5LJ3d

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 14
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3d00
4EMHA 4PJOB 4C8QB 4PJOG 1HK9A 1N9RA 3JB9H 4XU2A 5LJ3j 4JLIA 3QO3A 3RUXA 1LJOA 3SB2A 4DQ2A 4M7DA 3RKXA 3V8KA 5LJ5d 4XQ3A 3EFSA 4M77B 2E1HA 4WF2A 5GAN4 1D3BA 1YCYA 4RCBA 3VU3C 5GMKi 5LJ5f 2K57A 3QUIA 2QTXA 4C92C 5CAIA 1JBMA 2DXUA 5LJ5g 4C92A 3JCMg 4J5YA 4M75B 3RKWA 5GANd 3JCMW 4XU1A 3JB9G 4M7DF 1I8FA 5GAMh 4M7DE 4PNOA 3JCMQ 1U1SA 4M7DB 5GANf 4M7DG 4J6XA 2DTHA 2Y90A 3HFOA 4C8QD 4XTVA 4MMLA 1JRIA 5GAN3 4NL3A 4PJOD 3V7CA 3JB9F 2RD1A 2I2LA 1LOJA 1H641 4M77D 4C92E 3SWNA 4XTWA 1WPYA 4C92B 4J6YA 3M4GA 2E65A 3RESA 4C92G 5GAN6 3BDUA 5LJ3g 4HT8A 4NOYA 3PGGA 2E64A 4XU3A 5GAMj 2EJFA 3BFMA 4XTYA 3JCMd 4M75D 4X9CA 1TH7A 5GAOm 3JB9D 3RERA 4V2SA 2RM4A 2EWNA 4C92F 2FB7A 3JCMf 4PJOE 2YLBA 1B34A 4M7DD 1Y96A 3JCMP 4M78C 3JB9I 2FYKA 4QVCA 1HXDA 2YLCA 4M78A 4NL2A 4OP0A 3JCMX 4HA8A 2RB6A 3RKYA 2DTOA 4EMKA 1I81A 4C92D 3JCMb 5GAOr 4A54A 5LJ3d 4XU0A 5GAN7 1D3BB 3SWNC 4F7UA 5LJ5e 5GAMd 5GMKe 2DJZA 4M7AA 2DVEA 1WNLA 1B34B 5LJ3f 1Y96B 5GAMf 4JRKA 4RCCA 1MGQA 5GAN5 3JCMJ 5GAOl 3QSUA 4M78E 2RA2A 4A53A 5I21A 5GAMg 5GAN8 3FB9A 3L1AA 4J6WA 4JUVA 3FJPA 4M78G 4M78B 5GANe 5GMKm 2VC8A 1M5Q1 2DXTA 1LNXA 2DTIA 3BW1A 5GAOq 4M77A 4N0AA 1M8VA 4F7UG 3JCMc 2DZ9A 2EJ9A 3HFNA 4M78F 4M7AE 3QHSA 5LJ3e 1WQ7A 4M7AB 2DKGA 4XTUA 4M7AG 3SWNB 4EMGA 4EMKC 1KQ2A 5GANj 2JN0A 3JB9J 4JRIA 5GAOp 2EJGA 2VXEA 1KQ1A 2DZCA 2HNIA 2YHTA 3V7RA 5GMKh 5LJ5h 2CGHA 4HT9A 4F7UF 4M75A 3V7SA 1X01A 4XTZA 3AHUA 1I5LA 1BIBA 4C8QG 4X9DA 3HSBA 4M7AF 4M7AC 2DEQA 5GAN2 4M78D 3JCMe 4Y91A 3L2ZA 4M77E 3JCMV 2ZGWA 5GANh 4M77G 5GMKl 4PJOF 4C8QF 4C8QC 2E41A 4PJOC 1N9SA 3BY7A 5LJ5j 4M7AD 4C8QA 4PJOA 2E10A 4M75E 3FIFA 5GMKj 5LJ3h 4EMKB 4M77F 4M77C 4N0AC 4M75G 2VXFA 3V8LA 4QVDA 4F7UE 4F7UB 1I4K1 3INZA 1WQWA 5DY9A 4XTXA 2EAYA 3RIRA 4M75F 4M75C 5GAMe 5GANg 3GIBA 5GAOn 3JCMh 1U1TA 3EFRA 1BIAA 4MMKA 4C8QE 4M7DC 3V8JA
chains in the Genus database with same CATH superfamily
4BUGA 2HQHA 2X4WA 2E4HA 3CCLQ 1Q82R 2OTLA 2RHIA 2LT4A 1X2QA 2KXDA 1OEBA 5GMKi 1YJ9Q 4RTTA 3G6ET 2IPOB 2DXUA 3S6WA 2M1HA 1EZZB 1WA7A 3CBMA 4M7DB 3HFOA 1G83A 2LQWA 5IH2A 1G3SA 2RI2A 2EYWA 2JMAA 3G6EA 2DAQA 2L8DA 1UECA 2R58A 3FDRA 4M75D 2CP6A 2QQBA 3GF5A 1SF9A 1C1AA 2PNIA 1Y96A 2DJQA 4ELZC 1BCMA 4QVCA 1X27A 3S3OA 2CH4W 1X6GA 3J7AF 3JCMb 5A0GA 2CZ7B 2ZPGB 3SWNC 5LJ5e 1HYOA 1F1BB 1TS9A 3JSCA 2RO0A 3M9QA 2A08A 4JRKA 3JCMJ 1ZSGA 1AWOA 3FJPA 3TEEA 3EHQA 7AT1B 1LNXA 2DTIA 1WJQA 2BE9B 1Q82U 2KQWA 2I0NA 2YUPA 4ATOA 1WXBA 4E7SA 2AIRB 3CBPA 3CC2A 1KHCA 2ESWA 2B86A 4KULA 3H41A 4J7IA 2H3JA 3H0HA 3OYGA 4M75E 5CKEA 3E9FA 5GMKj 4DEXA 1VQMT 2K7AA 4BDZA 1EIFA 4F7UB 2VGMA 1I4K1 4X34A 4M75F 1VQ7A 3JCMh 3PIOA 3OQ5A 3CMAQ 4M7DC 2P0PA 2LCLA 1JB0E 1M1KC 2J06A 3CC7Q 2O9SA 3QO3A 4XQ3A 4KBMB 1VQ9T 1VQMA 2AKLA 3MPUB 4KGVB 3R6OA 4DOVA 1Y57A 1UJYA 4JPBW 1M1FA 1X2KA 3C4SA 3E19A 2FL7A 1FYNA 3CPWP 3JB9F 2PU9B 4Z8AA 4F17A 3VJPA 2MI6A 4C92B 3M4GA 3IQLA 1QMCA 1M4ZA 1YJNQ 3OS5A 1BBZA 3TU4K 1JJ2S 1VQ5T 1UHCA 3GPLA 1D09B 1MV0B 2H3EB 1W70A 3EGXA 3A8HB 1GXIE 3RMSA 4OP0A 2MPXC 3CCVA 4EMKA 4ESRA 2EPDA 2MWPA 2QEXT 5GAMd 1PC0A 1B34B 1VQ5A 4J9EA 1IGUA 3EFOA 1UGPB 2NUTB 4RTUA 1XQHA 4RCCA 4D6WA 5GAOl 3G1JA 1YIJT 1RAHB 4KH1B 4QQGA 1M5Q1 5GJWB 4E7HA 4GY5A 3BW1A 4N0AA 4X1VA 1UEBA 4LN2A 3CC4Q 1WLPB 1W2BS 1I0CA 5GANj 3CPWA 4HT9A 1KQ1A 5D6WA 4FYWB 1G3TA 5GMKh 4WCIA 4M75A 1OYXA 1M2VB 1PWTA 3X24B 4FW1A 1YIJA 2LQ8A 4K11A 3CCET 1Q7YU 1PKSA 2BZYA 1M90U 2CZ1B 1S72T 4Y92A 4DBQA 2DD4A 1SSFA 2CP7A 2QA4T 2A28A 3CCEA 4F04B 4C0ZA 2B8AA 5CO7A 4PJOB 1UFFA 2KY9A 4ELYC 4GBQA 3ULRB 3OSVA 4CC3A 5GAN4 2O4XB 3CCRA 1HSQA 3VU3C 3A8OB 1S72A 3OYFA 4C92C 4AFSC 2IIMA 2HSEB 2QA4A 2KMTA 2DL7A 4XTVA 3A1PA 4LDUA 2YRCA 1EX4A 3WVDB 2CYZB 1JO8A 2HKQB 4FSXA 3KBGA 3R6NA 4DA4A 1UE9A 1GRIA 2KVQG 1JEGA 3OYCA 2HL5C 3C95A 3JCMf 4IUUA 2G3RA 2VWFA 1X69A 2BTTA 1MHNA 1WIEA 1RACB 2O31A 2XK0A 1O75A 1VA7A 2E3IA 1IB8A 2PUKB 2L2PA 2K5LA 1YHQT 4M78E 2LZ6B 5KE3A 1GL5A 3A8LB 4PJJA 3QXEB 3QIIA 1M27C 2X4XA 4M78F 1WQ7A 1YI2Q 1Q86C 2OX7A 3DKMA 4OMLA 4IUQA 1YHQA 2LC4A 1MMNA 4JLGA 4AT1B 3S3NA 1IZ6A 3BE3A 2CT4A 2NUPB 1R8OB 1CKAA 1Q81C 3ASKA 4PJOC 2HDAA 1OOTA 2ZPFB 1K76A 4M75G 4QVDA 1OZ2A 1WZOA 3H0FA 2LTOA 5IT9E 3CXCP 1YJWQ 4JJCA 2YWWA 3EFRA 5J3BA 1NEBA 1NM7A 2FPDA 4C8QB 2PQWA 1D0XA 1YFNA 3CCQT 2E1HA 3NFCA 2JT4A 1TWBA 2F1LA 3NTIA 3CD6T 1VQ8A 1AHJB 2NWMA 3A8GB 2XI9A 2IVWA 1RI9A 2ABLA 4J5YA 2YUOA 3JB9G 2W10A 2RJCA 1U1SA 5FLXE 3MP6A 1PKTA 2CREA 4MMLA 2OTJT 4C0DB 4JJDA 1BU1A 1UGQB 3CD6A 4DBRA 1WJSA 2FZCB 3RR6A 2VKNA 2M0OA 3RMQA 1VQOT 2YUNA 4XU3A 4KUIA 3M0RA 3CCJT 1GFDA 5KYXA 1BKBA 2MF2A 1KC8C 1IRXA 1E7OA 3CCST 2JM9A 2FEIA 2OTJA 5CKHA 1PD0A 2PVDB 3CXCA 3VRZA 2RHZA 2YLCA 4M78A 2P0KA 4J9FA 1M1KU 3CC7A 2RB6A 5IN1A 4E2FB 4DEYA 5DM7R 1VQOA 3CCJA 2DBKA 2ZCFB 1RADB 1VIFA 2DXBA 3J80E 4AG2C 5KYYB 4D8KA 2X4YA 4E7KA 4LDWA 5CVIA 3CQTA 1G3YA 1M8VA 3JCMc 3G4SQ 2LQNA 1WXUA 1RAEB 3I55T 1WJRA 2PZ1A 2MIOA 2DZCA 4O6JA 1AZGB 3VKIA 2D1XA 2DL3A 3LYIA 2LX7A 4RG8A 4KRTA 1JJ2P 2JTFA 4C8QC 1RAFB 3I55A 4HKEA 2LQKA 1NLOC 2DF6A 2P0QA 2O88A 1KQSS 2CZ6B 5DY9A 1ABOA 2EGAA 1U1TA 5AYFA 5CKBA 4HXJA 1G2BA 4C0DC 2ZPEB 4IUPA 2E5QA 1W6XA 1D3BA 1KK7A 4LUDA 2QQSA 2O9VA 1OULA 2YDLA 1LCKA 4L5GA 1WHKA 1QLYA 3JCMQ 1FWZA 5DLQE 1MMGA 1QKXA 2CP0A 1T0HA 2RD1A 2WACA 2IG0A 2LVMA 3OW2S 2KK4A 1JJ2A 4PJMA 3PGGA 3JCMd 4V2SA 3I5SA 3RDVA 4ZTJA 4F16A 3EHRA 4XK8E 2GFAA 3RNJA 2LDMA 1UB4A 4FL6A 1OX8A 1Q86R 3HTRA 2JMCA 5IHNA 2KRNA 1Y96B 4OGEA 2WSEE 4ME7A 1N6AA 4M78G 2RF0A 3G7ZA 4AMCA 1E6GA 5D6XA 4QQ6A 2DKGA 2EGEA 3SDZA 2RJFA 2DK3A 3HRUA 3CMET 2MWOA 1TXQA 3HSBA 3FRNA 2FZGB 1RLQC 1I1JA 5GAN2 2MOXA 4RTXA 2JJ9A 4KH0B 1OU8A 1YWPA 3KXTA 1ZA2B 4M7AD 3QYGB 1VQKT 4LUEA 3FJ5A 3UF4A 1PRLC 3MCAB 3CCUQ 3PMIA 2EGCA 1VQPT 3EAEA 1V29B 4N4GA 2RHUA 4O5VA 5C6SA 1X43A 1NEGA 4QW2A 2FZKB 4JLIA 2JTMA 3SB2A 1VQKA 3SFMA 3UATA 3V8KA 4A4EA 4FCYA 2XU8A 1N8RC 1OV3A 3QJYA 1Q86U 5LJ5g 1VQPA 2JNGA 2OTLT 2DD5A 2Y90A 4CI0C 3L2RA 1PSFA 1Q81U 3REAB 1H641 2BZXA 1WPYA 3I56T 4PFOA 1Y71A 2EJFA 5AT1B 2YLBA 4M7DD 3OYIA 5DLOA 5HCKA 4NL2A 2KT8A 2CZ0B 3I56A 2EQIA 3OYDA 2DEUA 2P4TA 3M57A 2D9TA 2XIDA 2W0ZA 3EGXB 3F70A 1G8XA 5GAN5 1FX7A 2RA2A 1IREB 1GCQA 3PE0A 5C0MA 2FRWA 2HEQA 2PUOB 2X51A 3PMTA 3HFNA 3QYHB 1TG0A 1BCOA 3EFOB 5GAOp 3GOXA 5A2QE 1VQNQ 3EG2A 3CBOA 5HY6A 2XG8D 2QTVA 4M7AC 4PLLA 3EG0A 1MV3A 1KC8U 2O2OA 3ZEHA 2M9UA 2LMJA 1X6BA 3CC2T 5FWCA 1WQWA 4RUGA 2GGRA 5GAMe 3DLLA 5IHIA 5HK3A 2C0TA 1K4US 2JS2A 4M7DF 2RI3A 2GCXA 5FU7B 1NJIR 1VQ7T 1AEYA 2LRQA 3M0SA 3G4SA 3META 4A4FA 2KR3A 4BB7A 2XD0A 2J05A 3P8BB 2CP5A 3QWXX 1B07A 1PSEA 2VB6A 1KIKA 1I8FA 3TQ7P 2HMAA 4J6XA 1JRIA 1K9MC 3VS5A 2BE7D 3ME9A 1J3TA 4NS5A 2CDTA 3SWNA 1PNJA 5GAN6 3EG9A 1SSHA 2FPFA 3BFMA 1NBEB 4BY6B 2F5TX 2QDYB 1JQQA 3UDCA 3M0TA 1KQSP 5KYUB 2DL4A 1QVGS 4PK4A 4HCKA 2X35A 3MKDA 1K0SA 2JUFA 4C92D 3MEWA 3LGFA 1WNLA 5LJ3f 3L2VA 3CCVT 5FWBA 3H0IA 2OAUA 3G71Q 3CCMT 2AT1B 3ER0A 3N5BB 2EKHA 4FYXB 1N5ZA 4PLIA 1FMVA 3SEMA 1UUEA 2OJ2A 3JB9J 2V8JA 3OW2P 4F7UF 1JXOA 3TSZA 1I5LA 3CCMA 1WFWA 4AFUC 1WHLA 3JCMV 1OPLA 3LWHA 4OB0B 3J81E 1IHVA 3QZ9B 2E5KA 4KGZB 3JRZA 2HQEA 2J7IA 5FU7C 1KQSA 1N8RR 2EFIA 3KFVA 4J9GA 3INZA 2X9HA 4YTLA 5IXFA 3QDFA 1MNEA 5GAOn 4JJNK 1TOVA 2V1QA 1VQ4Q 4EMGA 1UJ0A 2HD0A 4XU2A 3NTHA 3JB9H 2E12A 4M77B 2EYXA 2GQIA 2JOYA 2K57A 1NLPC 1KD1R 4RTZA 4BY6C 3CCRT 1M9SA 3HP9A 1AWWA 1BI1A 1VQLQ 4PJOD 3OW2A 4FW2A 4TVRA 3S3MA 2I2LA 3DLMA 4XTWA 1ZSZA 2MYSA 4ZN1A 1H3ZA 3NHNA 4ZGEB 2XKOC 1YBYA 1SRMA 1MMDA 2JTEA 1CKBA 4PL6A 3RERA 5FRMA 4IURA 2KRMA 2DVJA 2YSQA 1VQ6T 3SD4A 3JB9I 1HXDA 2EBPA 1VYVA 5L23A 1QVPA 5GAOr 1YNZA 2LJ1A 3FEOA 4F7UA 1PD1A 1N8RU 2RQVA 2R57A 3CCLT 1QVFS 1VQ6A 3L2UA 1QCNA 1W1FA 5GMKm 4HCZA 4M78B 1YJ9T 1TUDA 4A63B 4J7FA 2DX1A 1AZEA 2AHJB 3LW5E 1QWEA 3FC3A 2C0IA 3PNWC 2EJ9A 1E6HA 2WSCE 4IIOA 4OMNA 5LJ3e 1NYGA 1VIEA 1KQ2A 1M3BA 3ZL7C 4J9DA 2JVVA 2J6FA 3CCLA 2DNUA 3QBYA 1BI3A 1WI7A 1OQKA 1QWFA 1YJ9A 5FROA 3MEVA 4JRPA 2A37A 5GANh 4MZTA 4PJOF 1XJWB 1SRLA 2DRMA 3NGPA 5LJ5j 1YWOA 2GQVA 1SEMA 4M77C 4FYVB 5GJVB 2V8IA 3LX7A 3VS6A 4XTXA 2M02A 2MMPA 4CC7A 3PVLA 2BZ8A 3GIBA 1BIAA 1K9MR 1W4SA 2RNAA 1ZUKA 3BDLA 3EGUA 5CIUA 1VOMA 2A3LA 3X25B 3GLXA 2A0FB 3JCMg 1AT1B 3I5RA 3UPUA 2LJ3A 2K79A 4HCCA 2RPNA 1VQ8T 1R0BG 3QPHA 5KYWB 4C8QD 1R77A 4Y28E 5HK0A 1H3HA 2CKKA 2EQMA 1RABB 2DFUA 2R5AA 3KUFA 1ZUUA 2OTLQ 2ZPIB 1YN8A 1PCXA 3OY9A 2ED1A 4M78C 2CP2A 1Y0MA 3M54A 1YITQ 4AFQC 4R56A 9ATCB 1I81A 1ZBXA 3M0UA 4HCBA 2QDLA 2QXFA 5LJ3d 1ZQ1A 2CUBA 3ZBDA 3CMAT 1I07A 2DVEA 4PJLA 4N4IA 3CC7T 3LGLA 4B6MA 4JZ4A 1LPLA 2K6DA 1T3SA 2H8HA 5I21A 2L3RA 3FB9A 3G6EQ 3REBB 4IKFA 2HKNA 3I35A 1K9MU 1N27A 4OMMA 4F7UG 1LVKA 3CMAA 2KXCA 5LJ5h 1GFCA 2RQUA 3E2UA 5D6YA 2RQTA 4XTZA 2D0QB 1G5VA 2X3XD 1SHFA 3JCMe 5KYNA 1C0MA 3MEUA 4LDXA 4AG1C 4C8QF 4CRIA 1YJNT 1ARKA 4OMFB 1BI2A 1H92A 4IUVA 5IXBA 2VXFA 2KEAA 2F2XA 3OS1A 3OS2A 2C06A 2SEMA 2G6FX 3VV0A 1K73R 1UGVA 3RIRA 3CPFA 5CK9A 3V8JA 1YJNA 3EH1A 1HK9A 3MEAA 2K5IA 1LJOA 2ZAEA 1WX6A 1WDXA 1M2OA 1NYFA 3X28B 2DYIA 5M9OA 1KHIA 2J6KA 3CC4T 5GANf 4J9CA 2KT1A 4P5NA 4BACA 2GNCA 1SHGA 2DM1A 2E64A 2F2VA 1Q95G 2QQ9A 2AZSA 3CC4A 4R0KA 4A4KA 1KFZA 4BE0A 5CQXA 4OB2B 1VQMQ 1M1GA 3UA6A 4BI4A 4CC4B 1W2BP 1VQ4A 1D1AA 4RKUE 2YT6A 3RKYA 3QZ5B 4A54A 4M4ZA 4C0FA 1NJIC 5GMKe 1ZUYA 1TTHB 2AZVA 1VQ9Q 1U5SA 1M8MA 2KSSA 2EQKA 2F5KA 5IAYA 2EYQA 1B7TA 2LX9A 2K5FA 4OMOA 3ZFJA 2ATCB 3QHSA 4JDSA 1CSKA 2DXCA 3V7RA 3M4YA 3H8ZA 2GTJA 3HKSA 2QGGA 2RQWA 3HHTB 2CT3A 5CQYA 3JAME 3VS3A 3PIPA 2COWA 1QP3A 2NYSA 1T3LA 4JRQA 1AWXA 1N9SA 1VQ5Q 1XOVA 2DLPA 3OB9A 1D1CA 4DBFA 1W2BA 4FYYB 1NZ9A 2FPEA 2HL3A 4JS5A 2RHXA 4E7JA 1QP2A 2KAFA 2E6ZA 2QEXQ 1H8KA 4MMKA 2QGFB 4ZTFA 2ZPHB 4J9BA 2NLUA 3PT9A 2K9GA 3PVQA 3M59A 3MP8A 2HQXA 1RAAB 4OB3B 5LJ5f 2AKKA 1YIJQ 5CAIA 3GP8A 1WHGA 4XU1A 5KYYA 5FW9A 4IUTA 1YI2T 1WXTA 2MK5A 2DO3A 4FIBA 1U06A 2J6OA 5ECAA 3L2WA 1M3AA 3V7CA 1D0ZA 4UC4A 3M56A 1WGSA 3JV3A 2LCSA 3MHXA 4OF1A 2E65A 3BDUA 2COYA 2VYTA 3M58A 3CCEQ 4XTYA 4B9XA 5GAOm 4ZNXA 1NPPA 2RM4A 2DIGA 2EWNA 1YI2A 1WHHA 1ZX6A 1G3WA 1UHFA 1S72Q 2GBQA 4XAXB 1BI0A 2DE0X 8ATCB 4DBHA 2QA4Q 4HA8A 4PFZA 1Y07A 1YJWT 1NPRA 2SRCA 2O01E 1UGSB 4E47A 2C0OA 1GCQC 2VUBA 5GAMg 1EFNA 1KD1C 4JUVA 1JU5C 2HAXA 2VC8A 1WYXA 1GBQA 2VVKA 2DL8A 1JXMA 1YJWA 2K2VA 4M7AE 3NMZC 4F14A 3GBQA 4XTUA 3OSSC 3AHUA 5EG2A 2OI3A 2EJGA 2VXEA 2YHTA 2HNIA 2QQAA 5IHKA 1K8AC 2KGTA 3V7SA 2DL5A 3QJ6A 1FMWA 1M30A 4M7AF 4C8QG 2PVGB 4FT4A 2BIVA 3MO8A 2E41A 1SG5A 3LLRA 3VS1A 1YITA 3OYAA 4EMKB 4ORZA 5A0DA 4N4HA 1KJWA 3VRYA 2QASA 2JS0A 1OI1A 2MAMA 2QK0A 3NPFA 2RJDA 3TVTA 4L59A 4PFPA 3VYGA 1RLPC 1RL2A 4ZN3A 2DA9A 1ZA1B 1YHQQ 2P4RA 1PM3A 2KYBA 4HVVA 3A98A 4KUDK 3VS2A 2QTXA 3EGDA 4PJNA 3Q1JA 4IIMA 3H6ZA 3VS7A 4M75B 3E9GA 3RKWA 2XHCA 3MP1A 5GANd 4BE2A 4M7DE 3PFSA 4KT0E 3G4ST 4LDVA 1YP5A 4E7LA 4OVAA 3CXCS 4RG2A 2LNHB 1U3OA 2LT1A 2RI5A 3H9NA 2DETA 2DRKA 1NE8A 2DYBA 1UTIA 2HCKA 3JB9D 2F69A 2M16A 2A36A 3JCMP 3OBYA 1D0YA 1VQ8Q 5KCHA 2FYKA 1M3CA 1U8RA 1ZSZB 2RH2A 1BK2A 2X3WD 3M55A 2DTOA 1O9SA 4EDUA 2DBMA 2DJZA 4M7AA 1ZHIA 4BI3A 3CCQQ 3CD6Q 2M0YA 4J6WA 3M0PA 4FM4B 2ZPBB 3OYBA 5FRNA 2A7YA 2RQRA 5GAOq 2QYZA 2DZ9A 1K1ZA 1RAGB 3OYNA 4EMKC 1QW1A 2OTJQ 1MUZA 1K9AA 3HPWA 3UA7A 3P8HA 4LE9A 2ROLA 1VQOQ 2ROTA 4CC2A 3CCJQ 2JXBA 1TU0B 3CCSQ 2YUQA 3VS0A 4D8DA 4N0AC 2CUDA 4OMPA 4F7UE 3TSWA 4MZPA 2QG9B 1IHWA 2HZYA 3TREA 4RTWA 4HVWA 1AVZC 2EW3A 1NJIU 2D8HA 4M75C 1Q7YR 1MNDA 1VQ9A 4BD3A 2VGNA 2EQUA 1M90R 3AT1B 1R0CB 3VUBA 4JS4A 5EC7A 1FMKA 2KROA 4M7DA 1HD3A 1X75C 2KBTA 5LJ5d 2EIFA 2V8KA 3EFSA 1IXDA 3HRTA 1YCYA 1WHJA 1JBMA 2YRVA 1Z9QA 2RJEA 2FG0A 1TSFA 4PKCC 3THKA 3I55Q 2XICA 2CSQA 1ABQA 2V1RA 3EG3A 2JZ2A 2L3QA 2D8JA 1I5OB 4QT7A 4FU6A 1ZSZC 1LOJA 4M77D 4OGCA 4C92E 2BKDN 4J6YA 2YXYA 5LJ3g 4OMQA 4NOYA 4HVUA 1B3QA 2ENMA 1C6VX 3OYHA 2Y4XA 4C92F 2L89A 4GLKA 2D0NA 1ZBJA 4GLMA 4C5GA 1K73C 2QEXA 2LCCA 4C0GA 3CCUT 2E6NA 2L3PA 2R5MA 2X4JA 2DIQA 5GAN7 2LNVA 5I22A 1K8AR 4QKUA 1HJDA 3O5ZA 1MGQA 4EIKA 4A53A 1A0NB 3WVEB 3CCUA 2DXTA 2GTOA 2EQJA 2LJ0A 2DERA 2K2MA 3OYMA 2EVRA 3OA6A 4M7AG 2JN0A 1UDLA 1YCSB 2XDDA 1ZLMA 1TUGB 1X01A 2PVOB 5KYXB 1T0JA 4M78D 2CS7A 3L2ZA 4M77E 2FRYA 4RTYA 4LNPA 2QAZA 2BUDA 4J9IA 2EKOA 4M77F 3VUZA 2NUZA 3L2QA 4C5IA 4J83A 3GNGA 1DJ7B 4J8OA 4KGXB 5KYUA 1TUCA 4PJOE 3X26B 5CR2A 1KD1U 1N9RA 4C5EA 3RKXA 3E1SA 1V1CA 5LL6S 1X6OA 1UGRB 2WSFE 3QUIA 4C92A 5CKDA 1K8AU 2RK1A 2CH4A 4M7DG 4Q5WA 3CMEQ 1VQNT 4Z89A 3X20B 2E70A 1RUWA 3RESA 2XDPA 2KE9A 1PRMC 4RTVA 5GAMj 4LD9K 5I2SA 2M51A 2Y4YA 4WTOB 1VQKQ 1B34A 3OYYA 4JJBA 2NUTA 1VQNA 2Z0WA 2JW4A 3C0CA 1VQPQ 4E7ZA 3OBWA 1KG1A 1D3BB 2YRDA 3QKJA 2K4YA 3VYHB 3C12A 1M1KR 1AOJA 3QSUA 5GAN8 1M2VA 3L1AA 2K3YA 3UT1A 5KCOA 1AWJA 2KRSA 4M77A 5I11A 2HSPA 3M0QA 3URGA 3EH2A 3EG1A 2COZA 1BIBA 1V76A 3A5ZB 3I56Q 2FO0A 2ZGWA 2QI2A 4ZGDB 3HL8A 3OYEA 2DMOA 3OYLA 4PJOA 2JM8A 1VYTA 2HBPA 4ZGJB 2LP5A 2CP3A 1GCPA 1VUBA 3WXMB 3P8DA 2O4XA 4DOWA 6AT1B 3QG1A 5KE2A 2EAYA 4QQDA 1QQJA 2GF7A 3LWIA 3CCQA 4C8QE 4EMHA 3QWYA 1QCOA 4E6RA 4Z02A 3O8VA 4RCBA 3I9QA 3G71T 1Z9ZA 1OPKA 4JZ3A 1QVGP 1KSWA 1WHMA 1RI0A 5GAMh 3OYJA 4PNOA 1BB9A 4NL3A 3OMGA 4AFZC 1NG2A 1Q82C 2K3BA 4Z88A 1IO6A 2P84A 4MDWA 3G71A 4LXCA 4L6V5 3CCSA 1OX9A 1RAIB 4C92G 1ACMB 2PTKA 1QCFA 3CC2Q 2RN8A 4LD6A 3A8MB 5FU6B 2KYMA 2E3HA 2KDSA 1VYUA 3GNFB 3DB3A 4II1A 3JCMX 1OU9A 3M53A 3LH0A 2MCNA 4C5HA 3PTAA 5CKFA 1VQ4T 2EYZA 1VQ7Q 2XMFA 2L0AA 2RHYA 5A0LA 1PHTA 3M5AA 1QVGA 2NUPA 2L3SA 4JRIA 4RMOA 5I2MA 1VQLT 1Y7XA 3OYKA 4X9DA 3CPWS 4OB1B 5KYWA 3NTKA 1PG5B 4M77G 2FHDA 5GMKl 4A4HA 1K73U 1MMAA 4C8QA 2E10A 3FIFA 1VQLA 3V8LA 4EPCA 2VV5A 4A4GA 2HBWA 3CEYA 5GANg 3RBBB 5CCAA 3OS0A 2RMOA 2FVUA 3D7SB 5D7UA 4PJOG 5J39A 5LJ3j 3CCVQ 3RUXA 4DQ2A 5KH6A 2DPPB 4WF2A 3CCMQ 1XNIA 2L5QA 2XDBA 3OMCA 4BE1A 3L42A 3JCMW 3SHWA 2K3XA 3T9NA 2D6FA 1D1BA 2DTHA 4VUBA 5FU6C 5GAN3 2ZZDA 1OZ3A 4FSSA 3EGDB 1QVFP 4HT8A 2KI7A 1AD5A 4X9CA 1TH7A 2CSIA 2QQRA 3C94A 2V26A 1Q81R 2FB7A 2DILA 3UWNA 1QKWA 3VS4A 1Q7YC 1M90C 2RK2A 3HRSA 4XU0A 1SPKA 1FXXA 1SKUB 5GAMf 2EYYA 2F2WA 4LDYA 3TCJA 4ANJA 2AK5A 3QDRB 5GANe 3CMEA 4MZMA 2OAWA 3CCRQ 1S1NA 4M7AB 3SWNB 1XTDA 2ECZA 3EG9B 2CGHA 4MDXA 2GFUA 3U23A 1QVFA 2DEQA 4Y91A 4BI8B 4BDYA 3FLGA 1P92A 3BY7A 2VASA 5L8RE 1GBRA 1VQ6Q 5LJ3h 4QVZA 4J9HA 4B9WA 3DB4A 1KC8R 1UG1A 4E7IA 8AT1B 1IGQA 4FT2A 4R55A 2KNBB 1YITT 2ED0A 5HKCA 1K0XA 3MJXA 1BYMA 5J26A 3LH5A
chains in the Genus database with same CATH topology
4BUGA 5CKBA 1W4SA 3VUBA 4JS4A 2X4WA 4C0DC 4M7DA 2ZPEB 1X75C 2OTLA 2RHIA 2EIFA 4IUPA 5LJ5d 3BDLA 2V8KA 3EFSA 2E5QA 2LT4A 3HRTA 5CIUA 1D3BA 1YCYA 5GMKi 2QQSA 2A3LA 3G6ET 1JBMA 2YRVA 2DXUA 3X25B 3GLXA 3S6WA 3JCMg 3UPUA 4L5GA 2RJEA 2M1HA 4PKCC 4HCCA 2XICA 3JCMQ 1FWZA 1VQ8T 3CBMA 3QPHA 4M7DB 3HFOA 4C8QD 5DLQE 2JZ2A 4Y28E 1G3SA 5HK0A 4FU6A 2RD1A 2RI2A 1LOJA 4M77D 2WACA 2IG0A 2LVMA 4OGCA 4C92E 2BKDN 3OW2S 4E7LA 2CKKA 2KK4A 3G6EA 2DAQA 2L8DA 4J6YA 1JJ2A 2R58A 5LJ3g 3FDRA 4NOYA 3PGGA 2EQMA 3JCMd 4M75D 4V2SA 2QQBA 2R5AA 3GF5A 2Y4XA 3OYHA 4C92F 2L89A 3KUFA 2ZPIB 4GLKA 4ZTJA 1Y96A 3OY9A 4XK8E 4C5GA 1K73C 2GFAA 4M78C 4ELZC 2QEXA 4QVCA 2LDMA 2LCCA 3M54A 4C0GA 3CCUT 1UB4A 4R56A 2E6NA 3S3OA 3J7AF 4FL6A 3JCMb 5A0GA 1I81A 1ZBXA 4HCBA 2R5MA 2CZ7B 2X4JA 2QXFA 2ZPGB 5LJ3d 2DIQA 1ZQ1A 3SWNC 5LJ5e 5GAN7 3ZBDA 3CMAT 3JSCA 2LNVA 2DVEA 2RO0A 1Y96B 4N4IA 3CC7T 3LGLA 3M9QA 4OGEA 4JRKA 1MGQA 2WSEE 3JCMJ 5I21A 4ME7A 4A53A 3G4SA 2L3RA 3FB9A 1N6AA 3FJPA 4M78G 3TEEA 4IKFA 3WVEB 3CCUA 2DXTA 1LNXA 2DTIA 3G7ZA 1K9MU 1N27A 1WJQA 2EQJA 4F7UG 3OYMA 5D6XA 2KQWA 1Q82U 3OA6A 4QQ6A 2DKGA 4ATOA 4M7AG 3CMAA 2JN0A 2RJFA 3SDZA 2DK3A 3HRUA 5LJ5h 2XDDA 3CMET 2MWOA 1X01A 5D6YA 3CBPA 4XTZA 3FRNA 3HSBA 2D0QB 2PVOB 3CC2A 1KHCA 1G5VA 5GAN2 4M78D 3JCMe 2CS7A 3L2ZA 4M77E 4KULA 3MEUA 4J7IA 4LDXA 4C8QF 2H3JA 4CRIA 1YJNT 3KXTA 4OMFB 3G71T 4M7AD 3OYGA 2BUDA 1BI2A 4M75E 3QYGB 3E9FA 4IUVA 2EKOA 4M77F 5CKEA 3VUZA 5GMKj 1VQKT 2VXFA 1VQMT 3L2QA 4BDZA 1EIFA 3OS1A 3MCAB 4C5IA 2VGMA 1I4K1 4J83A 4F7UB 3OS2A 3VV0A 2C06A 3GNGA 4X34A 1DJ7B 4J8OA 3RIRA 3PMIA 4M75F 1VQPT 1VQ7A 3CPFA 1S72A 3EAEA 3JCMh 1V29B 3PIOA 4N4GA 3OQ5A 5CK9A 4PJOE 3X26B 3V8JA 2RHUA 2LCLA 1JB0E 2P0PA 5CR2A 4O5VA 5C6SA 1YJNA 1KD1U 1HK9A 1N9RA 4QW2A 4C5EA 1M1KC 3MEAA 2K5IA 3QO3A 1LJOA 2JTMA 4JLIA 3SB2A 1VQKA 3RKXA 3SFMA 3V8KA 3E1SA 4A4EA 4XQ3A 4KBMB 1VQ9T 2XU8A 5LL6S 1X6OA 3X28B 1VQMA 1UGRB 2WSFE 1N8RC 3QUIA 5M9OA 3QJYA 1Q86U 5LJ5g 3R6OA 4C92A 4DOVA 1KHIA 5CKDA 1VQPA 2JNGA 2OTLT 1K8AU 2RK1A 2DD5A 3CC4T 5GANf 4M7DG 4PJOD 1M1FA 2Y90A 4Q5WA 3C4SA 4P5NA 4CI0C 3E19A 4BACA 3L2RA 2FL7A 1VQNT 3JB9F 1PSFA 2PU9B 1Q81U 1H641 3X20B 2E70A 1WPYA 3VJPA 2MI6A 3RESA 2XDPA 3M4GA 4C92B 3I56T 1M4ZA 1Y71A 2E64A 2EJFA 5GAMj 4LD9K 5I2SA 3OS5A 3TU4K 2QQ9A 1JJ2S 1VQ5T 2Y4YA 3GPLA 3CC4A 4A4KA 2YLBA 4BE0A 1B34A 3OYYA 5CQXA 4OB2B 4M7DD 3OYIA 1M1GA 1VQNA 3A8HB 4BI4A 2D6FA 5DLOA 1GXIE 1VQ4A 3RMSA 4RKUE 4NL2A 4OP0A 3CCVA 2CZ0B 3I56A 3RKYA 4EMKA 3QZ5B 3OBWA 4A54A 1KG1A 3OYDA 1D3BB 2QEXT 2MWPA 3QKJA 4C0FA 5GAMd 2P4TA 3M57A 5GMKe 1NJIC 2K4YA 3VYHB 1VQ5A 1B34B 2D9TA 2XIDA 3C12A 1UGPB 3F70A 1XQHA 4RCCA 5GAN5 4D6WA 3QSUA 5GAOl 1FX7A 2RA2A 2KSSA 1IREB 2EQKA 5GAN8 3L1AA 2F5KA 5C0MA 2K3YA 3UT1A 1YIJT 5KCOA 4QQGA 5IAYA 1M5Q1 4E7HA 2PUOB 2EYQA 4GY5A 3BW1A 2LX9A 3PMTA 4M77A 4N0AA 2K5FA 3ZFJA 1UEBA 3HFNA 3QYHB 3QHSA 1W2BS 4JDSA 5GANj 3URGA 5GAOp 3GOXA 3CPWA 1KQ1A 2DXCA 5D6WA 3V7RA 5A2QE 1G3TA 3M4YA 5GMKh 4HT9A 3CBOA 5HY6A 4M75A 1OYXA 3X24B 2XG8D 3H8ZA 1BIBA 4M7AC 3A5ZB 3HKSA 4PLLA 3HHTB 5CQYA 1YIJA 2LQ8A 3JAME 1KC8U 3PIPA 2ZGWA 2QI2A 3ZEHA 1QP3A 4ZGDB 2M9UA 3HL8A 3CCET 4JRQA 3OYEA 1N9SA 3CC2T 1XOVA 3OB9A 1Q7YU 3OYLA 4PJOA 2HBPA 1M90U 4ZGJB 1W2BA 2CZ1B 1VUBA 3WXMB 1S72T 1NZ9A 3P8DA 2O4XA 4DOWA 3QG1A 4JS5A 1WQWA 2DD4A 2RHXA 5KE2A 2EAYA 4QQDA 4E7JA 1QP2A 5GAMe 2GF7A 2KAFA 1SSFA 3LWIA 3DLLA 2QA4T 2E6ZA 5HK3A 3CCQA 4MMKA 4C8QE 3CCEA 4M7DF 4C0ZA 2B8AA 2RI3A 4EMHA 5CO7A 4PJOB 4ZTFA 2ZPHB 2KY9A 2NLUA 3PT9A 2GCXA 5FU7B 4ELYC 1VQ7T 2LRQA 3OSVA 4Z02A 3M59A 5GAN4 2O4XB 3MP8A 2HQXA 3CCRA 3O8VA 3A8OB 3META 4OB3B 4RCBA 3VU3C 4A4FA 4BB7A 3P8BB 4C92C 5CAIA 5LJ5f 3OYFA 2XD0A 3GP8A 2QA4A 1PSEA 4XU1A 1RI0A 1I8FA 5GAMh 3OYJA 4IUTA 4PNOA 1YI2T 4J6XA 2DO3A 2KMTA 4FIBA 4XTVA 4NL3A 1JRIA 3OMGA 1K9MC 4LDUA 3L2WA 3V7CA 3ME9A 1Q82C 4NS5A 4UC4A 3M56A 1WGSA 3G71A 4MDWA 3SWNA 4L6V5 3MHXA 4OF1A 3WVDB 2CYZB 3CCSA 4C92G 2E65A 5GAN6 4FSXA 3KBGA 3BDUA 2VYTA 3M58A 4DA4A 4XTYA 3BFMA 4B9XA 2KVQG 5GAOm 3OYCA 4BY6B 1NPPA 2RM4A 2F5TX 2QDYB 2DIGA 2EWNA 3C95A 3UDCA 1YI2A 3JCMf 4IUUA 4LD6A 3A8MB 5FU6B 1G3WA 2G3RA 4XAXB 1BI0A 1QVGS 2KDSA 3GNFB 3DB3A 2X35A 4II1A 3JCMX 1MHNA 2JUFA 3M53A 4HA8A 1Y07A 4C92D 1NPRA 3MEWA 1YJWT 2XK0A 1O75A 2O01E 1UGSB 3LGFA 3LH0A 4C5HA 4E47A 3PTAA 5CKFA 1VQ4T 2PUKB 1WNLA 5LJ3f 3L2VA 3CCVT 2K5LA 1YHQT 2OAUA 2VUBA 2RHYA 4M78E 3M5AA 5A0LA 5GAMg 5KE3A 3CCMT 1KD1C 4JUVA 3ER0A 3N5BB 3A8LB 3QXEB 2HAXA 2VC8A 1QVGA 3QIIA 1YJWA 2K2VA 4PLIA 4M7AE 2X4XA 4M78F 1WQ7A 4XTUA 3OSSC 1Q86C 3AHUA 3DKMA 4JRIA 5EG2A 2EJGA 2VXEA 2V8JA 2YHTA 2HNIA 2QQAA 5I2MA 4RMOA 3JB9J 1K8AC 1VQLT 4F7UF 3V7SA 3QJ6A 4IUQA 1YHQA 1Y7XA 4M7AF 1I5LA 3OYKA 4C8QG 2LC4A 4X9DA 2PVGB 3CPWS 3CCMA 4JLGA 4OB1B 4FT4A 1IZ6A 3S3NA 1R8OB 3JCMV 2BIVA 3NTKA 3LWHA 4M77G 4OB0B 3J81E 1Q81C 2FHDA 3MO8A 3ASKA 4A4HA 5GMKl 1K73U 2E41A 4PJOC 3QZ9B 2ZPFB 3JRZA 3LLRA 1YITA 2HQEA 5FU7C 2E10A 4C8QA 3FIFA 3OYAA 1KQSA 4EMKB 1VQLA 4M75G 3V8LA 4EPCA 4QVDA 2EFIA 5A0DA 2VV5A 1OZ2A 4A4GA 3INZA 4N4HA 3CEYA 2LTOA 5IT9E 4YTLA 1OI1A 2MAMA 5GANg 2RJDA 5GAOn 4L59A 4JJNK 3EFRA 3VYGA 5CCAA 5J3BA 3OS0A 4EMGA 2FVUA 4M7DC 1RL2A 4PJOG 4C8QB 4ZN3A 5J39A 2HD0A 4XU2A 3NTHA 5LJ3j 3RUXA 2PQWA 3JB9H 4DQ2A 5KH6A 2E12A 2DPPB 3CCQT 4M77B 2E1HA 4WF2A 3NFCA 2JOYA 3CD6T 3NTIA 4KUDK 1VQ8A 2K57A 1AHJB 1XNIA 2L5QA 2QTXA 2XDBA 3A8GB 3Q1JA 2XI9A 3OMCA 4BE1A 2IVWA 3L42A 4J5YA 3H6ZA 4M75B 3E9GA 3RKWA 2XHCA 3MP1A 4BY6C 5GANd 4BE2A 3JCMW 3JB9G 3CCRT 4M7DE 1M9SA 2K3XA 2RJCA 3HP9A 3PFSA 1U1SA 4KT0E 4LDVA 3MP6A 3T9NA 5FLXE 1BI1A 2DTHA 4VUBA 3G4ST 3OW2A 5FU6C 4MMLA 4OVAA 2ZZDA 5GAN3 3CXCS 4RG2A 2OTJT 4C0DB 1OZ3A 4TVRA 3S3MA 2I2LA 3DLMA 1UGQB 2LT1A 3CD6A 4XTWA 4ZN1A 2RI5A 1H3ZA 1WJSA 4ZGEB 4HT8A 2XKOC 1YBYA 2M0OA 3RMQA 1VQOT 4XU3A 1NE8A 4X9CA 4PL6A 1TH7A 4KUIA 3CCJT 3JB9D 3RERA 5FRMA 1BKBA 2F69A 2M16A 2MF2A 2QQRA 3C94A 2FB7A 4IURA 1KC8C 3CCST 1VQ6T 2OTJA 3JCMP 5CKHA 3SD4A 3OBYA 3UWNA 3JB9I 5KCHA 2FYKA 2PVDB 1HXDA 3CXCA 2RHZA 2YLCA 1U8RA 1Q7YC 4M78A 2P0KA 1M1KU 2RH2A 3CC7A 1M90C 3M55A 2RK2A 2RB6A 2DTOA 1QVPA 5IN1A 5GAOr 1O9SA 4EDUA 3HRSA 3FEOA 4XU0A 5DM7R 1VQOA 4F7UA 1FXXA 1N8RU 3CCJA 2DJZA 4M7AA 2R57A 1ZHIA 2ZCFB 5GAMf 4BI3A 1VIFA 2DXBA 3CCLT 1QVFS 3J80E 1VQ6A 3L2UA 4LDYA 3TCJA 5GMKm 4HCZA 4J6WA 4FM4B 4M78B 2X4YA 3QDRB 5GANe 2ZPBB 3OYBA 4E7KA 4LDWA 5FRNA 4J7FA 2A7YA 5CVIA 3CMEA 4MZMA 2AHJB 3LW5E 5GAOq 1G3YA 3FC3A 3PNWC 1M8VA 3JCMc 2DZ9A 2EJ9A 1YJ9T 5LJ3e 2WSCE 4M7AB 3I55T 3SWNB 1XTDA 1VIEA 1QW1A 1WJRA 4EMKC 3OYNA 1KQ2A 2DZCA 2JVVA 4O6JA 3VKIA 3CCLA 2CGHA 3QBYA 1BI3A 4MDXA 2GFUA 3LYIA 1QVFA 1YJ9A 5FROA 2DEQA 3MEVA 3HPWA 4JRPA 4Y91A 4BI8B 3P8HA 4BDYA 4RG8A 5GANh 4MZTA 2JTFA 3FLGA 4PJOF 4C8QC 1P92A 3BY7A 5L8RE 3I55A 5LJ5j 2GQVA 5LJ3h 4QVZA 4M77C 4N0AC 4B9WA 3DB4A 4HKEA 4F7UE 2LQKA 2V8IA 3LX7A 4MZPA 2P0QA 4E7IA 1KQSS 2CZ6B 4FT2A 4R55A 5DY9A 4XTXA 3TREA 1NJIU 1YITT 2MMPA 4M75C 5HKCA 1VQ9A 3GIBA 4BD3A 1U1TA 2VGNA 2EQUA 1BYMA 1BIAA 5J26A 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMH A;  4PJO B;  4C8Q B;  4PJO G;  1HK9 A;  1N9R A;  3JB9 H;  4XU2 A;  5LJ3 j;  4JLI A;  3QO3 A;  3RUX A;  1LJO A;  3SB2 A;  4DQ2 A;  4M7D A;  3RKX A;  3V8K A;  5LJ5 d;  4XQ3 A;  3EFS A;  4M77 B;  2E1H A;  4WF2 A;  5GAN 4;  1D3B A;  1YCY A;  4RCB A;  3VU3 C;  5GMK i;  5LJ5 f;  2K57 A;  3QUI A;  2QTX A;  4C92 C;  5CAI A;  1JBM A;  2DXU A;  5LJ5 g;  4C92 A;  3JCM g;  4J5Y A;  4M75 B;  3RKW A;  5GAN d;  3JCM W;  4XU1 A;  3JB9 G;  4M7D F;  1I8F A;  5GAM h;  4M7D E;  4PNO A;  3JCM Q;  1U1S A;  4M7D B;  5GAN f;  4M7D G;  4J6X A;  2DTH A;  2Y90 A;  3HFO A;  4C8Q D;  4XTV A;  4MML A;  1JRI A;  5GAN 3;  4NL3 A;  4PJO D;  3V7C A;  3JB9 F;  2RD1 A;  2I2L A;  1LOJ A;  1H64 1;  4M77 D;  4C92 E;  3SWN A;  4XTW A;  1WPY A;  4C92 B;  4J6Y A;  3M4G A;  2E65 A;  3RES A;  4C92 G;  5GAN 6;  3BDU A;  5LJ3 g;  4HT8 A;  4NOY A;  3PGG A;  2E64 A;  4XU3 A;  5GAM j;  2EJF A;  3BFM A;  4XTY A;  3JCM d;  4M75 D;  4X9C A;  1TH7 A;  5GAO m;  3JB9 D;  3RER A;  4V2S A;  2RM4 A;  2EWN A;  4C92 F;  2FB7 A;  3JCM f;  4PJO E;  2YLB A;  1B34 A;  4M7D D;  1Y96 A;  3JCM P;  4M78 C;  3JB9 I;  2FYK A;  4QVC A;  1HXD A;  2YLC A;  4M78 A;  4NL2 A;  4OP0 A;  3JCM X;  4HA8 A;  2RB6 A;  3RKY A;  2DTO A;  4EMK A;  1I81 A;  4C92 D;  3JCM b;  5GAO r;  4A54 A;  5LJ3 d;  4XU0 A;  5GAN 7;  1D3B B;  3SWN C;  4F7U A;  5LJ5 e;  5GAM d;  5GMK e;  2DJZ A;  4M7A A;  2DVE A;  1WNL A;  1B34 B;  5LJ3 f;  1Y96 B;  5GAM f;  4JRK A;  4RCC A;  1MGQ A;  5GAN 5;  3JCM J;  5GAO l;  3QSU A;  4M78 E;  2RA2 A;  4A53 A;  5I21 A;  5GAM g;  5GAN 8;  3FB9 A;  3L1A A;  4J6W A;  4JUV A;  3FJP A;  4M78 G;  4M78 B;  5GAN e;  5GMK m;  2VC8 A;  1M5Q 1;  2DXT A;  1LNX A;  2DTI A;  3BW1 A;  5GAO q;  4M77 A;  4N0A A;  1M8V A;  4F7U G;  3JCM c;  2DZ9 A;  2EJ9 A;  3HFN A;  4M78 F;  4M7A E;  3QHS A;  5LJ3 e;  1WQ7 A;  4M7A B;  2DKG A;  4XTU A;  4M7A G;  3SWN B;  4EMG A;  4EMK C;  1KQ2 A;  5GAN j;  2JN0 A;  3JB9 J;  4JRI A;  5GAO p;  2EJG A;  2VXE A;  1KQ1 A;  2DZC A;  2HNI A;  2YHT A;  3V7R A;  5GMK h;  5LJ5 h;  2CGH A;  4HT9 A;  4F7U F;  4M75 A;  3V7S A;  1X01 A;  4XTZ A;  3AHU A;  1I5L A;  1BIB A;  4C8Q G;  4X9D A;  3HSB A;  4M7A F;  4M7A C;  2DEQ A;  5GAN 2;  4M78 D;  3JCM e;  4Y91 A;  3L2Z A;  4M77 E;  3JCM V;  2ZGW A;  5GAN h;  4M77 G;  5GMK l;  4PJO F;  4C8Q F;  4C8Q C;  2E41 A;  4PJO C;  1N9S A;  3BY7 A;  5LJ5 j;  4M7A D;  4C8Q A;  4PJO A;  2E10 A;  4M75 E;  3FIF A;  5GMK j;  5LJ3 h;  4EMK B;  4M77 F;  4M77 C;  4N0A C;  4M75 G;  2VXF A;  3V8L A;  4QVD A;  4F7U E;  4F7U B;  1I4K 1;  3INZ A;  1WQW A;  5DY9 A;  4XTX A;  2EAY A;  3RIR A;  4M75 F;  4M75 C;  5GAM e;  5GAN g;  3GIB A;  5GAO n;  3JCM h;  1U1T A;  3EFR A;  1BIA A;  4MMK A;  4C8Q E;  4M7D C;  3V8J A; 
#chains in the Genus database with same CATH topology
 4BUG A;  2HQH A;  2X4W A;  2E4H A;  3CCL Q;  1Q82 R;  2OTL A;  2RHI A;  2LT4 A;  1X2Q A;  2KXD A;  1OEB A;  5GMK i;  1YJ9 Q;  4RTT A;  3G6E T;  2IPO B;  2DXU A;  3S6W A;  2M1H A;  1EZZ B;  1WA7 A;  3CBM A;  4M7D B;  3HFO A;  1G83 A;  2LQW A;  5IH2 A;  1G3S A;  2RI2 A;  2EYW A;  2JMA A;  3G6E A;  2DAQ A;  2L8D A;  1UEC A;  2R58 A;  3FDR A;  4M75 D;  2CP6 A;  2QQB A;  3GF5 A;  1SF9 A;  1C1A A;  2PNI A;  1Y96 A;  2DJQ A;  4ELZ C;  1BCM A;  4QVC A;  1X27 A;  3S3O A;  2CH4 W;  1X6G A;  3J7A F;  3JCM b;  5A0G A;  2CZ7 B;  2ZPG B;  3SWN C;  5LJ5 e;  1HYO A;  1F1B B;  1TS9 A;  3JSC A;  2RO0 A;  3M9Q A;  2A08 A;  4JRK A;  3JCM J;  1ZSG A;  1AWO A;  3FJP A;  3TEE A;  3EHQ A;  7AT1 B;  1LNX A;  2DTI A;  1WJQ A;  2BE9 B;  1Q82 U;  2KQW A;  2I0N A;  2YUP A;  4ATO A;  1WXB A;  4E7S A;  2AIR B;  3CBP A;  3CC2 A;  1KHC A;  2ESW A;  2B86 A;  4KUL A;  3H41 A;  4J7I A;  2H3J A;  3H0H A;  3OYG A;  4M75 E;  5CKE A;  3E9F A;  5GMK j;  4DEX A;  1VQM T;  2K7A A;  4BDZ A;  1EIF A;  4F7U B;  2VGM A;  1I4K 1;  4X34 A;  4M75 F;  1VQ7 A;  3JCM h;  3PIO A;  3OQ5 A;  3CMA Q;  4M7D C;  2P0P A;  2LCL A;  1JB0 E;  1M1K C;  2J06 A;  3CC7 Q;  2O9S A;  3QO3 A;  4XQ3 A;  4KBM B;  1VQ9 T;  1VQM A;  2AKL A;  3MPU B;  4KGV B;  3R6O A;  4DOV A;  1Y57 A;  1UJY A;  4JPB W;  1M1F A;  1X2K A;  3C4S A;  3E19 A;  2FL7 A;  1FYN A;  3CPW P;  3JB9 F;  2PU9 B;  4Z8A A;  4F17 A;  3VJP A;  2MI6 A;  4C92 B;  3M4G A;  3IQL A;  1QMC A;  1M4Z A;  1YJN Q;  3OS5 A;  1BBZ A;  3TU4 K;  1JJ2 S;  1VQ5 T;  1UHC A;  3GPL A;  1D09 B;  1MV0 B;  2H3E B;  1W70 A;  3EGX A;  3A8H B;  1GXI E;  3RMS A;  4OP0 A;  2MPX C;  3CCV A;  4EMK A;  4ESR A;  2EPD A;  2MWP A;  2QEX T;  5GAM d;  1PC0 A;  1B34 B;  1VQ5 A;  4J9E A;  1IGU A;  3EFO A;  1UGP B;  2NUT B;  4RTU A;  1XQH A;  4RCC A;  4D6W A;  5GAO l;  3G1J A;  1YIJ T;  1RAH B;  4KH1 B;  4QQG A;  1M5Q 1;  5GJW B;  4E7H A;  4GY5 A;  3BW1 A;  4N0A A;  4X1V A;  1UEB A;  4LN2 A;  3CC4 Q;  1WLP B;  1W2B S;  1I0C A;  5GAN j;  3CPW A;  4HT9 A;  1KQ1 A;  5D6W A;  4FYW B;  1G3T A;  5GMK h;  4WCI A;  4M75 A;  1OYX A;  1M2V B;  1PWT A;  3X24 B;  4FW1 A;  1YIJ A;  2LQ8 A;  4K11 A;  3CCE T;  1Q7Y U;  1PKS A;  2BZY A;  1M90 U;  2CZ1 B;  1S72 T;  4Y92 A;  4DBQ A;  2DD4 A;  1SSF A;  2CP7 A;  2QA4 T;  2A28 A;  3CCE A;  4F04 B;  4C0Z A;  2B8A A;  5CO7 A;  4PJO B;  1UFF A;  2KY9 A;  4ELY C;  4GBQ A;  3ULR B;  3OSV A;  4CC3 A;  5GAN 4;  2O4X B;  3CCR A;  1HSQ A;  3VU3 C;  3A8O B;  1S72 A;  3OYF A;  4C92 C;  4AFS C;  2IIM A;  2HSE B;  2QA4 A;  2KMT A;  2DL7 A;  4XTV A;  3A1P A;  4LDU A;  2YRC A;  1EX4 A;  3WVD B;  2CYZ B;  1JO8 A;  2HKQ B;  4FSX A;  3KBG A;  3R6N A;  4DA4 A;  1UE9 A;  1GRI A;  2KVQ G;  1JEG A;  3OYC A;  2HL5 C;  3C95 A;  3JCM f;  4IUU A;  2G3R A;  2VWF A;  1X69 A;  2BTT A;  1MHN A;  1WIE A;  1RAC B;  2O31 A;  2XK0 A;  1O75 A;  1VA7 A;  2E3I A;  1IB8 A;  2PUK B;  2L2P A;  2K5L A;  1YHQ T;  4M78 E;  2LZ6 B;  5KE3 A;  1GL5 A;  3A8L B;  4PJJ A;  3QXE B;  3QII A;  1M27 C;  2X4X A;  4M78 F;  1WQ7 A;  1YI2 Q;  1Q86 C;  2OX7 A;  3DKM A;  4OML A;  4IUQ A;  1YHQ A;  2LC4 A;  1MMN A;  4JLG A;  4AT1 B;  3S3N A;  1IZ6 A;  3BE3 A;  2CT4 A;  2NUP B;  1R8O B;  1CKA A;  1Q81 C;  3ASK A;  4PJO C;  2HDA A;  1OOT A;  2ZPF B;  1K76 A;  4M75 G;  4QVD A;  1OZ2 A;  1WZO A;  3H0F A;  2LTO A;  5IT9 E;  3CXC P;  1YJW Q;  4JJC A;  2YWW A;  3EFR A;  5J3B A;  1NEB A;  1NM7 A;  2FPD A;  4C8Q B;  2PQW A;  1D0X A;  1YFN A;  3CCQ T;  2E1H A;  3NFC A;  2JT4 A;  1TWB A;  2F1L A;  3NTI A;  3CD6 T;  1VQ8 A;  1AHJ B;  2NWM A;  3A8G B;  2XI9 A;  2IVW A;  1RI9 A;  2ABL A;  4J5Y A;  2YUO A;  3JB9 G;  2W10 A;  2RJC A;  1U1S A;  5FLX E;  3MP6 A;  1PKT A;  2CRE A;  4MML A;  2OTJ T;  4C0D B;  4JJD A;  1BU1 A;  1UGQ B;  3CD6 A;  4DBR A;  1WJS A;  2FZC B;  3RR6 A;  2VKN A;  2M0O A;  3RMQ A;  1VQO T;  2YUN A;  4XU3 A;  4KUI A;  3M0R A;  3CCJ T;  1GFD A;  5KYX A;  1BKB A;  2MF2 A;  1KC8 C;  1IRX A;  1E7O A;  3CCS T;  2JM9 A;  2FEI A;  2OTJ A;  5CKH A;  1PD0 A;  2PVD B;  3CXC A;  3VRZ A;  2RHZ A;  2YLC A;  4M78 A;  2P0K A;  4J9F A;  1M1K U;  3CC7 A;  2RB6 A;  5IN1 A;  4E2F B;  4DEY A;  5DM7 R;  1VQO A;  3CCJ A;  2DBK A;  2ZCF B;  1RAD B;  1VIF A;  2DXB A;  3J80 E;  4AG2 C;  5KYY B;  4D8K A;  2X4Y A;  4E7K A;  4LDW A;  5CVI A;  3CQT A;  1G3Y A;  1M8V A;  3JCM c;  3G4S Q;  2LQN A;  1WXU A;  1RAE B;  3I55 T;  1WJR A;  2PZ1 A;  2MIO A;  2DZC A;  4O6J A;  1AZG B;  3VKI A;  2D1X A;  2DL3 A;  3LYI A;  2LX7 A;  4RG8 A;  4KRT A;  1JJ2 P;  2JTF A;  4C8Q C;  1RAF B;  3I55 A;  4HKE A;  2LQK A;  1NLO C;  2DF6 A;  2P0Q A;  2O88 A;  1KQS S;  2CZ6 B;  5DY9 A;  1ABO A;  2EGA A;  1U1T A;  5AYF A;  5CKB A;  4HXJ A;  1G2B A;  4C0D C;  2ZPE B;  4IUP A;  2E5Q A;  1W6X A;  1D3B A;  1KK7 A;  4LUD A;  2QQS A;  2O9V A;  1OUL A;  2YDL A;  1LCK A;  4L5G A;  1WHK A;  1QLY A;  3JCM Q;  1FWZ A;  5DLQ E;  1MMG A;  1QKX A;  2CP0 A;  1T0H A;  2RD1 A;  2WAC A;  2IG0 A;  2LVM A;  3OW2 S;  2KK4 A;  1JJ2 A;  4PJM A;  3PGG A;  3JCM d;  4V2S A;  3I5S A;  3RDV A;  4ZTJ A;  4F16 A;  3EHR A;  4XK8 E;  2GFA A;  3RNJ A;  2LDM A;  1UB4 A;  4FL6 A;  1OX8 A;  1Q86 R;  3HTR A;  2JMC A;  5IHN A;  2KRN A;  1Y96 B;  4OGE A;  2WSE E;  4ME7 A;  1N6A A;  4M78 G;  2RF0 A;  3G7Z A;  4AMC A;  1E6G A;  5D6X A;  4QQ6 A;  2DKG A;  2EGE A;  3SDZ A;  2RJF A;  2DK3 A;  3HRU A;  3CME T;  2MWO A;  1TXQ A;  3HSB A;  3FRN A;  2FZG B;  1RLQ C;  1I1J A;  5GAN 2;  2MOX A;  4RTX A;  2JJ9 A;  4KH0 B;  1OU8 A;  1YWP A;  3KXT A;  1ZA2 B;  4M7A D;  3QYG B;  1VQK T;  4LUE A;  3FJ5 A;  3UF4 A;  1PRL C;  3MCA B;  3CCU Q;  3PMI A;  2EGC A;  1VQP T;  3EAE A;  1V29 B;  4N4G A;  2RHU A;  4O5V A;  5C6S A;  1X43 A;  1NEG A;  4QW2 A;  2FZK B;  4JLI A;  2JTM A;  3SB2 A;  1VQK A;  3SFM A;  3UAT A;  3V8K A;  4A4E A;  4FCY A;  2XU8 A;  1N8R C;  1OV3 A;  3QJY A;  1Q86 U;  5LJ5 g;  1VQP A;  2JNG A;  2OTL T;  2DD5 A;  2Y90 A;  4CI0 C;  3L2R A;  1PSF A;  1Q81 U;  3REA B;  1H64 1;  2BZX A;  1WPY A;  3I56 T;  4PFO A;  1Y71 A;  2EJF A;  5AT1 B;  2YLB A;  4M7D D;  3OYI A;  5DLO A;  5HCK A;  4NL2 A;  2KT8 A;  2CZ0 B;  3I56 A;  2EQI A;  3OYD A;  2DEU A;  2P4T A;  3M57 A;  2D9T A;  2XID A;  2W0Z A;  3EGX B;  3F70 A;  1G8X A;  5GAN 5;  1FX7 A;  2RA2 A;  1IRE B;  1GCQ A;  3PE0 A;  5C0M A;  2FRW A;  2HEQ A;  2PUO B;  2X51 A;  3PMT A;  3HFN A;  3QYH B;  1TG0 A;  1BCO A;  3EFO B;  5GAO p;  3GOX A;  5A2Q E;  1VQN Q;  3EG2 A;  3CBO A;  5HY6 A;  2XG8 D;  2QTV A;  4M7A C;  4PLL A;  3EG0 A;  1MV3 A;  1KC8 U;  2O2O A;  3ZEH A;  2M9U A;  2LMJ A;  1X6B A;  3CC2 T;  5FWC A;  1WQW A;  4RUG A;  2GGR A;  5GAM e;  3DLL A;  5IHI A;  5HK3 A;  2C0T A;  1K4U S;  2JS2 A;  4M7D F;  2RI3 A;  2GCX A;  5FU7 B;  1NJI R;  1VQ7 T;  1AEY A;  2LRQ A;  3M0S A;  3G4S A;  3MET A;  4A4F A;  2KR3 A;  4BB7 A;  2XD0 A;  2J05 A;  3P8B B;  2CP5 A;  3QWX X;  1B07 A;  1PSE A;  2VB6 A;  1KIK A;  1I8F A;  3TQ7 P;  2HMA A;  4J6X A;  1JRI A;  1K9M C;  3VS5 A;  2BE7 D;  3ME9 A;  1J3T A;  4NS5 A;  2CDT A;  3SWN A;  1PNJ A;  5GAN 6;  3EG9 A;  1SSH A;  2FPF A;  3BFM A;  1NBE B;  4BY6 B;  2F5T X;  2QDY B;  1JQQ A;  3UDC A;  3M0T A;  1KQS P;  5KYU B;  2DL4 A;  1QVG S;  4PK4 A;  4HCK A;  2X35 A;  3MKD A;  1K0S A;  2JUF A;  4C92 D;  3MEW A;  3LGF A;  1WNL A;  5LJ3 f;  3L2V A;  3CCV T;  5FWB A;  3H0I A;  2OAU A;  3G71 Q;  3CCM T;  2AT1 B;  3ER0 A;  3N5B B;  2EKH A;  4FYX B;  1N5Z A;  4PLI A;  1FMV A;  3SEM A;  1UUE A;  2OJ2 A;  3JB9 J;  2V8J A;  3OW2 P;  4F7U F;  1JXO A;  3TSZ A;  1I5L A;  3CCM A;  1WFW A;  4AFU C;  1WHL A;  3JCM V;  1OPL A;  3LWH A;  4OB0 B;  3J81 E;  1IHV A;  3QZ9 B;  2E5K A;  4KGZ B;  3JRZ A;  2HQE A;  2J7I A;  5FU7 C;  1KQS A;  1N8R R;  2EFI A;  3KFV A;  4J9G A;  3INZ A;  2X9H A;  4YTL A;  5IXF A;  3QDF A;  1MNE A;  5GAO n;  4JJN K;  1TOV A;  2V1Q A;  1VQ4 Q;  4EMG A;  1UJ0 A;  2HD0 A;  4XU2 A;  3NTH A;  3JB9 H;  2E12 A;  4M77 B;  2EYX A;  2GQI A;  2JOY A;  2K57 A;  1NLP C;  1KD1 R;  4RTZ A;  4BY6 C;  3CCR T;  1M9S A;  3HP9 A;  1AWW A;  1BI1 A;  1VQL Q;  4PJO D;  3OW2 A;  4FW2 A;  4TVR A;  3S3M A;  2I2L A;  3DLM A;  4XTW A;  1ZSZ A;  2MYS A;  4ZN1 A;  1H3Z A;  3NHN A;  4ZGE B;  2XKO C;  1YBY A;  1SRM A;  1MMD A;  2JTE A;  1CKB A;  4PL6 A;  3RER A;  5FRM A;  4IUR A;  2KRM A;  2DVJ A;  2YSQ A;  1VQ6 T;  3SD4 A;  3JB9 I;  1HXD A;  2EBP A;  1VYV A;  5L23 A;  1QVP A;  5GAO r;  1YNZ A;  2LJ1 A;  3FEO A;  4F7U A;  1PD1 A;  1N8R U;  2RQV A;  2R57 A;  3CCL T;  1QVF S;  1VQ6 A;  3L2U A;  1QCN A;  1W1F A;  5GMK m;  4HCZ A;  4M78 B;  1YJ9 T;  1TUD A;  4A63 B;  4J7F A;  2DX1 A;  1AZE A;  2AHJ B;  3LW5 E;  1QWE A;  3FC3 A;  2C0I A;  3PNW C;  2EJ9 A;  1E6H A;  2WSC E;  4IIO A;  4OMN A;  5LJ3 e;  1NYG A;  1VIE A;  1KQ2 A;  1M3B A;  3ZL7 C;  4J9D A;  2JVV A;  2J6F A;  3CCL A;  2DNU A;  3QBY A;  1BI3 A;  1WI7 A;  1OQK A;  1QWF A;  1YJ9 A;  5FRO A;  3MEV A;  4JRP A;  2A37 A;  5GAN h;  4MZT A;  4PJO F;  1XJW B;  1SRL A;  2DRM A;  3NGP A;  5LJ5 j;  1YWO A;  2GQV A;  1SEM A;  4M77 C;  4FYV B;  5GJV B;  2V8I A;  3LX7 A;  3VS6 A;  4XTX A;  2M02 A;  2MMP A;  4CC7 A;  3PVL A;  2BZ8 A;  3GIB A;  1BIA A;  1K9M R;  1W4S A;  2RNA A;  1ZUK A;  3BDL A;  3EGU A;  5CIU A;  1VOM A;  2A3L A;  3X25 B;  3GLX A;  2A0F B;  3JCM g;  1AT1 B;  3I5R A;  3UPU A;  2LJ3 A;  2K79 A;  4HCC A;  2RPN A;  1VQ8 T;  1R0B G;  3QPH A;  5KYW B;  4C8Q D;  1R77 A;  4Y28 E;  5HK0 A;  1H3H A;  2CKK A;  2EQM A;  1RAB B;  2DFU A;  2R5A A;  3KUF A;  1ZUU A;  2OTL Q;  2ZPI B;  1YN8 A;  1PCX A;  3OY9 A;  2ED1 A;  4M78 C;  2CP2 A;  1Y0M A;  3M54 A;  1YIT Q;  4AFQ C;  4R56 A;  9ATC B;  1I81 A;  1ZBX A;  3M0U A;  4HCB A;  2QDL A;  2QXF A;  5LJ3 d;  1ZQ1 A;  2CUB A;  3ZBD A;  3CMA T;  1I07 A;  2DVE A;  4PJL A;  4N4I A;  3CC7 T;  3LGL A;  4B6M A;  4JZ4 A;  1LPL A;  2K6D A;  1T3S A;  2H8H A;  5I21 A;  2L3R A;  3FB9 A;  3G6E Q;  3REB B;  4IKF A;  2HKN A;  3I35 A;  1K9M U;  1N27 A;  4OMM A;  4F7U G;  1LVK A;  3CMA A;  2KXC A;  5LJ5 h;  1GFC A;  2RQU A;  3E2U A;  5D6Y A;  2RQT A;  4XTZ A;  2D0Q B;  1G5V A;  2X3X D;  1SHF A;  3JCM e;  5KYN A;  1C0M A;  3MEU A;  4LDX A;  4AG1 C;  4C8Q F;  4CRI A;  1YJN T;  1ARK A;  4OMF B;  1BI2 A;  1H92 A;  4IUV A;  5IXB A;  2VXF A;  2KEA A;  2F2X A;  3OS1 A;  3OS2 A;  2C06 A;  2SEM A;  2G6F X;  3VV0 A;  1K73 R;  1UGV A;  3RIR A;  3CPF A;  5CK9 A;  3V8J A;  1YJN A;  3EH1 A;  1HK9 A;  3MEA A;  2K5I A;  1LJO A;  2ZAE A;  1WX6 A;  1WDX A;  1M2O A;  1NYF A;  3X28 B;  2DYI A;  5M9O A;  1KHI A;  2J6K A;  3CC4 T;  5GAN f;  4J9C A;  2KT1 A;  4P5N A;  4BAC A;  2GNC A;  1SHG A;  2DM1 A;  2E64 A;  2F2V A;  1Q95 G;  2QQ9 A;  2AZS A;  3CC4 A;  4R0K A;  4A4K A;  1KFZ A;  4BE0 A;  5CQX A;  4OB2 B;  1VQM Q;  1M1G A;  3UA6 A;  4BI4 A;  4CC4 B;  1W2B P;  1VQ4 A;  1D1A A;  4RKU E;  2YT6 A;  3RKY A;  3QZ5 B;  4A54 A;  4M4Z A;  4C0F A;  1NJI C;  5GMK e;  1ZUY A;  1TTH B;  2AZV A;  1VQ9 Q;  1U5S A;  1M8M A;  2KSS A;  2EQK A;  2F5K A;  5IAY A;  2EYQ A;  1B7T A;  2LX9 A;  2K5F A;  4OMO A;  3ZFJ A;  2ATC B;  3QHS A;  4JDS A;  1CSK A;  2DXC A;  3V7R A;  3M4Y A;  3H8Z A;  2GTJ A;  3HKS A;  2QGG A;  2RQW A;  3HHT B;  2CT3 A;  5CQY A;  3JAM E;  3VS3 A;  3PIP A;  2COW A;  1QP3 A;  2NYS A;  1T3L A;  4JRQ A;  1AWX A;  1N9S A;  1VQ5 Q;  1XOV A;  2DLP A;  3OB9 A;  1D1C A;  4DBF A;  1W2B A;  4FYY B;  1NZ9 A;  2FPE A;  2HL3 A;  4JS5 A;  2RHX A;  4E7J A;  1QP2 A;  2KAF A;  2E6Z A;  2QEX Q;  1H8K A;  4MMK A;  2QGF B;  4ZTF A;  2ZPH B;  4J9B A;  2NLU A;  3PT9 A;  2K9G A;  3PVQ A;  3M59 A;  3MP8 A;  2HQX A;  1RAA B;  4OB3 B;  5LJ5 f;  2AKK A;  1YIJ Q;  5CAI A;  3GP8 A;  1WHG A;  4XU1 A;  5KYY A;  5FW9 A;  4IUT A;  1YI2 T;  1WXT A;  2MK5 A;  2DO3 A;  4FIB A;  1U06 A;  2J6O A;  5ECA A;  3L2W A;  1M3A A;  3V7C A;  1D0Z A;  4UC4 A;  3M56 A;  1WGS A;  3JV3 A;  2LCS A;  3MHX A;  4OF1 A;  2E65 A;  3BDU A;  2COY A;  2VYT A;  3M58 A;  3CCE Q;  4XTY A;  4B9X A;  5GAO m;  4ZNX A;  1NPP A;  2RM4 A;  2DIG A;  2EWN A;  1YI2 A;  1WHH A;  1ZX6 A;  1G3W A;  1UHF A;  1S72 Q;  2GBQ A;  4XAX B;  1BI0 A;  2DE0 X;  8ATC B;  4DBH A;  2QA4 Q;  4HA8 A;  4PFZ A;  1Y07 A;  1YJW T;  1NPR A;  2SRC A;  2O01 E;  1UGS B;  4E47 A;  2C0O A;  1GCQ C;  2VUB A;  5GAM g;  1EFN A;  1KD1 C;  4JUV A;  1JU5 C;  2HAX A;  2VC8 A;  1WYX A;  1GBQ A;  2VVK A;  2DL8 A;  1JXM A;  1YJW A;  2K2V A;  4M7A E;  3NMZ C;  4F14 A;  3GBQ A;  4XTU A;  3OSS C;  3AHU A;  5EG2 A;  2OI3 A;  2EJG A;  2VXE A;  2YHT A;  2HNI A;  2QQA A;  5IHK A;  1K8A C;  2KGT A;  3V7S A;  2DL5 A;  3QJ6 A;  1FMW A;  1M30 A;  4M7A F;  4C8Q G;  2PVG B;  4FT4 A;  2BIV A;  3MO8 A;  2E41 A;  1SG5 A;  3LLR A;  3VS1 A;  1YIT A;  3OYA A;  4EMK B;  4ORZ A;  5A0D A;  4N4H A;  1KJW A;  3VRY A;  2QAS A;  2JS0 A;  1OI1 A;  2MAM A;  2QK0 A;  3NPF A;  2RJD A;  3TVT A;  4L59 A;  4PFP A;  3VYG A;  1RLP C;  1RL2 A;  4ZN3 A;  2DA9 A;  1ZA1 B;  1YHQ Q;  2P4R A;  1PM3 A;  2KYB A;  4HVV A;  3A98 A;  4KUD K;  3VS2 A;  2QTX A;  3EGD A;  4PJN A;  3Q1J A;  4IIM A;  3H6Z A;  3VS7 A;  4M75 B;  3E9G A;  3RKW A;  2XHC A;  3MP1 A;  5GAN d;  4BE2 A;  4M7D E;  3PFS A;  4KT0 E;  3G4S T;  4LDV A;  1YP5 A;  4E7L A;  4OVA A;  3CXC S;  4RG2 A;  2LNH B;  1U3O A;  2LT1 A;  2RI5 A;  3H9N A;  2DET A;  2DRK A;  1NE8 A;  2DYB A;  1UTI A;  2HCK A;  3JB9 D;  2F69 A;  2M16 A;  2A36 A;  3JCM P;  3OBY A;  1D0Y A;  1VQ8 Q;  5KCH A;  2FYK A;  1M3C A;  1U8R A;  1ZSZ B;  2RH2 A;  1BK2 A;  2X3W D;  3M55 A;  2DTO A;  1O9S A;  4EDU A;  2DBM A;  2DJZ A;  4M7A A;  1ZHI A;  4BI3 A;  3CCQ Q;  3CD6 Q;  2M0Y A;  4J6W A;  3M0P A;  4FM4 B;  2ZPB B;  3OYB A;  5FRN A;  2A7Y A;  2RQR A;  5GAO q;  2QYZ A;  2DZ9 A;  1K1Z A;  1RAG B;  3OYN A;  4EMK C;  1QW1 A;  2OTJ Q;  1MUZ A;  1K9A A;  3HPW A;  3UA7 A;  3P8H A;  4LE9 A;  2ROL A;  1VQO Q;  2ROT A;  4CC2 A;  3CCJ Q;  2JXB A;  1TU0 B;  3CCS Q;  2YUQ A;  3VS0 A;  4D8D A;  4N0A C;  2CUD A;  4OMP A;  4F7U E;  3TSW A;  4MZP A;  2QG9 B;  1IHW A;  2HZY A;  3TRE A;  4RTW A;  4HVW A;  1AVZ C;  2EW3 A;  1NJI U;  2D8H A;  4M75 C;  1Q7Y R;  1MND A;  1VQ9 A;  4BD3 A;  2VGN A;  2EQU A;  1M90 R;  3AT1 B;  1R0C B;  3VUB A;  4JS4 A;  5EC7 A;  1FMK A;  2KRO A;  4M7D A;  1HD3 A;  1X75 C;  2KBT A;  5LJ5 d;  2EIF A;  2V8K A;  3EFS A;  1IXD A;  3HRT A;  1YCY A;  1WHJ A;  1JBM A;  2YRV A;  1Z9Q A;  2RJE A;  2FG0 A;  1TSF A;  4PKC C;  3THK A;  3I55 Q;  2XIC A;  2CSQ A;  1ABQ A;  2V1R A;  3EG3 A;  2JZ2 A;  2L3Q A;  2D8J A;  1I5O B;  4QT7 A;  4FU6 A;  1ZSZ C;  1LOJ A;  4M77 D;  4OGC A;  4C92 E;  2BKD N;  4J6Y A;  2YXY A;  5LJ3 g;  4OMQ A;  4NOY A;  4HVU A;  1B3Q A;  2ENM A;  1C6V X;  3OYH A;  2Y4X A;  4C92 F;  2L89 A;  4GLK A;  2D0N A;  1ZBJ A;  4GLM A;  4C5G A;  1K73 C;  2QEX A;  2LCC A;  4C0G A;  3CCU T;  2E6N A;  2L3P A;  2R5M A;  2X4J A;  2DIQ A;  5GAN 7;  2LNV A;  5I22 A;  1K8A R;  4QKU A;  1HJD A;  3O5Z A;  1MGQ A;  4EIK A;  4A53 A;  1A0N B;  3WVE B;  3CCU A;  2DXT A;  2GTO A;  2EQJ A;  2LJ0 A;  2DER A;  2K2M A;  3OYM A;  2EVR A;  3OA6 A;  4M7A G;  2JN0 A;  1UDL A;  1YCS B;  2XDD A;  1ZLM A;  1TUG B;  1X01 A;  2PVO B;  5KYX B;  1T0J A;  4M78 D;  2CS7 A;  3L2Z A;  4M77 E;  2FRY A;  4RTY A;  4LNP A;  2QAZ A;  2BUD A;  4J9I A;  2EKO A;  4M77 F;  3VUZ A;  2NUZ A;  3L2Q A;  4C5I A;  4J83 A;  3GNG A;  1DJ7 B;  4J8O A;  4KGX B;  5KYU A;  1TUC A;  4PJO E;  3X26 B;  5CR2 A;  1KD1 U;  1N9R A;  4C5E A;  3RKX A;  3E1S A;  1V1C A;  5LL6 S;  1X6O A;  1UGR B;  2WSF E;  3QUI A;  4C92 A;  5CKD A;  1K8A U;  2RK1 A;  2CH4 A;  4M7D G;  4Q5W A;  3CME Q;  1VQN T;  4Z89 A;  3X20 B;  2E70 A;  1RUW A;  3RES A;  2XDP A;  2KE9 A;  1PRM C;  4RTV A;  5GAM j;  4LD9 K;  5I2S A;  2M51 A;  2Y4Y A;  4WTO B;  1VQK Q;  1B34 A;  3OYY A;  4JJB A;  2NUT A;  1VQN A;  2Z0W A;  2JW4 A;  3C0C A;  1VQP Q;  4E7Z A;  3OBW A;  1KG1 A;  1D3B B;  2YRD A;  3QKJ A;  2K4Y A;  3VYH B;  3C12 A;  1M1K R;  1AOJ A;  3QSU A;  5GAN 8;  1M2V A;  3L1A A;  2K3Y A;  3UT1 A;  5KCO A;  1AWJ A;  2KRS A;  4M77 A;  5I11 A;  2HSP A;  3M0Q A;  3URG A;  3EH2 A;  3EG1 A;  2COZ A;  1BIB A;  1V76 A;  3A5Z B;  3I56 Q;  2FO0 A;  2ZGW A;  2QI2 A;  4ZGD B;  3HL8 A;  3OYE A;  2DMO A;  3OYL A;  4PJO A;  2JM8 A;  1VYT A;  2HBP A;  4ZGJ B;  2LP5 A;  2CP3 A;  1GCP A;  1VUB A;  3WXM B;  3P8D A;  2O4X A;  4DOW A;  6AT1 B;  3QG1 A;  5KE2 A;  2EAY A;  4QQD A;  1QQJ A;  2GF7 A;  3LWI A;  3CCQ A;  4C8Q E;  4EMH A;  3QWY A;  1QCO A;  4E6R A;  4Z02 A;  3O8V A;  4RCB A;  3I9Q A;  3G71 T;  1Z9Z A;  1OPK A;  4JZ3 A;  1QVG P;  1KSW A;  1WHM A;  1RI0 A;  5GAM h;  3OYJ A;  4PNO A;  1BB9 A;  4NL3 A;  3OMG A;  4AFZ C;  1NG2 A;  1Q82 C;  2K3B A;  4Z88 A;  1IO6 A;  2P84 A;  4MDW A;  3G71 A;  4LXC A;  4L6V 5;  3CCS A;  1OX9 A;  1RAI B;  4C92 G;  1ACM B;  2PTK A;  1QCF A;  3CC2 Q;  2RN8 A;  4LD6 A;  3A8M B;  5FU6 B;  2KYM A;  2E3H A;  2KDS A;  1VYU A;  3GNF B;  3DB3 A;  4II1 A;  3JCM X;  1OU9 A;  3M53 A;  3LH0 A;  2MCN A;  4C5H A;  3PTA A;  5CKF A;  1VQ4 T;  2EYZ A;  1VQ7 Q;  2XMF A;  2L0A A;  2RHY A;  5A0L A;  1PHT A;  3M5A A;  1QVG A;  2NUP A;  2L3S A;  4JRI A;  4RMO A;  5I2M A;  1VQL T;  1Y7X A;  3OYK A;  4X9D A;  3CPW S;  4OB1 B;  5KYW A;  3NTK A;  1PG5 B;  4M77 G;  2FHD A;  5GMK l;  4A4H A;  1K73 U;  1MMA A;  4C8Q A;  2E10 A;  3FIF A;  1VQL A;  3V8L A;  4EPC A;  2VV5 A;  4A4G A;  2HBW A;  3CEY A;  5GAN g;  3RBB B;  5CCA A;  3OS0 A;  2RMO A;  2FVU A;  3D7S B;  5D7U A;  4PJO G;  5J39 A;  5LJ3 j;  3CCV Q;  3RUX A;  4DQ2 A;  5KH6 A;  2DPP B;  4WF2 A;  3CCM Q;  1XNI A;  2L5Q A;  2XDB A;  3OMC A;  4BE1 A;  3L42 A;  3JCM W;  3SHW A;  2K3X A;  3T9N A;  2D6F A;  1D1B A;  2DTH A;  4VUB A;  5FU6 C;  5GAN 3;  2ZZD A;  1OZ3 A;  4FSS A;  3EGD B;  1QVF P;  4HT8 A;  2KI7 A;  1AD5 A;  4X9C A;  1TH7 A;  2CSI A;  2QQR A;  3C94 A;  2V26 A;  1Q81 R;  2FB7 A;  2DIL A;  3UWN A;  1QKW A;  3VS4 A;  1Q7Y C;  1M90 C;  2RK2 A;  3HRS A;  4XU0 A;  1SPK A;  1FXX A;  1SKU B;  5GAM f;  2EYY A;  2F2W A;  4LDY A;  3TCJ A;  4ANJ A;  2AK5 A;  3QDR B;  5GAN e;  3CME A;  4MZM A;  2OAW A;  3CCR Q;  1S1N A;  4M7A B;  3SWN B;  1XTD A;  2ECZ A;  3EG9 B;  2CGH A;  4MDX A;  2GFU A;  3U23 A;  1QVF A;  2DEQ A;  4Y91 A;  4BI8 B;  4BDY A;  3FLG A;  1P92 A;  3BY7 A;  2VAS A;  5L8R E;  1GBR A;  1VQ6 Q;  5LJ3 h;  4QVZ A;  4J9H A;  4B9W A;  3DB4 A;  1KC8 R;  1UG1 A;  4E7I A;  8AT1 B;  1IGQ A;  4FT2 A;  4R55 A;  2KNB B;  1YIT T;  2ED0 A;  5HKC A;  1K0X A;  3MJX A;  1BYM A;  5J26 A;  3LH5 A; 
#chains in the Genus database with same CATH homology
 4BUG A;  5CKB A;  1W4S A;  3VUB A;  4JS4 A;  2X4W A;  4C0D C;  4M7D A;  2ZPE B;  1X75 C;  2OTL A;  2RHI A;  2EIF A;  4IUP A;  5LJ5 d;  3BDL A;  2V8K A;  3EFS A;  2E5Q A;  2LT4 A;  3HRT A;  5CIU A;  1D3B A;  1YCY A;  5GMK i;  2QQS A;  2A3L A;  3G6E T;  1JBM A;  2YRV A;  2DXU A;  3X25 B;  3GLX A;  3S6W A;  3JCM g;  3UPU A;  4L5G A;  2RJE A;  2M1H A;  4PKC C;  4HCC A;  2XIC A;  3JCM Q;  1FWZ A;  1VQ8 T;  3CBM A;  3QPH A;  4M7D B;  3HFO A;  4C8Q D;  5DLQ E;  2JZ2 A;  4Y28 E;  1G3S A;  5HK0 A;  4FU6 A;  2RD1 A;  2RI2 A;  1LOJ A;  4M77 D;  2WAC A;  2IG0 A;  2LVM A;  4OGC A;  4C92 E;  2BKD N;  3OW2 S;  4E7L A;  2CKK A;  2KK4 A;  3G6E A;  2DAQ A;  2L8D A;  4J6Y A;  1JJ2 A;  2R58 A;  5LJ3 g;  3FDR A;  4NOY A;  3PGG A;  2EQM A;  3JCM d;  4M75 D;  4V2S A;  2QQB A;  2R5A A;  3GF5 A;  2Y4X A;  3OYH A;  4C92 F;  2L89 A;  3KUF A;  2ZPI B;  4GLK A;  4ZTJ A;  1Y96 A;  3OY9 A;  4XK8 E;  4C5G A;  1K73 C;  2GFA A;  4M78 C;  4ELZ C;  2QEX A;  4QVC A;  2LDM A;  2LCC A;  3M54 A;  4C0G A;  3CCU T;  1UB4 A;  4R56 A;  2E6N A;  3S3O A;  3J7A F;  4FL6 A;  3JCM b;  5A0G A;  1I81 A;  1ZBX A;  4HCB A;  2R5M A;  2CZ7 B;  2X4J A;  2QXF A;  2ZPG B;  5LJ3 d;  2DIQ A;  1ZQ1 A;  3SWN C;  5LJ5 e;  5GAN 7;  3ZBD A;  3CMA T;  3JSC A;  2LNV A;  2DVE A;  2RO0 A;  1Y96 B;  4N4I A;  3CC7 T;  3LGL A;  3M9Q A;  4OGE A;  4JRK A;  1MGQ A;  2WSE E;  3JCM J;  5I21 A;  4ME7 A;  4A53 A;  3G4S A;  2L3R A;  3FB9 A;  1N6A A;  3FJP A;  4M78 G;  3TEE A;  4IKF A;  3WVE B;  3CCU A;  2DXT A;  1LNX A;  2DTI A;  3G7Z A;  1K9M U;  1N27 A;  1WJQ A;  2EQJ A;  4F7U G;  3OYM A;  5D6X A;  2KQW A;  1Q82 U;  3OA6 A;  4QQ6 A;  2DKG A;  4ATO A;  4M7A G;  3CMA A;  2JN0 A;  2RJF A;  3SDZ A;  2DK3 A;  3HRU A;  5LJ5 h;  2XDD A;  3CME T;  2MWO A;  1X01 A;  5D6Y A;  3CBP A;  4XTZ A;  3FRN A;  3HSB A;  2D0Q B;  2PVO B;  3CC2 A;  1KHC A;  1G5V A;  5GAN 2;  4M78 D;  3JCM e;  2CS7 A;  3L2Z A;  4M77 E;  4KUL A;  3MEU A;  4J7I A;  4LDX A;  4C8Q F;  2H3J A;  4CRI A;  1YJN T;  3KXT A;  4OMF B;  3G71 T;  4M7A D;  3OYG A;  2BUD A;  1BI2 A;  4M75 E;  3QYG B;  3E9F A;  4IUV A;  2EKO A;  4M77 F;  5CKE A;  3VUZ A;  5GMK j;  1VQK T;  2VXF A;  1VQM T;  3L2Q A;  4BDZ A;  1EIF A;  3OS1 A;  3MCA B;  4C5I A;  2VGM A;  1I4K 1;  4J83 A;  4F7U B;  3OS2 A;  3VV0 A;  2C06 A;  3GNG A;  4X34 A;  1DJ7 B;  4J8O A;  3RIR A;  3PMI A;  4M75 F;  1VQP T;  1VQ7 A;  3CPF A;  1S72 A;  3EAE A;  3JCM h;  1V29 B;  3PIO A;  4N4G A;  3OQ5 A;  5CK9 A;  4PJO E;  3X26 B;  3V8J A;  2RHU A;  2LCL A;  1JB0 E;  2P0P A;  5CR2 A;  4O5V A;  5C6S A;  1YJN A;  1KD1 U;  1HK9 A;  1N9R A;  4QW2 A;  4C5E A;  1M1K C;  3MEA A;  2K5I A;  3QO3 A;  1LJO A;  2JTM A;  4JLI A;  3SB2 A;  1VQK A;  3RKX A;  3SFM A;  3V8K A;  3E1S A;  4A4E A;  4XQ3 A;  4KBM B;  1VQ9 T;  2XU8 A;  5LL6 S;  1X6O A;  3X28 B;  1VQM A;  1UGR B;  2WSF E;  1N8R C;  3QUI A;  5M9O A;  3QJY A;  1Q86 U;  5LJ5 g;  3R6O A;  4C92 A;  4DOV A;  1KHI A;  5CKD A;  1VQP A;  2JNG A;  2OTL T;  1K8A U;  2RK1 A;  2DD5 A;  3CC4 T;  5GAN f;  4M7D G;  4PJO D;  1M1F A;  2Y90 A;  4Q5W A;  3C4S A;  4P5N A;  4CI0 C;  3E19 A;  4BAC A;  3L2R A;  2FL7 A;  1VQN T;  3JB9 F;  1PSF A;  2PU9 B;  1Q81 U;  1H64 1;  3X20 B;  2E70 A;  1WPY A;  3VJP A;  2MI6 A;  3RES A;  2XDP A;  3M4G A;  4C92 B;  3I56 T;  1M4Z A;  1Y71 A;  2E64 A;  2EJF A;  5GAM j;  4LD9 K;  5I2S A;  3OS5 A;  3TU4 K;  2QQ9 A;  1JJ2 S;  1VQ5 T;  2Y4Y A;  3GPL A;  3CC4 A;  4A4K A;  2YLB A;  4BE0 A;  1B34 A;  3OYY A;  5CQX A;  4OB2 B;  4M7D D;  3OYI A;  1M1G A;  1VQN A;  3A8H B;  4BI4 A;  2D6F A;  5DLO A;  1GXI E;  1VQ4 A;  3RMS A;  4RKU E;  4NL2 A;  4OP0 A;  3CCV A;  2CZ0 B;  3I56 A;  3RKY A;  4EMK A;  3QZ5 B;  3OBW A;  4A54 A;  1KG1 A;  3OYD A;  1D3B B;  2QEX T;  2MWP A;  3QKJ A;  4C0F A;  5GAM d;  2P4T A;  3M57 A;  5GMK e;  1NJI C;  2K4Y A;  3VYH B;  1VQ5 A;  1B34 B;  2D9T A;  2XID A;  3C12 A;  1UGP B;  3F70 A;  1XQH A;  4RCC A;  5GAN 5;  4D6W A;  3QSU A;  5GAO l;  1FX7 A;  2RA2 A;  2KSS A;  1IRE B;  2EQK A;  5GAN 8;  3L1A A;  2F5K A;  5C0M A;  2K3Y A;  3UT1 A;  1YIJ T;  5KCO A;  4QQG A;  5IAY A;  1M5Q 1;  4E7H A;  2PUO B;  2EYQ A;  4GY5 A;  3BW1 A;  2LX9 A;  3PMT A;  4M77 A;  4N0A A;  2K5F A;  3ZFJ A;  1UEB A;  3HFN A;  3QYH B;  3QHS A;  1W2B S;  4JDS A;  5GAN j;  3URG A;  5GAO p;  3GOX A;  3CPW A;  1KQ1 A;  2DXC A;  5D6W A;  3V7R A;  5A2Q E;  1G3T A;  3M4Y A;  5GMK h;  4HT9 A;  3CBO A;  5HY6 A;  4M75 A;  1OYX A;  3X24 B;  2XG8 D;  3H8Z A;  1BIB A;  4M7A C;  3A5Z B;  3HKS A;  4PLL A;  3HHT B;  5CQY A;  1YIJ A;  2LQ8 A;  3JAM E;  1KC8 U;  3PIP A;  2ZGW A;  2QI2 A;  3ZEH A;  1QP3 A;  4ZGD B;  2M9U A;  3HL8 A;  3CCE T;  4JRQ A;  3OYE A;  1N9S A;  3CC2 T;  1XOV A;  3OB9 A;  1Q7Y U;  3OYL A;  4PJO A;  2HBP A;  1M90 U;  4ZGJ B;  1W2B A;  2CZ1 B;  1VUB A;  3WXM B;  1S72 T;  1NZ9 A;  3P8D A;  2O4X A;  4DOW A;  3QG1 A;  4JS5 A;  1WQW A;  2DD4 A;  2RHX A;  5KE2 A;  2EAY A;  4QQD A;  4E7J A;  1QP2 A;  5GAM e;  2GF7 A;  2KAF A;  1SSF A;  3LWI A;  3DLL A;  2QA4 T;  2E6Z A;  5HK3 A;  3CCQ A;  4MMK A;  4C8Q E;  3CCE A;  4M7D F;  4C0Z A;  2B8A A;  2RI3 A;  4EMH A;  5CO7 A;  4PJO B;  4ZTF A;  2ZPH B;  2KY9 A;  2NLU A;  3PT9 A;  2GCX A;  5FU7 B;  4ELY C;  1VQ7 T;  2LRQ A;  3OSV A;  4Z02 A;  3M59 A;  5GAN 4;  2O4X B;  3MP8 A;  2HQX A;  3CCR A;  3O8V A;  3A8O B;  3MET A;  4OB3 B;  4RCB A;  3VU3 C;  4A4F A;  4BB7 A;  3P8B B;  4C92 C;  5CAI A;  5LJ5 f;  3OYF A;  2XD0 A;  3GP8 A;  2QA4 A;  1PSE A;  4XU1 A;  1RI0 A;  1I8F A;  5GAM h;  3OYJ A;  4IUT A;  4PNO A;  1YI2 T;  4J6X A;  2DO3 A;  2KMT A;  4FIB A;  4XTV A;  4NL3 A;  1JRI A;  3OMG A;  1K9M C;  4LDU A;  3L2W A;  3V7C A;  3ME9 A;  1Q82 C;  4NS5 A;  4UC4 A;  3M56 A;  1WGS A;  3G71 A;  4MDW A;  3SWN A;  4L6V 5;  3MHX A;  4OF1 A;  3WVD B;  2CYZ B;  3CCS A;  4C92 G;  2E65 A;  5GAN 6;  4FSX A;  3KBG A;  3BDU A;  2VYT A;  3M58 A;  4DA4 A;  4XTY A;  3BFM A;  4B9X A;  2KVQ G;  5GAO m;  3OYC A;  4BY6 B;  1NPP A;  2RM4 A;  2F5T X;  2QDY B;  2DIG A;  2EWN A;  3C95 A;  3UDC A;  1YI2 A;  3JCM f;  4IUU A;  4LD6 A;  3A8M B;  5FU6 B;  1G3W A;  2G3R A;  4XAX B;  1BI0 A;  1QVG S;  2KDS A;  3GNF B;  3DB3 A;  2X35 A;  4II1 A;  3JCM X;  1MHN A;  2JUF A;  3M53 A;  4HA8 A;  1Y07 A;  4C92 D;  1NPR A;  3MEW A;  1YJW T;  2XK0 A;  1O75 A;  2O01 E;  1UGS B;  3LGF A;  3LH0 A;  4C5H A;  4E47 A;  3PTA A;  5CKF A;  1VQ4 T;  2PUK B;  1WNL A;  5LJ3 f;  3L2V A;  3CCV T;  2K5L A;  1YHQ T;  2OAU A;  2VUB A;  2RHY A;  4M78 E;  3M5A A;  5A0L A;  5GAM g;  5KE3 A;  3CCM T;  1KD1 C;  4JUV A;  3ER0 A;  3N5B B;  3A8L B;  3QXE B;  2HAX A;  2VC8 A;  1QVG A;  3QII A;  1YJW A;  2K2V A;  4PLI A;  4M7A E;  2X4X A;  4M78 F;  1WQ7 A;  4XTU A;  3OSS C;  1Q86 C;  3AHU A;  3DKM A;  4JRI A;  5EG2 A;  2EJG A;  2VXE A;  2V8J A;  2YHT A;  2HNI A;  2QQA A;  5I2M A;  4RMO A;  3JB9 J;  1K8A C;  1VQL T;  4F7U F;  3V7S A;  3QJ6 A;  4IUQ A;  1YHQ A;  1Y7X A;  4M7A F;  1I5L A;  3OYK A;  4C8Q G;  2LC4 A;  4X9D A;  2PVG B;  3CPW S;  3CCM A;  4JLG A;  4OB1 B;  4FT4 A;  1IZ6 A;  3S3N A;  1R8O B;  3JCM V;  2BIV A;  3NTK A;  3LWH A;  4M77 G;  4OB0 B;  3J81 E;  1Q81 C;  2FHD A;  3MO8 A;  3ASK A;  4A4H A;  5GMK l;  1K73 U;  2E41 A;  4PJO C;  3QZ9 B;  2ZPF B;  3JRZ A;  3LLR A;  1YIT A;  2HQE A;  5FU7 C;  2E10 A;  4C8Q A;  3FIF A;  3OYA A;  1KQS A;  4EMK B;  1VQL A;  4M75 G;  3V8L A;  4EPC A;  4QVD A;  2EFI A;  5A0D A;  2VV5 A;  1OZ2 A;  4A4G A;  3INZ A;  4N4H A;  3CEY A;  2LTO A;  5IT9 E;  4YTL A;  1OI1 A;  2MAM A;  5GAN g;  2RJD A;  5GAO n;  4L59 A;  4JJN K;  3EFR A;  3VYG A;  5CCA A;  5J3B A;  3OS0 A;  4EMG A;  2FVU A;  4M7D C;  1RL2 A;  4PJO G;  4C8Q B;  4ZN3 A;  5J39 A;  2HD0 A;  4XU2 A;  3NTH A;  5LJ3 j;  3RUX A;  2PQW A;  3JB9 H;  4DQ2 A;  5KH6 A;  2E12 A;  2DPP B;  3CCQ T;  4M77 B;  2E1H A;  4WF2 A;  3NFC A;  2JOY A;  3CD6 T;  3NTI A;  4KUD K;  1VQ8 A;  2K57 A;  1AHJ B;  1XNI A;  2L5Q A;  2QTX A;  2XDB A;  3A8G B;  3Q1J A;  2XI9 A;  3OMC A;  4BE1 A;  2IVW A;  3L42 A;  4J5Y A;  3H6Z A;  4M75 B;  3E9G A;  3RKW A;  2XHC A;  3MP1 A;  4BY6 C;  5GAN d;  4BE2 A;  3JCM W;  3JB9 G;  3CCR T;  4M7D E;  1M9S A;  2K3X A;  2RJC A;  3HP9 A;  3PFS A;  1U1S A;  4KT0 E;  4LDV A;  3MP6 A;  3T9N A;  5FLX E;  1BI1 A;  2DTH A;  4VUB A;  3G4S T;  3OW2 A;  5FU6 C;  4MML A;  4OVA A;  2ZZD A;  5GAN 3;  3CXC S;  4RG2 A;  2OTJ T;  4C0D B;  1OZ3 A;  4TVR A;  3S3M A;  2I2L A;  3DLM A;  1UGQ B;  2LT1 A;  3CD6 A;  4XTW A;  4ZN1 A;  2RI5 A;  1H3Z A;  1WJS A;  4ZGE B;  4HT8 A;  2XKO C;  1YBY A;  2M0O A;  3RMQ A;  1VQO T;  4XU3 A;  1NE8 A;  4X9C A;  4PL6 A;  1TH7 A;  4KUI A;  3CCJ T;  3JB9 D;  3RER A;  5FRM A;  1BKB A;  2F69 A;  2M16 A;  2MF2 A;  2QQR A;  3C94 A;  2FB7 A;  4IUR A;  1KC8 C;  3CCS T;  1VQ6 T;  2OTJ A;  3JCM P;  5CKH A;  3SD4 A;  3OBY A;  3UWN A;  3JB9 I;  5KCH A;  2FYK A;  2PVD B;  1HXD A;  3CXC A;  2RHZ A;  2YLC A;  1U8R A;  1Q7Y C;  4M78 A;  2P0K A;  1M1K U;  2RH2 A;  3CC7 A;  1M90 C;  3M55 A;  2RK2 A;  2RB6 A;  2DTO A;  1QVP A;  5IN1 A;  5GAO r;  1O9S A;  4EDU A;  3HRS A;  3FEO A;  4XU0 A;  5DM7 R;  1VQO A;  4F7U A;  1FXX A;  1N8R U;  3CCJ A;  2DJZ A;  4M7A A;  2R57 A;  1ZHI A;  2ZCF B;  5GAM f;  4BI3 A;  1VIF A;  2DXB A;  3CCL T;  1QVF S;  3J80 E;  1VQ6 A;  3L2U A;  4LDY A;  3TCJ A;  5GMK m;  4HCZ A;  4J6W A;  4FM4 B;  4M78 B;  2X4Y A;  3QDR B;  5GAN e;  2ZPB B;  3OYB A;  4E7K A;  4LDW A;  5FRN A;  4J7F A;  2A7Y A;  5CVI A;  3CME A;  4MZM A;  2AHJ B;  3LW5 E;  5GAO q;  1G3Y A;  3FC3 A;  3PNW C;  1M8V A;  3JCM c;  2DZ9 A;  2EJ9 A;  1YJ9 T;  5LJ3 e;  2WSC E;  4M7A B;  3I55 T;  3SWN B;  1XTD A;  1VIE A;  1QW1 A;  1WJR A;  4EMK C;  3OYN A;  1KQ2 A;  2DZC A;  2JVV A;  4O6J A;  3VKI A;  3CCL A;  2CGH A;  3QBY A;  1BI3 A;  4MDX A;  2GFU A;  3LYI A;  1QVF A;  1YJ9 A;  5FRO A;  2DEQ A;  3MEV A;  3HPW A;  4JRP A;  4Y91 A;  4BI8 B;  3P8H A;  4BDY A;  4RG8 A;  5GAN h;  4MZT A;  2JTF A;  3FLG A;  4PJO F;  4C8Q C;  1P92 A;  3BY7 A;  5L8R E;  3I55 A;  5LJ5 j;  2GQV A;  5LJ3 h;  4QVZ A;  4M77 C;  4N0A C;  4B9W A;  3DB4 A;  4HKE A;  4F7U E;  2LQK A;  2V8I A;  3LX7 A;  4MZP A;  2P0Q A;  4E7I A;  1KQS S;  2CZ6 B;  4FT2 A;  4R55 A;  5DY9 A;  4XTX A;  3TRE A;  1NJI U;  1YIT T;  2MMP A;  4M75 C;  5HKC A;  1VQ9 A;  3GIB A;  4BD3 A;  1U1T A;  2VGN A;  2EQU A;  1BYM A;  1BIA A;  5J26 A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...