5LIPA

Pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIACYL-GLYCEROL HYDROLASE
publication title Structural basis of the chiral selectivity of Pseudomonas cepacia lipase
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Lipase
total genus 114
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lipA00
1XRPA 3O0DA 4HVTA 3AUKA 1O6FA 3KD2A 1HPLA 1FFEA 3OOSA 4YASA 3G0IA 3D2BA 3RKSA 4BBZA 3H17A 5ALFA 2PUJA 4G8DA 1F6WA 3BF7A 2V9ZA 1XZAA 4G5XA 2WG1A 3C6ZA 2YYSA 3HI4A 3D4LA 3I1IA 1UOOA 3WYDA 3ZV7A 2XQKA 2BUBA 2XMRA 2XQJA 3IURA 2D5LA 3WIOA 4ZV9A 3D0KA 5IVHA 4CG1A 2Y2VA 3WZMA 2GBFA 2OPHA 4LXGA 4GEGA 5FKJA 1MT3A 2EDCA 1AZWA 5AM3A 2ORYA 4C4YA 4M0FA 4TVKA 2XI4A 5K3EA 1ODTC 4PSUA 5AI6A 4B83A 4JYMA 4OYLA 2RGUA 3VXKA 3C5WP 1YAHA 3DLTA 3WWCA 2CMFA 3EIOA 4EBBA 2XDWA 2WTNA 4X6YA 2DQYA 4HZGA 4C6HA 1CR6A 1THTA 1BE0A 3BJMA 5ALXA 2Z8ZA 4MXDA 5C8VA 1DU4A 4H7KA 1GPKA 1QFMA 4W1RA 3I2KA 1DTEA 2BAGA 3WK7A 3HZOA 3DDUA 3NGMA 4K6GA 5AM4A 3DOHA 3WL7A 2C5FA 1LPPA 2Y6VA 5ALWA 4XJVA 5LZ2A 3ESDA 4J7AA 1IMJA 5AOBA 5LP1A 4M0EA 1HDEA 3B3QA 3I2GA 5CH5A 3FCXA 5E2IA 4W1SA 2RAUA 2VJDA 5IVKA 1W1IA 4W9RA 4QDOA 1WOMA 3AFIA 2FJPA 4GECA 2RONA 5DTJA 4A5SA 4B9EA 5ALNA 4BZWA 5DNUA 4Z49A 2PM8A 2Z3ZA 3I28A 3NOXA 2QVBA 1XZEA 4RE6A 1R3DA 1XZDA 1LBTA 3FSGD 1CUUA 4RPCA 1XRQA 2VAVA 3WWDA 2B9VA 1K4YA 4GBGA 5ALVA 5AOAA 2ZSHA 4HTAA 2PUHA 4ZRDA 1XKLA 4Y2QA 3C45A 4DNFA 3VDXA 1CPYA 4OPMA 2OLEA 3QMVA 1THGA 1CUSA 4PSCA 1R4ZA 4H18A 1CEXA 4AN1A 3FLEA 3GUUA 2OAEA 2CUTA 5HKAA 5HK8A 3F96A 3GBSA 4LYDA 1JJFA 5AKXA 1GQSA 2QZPA 4UBKA 1KEZA 2GBIA 5AI5A 1TCAA 1XQYA 4A16A 2HA5A 3DEAA 1CUXA 5AKYA 4B9AA 2OCKA 1HL7A 1CUDA 3ED1A 4Y2TA 2C4HA 4X92A 5JAHA 4WFIA 4EY6A 2O2GA 4Y2YA 2HFJA 5T4EA 1QFSA 5AM5A 1VLQA 5JD6A 5E4JA 1CUBA 1UT6A 2CJPA 5ALGA 4KJXA 2VJBA 2RHWA 3D7RA 2IX9A 1BROA 1WHTA 1XLUA 3GROA 2OGZA 1N1MA 5AIBA 4X3CA 1YCDA 5HF8A 1XRNA 5LZ7A 4WFKA 3WJ1A 4EY8A 3STUA 3I2HA 5ALSA 4P08A 5KBYA 1A8QA 3QZUA 1N8SA 2YASA 1CIJA 3H2KA 1QOZA 3W04A 3HABA 4BB0A 1DINA 4MEBA 3VJMA 5A7FA 1J06A 3WMRA 2OGTA 4XIIA 1TKRA 3C87A 3FLBA 5KREA 1SFRA 4MJ3A 2XMSA 3QM1A 5DJ5A 1JMYA 2LIPA 1CUHA 4BTLA 2XLBA 3QH4A 5ISMA 4D9JA 1JFRA 1ODCA 1XZCA 2ES4A 3G0BA 5ALEA 5FP0A 3HRHA 1BEEA 5JD5A 1UK7A 2X8BA 2XUHA 1YB7A 1Y37A 5EIEA 5AICA 1R88A 4QA9A 5AM2A 1L7QA 1DX6A 3A2LA 4AB1A 5A71A 5BWCA 3E4DA 1A88A 1IUOA 4KACA 1EHYA 3Q8WA 1JJBA 2H9YA 3IUMA 2HA0A 2H7CA 3DKKA 3VKFA 1C7JA 3ZWQA 3IUQA 1W76A 5AI4A 1AURA 1LZLA 1IUPA 3WKAA 4U2CA 4EA6A 1CUYA 2Q0XA 1C4XA 4AX4A 1F8UA 1OXMA 4EB0A 4UBLA 3FYUC 2AJDA 4YK7A 4BVLA 5AO9A 3R0VA 4H7DA 4IH9A 5HF6A 3PF9A 4X97A 4KE6A 2BUCA 5AHXA 1MAAA 2C5GA 4KYVA 3G9UA 5JARA 4F21A 2QXUA 2QJRA 5ALLA 5E4TA 3I6MA 4I4CA 3WYNA 2PSDA 1EXWA 2WU3A 5DNVA 4BE9A 2Y2UA 1EVQA 4HAIA 2XE4A 4G8BA 2FJ0A 2AXEA 3D2CA 2QT9A 1RYYA 1KU6A 3BIXA 4K6KA 3G8YA 2QRUA 2WHPA 1Y7HA 2HU8A 2DSNA 1QO7A 5CURA 4MEAA 4BYMA 3DQZA 1ZIYA 4W1QA 5FRDA 1XZLA 4J0HA 2V96A 1HBJA 2CBGA 1MNAA 4BAGA 5ALDA 4GHWA 2C0PA 4J03A 5D7BA 2WFLB 3AIMA 4Q05A 2JEYA 4RNCA 1VZ2A 4CI9A 1XZKA 5KWIA 4KE8A 2QUAA 2XMQA 4G4JA 4QNNA 4DNOA 2GBGA 3QPAA 1TAHA 4GW3A 4C01A 3F8SA 1WPRA 5DWDA 1ODSA 1W4LA 4AQDA 1QIJA 5CH3A 4X6XA 3SWWA 4F60A 3WKBA 1K8QA 4J0KA 3VVMA 4AO7A 3HSSA 2GBCA 3N0TA 3OURA 2PBLA 3A2NA 3CCBA 4UHCA 3VJKA 2XUDA 1EDBA 1XZIA 2DHDA 3T52A 1S8OA 1R9MA 4FLMA 5EHNA 4DTCA 4Q3LA 2RI6A 2BKLA 4L3WA 5AKGA 4C4ZA 5IVIA 5C7YA 2J3QA 1VJ5A 3BXPA 1TK3A 3C8HA 2OQVA 4B82A 3WK9A 4DGQA 1QGED 3WKEA 2HRQA 4CCWA 3F9CA 3KWJA 4EY7A 3NUZA 4FFWA 3WWOA 1DT5A 5T4HA 4HS9A 4MWTA 4ETWA 2HU7A 4LKOA 3K9BA 2V98A 2GYWA 2BJHA 4WDQA 5JASA 2WG2A 5F4ZA 5AJHA 1XZMA 3IDAA 2G4LA 3DL4A 4J0DA 5AKKA 4M0MA 2W6CX 4BP9A 2Z8XA 4BC1A 4LIPD 4BTVA 3EBLA 4BDSA 3QVMA 4PO3X 3I6ZA 5FLKA 2HA3A 5C8XA 2WQZA 2OQIA 4BCBA 2ROQA 3O9VA 1HQDA 2VT6A 1F0PA 2QMQA 1E3QA 5AKLA 2PSEA 2IIVA 4DMCA 5C8ZA 4XWGA 4RE5A 2OXEA 4WDRA 1MX9A 3V1NA 2UZ0A 5LLSA 4KAAA 3TGLA 1QIEA 2H1IA 1OCEA 4JYPA 5ALYA 4CIBA 2OCIA 4UFPA 3OC0A 2XQFA 4EZIA 5C81A 2JGEA 1CQWA 4K6HA 5ALTA 5JD4A 1EK1A 1XZFA 5ALUA 3R3UA 4J0JA 4MWSA 3FVTA 4C89A 1LBSA 4INZA 3DCNA 4G8CA 4UHFA 2HL6A 4UUQA 1FFAA 5DTIA 1YR2A 2XB6A 2H7YA 1H23A 1DWOA 4A23A 1MJ5A 4H7JA 2HHAA 1BEZA 1AUOA 5HQ3B 4U2FA 4W63A 4B0PA 4H35A 2Y1KA 3G0DA 1MTZA 3DD5A 3ESBA 4IHAA 3JW8A 1E8MA 3AINA 4JUIA 1UFOA 3FYTA 5DYWA 4J0GA 4ZV7A 1GGVA 3W05A 1N5RA 2XMDA 4KRYA 2WIDA 4FHZA 2WJ3A 4AMZA 4BVJA 3KWFA 1UWCA 2HIHA 1U2EA 1AX9A 4DMKA 1LPNA 3I6YA 1IZ8A 2VAXA 1YSCA 2WU4A 3STXA 1R50A 4WCVA 1YS2X 1FFDA 1WHSA 4CFSA 2HRRA 1YA8A 3W2TA 1Q83A 4H7IA 5FXMA 5CH8A 1WPXA 1AKNA 2WJ6A 2JGFA 4Q3OA 5JZSA 3RM3A 3IBTA 4UHDA 1QJ4A 2BUAA 4U2DA 2V97A 4QLAA 3PI6A 4GWLA 1EX9A 1VKHA 2WHQA 1BCSA 2PVSA 4Q3KA 5EIAA 1P0MA 2O7RA 1TIBA 1DWQA 5K3BA 4ZWNA 4X95A 5AI8A 3LIIA 1QTRA 3QPCA 4TGLA 4LHEA 3AZQA 4ZREA 1BCRA 3BJRA 3H2JA 1L7RA 2X76A 4KRXA 1D07A 4NZZA 4KAJA 2WIFA 4H77A 2ZYRA 2JGIA 4FLEA 3C6BA 3WI7A 3R3WA 2WHRA 2DHEA 2JIDA 5EGNA 4FDMA 4LXIA 4OYYA 1WM1A 2VT7A 1BN7A 4QDUA 2WIJA 4YPVA 1PV1A 2R8BA 3ZLUA 3E1GA 3WLAA 4E14A 1E66A 4NVRA 2CEKA 1IZ7A 2XUAA 4BCCA 2CKMA 3L1HA 4J0IA 2VJAA 1MN6A 5AIAA 3AZOA 2G5TA 3BF8A 3JWEA 4HRYA 1TCBA 1U8EA 4UBMA 4BZZA 4X85A 3WZLA 5EHZA 1SOMA 5IKXA 5SYMA 1EVEA 3ZLVA 5BV7A 1QZ3A 1R9NA 4Y2UA 1HLGA 4LYEA 4G1FA 4K5QA 2DR0A 2E3JA 3ICVA 4U2GA 4QWWA 4X00A 1VZ3A 1ZIXA 4DNPA 4B85A 1E8NA 3R3XA 1QONA 5AKZA 5JAOA 1XROA 1DQYA 5LKRA 3V9AA 4FMPA 3FYUB 1LPOA 3VVLA 1PJAA 2WSLA 4Y2SA 3PICA 4P93A 3VISA 1QIHA 5AKEA 3CN7A 3DKRA 4BDTA 2BCEA 5LIPA 3RARA 5CW2A 4J0CA 3BDVA 4H0CA 5LYYA 4C4XA 2WUFA 2WKWA 4DMHA 2XUIA 4B0OA 1B41A 1DX4A 4O08A 1XZHA 1CUZA 2XMCA 4MQLA 4XX1A 2WIGA 5EI5A 3IUJA 1GPLA 1QIGA 1E89A 5A62A 3E0XA 5I9IA 5K5EA 5LKAA 3H2IA 4QZVA 2B4KA 3F98A 1CUVA 3A2MA 1H22A 4Y2RA 1BN6A 1ZD5A 2FX5A 1CUEA 1MX1A 4FBLA 1W75A 5HKBA 1ISPA 2WTMA 5ALMA 1UKAA 3DYVA 4MQMA 1ZICA 2XT0A 5FV4A 1VA4A 5DYYA 3AJAA 1NX9A 1QIMA 4P9NA 3AIOA 3G7NA 3FBWA 4CIAA 3H2GA 1EK2A 3WL5A 3G0GA 5EFZA 3HACA 1P0PA 3GA7A 1VXOA 5AKJA 1UK9A 5JZBA 1VE7A 1W6RA 2PKYX 3ICWA 3H1AA 5AI9A 3F67A 3GFFA 4HXGA 3C43A 4IQ4A 5IH7A 1VXRA 4Q1VA 5ALHA 3W06A 4AO6A 4OB7A 1YAJA 3DL7A 1G42A 3MVEA 1TQHA 3ESCA 3WQHA 3LIPA 2XLCA 4TPKA 5AI0A 3FWHA 4N8SA 2I3DA 4ROTA 4OD0A 1ORVA 1EA5A 1AGYA 1PFQA 2JEZA 3IIIA 4WFJA 2Z5GA 3M82A 1H2XA 4FNGA 3I2IA 4H7HA 2XUQA 1JI3A 2WM2A 3WKCA 5E4YA 3HYSA 3RLIA 4CCYB 1CUIA 1Q0RA 2BGNA 4E15A 5CMLA 4KE9A 1XLVA 4BE4A 4PSDA 1XRLA 1QLWA 2O7VA 2ACEA 3UUFA 1K5PA 2NW6A 4PQEA 4PF1A 1QIDA 2QJWA 3WKDA 3G9TA 1ZI6A 5K3CA 5HZGA 2WFLA 4B7ZA 2VEOA 3C5VA 3S2ZA 3IA2A 5CRIA 4GLBA 1P0IA 4WJLA 1KU0A 3QITA 1UOPA 5K3DA 3S8YA 4QEKA 4X7BA 4EY4A 3H1BA 3E3AA 5CBKA 5AK5A 1ZD3A 3O4JA 2I78A 1LPBB 2ZVDA 1MX5A 3AZPA 3LLCA 1QIIA 1SCIA 3D2AA 1CLEA 4DNQA 4E11A 4X6UA 1QE3A 1EB8A 1XZJA 3AIKA 1IUNA 1YA4A 4BRSA 4JNCA 4AXBA 4QE3A 1XQXA 1DQZA 5FPPA 4UHEA 4BVKA 3KDAA 2DFPA 4FLFA 1O6GA 2QTBA 3FAKA 1J1IA 3EF3A 3R3VA 4X94A 4HXEB 4DIUA 2PSHA 4GXNA 4P92A 2C58A 3P2MA 2JGMA 2YH2A 1G66A 3L1JA 3QMWA 1CUFA 5AOCA 1EINA 4Y2PA 3DJYA 4B6GA 3TJMA 3IUNA 5AM0A 3SK0A 2OCLA 1Q84A 4ZGBA 1ACLA 4N8DA 4WY5A 3GELA 1CQZA 1X2BA 2QOEA 1JT2A 1GKLA 4PNZA 2XUJA 4DMFA 1NU6A 1J07A 2DHCA 1LZKA 3EQ7A 1LGYA 2W22A 4X71A 4I3FA 3H18A 4OU5A 5CTAA 1ZI8A 1TCCA 2EEPA 2VATA 4RGYA 4S0XA 1JKMA 3WK6A 2XUOA 1GZ7A 4Y7DA 1BU8A 1GXSA 2B61A 4BATA 5EHXA 5ALKA 3ILSA 2HA7A 4BP8A 4QWMA 2ZYSA 1T4MA 3FOBA 4ARAA 2QKYA 5A7GA 3LP5A 1VOTA 1B6GA 4UBNA 4B81A 1EDDA 1FSSA 4AN0A 2EDAA 5JANA 4FKBA 3O95A 3KSRA 1W52X 2GYVA 2FUKA 1MNQA 4UBOA 3C6XA 1CUJA 1RP1A 4BAZA 1FJ2A 3UMJA 4FOLA 1M33A 1ACJA 1XKTA 4Y2JA 4CG2A 3PUHA 4H7FA 5HQ3A 4X90A 5D3ZA 1BS9A 3WJ2A 4X93A 2R11A 5DNWA 4B84A 1CV2A 1MAHA 4UFNA 2PSFA 1OILA 1XLWA 3V1MA 2OG1A 2JF0A 3KOOA 4UHHA 3TRDA 3QPDA 3IULA 4AZ3A 1CUGA 1USWA 1WB6A 3WL8A 5HF5A 3JYHA 3EQ9A 1UOQA 3C8DA 3D5EA 5CT5A 2X5XA 5D3KA 5K3FA 2AJCA 4FNMA 1TRHA 1Y7IA 2HADA 1F0NA 2VTVA 3H2HA 3G9ZA 1EH5A 5CXXA 2RIPA 3DS8A 1ZD4A 1MO2A 4QDXA 2C7BA 5K3FB 3LS2A 4MYDA 1RWQA 1WCYA 4IH4A 1YASA 2ZJFA 4AO8A 1UKCA 4EY5A 5ALZA 2QM0A 6YASA 1XRRA 2XUFA 5BOVA 3R3ZA 2HM7A 2JGKA 5AKIA 1UKBA 1K63A 1CVLA 2WFZA 1UZAA 4QDZA 1AMNA 2CB9A 3FSGA 4JEIA 2CZQA 2XUGA 5J3JA 1JJIA 4CG3A 1LNSA 3OTQA 3O4HA 4G4IA 4E46A 3H04A 3QYJA 3OM8A 2YXPX 5EIHA 1YB6A 2HU5A 3O9MA 1H2YA 1L7AA 2XMBA 2Z3WA 2P8SA 4OUKX 1X70A 4N5HX 2WIKA 5HF9A 5FPQA 2OGSA 4NMWA 2PX6A 5AK4A 1K6EA 2OCGA 3W9UA 5CT6A 2K2QB 2PSJA 1QIFA 1CUAA 1LPMA 3FNBA 3O4GA 4FFVA 5DLPA 4WY8A 4K2AA 4UBIA 2VSQA 1DT3A 3ZI7A 1CRLA 5ALRA 4F5ZA 3DNMA 3R3YA 5H3HA 1SCQA 5LZ5A 1XZGA 5JATA 2BFNA 3I2JA 2WUGA 4HXFB 2QR5A 4BC0A 4U2EA 3C6YA 3WL6A 2O2IA 1GKKA 2I3ZA 3STWA 3WWEA 4H7EA 3STYA 3QBJA 2OAGA 2QS9A 3FYUA 1FFBA 2WUEA 3FVRA 4V2IA 1I6WA 5HFAA 5YASA 3ANTA 5KWJA 3QMMA 4L0CA 2XQIA 3OG9A 3F97A 1N5MA 3CN9A 4KAFA 1QO9A 4IO0A 4QDTA 1XZBA 1SCKA 4QLOA 1XRMA 1ETHA 1G4HA 3LCRA 3STTA 1DWPA 3PF8A 4FWBA 2DCMA 1ZI9A 1JU4A 2XUKA 3HXKA 3AILA 4DSAA 3RK4A 5CXUA 4XVCA 2PU7A 1QIKA 1U65A 1VA5A 3ZPXA 1JMKC 3ZLTA 2XMGA 2WLSA 4G9EA 1CFJA 1WB5A 4EHBA 2ACKA 3I2FA 1G5FA 2B20A 2BGRA 3V1KA 1A8SA 1E8DA 4PV7A 5K3AA 3G0CA 2ONCA 4N8EA 4OB6A 2GYUA 2GZSA 3N2ZB 5A2GA 5DYTA 2JGJA 3Q0TA 5ALIA 1UXOA 2QXTA 4UFOA 1SC9A 1NU8A 1J2EA 4C88A 3M3DA 3EQ8A 4G9GA 2HA6A 3MUNA 1VE6A 1XQVA 5ESRA 4FBMA 3BWXA 5T4BA 3SC2A 1BRTA 3G9XA 3H19A 3TEJA 1AQLA 1IVYA 4BCDA 3YASA 2DQZA 4KR0A 3WIBA 3ANSA 5IVDA 3DYIA 3M83A 5I7UA 2GZRA 4ZXFA 3GZJA 2I03A 2ZSIA 3K6KA 1EI9A 2PPLA 3G02A 3HLKA 3UUEA 4Y2XA 3PDCA 3V1LA 1MU0A 3BDIA 5JAUA 5LZ9A 4MYSA 4YX9A 4LXHA 5AKHA 4EUSA 3A70A 1CUWA 4GI1A 4OCZA 3O4IA 1LPSA 1A7UA 3B12A 1WB4A 4CCYA 3CXUA 1T2NA 1UK8A 4JH0A 4G4GA 1ZD2P 2WFMA 3M81A 4BRZA 3MGAA 2WG0A 4GDMA 4F0JA 2WJ4A 3X3HA 1X2EA 4DLNA 3R41A 5FDFA 3L1IA 3WA7A 4J3JA 1CUCA 1C7IA 2ECFA 2XMZA 3HEAA 5JADA 5JIBA 3V48A 1YS1X 5SYNA 2JGLA 2PL5A 1A8UA 3IVMA 3WWPA 4DM7A 5HK9A 3WK4A 1EB9A 4N5IX 1XFDA 1JU3A 4I19A 3U0VA 2HFKA 1GQRA 3PUIA 2H7XA 1R1DA 2D0DA 5LZ8A 3PFBA 3BE8A 5ALQA 4AZ0A 4W1PA 3WK5A 3T4UA 3R40A 3ESAA 5ALJA 2J4CA 4IH1A 3SX4A 2J3DA 4L72A 4ITVA 1H2WA 2RHTA 1GT6A 1Q0ZA 3OPMA 2WUDA 5CT9A 3U1TA 3H0CA 4C87A 4HRXA 1H2ZA 3CCCA 3BL8A 2AJLI 2IITA 4KEAA 2XUPA 2QUBA 3W9BA 5HFNA 5CT8A 5FOQA 2Y6UA 2C0QA 5BWBA 3A6ZA 7YASA 2WHPB 2G5PA 2VJCA 1MPXA 4BAUA 2JBWA 3NWOA 4AMYA 4L9AA 1ZJ4A 2VA9A 1LLFA 1ZGCA 1FFCA 2AJ8A 5CT4A 2XQGA 2J4FA 1EDEA 3FLAA 1U4NA 5EHQA 5JALA 3I1YA 3PE6A 4U2BA 5JZ9A 1Z68A 1UK6A 3PFCA 1ZOIA 5I8PA 1E5TA 4UBJA 4B80A 1QTIA 3HC7A 2VQ6A 5T4FA 3C70A 2ZYHA 2ZJ6A 5A7HA 3WK8A 2O2HA 2HA4A 2ZJ7A 1GPNA 3K2IA 4NS4A 3FCYA 5AK3A 4UHBA 1ZGBA 2VF2A 3HJUA 1P0QA 4OU4A 4FTWA 2HDWA 4X91A 5AH0A 4ARBA 4OSEA 5ALOA 4ZI5A 4UPDA 5AP9A 4DSZA 5ALPA 3STVA 3BIWA 5A6VA 2AJBA 1AC5A 3VJLA 4KE7A 3D59A 5LZ4A 4Q82A 4PW0A 1HKHA 5JAPA 1LPAB 3WA6A 3IB3A 5AK6A 5JYCA 2PU5A 1XQWA 3B5EA 3MUOA 5AM1A 3KXPA 5FUMA 1ORWA 2HA2A 3DOIA 2G63A 5HCUA 5D6OA 4DYHA 4Y9SA 2ZYIA 4OB8A 1ZJ5A 3D3NA 2WILA 4Y2VA 4Q34A
chains in the Genus database with same CATH superfamily
5H3CA 3I53A 3CNQS 5SZHB 5JCZA 2QRLA 2VYCA 4HVTA 1CD5A 3RIXA 2IYFA 4FFDA 4EABA 4RJLA 5H1YA 2KQUA 1FFEA 1VGRA 3BMOA 3KEMA 2XGOA 4HYYA 1AN9A 4RJKA 3X2EA 1JDUA 2R6GA 3Q6IA 1M2NA 3NC4A 2W4QA 4Y6LA 1EVZA 3DAOA 4XGNA 5CXUA 5KNDH 3GLUA 5LC1A 1BGWA 4MGYR 2P4UA 4ES6A 1OB5A 2OXFA 4GC9A 1F8YA 4HN9A 3NKFA 2AWOA 3EZLA 1KYVA 2UAGA 3OZWA 4MI9A 4V3CA 1YKSA 4JUBA 3RC7A 4NZYA 3OFJA 4FSDA 4TV8F 2YWHA 3AEYA 2VK1A 1QR2A 5LQDA 1B15A 4MVJA 2V9ZA 5LM3A 1XZAA 3KZOA 3A1UA 3G6WA 4HV4A 2Y92A 5IZCA 1XP5A 3CUKA 1P7VA 2BEJA 3DMGA 4G8JA 4RABA 2BJWA 3KJEA 3CO0S 5ILOA 1O96A 2HO4A 3D4LA 1L6IA 2QJFA 4HADA 2AGVA 3I1IA 1KR5A 4ZEMA 2P90A 1BQ4A 1GKYA 2Q7XA 4FYKA 4G4SP 1KL7A 1G7RA 5KNCD 2OUIA 2VNKA 4NCJA 3LHFA 1FDSA 4LXQA 3TLZA 3TAXA 2CNWA 5D5HA 4IDFA 2R6ZA 3HBNA 4TLDA 3PGVA 1D4ZA 1DLIA 4G0OA 4HDSB 2W6IA 3OKFA 3S1SA 2XMRA 2XQJA 4G5FA 2D5LA 2AEJA 4ZV9A 1WZUA 5IVHA 4XGIA 1YBVA 3FIJA 3C97A 1F2UB 5BO5A 1NA5A 3O94A 1YHZA 3MTDA 4Y2HA 4A91A 1H8HD 2OPHA 3L82B 1ZCJA 4D8YA 3VKWA 5EQFA 2CXTA 2BEVA 2PX3A 4QNRA 1W6UA 4U1RA 1AKMA 3OJEA 2C4UA 3S2IA 4BO8A 4W9MC 3PNSA 2QENA 3O7MA 2YVQA 4KYTA 4DJTA 5FQNA 4UHKA 4JLKA 4GYWA 3Q9LA 4LDRA 1X1BA 5EKSA 1P4HA 2IZ0A 2CNKA 3ICPA 3L8ZA 5L7YA 4C4YA 5GOZA 2KW5A 4L2IB 2R7MA 4C22A 4RJTA 2EG9A 3EG9A 1PT8A 2Z1MA 3FYDA 1XAHA 4KQXA 1ZN7A 4PPFA 3IGFA 1IONA 2CHUA 7GPBA 2UZ1B 3H7IA 1TADA 4LYGA 4N40A 4PGFA 4PLZA 4PSUA 4NEQA 3PNVA 1QK5A 4DMLA 2ZZMA 5H8WA 4ZI2A 3D4NA 1FVFA 3OLZA 4EBFA 3P9NA 2QDKA 4R2HA 3WWCA 1CVRA 3OFND 2NO6A 3PNPA 2EZ8A 2MDTA 3EGWA 3L6DA 2CMFA 2OZKA 3KSZO 4Q3AA 4B6RA 4BFVA 3KUCA 1X9GA 2NXNA 4EJSC 3PCRB 3ZD6A 1YS9A 1QSGA 3DDSA 4X6YA 2IT1A 2DQYA 3BK1A 4LSWA 3ZWCA 4MV9A 1THTA 3U61B 2PWAA 5DCLA 5EWMA 3NTVA 1HX7A 1YIDA 4QNMA 2HMUA 2RBGA 2O6HA 2R48A 2XGSA 2BFOA 1KYQA 3RNLA 2A8YA 4WPGA 4AS3A 3RVPA 2ZSKA 2VRCA 4DLVA 2NVWA 3EIQA 3WBKA 1UJCA 5C8VA 4DR3B 3EC2A 3EG9B 4BE7B 2Z5VA 1M8PA 4GQAA 3MBOA 3Q10A 4PG7A 3GGGA 1TEXA 1JDBB 1C3VA 1RWNA 5L4NA 1BMDA 1ZK3A 4MWOA 4GMGA 1SOWA 2Y71A 4EMTA 2BAGA 4RJJA 3DDUA 4EYKA 4OYRA 1WO8A 4D99A 4TZ6A 3Q5GA 4UEKA 1P3DA 4K6GA 3N75A 3K6RA 4EATA 1XDSA 3FB1A 4JBHA 4LYFA 3TM5A 5CAEA 5ER6A 1WDLA 3WL7A 5LMNB 4L4SA 3NV7A 4U7TB 2WAXA 2I99A 1ONBA 2W2KB 5KS2A 1YGPA 2Y6VA 1GRQA 1AUXA 3I45A 4P35A 4PLVA 5CIQA 4XJVA 3O2SB 5EWMB 3VHXA 3KWMA 4J7AA 2GD0A 3BXGA 1IMJA 2P6PA 5LP1A 4M0EA 1E5XA 1HDEA 4BLTA 3N2NA 2ZIWB 4D5EA 3VZBA 3AEKA 4PINA 1AS0A 3BK2A 5IJ0B 1WHSB 3T7JA 3AP2A 2QVXX 3L8HA 1ILEA 5E2IA 1D5CA 1SGWA 2AG8A 1B16A 4A2PA 3A3NA 2CLEB 1TUBB 2JFNA 2CDCA 4M98A 1L7DA 3RSLA 1ZNYA 5COBA 2VJDA 4OIMA 2DFDA 2Z3VA 4L8LA 3UAGA 1Z15A 1RQPA 2ZB8A 1MQAA 1YJBA 3DV0A 4F45A 3LX5A 1N6NA 1V5FA 4EFKA 4JVNA 1PT5A 1JFLA 1OZ0A 1C50A 1O2DA 1Z18A 3VX4A 2QIPA 1AMOA 3SIRA 3KALA 5F9MA 2OESA 4A5SA 2F3PA 2AOVA 2GK3A 5THQA 3VHXB 2O8EA 4M0CA 5LA6F 1IG3A 3ORHA 4PBRA 1DAGA 3KR0A 5JNUA 5DNUA 2RH8A 2BJVA 3H05A 1R10A 4Z49A 1I33A 3WOHA 1P9OA 3HO6A 4RH3A 4B46A 5K20A 4NY1A 3RUFA 1XZEA 3FDZA 1XZDA 1BCSB 1LBTA 1ZM9A 2YW2A 3DZKA 2O7SA 2JCGA 4ZVOA 1N2IA 2KLBA 1KZGB 2I1LA 3BE5A 2FWAA 4ZJYA 1DXQA 3N2EA 2WSBA 4R0NA 3HP4A 3WE7A 1XRQA 1YDFA 1AJEA 2Q1TA 2QXYA 3JSAA 1WAMA 2QI9F 2VAVA 2JJQA 4UVEA 3GRKA 1M1NA 1UINA 3KOUA 4JU9A 4KQMA 1AXRA 2G3YA 3WWDA 2ZU6A 1CHDA 1XCPA 1YQ9A 2VHZA 1RC1A 4GBGA 3ZVRA 4L8VA 1V6CA 3E0QA 5JAZA 1ID1A 5CVJA 5E7JA 2JJ1A 2ZSHA 2IPOA 2X23A 1LK5A 1WDKA 3N8KA 3QVWA 4HNGA 2SKCA 4HTAA 4ZRDA 1R5OA 1BCRB 2ETXA 2WHXA 5EMHA 5E7QA 5IG2A 2PJRA 2GESA 1WW3A 1RKUA 4UAJA 1G6KA 1T91A 1XSEA 1LI5A 5C1DA 2XNHA 4B3TB 1YB2A 2O8EB 3T5BA 3NQ41 1Z0FA 1GT91 1ATIA 1SZDA 2Y1CA 4ILKA 1RJWA 2FF5A 4HB0A 4DNFA 3DFFA 1WW2A 2AMLA 3CMMA 3VDXA 1L1EA 4L9WA 4G0QA 2KM1A 2V4ZA 1GUYA 4LJRA 2H16A 3FDZB 3K2QA 1V41E 3V8PA 1RM4A 2JAQA 1CUSA 2VHUA 3CLVA 4QRHA 2YJ6A 4BVHA 4WBNF 2X4IA 2PZLA 1Z6QA 2VPIA 4LYAA 5BVGA 3CT4A 3W5HA 2A3RA 3P0FA 1YZVA 2CUTA 2XA1A 4JOSA 5AT1A 5HK8A 3Q8XB 4DBLC 5HKAA 2P2CA 4KODA 3ZWAA 1RFLA 2JASA 2QPLA 4UU1A 1SAYA 3ONNA 5KNCH 1QH0A 2JIZD 5A5GA 1GQSA 4RXUA 4XWKA 4CWAA 4G25A 4TS3A 1R74A 3N2IA 3IAS1 3IQXA 3I5AA 4JJAA 4R1NA 3ICOA 1EJ2A 2RMKA 3KB2A 4RF5A 4WBXC 5JOQA 2PMEA 3AJDA 4H6WA 4L7VA 3RSCA 3ZCTA 1JG2A 1P1HA 5IT0A 1BXZA 1QKKA 4A16A 2CYBA 4LDPA 3IEVA 4K9LA 4ZQGA 4YA6A 1ICIA 1P9RA 1WPGA 1Q0LA 2QLMA 2ZIUB 3LPDA 2ZRHA 4L6CA 3GLGA 5T57A 2UYGA 2O7NA 3B1KA 4PLHA 1TGYA 2IHKA 2MSEB 1DX9A 3LUHA 4ITUA 4LF8B 2ZT5A 2C4HA 5F2NA 1PUJA 3WYAA 1L4LA 2AC2A 3O21A 2PT7A 4DXDA 3DFZA 3T61A 5JAHA 4PFQA 1PFUA 2C61A 2Q1XA 4IDDA 5CD1A 1RM3A 1QVRA 1M6VA 1ZEJA 5AVUA 3TPCA 1GTSA 1C7RA 1JIJA 4Y2YA 1XXHA 3GFBA 4I36A 2ZRIA 3JASB 2HFJA 4LF9B 1NXWA 4P22A 2YDXA 5AFSA 2PLWA 1I9CA 3I9V6 1ZNXA 5JD6A 3OOWA 2WAAA 3ONDA 4ZARA 4DPLA 3O8OB 1AF4A 4ZZ1A 1RAFA 2RHWA 4CUKA 5K6AA 1A5TA 1WDMA 2IX9A 5AVOA 3VMMA 3UYKA 2ZM5A 5AQEA 3K1AA 2QV7A 3HPQA 2GF2A 4C5AA 1AHNA 1K6XA 5KEIA 3OIFA 4EG3A 2QX4A 4A92A 3UATA 1YCDA 2A0WA 1UC8A 2YYAA 3A4IA 3TBHA 4JA0A 3SJ7A 2JLYA 3WJ1A 3LI2A 1KSGA 2C42A 1YJAA 2OP1A 4MLCA 4GE3A 1PRYA 3EVEA 1RRMA 3SM9A 2C2OA 1A8QA 1A9OA 1CF2O 4XB2A 2FFHA 1N8SA 1P2FA 3H5AA 4Q4HA 3A6LA 1QOZA 2B83A 1KI7A 4H3SA 4XQGA 2I7TA 3W04A 4AXXA 5JPCA 1N2XA 3TD2A 5JXGA 4IIYA 4YUXA 2GMWA 1LLUA 4JKIA 4TYPA 4XEUA 5ED4A 4D9EA 4OFZA 4DQDA 1YB1A 1WZIA 3WMRA 421PA 4YRMA 1T3TA 2OGTA 4G23A 4TLBA 2CLMB 4UPVA 4OHCA 3FLBA 5CP8A 3HJAA 3K1AB 4HNAB 2W2OA 1FYFA 1XNGA 3D3WA 4MJ3A 5DEOA 3M5DA 1RI2A 3P71T 3L8MA 3PA6A 2Q4TA 4NZMA 3WLQA 4EO4A 5K0BA 4INOA 3OZGA 5DM1A 1ZM3A 2XMSA 1Y3BE 3IP9A 1QDLB 5EXSA 5AVWA 4I5FA 4PM4A 1ND5A 1SH7A 3NWBA 2P75A 3E05A 4L8WB 4J49A 5D51S 5DJ5A 1JTEA 2LIPA 3RG2A 5JCXA 5I7EA 1G9SA 2GCNA 2R2AA 5I4KA 4P8RA 2QP3A 1HDIA 3CKLA 3MWLA 2XLBA 3QH4A 5BN1A 4EJMA 2ZI7A 3W90A 1NMSA 3L1VA 2BFAA 3UZUA 2AYYA 1AUPA 1Q15A 1QOPB 4KHZA 4KN5A 4NNOA 2YL2A 4Q4HB 4TWZA 5DE3A 5JNWA 2DP4E 3OM9A 1ODCA 2A9VA 3KJFA 1C1XA 1ZPDA 1RRKA 2WP0A 5CVVA 5K8JB 1DKUA 2EJVA 4FD3A 1S7CA 5ALEA 4GUAA 3HRHA 1BEEA 1UK7A 4Q02A 2MINA 5F35A 1E4EB 1U9JA 2X9VA 3D3WB 3NBMA 4UZFA 3GMSA 2QA5A 3WLRA 1E2HA 1KA9H 2R96A 3NCTA 1W5AA 2E85A 2IKQA 4FYHA 4YRQA 1SBTA 2CXOA 3NIGB 3LPLA 4RFSA 4KLRA 2PRSA 1ZINA 2RC5A 2CYAA 1Y37A 1Y6FA 2CMHA 3H13A 1H2HA 1T2FA 3LUJA 4P7KA 2ZJ0A 3EB9A 4RSGA 3N0WA 3N87A 1BTOA 3H83A 3KG2A 4F84A 5L4SA 1JE1A 4LG1A 1KFKB 2Z6UA 4Q1BA 3D6FA 3A2LA 2J85A 4HH0A 3A9SA 3B38A 1ECPA 3A6HA 4MTCA 1LI7A 1GUAA 4AB1A 5BWCA 1DCFA 5JFGA 1CF9A 3P97A 4LZJA 4N5MA 2R47A 1LF0A 1JJBA 1O94A 2CLLB 4P2GA 2O0MA 2HA0A 4QO7A 5H3LA 4DR1B 3HBMA 3LQFA 1P45A 1Y3HA 3IUQA 1W76A 1PFYA 1PL6A 5LBTA 4IP0A 1WL8A 2FQYA 2GEFA 1RI4A 2FSGA 1R2QA 1SOUA 2Q0QA 5A5DA 4ZO6A 1AURA 3NT4A 4ARZB 4RFSB 1VL2A 3SHWA 4ZCPA 4YJ3B 3KCQA 3VNAA 5BRJA 4A0SA 1C4XA 1U99A 1UQUA 2G36A 1E1RD 3MT0A 4AX4A 4AUNA 1ELOA 1RKBA 1TZ2A 3ZHTA 5TMPA 1OXMA 4DLPA 1THMA 4DC1A 3PIIA 4J4BA 3FYUC 3CJTA 4KTVE 1K8RA 4YK7A 1P5FA 4TKZA 3X1YA 4Q9NA 2PBFA 4CMKA 5B1IA 3KC2A 3MCZA 3SYRA 4QLBA 2FWJA 3D3KA 3DWFA 3I9OA 4LJAA 4MUJA 4D96A 3HFGA 3W6PA 3S4YA 2A86A 2DFVA 3N7TA 2QMOA 3ZZ1A 2ZQYA 5KOIA 2NSYA 1AIPA 1OTYA 3N7AA 1JQAA 3R6WA 4IH9A 4L1KA 4TXNA 5KTKA 2ATXA 2NPFA 2FSHA 4DVGA 1E3IA 1MAAA 1NJGA 3TD9A 1HQYE 2A57A 2QPOA 3FNHA 3NYRA 2FMXA 3RUCA 1L8QA 3PL5A 2W42A 1N75A 2QXUA 3H65A 1A2BA 1A7KA 2A5FA 3KAQA 1T9ZA 4BWYA 3I6MA 2VSXA 3KOWA 3QLVC 5HM8A 1QH8A 2MHCA 3FFWA 3HP7A 2X5JO 4BTEA 5AQ1A 4LHSA 5J23A 5DNVA 4L9SA 3NBQA 5DBOA 1YJCA 3O82A 4MKGA 4DV5B 2YNMD 3HR7A 5JEDA 3VI4B 4ZZ2A 3JYOA 5KOYA 4O2BF 3SHQA 4NJEB 2X5KO 3JZDA 1OC2A 2XE4A 2REQB 1BX1A 1LUAA 1MVLA 3HADA 1YE8A 2CL5A 1R9JA 2AXEA 2FJ0A 3ZIUA 1EUQA 3V97A 1RYYA 1QFYA 3QU7A 2GB4A 3CZ9A 1MO6A 4PEVA 3EXG1 4GBJA 4NAUA 5LMUB 2WHPA 2NYVA 3ILYA 4LJSA 3TRHA 2DBZA 2I6QA 1KSHA 4TSKA 1E4VA 3RTBA 4A2QA 1XDGA 4OLAA 1XMVA 4JHLA 2VZLA 4Y9DA 4ZO8A 1J5PA 3IKMB 3P9CA 3RW9A 4EUNA 3DQZA 3DL0A 4LBZA 1ZESA 1JDPA 1RE1A 2I7XA 3O03A 4GYKA 4HY3A 4W1QA 2H85A 3L7KA 5JMPA 5JW6A 1XZLA 3AB7A 3ILVA 1QQBA 3AR2A 1XMJA 3NDRA 4O25A 1HBJA 4L16A 3SI7A 2CLHB 4ESVA 1CJTC 3MHTA 3SF8A 1B8OA 1SEPA 3O3MB 5KB3A 5LQMA 3G89A 2Z6QA 3HDYA 1BHQ1 2QG4A 3CX7A 3L8YA 3CBQA 1RWOA 1OHHD 3MLBA 3TQHA 4BV9A 1JJ7A 4RKEA 1G5QA 5KSPA 5K6TA 1CNMA 2Z57A 5BN3A 2FW7A 5ALDA 5D7BA 2WFLB 4C06A 1DFGA 2JEYA 4DCUA 1OH5A 1F3LA 4CI9A 1G8JA 1SBYA 1SVSA 1RACA 3AM3A 3BG5A 3FA2A 3SQNA 3GGPA 4CT4B 4EKEA 3ZWOA 1IAVA 1XPJA 2CLCX 4CDMA 1RKQA 3WNBA 4MP6A 3IXLA 3KPVA 4QNNA 4FIDA 1JHUA 1IUKA 5DU2A 3ZCXA 4Z4CA 10MHA 2WPNA 3HU2A 2VDRB 3EMKA 5JTTA 3RS9A 2H17A 4K9SA 4DOMA 1SUWA 1K4MA 3ZUGA 1GCOA 4CUJA 4OG2A 3WGOA 3C1UA 3CNOA 1BS1A 4CXMA 4E1AA 1RJ9B 2HOQA 1NM5A 4AQDA 1VIAA 4DUGA 2X42A 2XW6A 3UAYA 4UXJA 2FPIA 3ZIDA 4EEXA 5IT5A 2NU7A 4X8LA 4X6XA 4YBRA 2V5UA 3PRJA 2JJ8A 2XF2A 3AHHA 3AR7A 3JQ7B 1ZGGA 3GN2A 4KXQA 3LVBA 4HB3A 2ZRJA 1XNJA 1UZNA 1FNDA 1CETA 4K9PA 1W34A 5BV2P 2XCRB 1NURA 2HLHA 4J0KA 4NYIQ 4AO7A 4KWHA 2QLJA 1KI3A 2O7QA 4J1SA 4BBPA 1T2AA 2FYTA 2W90A 3F6YA 1PTJC 2O1XA 2YCLA 3GD7A 4XX0B 2PBLA 4ZP1A 3PUZA 2H8KA 3TSYA 1JNXX 3L7IA 1I9GA 4UHCA 1R18A 3V7UA 3HA5A 2V6IA 1W85B 2RH4A 3M1IA 3KE8A 2I4TA 4BNLA 2BLLA 4EG7A 1VQ1A 4WCDA 2HMSA 3AJ8A 1EDBA 4OK3A 4E6EA 2R8XA 1HE4A 5EXTA 3MTIA 1MCZA 4FLMA 3CH6A 1RPAA 3LRPA 3OOEA 4KVFA 1T8RA 2FPIB 1FRQA 2ZB7A 3FJOA 2NU7B 3ASUA 4Q3LA 2Q4DA 5BUQA 5JS6A 2FWIA 2C20A 1E7QA 1ZOSA 4J9VA 3ZV5A 4X66B 5C5IA 4NS1A 3MUFA 1PW7A 1KAOA 4JUAA 4XOIA 4ZAWA 2OXCA 1BE6A 1TK3A 1XD2A 1YCGA 2WT9A 2VUTA 3HGTA 1VL1A 3UFXB 2OQVA 1WNTA 4BVGA 5DBIA 3WK9A 4TTRA 4B82A 2CL7X 3EPKA 2WQ6A 1HC7A 3IP7A 3IAAA 3PB3A 2JI8A 5E6SA 3PT9A 2ZBEA 3O1JC 2WF9A 1KJQA 1BNCA 2ALJA 4R7ZA 3WWOA 2D8AA 2BFEA 2PIAA 5BXQC 3J80A 2B2CA 3PC4A 2DF8A 4HS9A 4MWTA 4ETWA 5EMMA 2HU7A 1Z6AA 2V6FA 2CZCA 3V8QA 4X65B 3PX7A 2BJHA 4MW0A 3ZBQA 4DJFC 4OOEA 5JASA 1IQ0A 1KMCA 3F90A 1IZYA 3KYJB 5F4ZA 3H5WA 4ID9A 2Q9AA 1IIBA 4GNKA 2FH5B 3IDAA 4ND3A 3ZDZB 2C82A 3EPPA 1IOVA 3UAZA 2ONKA 3GZNA 3KJXA 5F2KA 1FDRA 4WH0A 2DFNA 3V6MA 2G1AA 3V1TC 1FPQA 1KKUA 3NEPX 3Q6NA 3V80A 4DCNA 3T9FA 5DGCA 1Q7BA 2O9JA 5HRCA 5IHPA 4R1TA 4BC1A 5A6SA 4LIPD 5BW4A 2D2IA 2E87A 3LUCA 4OO3A 2XKKA 2V7WA 3L04A 4YNBA 4JSTA 2YJZA 4ZOBA 4BV3A 3C7TA 1ZH2A 2DWUA 2BFEB 2HJ9A 4KVGA 2G72A 1Y6ZA 1XCOA 5FOVA 4C43A 4EENA 1V4NA 2M98A 1XO1A 3JPWA 3WQSB 4BDSA 2YV3A 3OO0A 4MVJF 4W9NA 5EIBC 1TZBA 3I6ZA 4M37A 1D2MA 4P3NA 5FLKA 4M0LA 3T3HA 5C8XA 3DDOA 4HH4A 1PO7A 1BJRE 4OHWA 4KO8A 2HPAA 3KFXA 3GNTA 5BYBA 2FZVA 2Q8QA 1JIQA 1EFLA 4EHLA 5CBPA 1F2DA 2QMEA 1HQDA 3BIFA 3D4BA 4QO8A 2FCRA 2A1IA 5FFFA 2QMQA 4FDAA 5B53A 1DRVA 2RHMA 4PGHA 5AKLA 2PSEA 2C96A 4DMCA 4XWGA 1J5XA 3SE0A 3SYMA 2BKVA 4JX9A 1MX9A 1DRKA 4CDNA 1S6YA 3I9V1 2UZ0A 1YQEA 4HOYA 5LLSA 1EX7A 1YQQA 4KAAA 3UUWA 5FPYA 1PZFA 2W9XA 4C0JA 4R2KA 2FSVA 4RK4A 3V8VA 5TDHA 5MN5A 1YR7A 2JLQA 5IT9A 3CE9A 1UPFA 4II2A 4V2UA 4CIBA 3ETGA 2OCIA 2IP4A 4RK7A 4UFPA 2PX4A 5DTMA 4CN8A 4JD5A 3P5SA 1VSBA 1PQUA 1Z3CA 1XVTA 2FW8A 1Q7GA 4DCTA 1G64A 4OV6B 2I6XA 5DZSA 4HGQA 1ZGJA 2AYZA 3LGAA 5HE8A 2HT6A 3TZCA 5DH9A 5FNZA 4F3RA 4PQYA 1G7TA 4FW9A 3UMCA 4R2MA 3FCUB 1HV8A 4X60A 3PEUA 4MWSA 3FVTA 3IERA 3W0LB 3RKRA 3B5JA 1UCFA 1EVIA 3DXZA 4JBLA 2VBGA 1DB3A 1H05A 4JLWA 4N7JA 5BQOA 5ED0A 1RR6A 1X6VA 2JKVA 3DCNA 2H9AA 3RIYA 3N59A 2YC2C 4Z5XA 2PUWA 2DBRA 3G2PA 1LSJA 1I7PA 3H5LA 4G8CA 4UUQA 5FHQA 4Q9IA 2UUBB 3PFGA 3P9SA 5DTIA 3E48A 5E1MA 5FI3A 2IPNA 3TS1A 2M9MA 4TTSA 3V2HA 1E1MA 1DWOA 4LZAA 4A23A 5DV9A 4H7JA 4LXUA 4D4KA 3PX2A 1OXBB 4LAFA 1ODLA 3GB9A 4LWZA 2W2LA 4H1VA 3EW7A 3ZW8A 2WD7A 3LFUA 1QP4A 4RHCA 3A4LA 3VNUA 3VPHA 3VH1A 2OILA 1H0KA 4WWHA 1KEKA 4MQ6A 3MEQA 1RYZA 3HUUA 2QRKA 1Y1KE 1XMOB 1XLTA 5FBRB 2P9QA 1VRCA 3AF1A 3ESBA 3JW8A 1DAPA 5AUOB 3JVDA 3OO1A 3QPUA 1E8MA 1KDVA 1XWWA 1RJEA 3LLMA 4J9UE 4JUIA 1ZOOA 2I65A 3B6KA 5EJ5A 2YXBA 4WECA 4IFTA 2FE1A 3LLUA 2A92A 3P5BA 4HK4A 4NMXB 1X1TA 2XWBF 1A4RA 3EZ6A 4UDNA 1JHAA 3TNDA 4BFZA 5C53B 2QSZA 2YBDA 1OBOA 3PP8A 4M1YA 4R2XA 2C4WA 5IAKA 3L7MA 5CPBA 5KTRA 2ZT8A 1WULS 3NTOA 2HSZA 4AZ3B 1KO5A 1NM5C 4FHZA 5EJ4A 1Q7TA 2H4FA 2WJ3A 3A9UA 5G0VA 4A6PA 4AMZA 4BVJA 4DHWA 4EHHA 4NCIA 5FWYA 2P0YA 3D43A 2BELA 3IRVA 4K7JA 3IPXA 4NCHA 1IB6A 4MVJD 4IUBS 3GLIB 1GNTA 3V4ZA 3Q1KA 2X86A 2ZRGA 1YSCA 2WU4A 2GBLC 3PFWO 3TLKA 3FDFA 2Q5QA 4YCSA 4IMIB 4WCVA 1YS2X 2TMGA 2H2FA 4WKPA 3LCUA 4X45A 5LDHA 1QP0A 1ZHOA 3DOJA 3NWPA 4IIUA 3UV7A 3MXTA 1FRFS 3JQ6A 3MAGA 2JFFA 3MFQA 4MVYA 3TM4A 2MR5A 2HQSA 4TXLA 1Z0KA 1PSWA 3EGIA 4H7IA 5ERGB 2CNWD 3F9RA 4KQ1A 1ZQ1A 1SHJA 1XCBA 5K4GA 3GLHE 3WV5A 1MC5A 1V6SA 4MJLA 5CH8A 4E70A 3ZI4A 2FUEA 4XXHA 2QHXA 5M04A 3DAGA 5CX4A 5B1HA 1FP4A 5B58C 1M9NA 5FWYB 4FMBB 5E0OA 5BVHB 1ENPA 5KYTA 4I0WB 2B8JA 2RHRA 3EMVA 2ZBVA 4MQ4A 2C5EA 4IINA 2BUAA 1KZHA 1BKYA 4MPDA 1A1SA 1FL9A 2O3SA 4IRMA 1OF1A 1TT5A 1WOYA 2SICE 3F6RA 3T1HB 1EX9A 1HYEA 1HZZA 1VB5A 2WHQA 3ANYB 2PVSA 4KLCA 1Z0UA 1X74A 5HM6A 4TM7A 2EWWA 1KZYC 1Y4DE 4LXTA 5EIAA 3U3RA 2O7RA 3SC6A 1TIBA 3QIAA 1OWNA 1DAIA 4RY0A 1H69A 2VHCA 1W1UA 4JKOA 4XJTA 3ZBTA 3TKYA 4OGFA 1X1CA 3TDKA 1YRQA 2BFDA 1E9AA 4BWFB 5ADWA 1JP7A 3PC8C 4GOKA 4XVHA 3MT9A 4LHEA 4PLCA 621PA 2GAJA 2GPJA 4I2VA 1U3FA 2GJ4A 3BJRA 4D7AA 3EQ2A 4K8RB 3AR8A 4CFZA 3GFQA 2F8SA 3AJEA 3LCJA 1NUQA 1NN3A 3HCCA 2LE0A 1EFRA 1JFFA 3LDUA 2B30A 4NZZA 3RQIA 3RODA 2MYUA 1DBVO 2VQFB 3COPA 1NYRA 1EAYA 2H18A 1DNPA 4IRUB 3ZZMA 5MF6A 4BRUA 3ZGVA 4TZ0A 2JGIA 3RYHA 4I7EA 1XZ8A 4AY3A 2VRCD 4ZOAA 4FLEA 1P7PA 1N3IA 2OORA 4OY3A 2F43A 2HMTA 4Q6BA 4TKUB 3WI7A 1OAOC 4MAMA 3GO4A 5DHQA 2WHRA 4W9NC 3U3XA 3MYYA 3AR6A 2VWQA 2JIDA 2A94A 2BFDB 1SCUB 1XG5A 4EPWA 3H5TA 1G63A 1PL0A 3BMQA 2RB5A 4OYYA 2L82A 4K87A 1EGVB 3CS3A 1ADGA 4PYKA 5LLTA 1CK4A 2I1WA 4R1LA 1BN7A 2WIJA 5C52B 3GPLA 5JVDB 1T4GA 3HB4X 3QBEA 1I2BA 1U2DA 1JFFB 3KT3A 3S28A 1UZMA 2FSIA 3DVAB 2I62A 1MAUA 2GEJA 3E1GA 3NC1C 4KJZA 1KQGA 1R6XA 3HG7A 1Q21A 2HMWA 4XUCA 3M6LA 3RYHB 5KYUB 3GI1A 2VXYA 5CITA 3PR3A 5LU8A 3L1HA 1X0VA 3ZVNA 2VJAA 1ESEA 3SR0A 1OWLA 1MN6A 3AL0C 2AUMA 5HQJA 1T6ZA 4B2IA 4IHJB 4HRYA 1Q1QA 1J20A 1TCBA 2HC9A 2XHZA 1AU9A 3HNOA 3QKUA 4IIJB 5CIYA 2AQIA 3MWGA 4TTVA 1IQPA 2C2ZA 4KGZA 4X85A 4FYMA 1VLJA 4BMNA 1SOMA 3BMQB 5BW5A 4KV9A 4Q9LA 2F62A 1GU0A 2AFIE 3O83A 4IIXA 2P8JA 3BHMA 3A27A 1EVEA 1BFUA 3JV7A 4D2IA 4XE5A 5K0LA 2PMDA 1NNI1 3DVSX 3L05A 2VSYA 5EJFA 3PZBA 4OHMA 5EUCA 3D1JA 3OAAA 3MPUA 5JC8A 4Y2UA 5A2QA 1SEVA 2YR0A 4JT8A 4J91A 4G1FA 2NVOA 5C4IA 2R2GA 3ES9A 1CX9B 2R8OA 4R9SA 2EBWA 5EWLA 3ICVA 1GG8A 1GPAA 2WYOA 2GN9A 3EQ6A 1APBA 3S1AB 1XPRA 1PNRA 4IGIA 1TVKB 3ZDBA 1E3MA 1IN5A 1DC4A 3HVJA 4LDAA 3TYXA 4QTTB 4O29A 1JIVA 3LGXA 1ENOA 1KJJA 3EHDA 1EQUA 3AY6A 3ZTTA 3ED5A 2FDRA 5C1BA 4PTYA 3A3PA 4NICA 4B76A 1FFHA 1RU3A 3T0GA 2JK0A 2Y27A 3PGKA 1A7JA 2JFWA 2JJ1D 1WTAA 2PX2A 3K96A 2VTKA 4FMPA 4IGEA 3SU8A 1GSOA 3H11A 1HFEL 5A9TA 4BS9A 2EYQA 4Q01A 5JXJA 1YMUA 3D6HA 1UMBB 2DFTA 3A05A 3DMTA 4DXAA 3VISA 1U7XA 2O3RA 4EG6A 3M5WA 1YK1A 3B51X 1QIHA 2G83A 1O89A 2LZ0A 2Q99A 3EA0A 4P5PA 2EKLA 3CN7A 5AKEA 4D43A 3DKRA 3HCOA 2HXGA 1WUKS 3ND7A 3VZQA 4BDTA 4RTKA 4X63A 2C7GA 3GPIA 5EWLB 1T2UA 2ZTUA 3CWCA 2CSXA 2D2XA 4GOOD 1GILA 2YIJA 1KVRA 4OQEA 4LRQA 4LRWA 4P31A 4LTMA 2D4AA 2HK6A 4W5JA 1W88B 2J9XB 2ASEA 5LYYA 1PDVA 4NBTA 3V7FA 1JYFA 4N18A 9MHTA 1T9KA 2WUFA 4YACA 5M2QA 2HF9A 2WKWA 2ZE6A 3DH0A 1YRHA 4JEMA 3SIPA 1JQDA 3MAJA 4IJ6A 4RVCA 4YCNA 1J8MF 5H0IA 3RWOA 1QHHA 2G6BA 2REOA 1DX4A 1M7BA 1FP1D 2VJMB 3GMTA 4ND4A 3IUJA 1FTNA 3BCSA 3O2NA 2QPAA 1GPLA 1QIGA 3K3PA 1LTHR 4F7WA 1YKGA 2GPWA 4ED9A 2CVOA 1JR3A 4K0RA 1NLFA 3ZWWA 3ENNA 3H2IA 1OFHA 1Z3IX 3D5TA 2IZ7A 4HMOA 4QZVA 1JH9A 4EIWA 5DPMA 2XCSB 1R37A 3I1JA 3F98A 3NVMB 1WD5A 3P27A 3HR4A 1KYXA 4OEHA 5ENVA 1ZD5A 5EJAA 4ZJUA 2VDOB 1MX1A 3LT4A 4YFYA 1W75A 2VF5X 2VJNA 3RT9A 4YJ3F 5I9LA 2IS1A 1J8QA 2PGJA 5HE9A 1X1EA 1DS6A 4TMVA 2EZ9A 2Q3CA 5J1TB 3ZD8A 3LYHA 4QUJA 3P52A 3D3JA 1WUTA 3NWJA 5JS2A 4DKXA 1Y5LA 1QHHB 5IEBA 5EEGA 4A8HA 5JWOA 4C29A 1YR8A 3U5TA 2AR7A 4DFDA 3ZQ4A 5J4HA 4QJBA 2L0XA 1EU1A 5FV4A 2WWYA 2HWWA 4EGJA 2RIRA 3ZV3A 3PR2B 1BHJA 4BKQA 3M9XA 5L95A 2HNAA 2ZOSA 1OROA 3VHLB 3CZ4A 1XBTA 5U4QA 5F4BA 1LQ2A 2G17A 3GFVA 3A6PC 1PQWA 3OPYI 4XASA 2SECE 1O0BA 1N2CE 1OPRA 1P4JA 3E81A 4BL5A 4CIAA 3H2GA 3NO4A 2FN8A 4H2DA 4BN5A 3DLCA 3AXTA 4DYVA 4E33A 1IN1A 1FPMA 3SHOA 1Q20A 1X39A 3OZEA 1N8TA 2GFIA 2H11A 5EFZA 4MDFA 4RACA 1EFPB 3HXMA 4DQUA 1U3UA 4F8JA 1F0YA 4FEGA 2W7TA 3OZTA 3GLRA 1UXJA 4NDAA 3SSNA 3TOVA 4F9GA 1XMSA 2PD3A 3QX9A 5AKJA 1VHDA 3LUFA 5L45A 1RMYA 3IE2A 3WAGA 2P9TA 3OSZA 5BPFA 1Y8QA 1QK4A 1RVV1 1VFPA 2C4VA 2I0FA 3IJ5A 5FOUA 4QTUB 3C4VA 5BNIA 1DE0A 1UADA 3RRMA 1JA9A 2J3KA 2OORC 1N25A 2C00A 1QCZA 4IJMA 4OQQA 1VXRA 3NTXA 4LGVA 3U40A 4YHBA 3UMYA 1F9AA 1BOOA 3IOEA 4BYMA 1BJKA 1RZ3A 5ALHA 4C0BA 3OU2A 3BQMB 1JWAB 3PQ8A 1CNEA 4DV3B 1YQDA 4C2BA 1Z88A 3VU1A 1TQHA 2XZDA 5KNBH 4ZCTA 5B6JA 1M1ZA 4D5GA 1NUTA 2OG2A 1KQFA 1NR1A 3PKZA 4TPKA 1GTZA 4YJGB 1GU1A 5HUHA 1VMDA 2TECE 3EXIA 1SK9A 4EFNA 3PHGA 3I9NA 2D0IA 2FR8C 3ORSA 4OD0A 4J0EA 1KY5A 2PMBA 1H4TA 3O4VA 4NHEA 4BZQA 1ESNA 2VPQA 2C2MA 2WWIA 4WOCA 4YMGA 5L51A 1AGYA 3IVGA 1XJQA 4IJQA 3VPDA 4BV8A 1Y8QB 2X13A 1QYWA 5HZHA 4PPQA 5TGDA 3FETA 3WJ7A 1C0EA 3P4XA 1ECFA 4WFJA 3M82A 4BXOA 2R4TA 1TK2A 1FYWA 4TLEA 2FLKA 5IFLA 2NUTB 3ETJA 4H7HA 3NRBA 3TIFA 3VKUA 2IZOA 3GRUA 3FUXA 4EHIA 5EIXA 1JKJA 2DT8A 1NPTO 3ZWBA 5KTOA 2BGUA 1Z17A 2YIVX 3EZXA 2O19A 2V7QD 1AQNA 4BQSA 1GARA 4ZCIA 1N36B 2PPVA 1QWOA 3ASYA 3LBHA 1QGUA 3EXIB 4WEOA 3CG0A 4IFBA 5A4FS 2GD6A 1CUIA 3BWEA 1HORA 1OXSC 4PC1A 1ZCBA 3WRXC 3A37A 4H3KB 3D6UA 1K8XB 6AT1A 4KE9A 4ENSA 1OSNA 3NFRA 2I1VB 2WT8A 1NN0A 4BE4A 1WCWA 4MUMA 1B6TA 3PDJA 2EZUA 4NCXA 9GPBA 4KREA 5L3SB 4Q9KA 3LLSA 3HLYA 2ACEA 3WFZA 2EIHA 1JL3A 2NW6A 3DGEC 3DBIA 3PDHA 4PQEA 4ZQBA 2IH4A 2DLDA 2LV8A 4CR7A 4PF1A 4MA0A 1O94D 1L5YA 1JIIA 1ZNWA 2CXUA 2YW9A 1JKJB 3G9TA 3LPAA 1YQUA 3UUGA 1A0OA 1XFAA 1U8TA 3KYIB 3ZWVA 2VEOA 3F78A 2ZBRA 3COJA 1MQ8B 1KBZA 2JFGA 5K01A 3CU5A 3ON5A 3C5VA 2LKCA 4ACBA 5MFZA 5TARA 4EB8A 3CGGA 1ZXLA 2IHJA 1JBQA 2ATIA 4BHTA 1H2FA 3INGA 4LTDA 2JLXA 4JBGA 1P0IA 4MPJA 4WUVA 5C8DA 1JEDA 5EHGA 2E21A 2OK7A 4COOA 2OFOA 1E2IA 3AU8A 1VPDA 4KQ9A 4JROA 5K3SA 3IEKA 4O2AA 3QITA 1H85A 2XMPA 5B37A 5FWXA 5LUAA 3TMAA 3W9YA 2JVKA 5DSZA 4CM4A 2R7AA 4D46A 4QEKA 1ZD8A 3SM3A 2GASA 5TQ0A 1Z4OA 4MROA 3H1BA 3P9ZA 4II3A 4RIFA 5FIUA 1M8GA 2C98A 4MI3A 4PZYA 4RKFA 5D87A 4A3SA 1XVLA 3O4JA 1EVYA 4M0PA 1LPBB 5JDIA 3G5MA 4W4TA 1M66A 4YC7A 4KAXA 5K1ZA 1WCIA 4OYHA 4AZ0B 5AJUA 3W5DA 4Y8VA 2WWVD 1GLVA 2EATA 2L17A 3D2AA 2JD1A 1CLEA 3FNQA 1MJNA 4GLLA 4ESOA 3C98A 4BMOB 2QE7A 2GFHA 5D00A 4C08A 5LP6C 5HBGA 4UOZA 2IHTA 3VZPA 3QKIA 4JP8A 4AJPA 1JHXA 3AIKA 2VDLB 4E7OA 1I51A 1KH1A 1MB0A 1XQXA 3FIUA 1LQUA 4IFEA 1RD4A 4AURA 2YMPA 4E22A 2WTEA 1N6IA 1WQ3A 2RGXA 3OLYA 2WKSA 1NC3A 1CEYA 3U7QA 4BVKA 1V7CA 1XEAA 2CD9A 3ZN2A 1JQEA 4R1PA 3N2KA 4FB4A 1QH1A 3DPSA 4BQOA 3FAZA 3DL2A 3GLFA 3E9RA 2GPAA 3UQYS 4FFBB 5BSMA 4C6RA 4EKDA 3ECAA 3NHLA 3JQBC 5FL7A 4ZI3A 2ZRNA 2GM9A 3FTNA 3FAKA 1N5KA 4MVXA 4RCVA 4R7GA 1WCIB 4EH1A 4Z8XA 2XADA 4HGYA 4GXNA 4NCBA 4FT4A 5F76A 3THWA 2JGMA 3PHBE 2WAYA 1P81A 4QREA 1A2OA 1NXPA 1Y7LA 2NQTA 2ZJ4A 3K9LA 3NHKA 2MSDB 1BQ3A 4KXLA 1Z0ZA 1NG9A 2R66A 2X8WA 3MBIA 3U4DA 1VKRA 1QCCA 1VLZA 2WJPA 1SMKA 1XHLA 5AOCA 5D01A 2BI7A 3CSSA 4DANA 5ESWA 2OENG 3RYCB 2WC1A 3P9KA 1G3UA 2YXNA 3GXOA 1OJ7A 1MH1A 1WQ4A 4ZGBA 4NBRA 2D74A 3DHVA 3N2KB 2AV6A 4LI3X 4RH0A 4TSRA 4W7IA 4N8DA 1OPXA 1QH1B 4WY5A 3SJAA 4EMSA 5AVSA 4ALNA 3GLFB 2ATVA 3NH9A 1ODIA 3WQRA 2QOEA 1W0CA 1MEOA 4DMFA 2POQX 3NYWA 2ZYTX 3OFSA 5DHUA 2XXJA 5IX8A 2G77B 3KQOA 1J07A 1DI0A 2XE6A 1GGKA 5IH3A 1GLGA 2I6TA 1LVUA 1M83A 2DHCA 1ADJA 2XOKA 4ZTBA 2YNMC 4Z1MA 5F1YA 4YRZA 2F3QA 2XCLA 3ZXSA 3FPFA 1J56A 3M4ZA 1LFAA 2W22A 1OGJA 4X71A 3CKYA 4ENTA 1USKA 2AMYA 2WQ7A 1V45E 4JP5A 4UU7A 3PQ6A 5CTAA 5DTEA 4EMBA 1KDOA 1ZI8A 1TCCA 1ZIOA 2EEPA 2OQRA 2R5FA 2RARA 1QYXA 4OQMA 3UWSA 3P26A 3TAUA 4EL5A 1QJCA 2IV2X 1PW5A 3VPGA 4HO1X 2G1UA 4GGMX 1RI1A 1ZW1A 2OQ2A 2UUCB 4PBTA 2YOGA 4K86A 1HDZA 1M5UA 3N7UA 3O2QB 3BFJA 1JKMA 2GN1A 1V96A 2GI4A 4GKVA 4QU8A 2VYND 1AS2A 4YWJA 4RD3A 1DBIA 2P1RA 4Y7DA 1TMYA 5E6SB 6LDHA 2VJKA 1GXSA 2AK3A 3F4BA 4WRRA 2B61A 5MGBA 1RXVA 4TL6A 3WRWA 2I34A 1RVDA 3N2YA 3BIOA 5CFZA 3GEHA 5L3ZA 5ALKA 3ILSA 4U9HS 2OFFA 1B74A 2R8RA 3WMFA 5C5DA 4GD3Q 2QUZA 3T1NA 5IBCA 1FXUA 4HD8A 2J33A 3LUPA 4MMYB 2VSNA 3L8DA 4PONA 3T3GA 2H5JA 4KPYA 1AT1A 1W0KA 1UAGA 1N0VC 3BKXA 4RV4A 1KAMA 3EFEA 3QA9A 2AFHA 1VOTA 1MVOA 4FMDB 1IL0A 1P19A 4JYCA 4XJXA 1ZYUA 5E1DA 3RC1A 4B81A 2AN4A 2UYYA 4HNUA 3LK7A 2XCTB 1SKYB 5JANA 4FKBA 1EHCA 1FQOA 1N8NA 4NE2A 4IHKA 4YV2A 1V3VA 3SC3A 2OO7A 1M72A 4J16A 1L5HB 1L3CA 3PUVA 5HILA 1I13A 3KKPA 5KDOA 3WSTA 4ZPJA 5AW8A 3BH7A 2Z9BA 2V55B 4M1KA 1O54A 5TVGA 2QVZX 1P9WA 1UBFA 4NF2A 4WI1A 1TUIA 3GMIA 3W34A 1FS5A 1H65A 1FNMA 1UANA 3OBIA 4OQDA 1SO8A 2GGSA 1WWKA 3UXYA 4BLVA 4ZALA 3GAZA 4UBOA 5DTRA 4PLPA 3R8CA 2FETA 1VLHA 4GI7A 2G0AA 3R7LA 4BAZA 4FEAA 3OBBA 3UMJA 2E6UX 4EM6A 4QPCA 4WXMA 1NT2A 1JB9A 2FMKA 3K92A 1HLFA 4KN6A 4JGIA 4TKLA 4EW3A 4ZZ3A 4F91B 4XARA 1TE2A 1ACJA 4GT1A 1YT5A 3C16C 5DI3B 3L40A 1W5EA 3TIXB 3PUHA 2Q5IA 1DEKA 5HQ3A 1F4VA 3DA8A 2C3UA 5E3IA 4F4FA 1LBQA 3MRXA 4UTPA 1IZ0A 3ZE8A 3BZBA 1EFHA 2P5TB 4PXSA 5FL3A 3TTTA 4AIIA 4IMRA 1T0IA 1TM7E 5DNWA 2WSIA 2O8DB 4QPZA 5KJ1A 5B6PA 4AKGA 2GM4A 2J31A 3PXAA 4HQLA 3U60B 4R41A 4GYJA 2CXPA 2PSFA 4G1EB 4JQSA 1YVDA 3HNRA 5DTQA 4CDGA 1F3OA 4PHGA 1NNEA 2LPMA 2R87A 2OG1A 3KOOA 4YI3A 3RVBA 4C5CA 1FLVA 4LZNA 4YAFA 1Y5NA 1MMFB 2CMKA 4NZPA 2P3SA 3IULA 2A0FA 1CUGA 1USWA 4QJ5A 3WL8A 2GN6A 3SVLA 1E2FA 3K70B 3E5HA 3FUTA 1MD9A 2GEVA 2BGWA 2NV2B 2P4QA 5FBQB 1XR3A 3PIRA 3JQFC 1ZJJA 3C8DA 5CT5A 4M83A 5AK0A 5D3KA 3C7KA 3M8KA 4EL0A 1Q1ZA 3TSAA 5C1OA 3U3ZA 1XC7A 2DH5A 5K3FA 4K0KB 4LX8A 2IUSA 5HOQA 3D8RA 5A9SA 1PX2A 4KN8A 2WM8A 3LY5A 4NBVA 2LW7A 3AFGA 4LS3A 4ZGWA 4RM2A 1Y7IA 2PK3A 2GXAA 1T8WA 4FKMA 1B0PA 5EJ9A 3BZWA 1L5OA 4H6PA 3MK31 3N0VA 2BKAA 1CP2A 1X77A 2HADA 2ZIGA 3DV2A 3GAAA 3HYRA 1N92A 1TA0A 1QNLA 4B6QA 4B47A 4NJOA 5JBNA 3U48A 1VE3A 2EJTA 4ETNA 1JEQA 1NN1A 2B4YA 2NZ2A 1M5TA 2DB3A 4KO2S 3JVVA 3IKJA 2GA9A 1T15A 4EI2A 1KZ9A 1IDN1 3ZQKA 3DS8A 2Z09A 2UZ4A 3ZOKA 1NR5A 3HB9A 3D8TA 5EMJA 4QDXA 1Z7YA 5JXWA 1XJ0A 2QMHA 5L4LA 3E23A 4G6ZA 3S99A 3SXJA 1SCNE 4N41A 3UGTA 3QGMA 5K3FB 3LS2A 5HIAA 5A9SB 3D4OA 2G76A 1W48A 1IPEA 1IBCA 2WIBA 4PX3A 2R7LA 4ARUA 1CJCA 2CWWA 3D7NA 1VLLA 2FSSA 1QO0D 2HSJA 1E9RA 4HVCA 4YJDA 5FJIA 3PUWA 4XAQA 1K89A 2O5VA 3H6KA 5ALZA 3T5GA 2QM0A 1DQSA 4OL0A 4BYGA 4F3YA 2IYWA 1JEQB 1TW2A 2VHQA 1N7HA 5DLDA 3R3ZA 5C37A 1VKNA 4KOAA 4N3AA 4K1LA 2JGKA 3RD5A 5AKIA 1UKBA 1ZSYA 3OEHA 4OA8A 5BQPA 5KNBA 4KQFA 3LA6A 1I1QB 1UZAA 1X7DA 1ZL2A 3R3SA 3KJZA 2HJHA 2P9CA 2UYQA 1AZSC 4JEIA 4RKQA 1W5BA 4TOIA 2BCJQ 2NP7A 3W8DA 2XUGA 4B44A 3NBZC 1J97A 4M1ZA 5IM5A 2EP7A 4A03A 3DFKA 4ZDIA 3A28A 4C6TA 4ZCQA 1KMMA 1QAOA 2YXPX 5JQWA 4LNHA 4C7XA 1WMBA 5IAOA 2JFBA 2HQOA 2HU5A 1BMFA 3CT6A 5KU1A 1CDOA 3L4SO 3O9MA 4DB4A 1L7AA 4RTJA 3LX4A 3RJ9A 4IHJF 1E2DA 1C9MA 5K7SA 1IATA 4IIJF 2P8SA 2V9CA 1IZ9A 3WO1A 4OHUA 4MQBA 4AJ4A 3NT5A 1GN8A 4UTXA 3QVSA 3H6HA 3B9QA 2QLNA 3ZJVA 1WETA 1NMEA 1VP9A 3P2IA 2OGSA 1EWVA 2JFZA 5A3QA 4GMKA 3K32A 2HWXA 3HH8A 1Z29A 2QBYA 5DI9A 4XFKA 2FPPA 8ABPA 2RE8A 2OCGA 2HYDA 4XCXA 3T7SA 3NHPA 2UVPA 4C6TB 4YXWA 2ZM6B 2K2QB 4J7CA 2FZKA 1YZKA 2QAIA 3CRMA 2JD2A 2Z8YM 5AXBA 2PSJA 4BNUA 3VH2A 4XTRA 2GRUA 5L7TA 1OLUB 3L84A 1QIFA 3CVXA 2VS1A 4HYEA 4E3WA 4N12A 2Z04A 4J2OA 4D98A 1YRAA 4KXMA 1KHTA 3UJCA 4GP6A 4KP7A 3JD2A 4P32A 5E4FA 2IIBA 1T43A 5DLPA 2AI1A 5I9SA 5KYWA 4IJUA 3ZDQA 1SXJA 3N3BC 1GHTA 4P36A 3ID6C 1BDMA 3VO8A 1HM5A 3ZHCA 3AF6A 3B53X 4IJVA 1JQJC 3AM5A 3EJ6A 4UBIA 4L3OA 4DIOA 3DEJA 4KN9S 1ULUA 2A6PA 2ADOA 2QD2A 2Q0HA 3VR2D 4DWJA 2IY9A 4L4UA 2FFJA 2QBYB 4A36A 1CRLA 3CFYA 3NB0A 2VFAA 4BMDA 2W6ZA 2FPPB 1D6JA 4ESEA 3U7JA 1Q19A 5KSOA 1XZGA 4GKBA 2COKA 5JZVA 3A7EA 1ZC3A 1SUFA 2BFNA 1GTMA 2H08A 3KOMA 2AOXA 4AUMA 3UMRA 1FC0A 4EDHA 4KIFA 1U90A 4ADSG 1EFTA 1NNUA 3JVEA 2WICA 1CDEA 4U2EA 5J63A 4V03A 3A9RA 4XYGA 4TS4A 3WADA 4CQLA 4MKHA 3Q87B 3ZCSA 2B2NA 2TMYA 4NK4A 2O2IA 3PPVA 4RWZA 3U49A 5KYWB 3ISJA 5JMTA 1N6PA 2RHOA 3LQRA 3WWEA 3QBJA 1XWIA 2OAGA 1DAHA 5F21A 5J40A 2NO0A 1GQFA 3CONA 3ZX5A 2QNRA 3CEJA 4NYJQ 2CFTA 3NTQA 3EX7C 2X6RA 5EZSA 2RK6A 4XD2A 4V2IA 3DEIA 4LVUA 5HFAA 5YASA 3JVIA 4FE3A 1HTBA 3L77A 3BH0A 4OF4A 2ZAIA 3NT2A 1GGHA 3FTPA 4D79A 3VFDA 1PV2A 4IFIA 5HWSA 3TLMA 5TMBA 4TXMA 3WGIA 3VKGA 2I4LA 3AUTA 1QH9A 1VJTA 5LR6A 1WKBA 5TNXA 1N5MA 4EGSA 1RQ2A 3K9CA 3F46A 2QW8A 2OBLA 4RQTA 3LZDA 4D9GA 4INPA 2ZBUA 2QZ4A 2XKBA 3HV0A 4YJFA 4JV5B 5I7SA 3QP9A 4FNOA 2K5UA 4YO8A 3LP8A 2G9RA 4YTEA 3T5TA 1BDBA 3UWMA 3R7WA 4Z4FA 2O23A 2VL7A 5C51B 1CB0A 4MPPA 4WKGA 2IUUA 3STTA 5FI1B 4FWBA 3AVOA 1YUBA 3R5KA 4CLRB 3AVWA 4HDRB 4G0PA 1I2AA 4M9RA 4FNAA 2GCOB 4I55A 4ARIA 3MMXA 2A35A 3P19A 1JDBC 1I8TA 1ULZA 4KDRA 2RGWA 3K1JA 4R2WA 3HU3A 1KGSA 1PS0A 4YEDA 5T8KC 4XVCA 1NF2A 4IIBA 3DZCA 1QIKA 2PDAA 1ZVKA 2QU7A 3AX6A 3ABOB 1IXKA 1WVIA 1SXQA 4QTYA 4JLBA 3LXMA 4TWAA 4JBNA 4ALIA 4YROA 4YJFB 5EQJB 5K4AA 1OX6A 4G9EA 2PNJA 4D8XA 2BN4A 1L5NA 1UAAA 2WDZA 4B74A 4MWGA 1EUZA 4PXYA 4YRDA 3QVVA 2H29A 1G5FA 4PNHA 5BOSA 4TMKA 3TZEA 1G21A 1VCNA 4HAXA 4I46A 4PV7A 5I9TA 2I6GA 1XVVA 5EUBA 1JR6A 5FNVA 2DHRA 2ONCA 1EM8A 4X41A 1T25A 1NKTA 4JP3A 2RJOA 1U2SA 2VAMA 4FQ7A 5DEIA 4OB6A 1C7EA 1LBEA 2GZSA 3CLHA 3N2ZB 1WLSA 4I55B 3VAYA 4DBZA 3ETHA 2FEOA 4PG6A 4JBYA 2FUNB 1XK7A 1NI4B 1YCFA 4F9TA 1QRUA 2CNDA 4NECA 2IXGA 4TRJA 3SBEA 2DYKA 1UXOA 1UWKA 3IMCA 3HKCA 3MB5A 4MITA 4AKEA 4OX9Y 3KJNA 4W5TA 3ZXYA 4D8WA 2CV0A 1SC9A 2ZRDA 3SE7A 2FE4A 5J5AA 1PSZA 3E3NA 5JSYA 1HI9A 2Z2KA 3ROTA 2REBA 4HDQB 4REMA 3VRHA 1V25A 4CUZA 1G21B 1GQ2A 1QVAA 1VE6A 3UT6A 3D2LA 5DX0A 4QRIA 5DMXA 1WXEA 5GAJA 4FBMA 2J0VA 3LCMA 4O1MA 5T64A 5IU6A 3FVQA 3VDQA 1KQ3A 4RYLA 3VAZA 3QWBA 4AJLA 1ZCZA 4DDWA 4RANA 4F3KA 4KQCA 1WHTB 4TYWA 3DAPA 3G5LA 1B1AA 2GQ0A 4OTZA 2H4YA 1NULA 2R60A 3UXMA 1YVPA 3TEMA 1MXFA 5K3OA 3A11A 3V4VB 1CULC 4HSEA 4IGKA 3AETA 3DBHB 3EVTA 5CNIA 4ZO7A 4BCDA 4NYIR 1MP0A 1FXWA 4QIHA 3DP9A 1WSWA 2I4MA 3PFIA 5FBKA 1UL1X 2BDTA 1Z2DA 2GF9A 1CY1A 1E96A 3HKEB 4QELA 4GQBA 5CLQA 1S2OA 4DY4A 1GQYA 4R1MA 4XM0A 4BFCA 5BYKA 5MGNA 2MIIA 3UAOA 3OT4A 4WJZA 1NF3A 1NYLA 3OZIA 2GZRA 4HLUA 3GZJA 2JJ2A 4Q1EA 2I03A 4ZIRB 2VUIB 2X9GA 3WLNA 4ARSA 2ZSIA 4B4DA 3C5EA 2MSCB 4ECEA 2Q6TA 3P0EA 4FI3F 4A1FA 4ZI7B 4FZ5A 3R9WA 3CPJB 4QJ4A 3Q98A 3DD1A 1YJ5A 4ICIA 4OK5A 4YAOA 4M54A 3ZCQA 2H1SA 4TLMB 1QHXA 2JFYA 3EAGA 2C9MA 3PHCA 3SKYA 3IQDB 4RTLA 5DW3A 1SXGA 1RPNA 4JR2A 3CV3A 1WV1A 4MRSA 4LXHA 3QF7A 1U4OA 1VJDA 3UW3A 1D2EA 1NSYA 1PD0A 2R86A 3AETB 4U9UA 3TXYA 4YUZA 1JR3D 1X7XA 3OU6A 5ENDA 1GRRA 4CT5A 2VQEB 4GI1A 4I1SA 4MUBA 3O4IA 3UMFA 1SRRA 2Q2WA 1VHJA 2H2HA 3YASA 5K8TA 1J90A 1RAIA 3T41A 4Z4QA 2OXTA 1II8A 1UKYA 3I0ZA 4O4LA 3RUAA 3RTDA 4CCYA 5GJBA 3AW8A 2GTIA 1UK8A 3GP5A 4JNKA 7MHTA 1X7ZA 5CVUA 2FR0A 4NESA 1CBUA 1ZKMA 3W3ZB 3UHOA 3DDCA 4FQ5A 1JE0A 1PWZA 3OTWA 4DUYB 1NUUA 3O3NB 3MGAA 2WG0A 1DMRA 2A0XA 4GDMA 5DF1A 1QP8A 5TS2A 5JJCA 4E13A 4MDEA 3CMCO 4DLNA 1X2EA 3KLPX 2IPAB 3ZU2A 1SD2A 1G3RA 1KJYA 1N9GA 1SOAA 1KWKA 2WMYA 3QKRA 3R0QA 4Q4LA 1C7IA 2RGYA 2LWIA 3OUTA 3BICA 2PCJA 3CLSD 2O2DA 1CR1A 1DJNA 3EIUA 1UPXA 3HEAA 3K5PA 3KB6A 3VU8A 5JIBA 2NP6A 1N78A 3ORQA 2JKZA 4W7HA 4RXMA 3KIPA 5HIKA 2DR2A 1OIVA 1T2DA 1VP3A 3ADCA 1YE5A 2PL5A 5THXA 3IE1A 2AG5A 4LVOA 3G5UA 4UULA 1II8B 4HHEA 4OLFA 2WD9A 2K2WA 3EAFA 4RPIA 5CNKA 3X1XA 1M7HA 1X7ZB 3CUWA 1Z4PX 3NBAA 2Q7OE 3SX2A 4A0GA 1W9MA 1EIZA 2C94A 1GA6A 4X84A 3PQDA 1O6CA 4RTSA 1IZZA 1DJQA 1AV7A 2R6JA 2YJ5A 3N53A 3QFFA 5FAXA 4I19A 5KIAA 1W36B 3KD3A 4HZIA 1LW7A 4O2AF 3AKZA 4FFLA 1DEXA 4XGKA 2HFKA 2GZDA 1IIRA 3WG9A 2JJMA 1Z0JA 3BMXA 1GQRA 4HDMA 4OMDA 2XDAA 2H7XA 4E08A 3VR5A 5AVKA 1AKQA 4LA4A 4RKRA 4ZVTA 1QK3A 4N6NA 2AS0A 3AI3A 1NHGA 4CLHA 1T4BA 1B73A 3BHNA 1IMOA 3BCHA 1KYIA 1S2LA 2AD5A 1XCGB 2GETA 5JS1A 3VPFA 2D2FA 1OWOA 4KSBA 4C0LA 3DW1X 4R81A 3WK5A 3SNKA 2XQVA 1A8PA 3T4UA 1ZK0A 3KPUA 2DULA 1YTUA 1O95A 3KDPA 4LEIA 5ELMA 3DBRA 3TRFA 4L6IA 2VDWA 4PICA 4XYLA 3N86A 3LQYA 1IY1A 2J7PA 4HJXA 5HOEA 1KQOA 4CKYA 1USGA 1ZM7A 4UXHA 4UCQA 5COAA 5DHAA 3SX4A 2J3DA 4HAUA 3B3AA 4L72A 4L0QA 2O2EA 1RQNA 1XOIA 3PU6A 2WJAA 3ZY4A 1HH4A 1QORA 3THSA 4HDMB 5B1EA 2QPTA 2Z2JA 3CUYA 1B8PA 3EXAA 4ITVA 4IHQA 3T3NA 1KQPA 1VMEA 3N8HA 4I9FA 4KNWA 2XNCA 3K71B 2OZEA 2AXPA 1R6VA 4IKOA 4S1TA 4YP7A 5DGXA 5FBVB 1H8EA 5KVVA 4C87A 2V45A 1QHFA 4ERXA 2JLRA 5DXFA 2AJLI 2IITA 4Y0VA 4RS3A 4DCCA 2WVGA 3H0EA 1UQTA 3ZHXA 4E21A 2Z2YA 2N0SA 1AD2A 4I50A 3DBRB 2ZUEA 3IUBA 4AP5A 2HK8A 2XDQA 3MIIA 3NVAA 4WERA 3GRCA 4FYYA 2Y6UA 1TVMA 2JC3A 1Q17A 221PA 2C0QA 3DR3A 4WZBE 1R6TA 2AK2A 1T1IA 4RLHA 2VHVA 2GA8A 3E70C 2A1TR 5A05A 4OVKA 3DAHA 2QW1A 2NVBA 3IT2A 2IYTA 2YWJA 3T9DA 2VHYA 5JDCA 1Z4MA 1MORA 2BFCB 4MUFA 5CA0A 5A1JA 1GAXA 1KMHA 2F48A 2NVUA 3COSA 4L9AA 1DCKA 1DTWA 5KAMA 5FHRA 2IVZA 1LD3A 4JB0A 5IUNC 1LLFA 3Q7RA 5F23A 4BZXA 3M4JA 3RUHA 3V46A 2QSJA 3EE6A 1WUJS 2ZROA 3JYPA 3LHSA 3SQXA 1L6RA 1R0BA 2XQGA 5HJ7A 5ETJA 1S1MA 3KB1A 1OASA 1C7ZA 1Y6RA 3MG9A 3ZY6A 4I50B 4BU0A 2DTDA 4V1CA 2A14A 2QQ0A 2H59A 3I1YA 2XDQB 3RVMA 5J2TB 5FA5A 1TTTA 5F98A 4FZVA 4OJQA 1JSCA 1O97D 4IO1A 1UK6A 4BNIA 3WWYA 1LDBA 3F71A 1GTG1 4NNJA 1Z0IA 1Q12A 2L2QA 4GLFA 1D2NA 5I8PA 1E5TA 1OXXK 2XVAA 4D4IA 2E49A 4FMDF 3SPXA 3HC7A 5T4FA 2VNJA 3BPSA 3WDSA 3ZUPA 3EQZA 3C70A 1TX4B 2QN2A 4MS3A 4DQ0A 5CA0B 2O4CA 4MJ7A 2NVUB 2GJ9A 3A26A 3FNRA 1ENYA 3KT0A 2PKCA 3EJWA 3WHKA 5AW0A 5JRZA 3GQVA 1WQ1R 2E6KA 1YULA 2O2HA 4KMRA 3CNNA 2ZJ7A 1I10A 3JR3A 2ACWA 4DCVA 1GPNA 3IB6A 2CEAA 3DLPX 2OCPA 2XA2A 4MH0R 2DTEA 1JKFA 4V1CB 1TYEB 2QE7D 1G6OA 3ONFA 5KTPA 1G5PA 4KIWA 2A0YA 1QYDA 4D3YA 1P0QA 2ZUFA 4ZVSA 3K35A 3I5YA 1N6RA 4H08A 3U4HA 1CRPA 5B3KA 2AEFA 1VPWA 2ZSBA 3NBXX 1RRVA 2GKGA