 2H51A 4TMZA 4AU1A 5EKUA 5JTTA 5M34A 2COEA 1SEPA 3KOUA 2DBYA 3B3QA 3G1UA 4ETIA 2QIPA 4DSTA 1QE5A 2EFYA 5KNBA 1PKXA 5JS1A 1OT5A 2RHJA 3HBLA 1RC0A 4KG7A 3TSCA 5IKMA 2JL1A 4FS8A 3VO8A 1U0LA 2O2CA 2G0AA 2XHEA 2J67A 1Z38A 2I6GA 2HBRA 3ZVRA 4DILA 3M1IA 3F3SA 5TY0A 3SJBA 1SUIA 4QAQA 2BGMA 5KYKA 5DSTA 3RM3A 4JN6B 3AW9A 2X8JB 1ODSA 4I4NA 4Q3BA 4QBKA 2YHUA 2XNKA 1W88B 1R00A 4NU0A 1JQKA 1PWXA 1XJ5A 3ESBA 4XWOA 1ELOA 1RJEA 4CMCA 3D1LA 1JFVA 2K2QB 2PKCA 1JH8A 4IWXA 4AJKA 2VG8A 1J4AA 3K9HA 3B48A 1W581 4NJEB 4TT8A 4AY4A 5EJFA 4DRYA 5K0ZA 2AG5A 2PZGA 2UYQA 2X77A 3FNIA 3HBMA 1EJBA 3S2EA 3TTXA 4O1HA 3ZW9A 5JALA 3HUDA 3S1LA 5FHRA 4GQIA 2J6CA 2Y1KA 2XMRA 3DV9A 1EVQA 3JD4A 1L7RA 4IGKA 3UYKA 4EVIA 5EAIA 1JVBA 2A59A 1VMAA 4Y2UA 1FSGA 4V1CA 1JEEA 1M75A 3CA8A 3I62A 3GU3A 4YXWA 2R96A 3UNXA 2PVPA 3QU5A 4ZCRA 4MUEA 1NMQA 2ESRA 2Z2IA 1N6HA 4FNAA 4O4IF 4QXAA 4N5LA 5KHAA 1CIJA 4N3AA 1HX7A 3NNSA </