5LJ3d

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
b'NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
molecule tags Splicing
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 14
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3d00
1I8FA 4M77G 1I81A 2K57A 2RA2A 3FB9A 4M7AB 2VXFA 4PJOG 3SB2A 5GAOm 3JB9H 4DQ2A 3L2ZA 1MGQA 4NOYA 4M75B 4RCCA 5CAIA 4M7AG 4M78G 4JUVA 2EWNA 3RKXA 4JRKA 1WQWA 2CGHA 1U1SA 4N0AA 3RIRA 1I5LA 3AHUA 2DTHA 4MMLA 5LJ5f 4M7DC 4M7DF 5GAMh 3JCMb 1D3BB 4M7DD 4M7DB 2DXTA 4C92F 3JCMV 5GMKe 5GAN2 4QVCA 4XTYA 2E65A 2EJFA 3INZA 3V8JA 4C8QD 2EAYA 4PJOE 1LNXA 5GAOq 3JCMP 1HK9A 1WQ7A 2E41A 2EJ9A 3BW1A 4M77E 4M75D 2YLCA 1KQ2A 2HNIA 5LJ3d 3M4GA 1M8VA 3QHSA 4M7AF 4M75A 4XQ3A 3EFRA 5GAMf 3V8KA 2QTXA 3HFOA 4M78B 3JCMh 2DXUA 1B34A 5GANe 4M7DA 3QSUA 3JCMc 4C92E 3FIFA 2RB6A 4HT9A 4PJOB 4F7UF 4XU3A 4XU2A 1WNLA 2VC8A 1JRIA 2Y90A 3BFMA 2DJZA 5LJ5j 1JBMA 2ZGWA 4XTVA 3JCMJ 4C8QG 4M7AA 5GAN3 1TH7A 2E1HA 4M75C 4J6YA 3JB9G 1I4K1 4XTUA 4C8QB 4C92B 5GAOp 5LJ3f 2E10A 4M7AC 1Y96A 3EFSA 3BY7A 3RERA 4V2SA 1LOJA 4XU1A 5LJ5g 4NL2A 3RKWA 4EMHA 5GAN5 5GANf 1D3BA 4M78F 5GMKl 4PNOA 2FYKA 1YCYA 4EMKA 5GAN4 5GMKj 4M77C 3V7RA 4C92D 1HXDA 4M77D 3RKYA 5LJ5e 5LJ5d 5GAMd 3JB9J 4C8QE 5GAMe 4J5YA 1H641 4M77A 4M77B 3RESA 5GMKh 3JB9F 2DEQA 3SWNB 2DZ9A 3JB9D 1BIAA 1KQ1A 5GAMg 3JCMg 3HSBA 5GMKi 4EMKB 4M78E 5I21A 5LJ3h 5GMKm 5LJ3e 4MMKA 4JRIA 4EMKC 3JCMW 1LJOA 2FB7A 4F7UE 3JCMd 1Y96B 5GANd 2YHTA 4PJOF 3VU3C 4WF2A 5LJ3g 2RM4A 3L1AA 4C8QA 3QUIA 4F7UA 5GAMj 2I2LA 3V8LA 1X01A 4M7AE 5GANg 3SWNC 3GIBA 2DZCA 4XU0A 4F7UB 3BDUA 1WPYA 3JCMQ 1N9RA 4M78C 3SWNA 5LJ3j 2DVEA 5GAOr 4F7UG 5GAOn 4M7DG 3RUXA 4J6XA 3HFNA 4C8QC 4M7DE 5GAN8 4M78A 5GANj 2VXEA 4M75G 3JCMf 4Y91A 4HT8A 1N9SA 1BIBA 3PGGA 3QO3A 4OP0A 3V7SA 4M7AD 4EMGA 2RD1A 2DTIA 4C92C 4M75F 4RCBA 4QVDA 5LJ5h 1B34B 2JN0A 4M77F 4XTZA 4A53A 3JCMX 5GAN7 4M78D 4C92G 4NL3A 3V7CA 4X9DA 4J6WA 4JLIA 4HA8A 4M75E 2YLBA 5GAN6 4N0AC 4X9CA 4PJOC 5GANh 4PJOD 4A54A 3FJPA 1M5Q1 2DTOA 2E64A 5GAOl 4XTXA 2DKGA 5DY9A 4C92A 2EJGA 3JCMe 4PJOA 1U1TA 4XTWA 3JB9I 4C8QF
chains in the Genus database with same CATH superfamily
5I22A 2RA2A 3OYHA 1A0NB 4DQ2A 4OMQA 2XDDA 1NG2A 1V29B 4UC4A 2NUZA 1PC0A 1VQNT 6AT1B 1U3OA 4C5GA 1WDXA 3G6EQ 2D8HA 4PJOE 1OQKA 5LJ3d 2IIMA 3L2WA 2RQRA 2ZPBB 4PK4A 1KFZA 4QT7A 3T9NA 1M90R 3RMQA 3L42A 1ZLMA 1IREB 1D09B 2I0NA 3OYEA 3S3OA 1UDLA 1KQSP 2DVJA 5I2MA 2F5KA 2O4XA 1FYNA 2X4WA 5I2SA 2RHZA 1E6HA 2ED0A 1ARKA 1Q81C 4JDSA 4PLLA 5GAN5 2QXFA 5GANf 1W2BP 3CCJA 1GFDA 3OBWA 3ULRB 1KK7A 2RPNA 3CC4Q 1N5ZA 4MMKA 4D8DA 3PMTA 5CK9A 2RF0A 4A63B 4WF2A 2HL3A 4JRPA 1IB8A 4MZMA 2DXCA 3QPHA 3QWYA 3EGDB 1UECA 2JMAA 3HHTB 1V1CA 2YUQA 1UGSB 2EKOA 2JS0A 3EG0A 1IHWA 2D1XA 1YJNT 1WX6A 3PGGA 4ORZA 1CKAA 1PKTA 4IUQA 1PD0A 2VYTA 1UEBA 5IHIA 3KUFA 4QVZA 1Q86U 4AMCA 3C95A 3JCMX 3CPWS 4M78D 3R6NA 3V7CA 3UATA 2QDLA 1WHKA 5GAOl 5DY9A 3OQ5A 4D6WA 3CCMQ 5FW9A 3G1JA 4TVRA 2K5FA 3G7ZA 1M8MA 1YJ9A 2KMTA 3ASKA 5KE3A 1UB4A 1ZUKA 2DTHA 1R0BG 4FIBA 1NPPA 1GL5A 4M7DB 3M0RA 3INZA 4LUEA 2K3YA 2LT1A 2NUPA 1QWFA 5FWCA 2O9VA 2LCSA 3E9GA 3WVEB 1WI7A 4FSXA 5CO7A 4M75A 1YITQ 2DL7A 1RAAB 3MPUB 5CQYA 4JZ4A 3URGA 3CQTA 2L3RA 2ROTA 4PJOB 3CMEQ 1JRIA 2WACA 4AT1B 1X75C 1PM3A 1ABOA 3JCMJ 2JZ2A 4R56A 1NJIU 3RMSA 1MMNA 4BE2A 4OMPA 2FO0A 4ESRA 3RERA 4AFZC 5LJ5g 1QP2A 1JJ2A 3QDFA 1YCYA 2L8DA 3HKSA 1M4ZA 3E1SA 2OTJA 1W1FA 4PL6A 4BUGA 1VQ5A 5GJWB 1M1KR 4E47A 4M78E 5GMKm 1QVFS 2XDBA 3VUBA 2JJ9A 3F70A 2RO0A 2MF2A 4JZ3A 1UJ0A 2F2XA 2LQNA 3CC2T 1D0ZA 1N6AA 3CC7Q 4ANJA 2CZ7B 1M1KU 4IKFA 1VQNQ 5LJ3j 3ZBDA 4M78A 2HEQA 1NEGA 5GANj 1YJWQ 2LNVA 1MUZA 1AOJA 2BZ8A 4OB2B 4RCBA 2BUDA 4LDXA 2XD0A 2DX1A 2VGMA 1FMVA 4WCIA 4C92G 3TU4K 2QQ9A 2DM1A 3CXCA 2QTVA 4FM4B 3FJPA 3CCQT 3M0TA 2KK4A 1JJ2S 5GAOm 3OW2A 2KGTA 2E5QA 2ROLA 4NOYA 3A8GB 1UGVA 3OYYA 1U1SA 1IZ6A 1BU1A 4MMLA 1W4SA 3OS5A 2K3XA 5GAN2 1SPKA 1IHVA 1XNIA 3BW1A 2EBPA 2B86A 2O2OA 1SKUB 1I0CA 3RNJA 3OYNA 4XQ3A 4AG1C 3V8KA 4M7DA 1AEYA 2L3SA 3BDLA 1MHNA 2FHDA 4HVWA 3WVDB 2K7AA 4BDYA 2EYXA 2MIOA 2JUFA 4C8QG 2FG0A 1JXMA 1MNEA 3CD6A 3M0UA 3PIOA 1RAIB 5LL6S 3PNWC 4E6RA 3FC3A 3A1PA 4J9DA 4XU1A 3HP9A 1NM7A 2LQ8A 2BZXA 1Y57A 5ECAA 1X43A 3QIIA 2LC4A 3OW2P 3UA6A 5GAMe 5KYXA 2DERA 1WHLA 5GAMg 4B6MA 4ZN3A 5I21A 2EYYA 2L0AA 2VVKA 1FMWA 1WHJA 2X9HA 2SRCA 1OULA 3L1AA 1VQ5T 3OY9A 1OEBA 1ABQA 5FU6C 2HKNA 2VUBA 1K9AA 1TS9A 2JMCA 2Z0WA 3QYHB 1FMKA 3E9FA 2LRQA 1MMDA 1Q81R 4IUTA 5D6YA 3GNGA 4NL3A 2JOYA 2E70A 1KD1U 4OVAA 2M9UA 2DTOA 1JQQA 4XTXA 2KVQG 3A5ZB 1VQOA 1FX7A 2J05A 2VXFA 4JS4A 1MGQA 1KQSA 2CS7A 4M7AG 4BE1A 4ELZC 1D0YA 2GQVA 1AWOA 2FL7A 5FU7C 5LJ5f 2RN8A 1NBEB 4FYWB 1QVFA 2K5LA 2CZ1B 2EAYA 2KEAA 2HSEB 3C0CA 1WQ7A 4CRIA 4IURA 2YLCA 4KULA 1YITA 3CCSQ 2C0OA 4M78B 4QQ6A 4JS5A 2DXUA 1OX8A 4C92E 1I07A 4XU3A 1VYTA 5LJ5j 2V1RA 4KH0B 5IHNA 1AD5A 2DYBA 4A4EA 2KRSA 3H8ZA 4M7AC 1KC8C 1BK2A 4IUUA 3BY7A 3G4ST 3VS1A 3RKWA 2CREA 2KDSA 2J6KA 5EC7A 2KXCA 3EGUA 3CCRA 4MDXA 3RKYA 4KUDK 1GBQA 2M1HA 3MCAB 1YIJA 2DZ9A 4LUDA 1ZA1B 3ZFJA 1W2BS 3QBYA 4Y92A 4GLMA 4J9FA 2FZCB 1QVGP 3L2UA 4FU6A 5LJ3g 4F7UA 3VS5A 2K9GA 1W6XA 4Z88A 5GANg 3H9NA 3GIBA 1LVKA 4K11A 1K9MU 1U8RA 1T0JA 4F7UG 4A4KA 3UWNA 2ATCB 1N27A 2XDPA 1ZSZB 1K9MR 5L23A 5GAN7 2LDMA 1K8AR 3CCJT 5D6XA 1T3SA 4ZGDB 2WSEE 2DKGA 3EH2A 3EG1A 2EFIA 3CCJQ 1O75A 3JB9I 2OTJT 1YWOA 5HY6A 2EGEA 3P8HA 2J06A 2EWNA 4JRKA 1UE9A 4XAXB 4L59A 2NUPB 1K8AU 4OGEA 2PUKB 4KGZB 4XTYA 4RTTA 3V8JA 4LD6A 4D8KA 3UA7A 5GAOq 1OZ2A 1UGPB 2AZSA 1PD1A 1Y7XA 1ACMB 4FCYA 1RAEB 2COWA 4LXCA 3FIFA 3G6EA 1UHCA 1JBMA 4M4ZA 2A3LA 3C4SA 1KD1C 2RI5A 4PFPA 2CP3A 4EMHA 4PNOA 4HVUA 2OX7A 3CEYA 3V7RA 5LJ5e 5KYUB 1PRMC 3CCQA 2RK1A 4GLKA 1VQPA 2JS2A 5KYWA 5GMKh 3JB9D 1KQ1A 1SSFA 2DF6A 5CCAA 3CCLT 3LGFA 4LDUA 3VYGA 2VGNA 4MDWA 1TWBA 1BKBA 3QWXX 1YJWT 2H8HA 2SEMA 3X20B 3J7AF 2CKKA 2RHIA 3DKMA 5J26A 4E7ZA 1KD1R 4M7AE 1X6GA 4RUGA 3OYKA 3SWNC 4IIOA 3J81E 1VQKT 3CCST 1RUWA 4RTZA 3G71Q 3CC2Q 2E3IA 2BE9B 2QYZA 4C8QC 4RG2A 3CCVT 4Y91A 3OYAA 4HT8A 1C6VX 5M9OA 2CSQA 4C92C 3OMGA 4M75F 4JJNK 2HQEA 1KHIA 2JTEA 3LW5E 1B7TA 4LDYA 4J9HA 2WSCE 1D1BA 4CC2A 1KQ2A 4PJOG 2ZCFB 2LNHB 1BI0A 1TUCA 1RAFB 4J8OA 3FLGA 2XKOC 3RKXA 3OW2S 3VS0A 1VQKQ 3HTRA 1Z9QA 3M59A 4QQDA 5A0GA 2X4JA 3GNFB 5C0MA 2P0KA 5GAMf 4KRTA 3MEUA 4KT0E 1DJ7B 3VS4A 5GANe 1N8RC 3CCLQ 2XG8D 4F7UF 2D8JA 1V76A 1WNLA 2MOXA 3A8LB 1X2QA 4RG8A 4OMNA 1TXQA 4M7AA 4BI8B 5KYYA 4M75C 2RH2A 4KH1B 4BDZA 4BD3A 2KRNA 2X4YA 3TCJA 1PCXA 3MJXA 4M78F 5GMKl 3C94A 2E6ZA 2ZZDA 2MMPA 1VQ9A 5GAN4 4M77C 3PE0A 1HXDA 2XIDA 4EDUA 1H641 4M77B 4C0DB 1VQOT 3CPWP 1YHQQ 1BIAA 1LPLA 2X35A 2DD4A 2RQUA 1KSWA 4F16A 3JCMd 2QA4T 2M02A 4PJOF 1S72T 2PVOB 3CMET 4N4IA 4CC4B 4C5HA 2CUDA 5J3BA 1YP5A 4DBQA 4XU0A 4FSSA 4PFZA 1KJWA 1AVZC 5GAOr 3M0SA 2MYSA 2IG0A 2EQMA 4ZGEB 3TEEA 3S3NA 1N9SA 1BIBA 5LJ5h 2GFUA 4XTZA 3CCUT 2QAZA 5CVIA 1NYGA 2QEXQ 2YUPA 1F1BB 1VQ6T 3A8HB 5HK3A 3EGXB 1YWPA 1YHQT 1YIJT 2D6FA 5GJVB 2MCNA 1U5SA 2CDTA 4Z89A 2YRCA 2KBTA 1AWJA 2E4HA 4RCCA 3CD6Q 4KGXB 2DA9A 4JLGA 2LMJA 3U23A 1RL2A 3CMAA 4M75D 2HNIA 1X2KA 2DL3A 3JCMh 3DLLA 4KGVB 1T3LA 3CMAQ 4RTWA 3I56A 3BFMA 2E3HA 2FPDA 2EVRA 4PKCC 2K6DA 1VIEA 2W0ZA 3OSSC 4FYYB 1MNDA 1K9MC 3AT1B 1XJWB 3QKJA 2YSQA 4C8QB 2D0QB 2W10A 2E10A 2PUOB 1Y96A 2DL4A 1QCOA 1OPKA 2P4RA 1GFCA 3OYDA 3VS7A 2OAWA 2R5MA 4DEXA 4C92D 2RJDA 2QGGA 2D0NA 3CXCP 1HSQA 2OTLQ 3JB9F 4DEYA 3QZ5B 4QKUA 1T0HA 2BKDN 3MP1A 4OB1B 4EMKB 5LJ3e 4LN2A 4EPCA 3JCMW 3OYCA 2PQWA 2H3EB 1AZGB 3M54A 1RLPC 3CBMA 2C06A 2KT1A 4J9GA 1VQMQ 1OX9A 4ZTFA 1X6OA 1M90C 1JJ2P 4ZN1A 2NUTA 1SEMA 3HL8A 2WSFE 4ATOA 2LQWA 3G6ET 1M1KC 1SSHA 4OP0A 2RD1A 3LWIA 1WA7A 3LYIA 2PVDB 2R57A 3JV3A 1TG0A 2EW3A 4BE0A 2HBWA 2E64A 2O4XB 2VV5A 5CKEA 2QQBA 4C8QF 1K73C 4PLIA 1WXUA 2PVGB 2HDAA 5CKDA 1E7OA 4R55A 1VQ7A 4OMFB 4QQGA 1JXOA 2CGHA 1I5LA 3AHUA 2XMFA 2R5AA 4C92F 4FL6A 1WXTA 1ZX6A 1NPRA 4PFOA 2XI9A 3M4GA 1AT1B 5AYFA 1PNJA 1JB0E 1ZA2B 1Q86R 4DBHA 2NUTB 1OU8A 1XOVA 1ZBXA 4BB7A 3FEOA 2BIVA 2KR3A 2E1HA 4E7SA 4C0ZA 1B07A 1BCMA 2VKNA 1VQ5Q 1Z9ZA 3VUZA 8AT1B 4EIKA 2KRMA 3LX7A 3SD4A 2JNGA 2CZ0B 1VQ6Q 2GQIA 1BCOA 5HKCA 2CT3A 1VQ9Q 5IN1A 2EIFA 4ZGJB 4BACA 1WHGA 1RABB 4F7UE 5HCKA 3DLMA 3CBPA 3BE3A 2PNIA 1FXXA 1G83A 1M1GA 3HRUA 2BE7D 2G6FX 4BY6B 1G3SA 4M78C 4M7DE 3REAB 1NLPC 3VS3A 1P92A 2LX9A 2JVVA 3EG9B 3KXTA 1SRMA 3GLXA 2FZGB 2KYMA 3UDCA 2X3WD 4E7LA 4J6WA 2VASA 5GAN6 2FZKB 1VQPQ 1YI2T 2ECZA 4PJOD 3O8VA 4JPBW 1G3TA 4C92A 4PJOA 1WHHA 4XTWA 3JB9H 1PKSA 3TVTA 3OYBA 1IXDA 2RK2A 1H3ZA 1BB9A 4N0AA 3I55A 1K0XA 5FWBA 2RJEA 4M7DD 1NE8A 4QVCA 3LLRA 1LNXA 4AFUC 3SDZA 3H0HA 1YBYA 3OMCA 2JT4A 3KBGA 2K79A 4A4FA 3P8DA 3TSWA 1B3QA 4CC7A 3QSUA 3LH0A 4RMOA 3SFMA 2DIGA 3NTHA 3E19A 2DJZA 3M58A 3I5SA 4IIMA 4XTVA 2HKQB 1TH7A 2CT4A 2K5IA 2DMOA 2EQJA 2CZ6B 1OV3A 4B9WA 2QASA 4J9IA 4KBMB 2A28A 2LP5A 3SHWA 2E5KA 1UTIA 1OU9A 2QEXT 1GRIA 5I11A 1O9SA 4DA4A 2NYSA 5CQXA 3PFSA 2EYZA 1EZZB 2M51A 2IVWA 2F5TX 4RTXA 5KYUA 2AKKA 3QUIA 4X34A 1XTDA 1BBZA 2MWOA 2I2LA 3CMAT 2L2PA 4JRQA 2J6OA 2ZPIB 3NTIA 3NHNA 3JCMQ 3E2UA 4J7IA 3A8MB 4AG2C 1Q95G 4HCBA 1RI9A 2GTJA 2V8JA 3HFNA 3OA6A 1G5VA 1WXBA 2AK5A 2K3BA 3EH1A 4C5IA 2F2WA 4E7KA 1QLYA 1D1CA 3CD6T 2CH4W 1YHQA 1SF9A 2XICA 2MI6A 1PHTA 2YLBA 4ELYC 3MKDA 2CP5A 4OGCA 2K2VA 2DD5A 1QWEA 3JCMe 4LE9A 2DEUA 4J7FA 3LWHA 2AZVA 2X51A 1WGSA 3QXEB 2E6NA 5CAIA 4JUVA 2DK3A 1G8XA 5FU7B 1VQ4A 3X28B 1S72A 2P0PA 4C5EA 2YRDA 2E65A 2MK5A 2LQKA 4C0GA 4C8QD 3CMEA 1OI1A 2E41A 1I5OB 4JJDA 2KI7A 1R0CB 3CPFA 4HT9A 3M4YA 5L8RE 5CKHA 5KYNA 1VQLT 1S72Q 4LD9K 5IXFA 2EQKA 4YTLA 1ZSGA 3EAEA 1AHJB 4ZNXA 2RHYA 4XTUA 5GAOp 5DLQE 1VQOQ 2FRWA 2QG9B 2FYKA 2ZPFB 2DL8A 2EGAA 2O88A 3CXCS 3C12A 1VIFA 2DEQA 1HJDA 4L5GA 1WJSA 3M53A 1YJ9T 1QCNA 5LJ3h 4HKEA 1UJYA 1K4US 3CC7T 1X01A 2MAMA 3G71T 3VRZA 1YJNA 2LCLA 1QCFA 2ED1A 4OB0B 5KH6A 1R77A 4RKUE 2QQRA 3BDUA 1M2VB 2DNUA 2XU8A 5GAOn 1SHGA 5KYXB 3I56T 4M7DG 2KAFA 1FWZA 1OOTA 1VQ4Q 3WXMB 2MPXC 3RR6A 2CP7A 5FROA 2JN0A 4A53A 1GCQA 4FYVB 2AKLA 4O6JA 3I9QA 9ATCB 1D1AA 1S1NA 4KUIA 1I8FA 3NFCA 2DJQA 1TTHB 3J80E 4E2FB 2DETA 2V8IA 4B9XA 1EIFA 2DXTA 1ZSZA 2M0YA 3OYIA 2QI2A 2HSPA 3S3MA 1Q7YC 1M8VA 1M1FA 1H3HA 4X1VA 2L3PA 1VQLQ 3Q1JA 1K73U 4OMLA 4Y28E 4DBFA 2DBKA 4LNPA 2GNCA 2HBPA 1VQ9T 1YITT 2AIRB 3GF5A 3EGXA 2JTFA 1I4K1 2ZPEB 2CP2A 1R8OB 2O9SA 1LOJA 2HCKA 1K8AC 2OTLA 4EMKA 1YI2A 1IGUA 1XQHA 2EYWA 3JB9J 2A0FB 1UGRB 3OYFA 3D7SB 1KC8U 2LZ6B 3META 2HZYA 3JCMg 2LVMA 1M9SA 3ZEHA 5DLOA 5IHKA 3M55A 2DLPA 2ESWA 2P4TA 1LJOA 2FB7A 1M2VA 1KHCA 3MP8A 2KY9A 2JM8A 4BY6C 3L2QA 1PSFA 1QVFP 1NJIR 1ZQ1A 2DRKA 1TUDA 4ME7A 1PRLC 3CC7A 2FEIA 1MV3A 1YJNQ 1U06A 2ABLA 1G2BA 2M16A 3V7SA 2DTIA 3REBB 4E7JA 1CSKA 1WLPB 3VRYA 3ER0A 2PTKA 3PVQA 2OTJQ 3A8OB 4PJOC 5CR2A 2A36A 2YDLA 2QK0A 2QEXA 1G3YA 2DL5A 1N8RR 1GCQC 3L2ZA 4M75B 4LDWA 3A98A 4N4GA 1JO8A 4M7DC 3JCMV 5GMKe 3CCVQ 1YJWA 1W70A 1BYMA 1HK9A 1QQJA 2YUNA 2EQUA 1VOMA 1WHMA 2LCCA 3EFRA 3CCSA 4AFQC 1PSEA 2K2MA 2OI3A 3ME9A 4P5NA 4RTUA 2DAQA 1EX4A 2Y90A 1QVGA 5CKFA 2RI3A 3CCVA 1RLQC 3QDRB 5A0DA 3M57A 4FT2A 4II1A 4C0FA 2CP0A 3EFSA 3M0QA 2COZA 3CCMA 2DO3A 2FVUA 4C8QE 1VQ8A 3PIPA 2CP6A 4M77A 4CI0C 2YT6A 2OTLT 3HSBA 1I1JA 3GOXA 3NMZC 2LJ1A 2HD0A 1QVGS 2YUOA 4DBRA 3P8BB 1VQPT 1Y96B 3VYHB 1VQ4T 2QGFB 2YHTA 4FW1A 4PJJA 2ZAEA 1BI1A 4A4HA 2O01E 3CCLA 3UF4A 2DXBA 2RJFA 3CCEQ 2GBQA 1Y0MA 1ZUUA 3OS0A 2OAUA 3PVLA 2M0OA 1JEGA 2LX7A 2GCXA 3O5ZA 3VS6A 1VQKA 3QO3A 4QVDA 1KG1A 4GBQA 2PU9B 2JTMA 4IUVA 3CC4A 1VQ7Q 2D9TA 2Y4YA 1QMCA 2O31A 4HA8A 3TSZA 1M27C 4A54A 1KC8R 2RNAA 3HPWA 4OF1A 1CKBA 2EJGA 1U1TA 4NS5A 2NLUA 2HQHA 3VV0A 3SEMA 3EFOA 4OMOA 1M2OA 5D7UA 4M78G 3GP8A 3DB4A 3I5RA 2LTOA 5GAMh 2HAXA 4Z8AA 2PZ1A 2RQVA 2EJ9A 4M77E 3G71A 1VQLA 1IRXA 2H3JA 3QHSA 4M7AF 4VUBA 4AFSC 3MEVA 2P84A 1VQMA 2EKHA 5DM7R 2FPEA 2GTOA 3G4SA 1K1ZA 2VC8A 2AHJB 1Q82U 2A7YA 4J9CA 1H8KA 4RTVA 3NTKA 1J3TA 5GAN3 1HD3A 4DOWA 4V2SA 3PT9A 1MV0B 4E7IA 1IO6A 1RI0A 2HMAA 2KNBB 1C0MA 3MHXA 1SRLA 2DYIA 3CCQQ 1QVPA 4M77D 5LJ5d 1Q82R 2BZYA 3NGPA 5A2QE 3THKA 3TQ7P 3X24B 1QKXA 1Q82C 1AZEA 3VKIA 3EHQA 4JJBA 1NJIC 1WJQA 2Y4XA 4EMKC 1UG1A 2VWFA 1VQ8T 1BI3A 5GANd 4E7HA 3EHRA 5KYYB 3EG3A 3R6OA 1VYUA 3OS1A 2DZCA 5IAYA 4J9EA 5D6WA 1UGQB 1WPYA 1N9RA 3SWNA 2LT4A 2DVEA 1GBRA 2CUBA 3H0IA 2CH4A 4WTOB 2F2VA 2COYA 2E12A 2DIQA 1RACB 4OMMA 4Q5WA 1X27A 1D0XA 4A4GA 3NPFA 3I55T 2KT8A 1EFNA 3UPUA 1BI2A 1GCPA 1M3BA 8ATCB 4MZPA 3FB9A 1UFFA 1Q86C 4F14A 2LJ0A 1MMAA 2ZPHB 4M7DF 1W2BA 4GY5A 1NLOC 1UHFA 3N5BB 3JCMP 2CSIA 3L2RA 1TU0B 2MWPA 2QQAA 1VQNA 2DFUA 3HFOA 3EFOB 5HK0A 1WZOA 1B34A 1VYVA 1K0SA 5J39A 1M30A 4N4HA 2CYZB 2XHCA 2A08A 2KYBA 1X69A 3JB9G 1WIEA 2J6FA 1YJ9Q 2DBMA 4J9BA 3EG9A 1LCKA 3H41A 3OSVA 2ZPGB 3CCRQ 2V26A 3MO8A 3UT1A 1TUGB 1KIKA 2KE9A 1WFWA 2EGCA 2F69A 3JAME 2V1QA 4JRIA 4MZTA 2XK0A 3ZL7C 5GAMj 3V8LA 2V8KA 2BTTA 4OB3B 5FU6B 2RMOA 1AWWA 1PG5B 2KXDA 2C0IA 4LDVA 3RUXA 5CIUA 2FRYA 3JCMf 2X3XD 2RI2A 1YN8A 2B8AA 4R0KA 1NZ9A 2VB6A 3M9QA 1MMGA 4Z02A 1SG5A 4M77F 1QW1A 3MEAA 1OPLA 3CCMT 3X25B 3CPWA 3OYLA 1QP3A 2OJ2A 1ZUYA 3H0FA 2QDYB 3OYGA 4ZTJA 5FRNA 1WQWA 4F04B 3CCET 4FW2A 1D3BB 3JCMb 1Q81U 2KQWA 4J83A 3I56Q 1JU5C 1Q7YR 3X26B 1VQ7T 3CC2A 2RQWA 3LGLA 2C0TA 2QTXA 3JCMc 4XU2A 2GGRA 1M3CA 2ZGWA 1Q7YU 1Y71A 3I55Q 3FDRA 4J6YA 2JM9A 3QYGB 7AT1B 4NL2A 2QQSA 2YRVA 2DRMA 1SHFA 2R58A 5KE2A 5GMKj 3S6WA 2P0QA 3FJ5A 4RTYA 2RJCA 3RDVA 4HXJA 3LH5A 2A37A 1M90U 1QKWA 3DB3A 5GMKi 4XK8E 2AT1B 4JJCA 1VUBA 2DILA 3OBYA 1YFNA 2RM4A 4C8QA 2ENMA 2KSSA 2DPPB 4BI3A 3G4SQ 5FLXE 2YWWA 3M0PA 4BI4A 1M3AA 3QG1A 1PWTA 1X6BA 5IT9E 5A0LA 2IPOB 4HVVA 4J6XA 5GAN8 1TSFA 2GF7A 1K76A 3KFVA 2VXEA 4M75G 2K4YA 3EG2A 4M7AD 5EG2A 4EMGA 2FPFA 1KQSS 3JSCA 5KYWB 1GXIE 1B34B 2RQTA 1OZ3A 5CKBA 1E6GA 1RAGB 3OS2A 4JLIA 4PJLA 3M56A 3GPLA 4M75E 3FRNA 1VQ8Q 4HCKA 1VA7A 4IUPA 3HRTA 4X9CA 2L89A 4DOVA 1WYXA 1D3BA 2EQIA 1YCSB 4M77G 1I81A 2K57A 1K73R 4M7AB 3SB2A 3HRSA 3PTAA 1ZSZC 3RIRA 3IQLA 3OB9A 4F17A 2QA4A 4O5VA 2EJFA 2RHXA 1IGQA 2F1LA 4FYXB 4PJNA 5C6SA 1G3WA 3CCEA 2RB6A 3JRZA 3L2VA 1RADB 2YXYA 1Y07A 1YNZA 2J7IA 3GBQA 2DE0X 1AWXA 2KROA 3CC4T 4CC3A 4C92B 3CCUA 5LJ3f 2LJ3A 1NYFA 3OYJA 1YIJQ 2G3RA 2X4XA 5IXBA 4C0DC 1RAHB 1VQ6A 3VS2A 5AT1B 1N8RU 4PJMA 1TOVA 5GAMd 4J5YA 3MEWA 3RESA 5IH2A 5KCHA 3SWNB 4HCCA 2HL5C 4L6V5 3CCUQ 2JXBA 1UUEA 2L5QA 3VJPA 3M5AA 1NEBA 3QZ9B 3QJYA 3VU3C 3RBBB 1C1AA 1H92A 4HCZA 3EGDA 2EYQA 3MP6A 2HQXA 1ZHIA 2L3QA 3QJ6A 4F7UB 1VQMT 3I35A 1WJRA 4QW2A 2RHUA 3PMIA 3H6ZA 2QA4Q 1ZBJA 1OYXA 1HYOA 5KCOA 2GFAA 4X9DA 2EPDA 4FT4A 3TREA 4N0AC 5FRMA 2JW4A 1M5Q1 3CCRT 1YI2Q 2NWMA 3OYMA 3CBOA 5GANh
chains in the Genus database with same CATH topology
2NLUA 2RA2A 3JB9H 3OYHA 5HY6A 3VV0A 3OYBA 2RK2A 4DQ2A 1H3ZA 2XDDA 3P8HA 4M78G 3GP8A 2EWNA 1V29B 3DB4A 4JRKA 4UC4A 4XAXB 4N0AA 4L59A 3I55A 1VQNT 1K8AU 2LTOA 5GAMh 2HAXA 2RJEA 4M7DD 4OGEA 4C5GA 2PUKB 1NE8A 4QVCA 4XTYA 3V8JA 4LD6A 3LLRA 4PJOE 1LNXA 5GAOq 1OZ2A 2EJ9A 4M77E 3SDZA 1UGPB 1YBYA 3OMCA 3G71A 1VQLA 3KBGA 5LJ3d 2H3JA 3QHSA 4M7AF 1Y7XA 4VUBA 4A4FA 3L2WA 3P8DA 3MEVA 2ZPBB 1VQMA 3QSUA 3LH0A 4RMOA 3FIFA 3SFMA 3T9NA 5DM7R 3G4SA 2DIGA 2VC8A 3NTHA 3G6EA 3E19A 2DJZA 3RMQA 3L42A 2AHJB 1IREB 3M58A 2A7YA 1JBMA 1Q82U 2A3LA 4XTVA 3C4SA 3NTKA 1KD1C 3OYEA 5GAN3 3S3OA 1TH7A 2RI5A 5I2MA 2K5IA 2F5KA 2O4XA 2X4WA 2EQJA 4DOWA 2RHZA 5I2SA 2CZ6B 1Q81C 4V2SA 3PT9A 4JDSA 4B9WA 4PLLA 4E7IA 4EMHA 1RI0A 5GAN5 2QXFA 5GANf 4KBMB 3MHXA 4PNOA 3CCJA 3CEYA 3V7RA 5LJ5e 1QVPA 4M77D 5LJ5d 3CCQA 2RK1A 4GLKA 5A2QE 3OBWA 1VQPA 2QEXT 5GMKh 1O9SA 3JB9D 4DA4A 3X24B 5CQXA 1KQ1A 3PFSA 1Q82C 1SSFA 3VKIA 5CCAA 3CCLT 1NJIC 1WJQA 2Y4XA 3LGFA 4MMKA 2IVWA 4EMKC 4LDUA 3VYGA 2VGNA 5CK9A 3PMTA 4MDWA 1VQ8T 1BI3A 2F5TX 5GANd 1BKBA 4E7HA 1YJWT 4WF2A 4JRPA 3QUIA 4X34A 1XTDA 3X20B 3J7AF 2CKKA 2MWOA 2I2LA 4MZMA 2RHIA 3R6OA 3DKMA 3CMAT 5J26A 4M7AE 2DXCA 3QPHA 3OYKA 4JRQA 2ZPIB 3SWNC 3J81E 3OS1A 2DZCA 5IAYA 1VQKT 3NTIA 5D6WA 1UGQB 3JCMQ 1WPYA 3CCST 1N9RA 4J7IA 3SWNA 3HHTB 2LT4A 2DVEA 3A8MB 4HCBA 2V8JA 3HFNA 4C8QC 1UGSB 3OA6A 2EKOA 1G5VA 4RG2A 3CCVT 1YJNT 4Y91A 3OYAA 4HT8A 3PGGA 4C5IA 2E12A 4IUQA 5M9OA 2VYTA 2DIQA 4C92C 3OMGA 1UEBA 4M75F 4JJNK 2HQEA 3KUFA 4Q5WA 4E7KA 3CD6T 1KHIA 4QVZA 1Q86U 3C95A 1YHQA 3JCMX 3LW5E 3CPWS 2XICA 4M78D 4LDYA 2MI6A 3V7CA 2YLBA 4ELYC 4A4GA 2WSCE 4OGCA 2K2VA 3I55T 5GAOl 5DY9A 3UPUA 2DD5A 3OQ5A 4D6WA 1BI2A 3JCMe 4MZPA 1KQ2A 3FB9A 4TVRA 4PJOG 1Q86C 2K5FA 4J7FA 2ZCFB 3LWHA 3G7ZA 1WGSA 1BI0A 3QXEB 1YJ9A 2E6NA 5CAIA 2KMTA 4J8OA 3ASKA 3FLGA 2XKOC 4JUVA 1UB4A 3RKXA 5KE3A 2DK3A 2ZPHB 2DTHA 3OW2S 2OTJT 4M7DF 4FIBA 1W2BA 1NPPA 4GY5A 5FU7B 1VQ4A 3X28B 4M7DB 1S72A 2P0PA 4C5EA 2E65A 3INZA 2LQKA 4C0GA 3N5BB 2K3YA 2LT1A 1OI1A 3M59A 4C8QD 3CMEA 4QQDA 3L2RA 3JCMP 2E41A 2MWPA 3E9GA 5A0GA 3WVEB 2QQAA 2X4JA 3GNFB 4FSXA 2P0KA 4M75A 5CO7A 5C0MA 5GAMf 1VQNA 3HFOA 3MEUA 4KT0E 1DJ7B 5HK0A 3URGA 1B34A 5CQYA 5GANe 1N8RC 2L3RA 3CPFA 2XG8D 5J39A 4HT9A 4PJOB 3M4YA 5L8RE 5CKHA 4F7UF 4N4HA 1WNLA 1JRIA 2CYZB 2WACA 3A8LB 1VQLT 1X75C 4RG8A 4LD9K 2XHCA 3JCMJ 2EQKA 2JZ2A 4R56A 1NJIU 4M7AA 4YTLA 3RMSA 4BI8B 3EAEA 4M75C 1AHJB 4BE2A 2RH2A 3JB9G 2RHYA 4BDZA 4XTUA 5GAOp 4BD3A 5DLQE 2X4YA 3RERA 3TCJA 5LJ5g 1QP2A 4M78F 5GMKl 3C94A 1JJ2A 2E6ZA 2FYKA 2ZPFB 2MMPA 2ZPGB 1YCYA 2ZZDA 3OSVA 1VQ9A 5GAN4 2L8DA 4M77C 3HKSA 1HXDA 1M4ZA 3E1SA 3MO8A 3UT1A 3CXCS 2XIDA 3C12A 4EDUA 1VIFA 2OTJA 1H641 4M77B 4C0DB 2DEQA 1VQOT 4PL6A 4BUGA 1BIAA 1WJSA 3M53A 4L5GA 1VQ5A 1YJ9T 4E47A 2F69A 2X35A 4M78E 5LJ3h 5GMKm 3JAME 1QVFS 2XDBA 3VUBA 2DD4A 4HKEA 4JRIA 4MZTA 2XK0A 3F70A 3JCMd 2RO0A 2MF2A 3CC7T 2QA4T 4PJOF 1S72T 2PVOB 1VQOA 5GAMj 3CMET 4N4IA 3V8LA 3CC2T 1X01A 2MAMA 4C5HA 2V8KA 3G71T 5FU6B 4OB3B 1YJNA 1N6AA 5J3BA 2LCLA 4PJOA 4OB0B 5KH6A 2CZ7B 4XU0A 1M1KU 4RKUE 4IKFA 2QQRA 3BDUA 4LDVA 5LJ3j 2XU8A 5GAOr 5GAOn 3I56T 3RUXA 5CIUA 3ZBDA 4M7DG 2IG0A 4M78A 2EQMA 5GANj 4ZGEB 2KAFA 1FWZA 3JCMf 2LNVA 3TEEA 1N9SA 1BIBA 2RI2A 3S3NA 2B8AA 3WXMB 1NZ9A 4OB2B 3M9QA 4RCBA 5LJ5h 2BUDA 4LDXA 2XD0A 4Z02A 5FROA 2GFUA 2JN0A 1QW1A 4M77F 4XTZA 3MEAA 4A53A 3CCUT 2VGMA 5CVIA 4O6JA 4C92G 3TU4K 2QQ9A 3CCMT 3CXCA 5GANh 4FM4B 1VQ6T 3FJPA 3CCQT 3X25B 3A8HB 3CPWA 4KUIA 2KK4A 5HK3A 3OYLA 1I8FA 3NFCA 1JJ2S 1QP3A 5GAOm 1YHQT 3OW2A 1YIJT 2E5QA 2D6FA 3J80E 4NOYA 4RCCA 2QDYB 3OYGA 3A8GB 4ZTJA 5FRNA 3OYYA 1WQWA 4M7AD 1U1SA 1IZ6A 2V8IA 4MMLA 4B9XA 3JB9I 3CCET 4JLGA 1D3BB 3JCMb 1EIFA 1RL2A 1W4SA 2DXTA 1Q81U 3OS5A 2K3XA 5GAN2 2KQWA 1XNIA 4J83A 3OYIA 3CMAA 3X26B 2QI2A 1VQ7T 3BW1A 3CC2A 4M75D 2HNIA 3S3MA 1Q7YC 1M8VA 1M1FA 3OYNA 3LGLA 4XQ3A 3V8KA 2QTXA 3JCMh 3DLLA 4M7DA 3Q1JA 3JCMc 3BDLA 1MHNA 2FHDA 3WVDB 1K73U 4Y28E 3I56A 4XU2A 4BDYA 3BFMA 2JUFA 4PKCC 2HBPA 2ZGWA 1VQ9T 1YITT 1Q7YU 1Y71A 4C8QG 1VIEA 3OSSC 3GF5A 3FDRA 1K9MC 4J6YA 2JTFA 1I4K1 2ZPEB 3QKJA 4C8QB 2D0QB 3CD6A 2E10A 3PIOA 2PUOB 1Y96A 3QYGB 5LL6S 1R8OB 3PNWC 3FC3A 1LOJA 4XU1A 3HP9A 4NL2A 2QQSA 2YRVA 2LQ8A 1K8AC 2OTLA 3OYDA 4EMKA 2R58A 1YI2A 5KE2A 2R5MA 3S6WA 5GMKj 3QIIA 2LC4A 2P0QA 4C92D 1XQHA 2RJDA 3JB9J 5GAMe 1UGRB 2RJCA 3OYFA 3JB9F 1KC8U 3META 3QZ5B 3MP1A 2BKDN 4OB1B 3JCMg 2LVMA 5GAMg 1M9SA 3DB3A 3ZEHA 4ZN3A 4EMKB 5GMKi 5I21A 5DLOA 4XK8E 3M55A 5LJ3e 4EPCA 1VUBA 3JCMW 3OYCA 3OBYA 2P4TA 1LJOA 2FB7A 2PQWA 1KHCA 3MP8A 3M54A 2RM4A 3L1AA 4C8QA 3CBMA 2KSSA 2DPPB 2C06A 4BI3A 2KY9A 3OY9A 1VQ5T 4BY6C 5FLXE 3L2QA 1PSFA 1ZQ1A 4BI4A 4ZTFA 3QG1A 4ME7A 1X6OA 5FU6C 1M90C 4ZN1A 3CC7A 5IT9E 5A0LA 3HL8A 2WSFE 4ATOA 4J6XA 2VUBA 5GAN8 2GF7A 3G6ET 2VXEA 4M75G 2K4YA 2M16A 1M1KC 4OP0A 3QYHB 5EG2A 3V7SA 4EMGA 2RD1A 3E9FA 3LWIA 2LRQA 2DTIA 1KQSS 3LYIA 3JSCA 1GXIE 1B34B 4E7JA 4IUTA 2PVDB 1OZ3A 2R57A 3ER0A 5CKBA 5D6YA 3GNGA 4NL3A 3OS2A 2JOYA 4JLIA 2E70A 3M56A 3GPLA 1KD1U 4M75E 3FRNA 3A8OB 4IUPA 3HRTA 4X9CA 4PJOC 2L89A 4OVAA 4DOVA 2M9UA 2DTOA 5CR2A 2E64A 4BE0A 4XTXA 2KVQG 2O4XB 2VV5A 5CKEA 2QQBA 1D3BA 4C8QF 1K73C 3A5ZB 4M77G 1I81A 1G3YA 2K57A 1FX7A 4PLIA 2VXFA 4M7AB 3HRSA 2PVGB 3SB2A 3PTAA 4JS4A 3L2ZA 5CKDA 1MGQA 4R55A 4M75B 1KQSA 4LDWA 4OMFB 2CS7A 1VQ7A 4QQGA 4BE1A 4M7AG 4N4GA 4ELZC 2CGHA 2GQVA 3RIRA 1I5LA 3OB9A 3AHUA 2FL7A 5FU7C 2R5AA 5LJ5f 4M7DC 2QA4A 4C92F 3JCMV 5GMKe 4FL6A 4O5VA 1YJWA 1QVFA 2K5LA 2EJFA 2CZ1B 2RHXA 2EAYA 1BYMA 1HK9A 1NPRA 1WQ7A 4CRIA 4IURA 2XI9A 2YLCA 4KULA 2EQUA 3M4GA 1YITA 2LCCA 3EFRA 5AYFA 4M78B 1G3WA 4QQ6A 5C6SA 3CCEA 3CCSA 1JB0E 4JS5A 2DXUA 1PSEA 4C92E 3ME9A 2RB6A 4P5NA 4XU3A 2DAQA 3JRZA 2Y90A 3L2VA 5LJ5j 1QVGA 1Y07A 2RI3A 5CKFA 3CCVA 1XOVA 3QDRB 1ZBXA 4BB7A 3FEOA 3M57A 5A0DA 2BIVA 4FT2A 2E1HA 4II1A 3CC4T 4A4EA 4C0FA 4C0ZA 4C92B 3CCUA 2QEXA 5LJ3f 3H8ZA 4M7AC 1KC8C 3EFSA 4IUUA 3BY7A 3G4ST 3VUZA 3OYJA 3RKWA 2G3RA 2X4XA 2DO3A 3CCMA 3LX7A 4C0DC 2KDSA 1VQ6A 3SD4A 1N8RU 2JNGA 3CCRA 4MDXA 2CZ0B 3RKYA 5GAMd 2FVUA 4KUDK 4C8QE 5HKCA 4J5YA 1VQ8A 3PIPA 4M77A 3MEWA 2M1HA 3RESA 3MCAB 5KCHA 5IN1A 3SWNB 2DZ9A 1YIJA 4HCCA 4CI0C 2OTLT 4L6V5 2EIFA 3ZFJA 1W2BS 3HSBA 4ZGJB 3QBYA 4BACA 3GOXA 2HD0A 2L5QA 3VJPA 1QVGS 3M5AA 4F7UE 3QZ9B 3P8BB 3L2UA 4FU6A 1VQPT 1Y96B 3VYHB 1VQ4T 3DLMA 2YHTA 3QJYA 3VU3C 3CBPA 5LJ3g 4F7UA 1FXXA 4HCZA 1BI1A 2EYQA 4A4HA 2O01E 1M1GA 3MP6A 2HQXA 1M90U 5GANg 1ZHIA 3HRUA 3CCLA 2DXBA 3GIBA 2RJFA 3QJ6A 4F7UB 4BY6B 1K9MU 1G3SA 4M78C 3OS0A 1VQMT 1U8RA 1WJRA 2OAUA 4F7UG 4M7DE 2M0OA 4QW2A 2RHUA 4A4KA 3UWNA 3PMIA 3H6ZA 2GCXA 1VQKA 3QO3A 1P92A 2LX9A 1N27A 2JVVA 3KXTA 4QVDA 4NS5A 1KG1A 1OYXA 3GLXA 3UDCA 2PU9B 2JTMA 2XDPA 4IUVA 3CC4A 4E7LA 2D9TA 5KCOA 2Y4YA 2GFAA 5GAN7 2LDMA 4X9DA 4FT4A 4J6WA 4HA8A 3CCJT 3TREA 5GAN6 4N0AC 5D6XA 1YI2T 5FRMA 4ZGDB 4PJOD 4A54A 2WSEE 1M5Q1 3O8VA 3HPWA 3CCRT 2DKGA 1G3TA 4OF1A 2EJGA 4C92A 3CBOA 2EFIA 3OYMA 1U1TA 4XTWA 1O75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8F A;  4M77 G;  1I81 A;  2K57 A;  2RA2 A;  3FB9 A;  4M7A B;  2VXF A;  4PJO G;  3SB2 A;  5GAO m;  3JB9 H;  4DQ2 A;  3L2Z A;  1MGQ A;  4NOY A;  4M75 B;  4RCC A;  5CAI A;  4M7A G;  4M78 G;  4JUV A;  2EWN A;  3RKX A;  4JRK A;  1WQW A;  2CGH A;  1U1S A;  4N0A A;  3RIR A;  1I5L A;  3AHU A;  2DTH A;  4MML A;  5LJ5 f;  4M7D C;  4M7D F;  5GAM h;  3JCM b;  1D3B B;  4M7D D;  4M7D B;  2DXT A;  4C92 F;  3JCM V;  5GMK e;  5GAN 2;  4QVC A;  4XTY A;  2E65 A;  2EJF A;  3INZ A;  3V8J A;  4C8Q D;  2EAY A;  4PJO E;  1LNX A;  5GAO q;  3JCM P;  1HK9 A;  1WQ7 A;  2E41 A;  2EJ9 A;  3BW1 A;  4M77 E;  4M75 D;  2YLC A;  1KQ2 A;  2HNI A;  5LJ3 d;  3M4G A;  1M8V A;  3QHS A;  4M7A F;  4M75 A;  4XQ3 A;  3EFR A;  5GAM f;  3V8K A;  2QTX A;  3HFO A;  4M78 B;  3JCM h;  2DXU A;  1B34 A;  5GAN e;  4M7D A;  3QSU A;  3JCM c;  4C92 E;  3FIF A;  2RB6 A;  4HT9 A;  4PJO B;  4F7U F;  4XU3 A;  4XU2 A;  1WNL A;  2VC8 A;  1JRI A;  2Y90 A;  3BFM A;  2DJZ A;  5LJ5 j;  1JBM A;  2ZGW A;  4XTV A;  3JCM J;  4C8Q G;  4M7A A;  5GAN 3;  1TH7 A;  2E1H A;  4M75 C;  4J6Y A;  3JB9 G;  1I4K 1;  4XTU A;  4C8Q B;  4C92 B;  5GAO p;  5LJ3 f;  2E10 A;  4M7A C;  1Y96 A;  3EFS A;  3BY7 A;  3RER A;  4V2S A;  1LOJ A;  4XU1 A;  5LJ5 g;  4NL2 A;  3RKW A;  4EMH A;  5GAN 5;  5GAN f;  1D3B A;  4M78 F;  5GMK l;  4PNO A;  2FYK A;  1YCY A;  4EMK A;  5GAN 4;  5GMK j;  4M77 C;  3V7R A;  4C92 D;  1HXD A;  4M77 D;  3RKY A;  5LJ5 e;  5LJ5 d;  5GAM d;  3JB9 J;  4C8Q E;  5GAM e;  4J5Y A;  1H64 1;  4M77 A;  4M77 B;  3RES A;  5GMK h;  3JB9 F;  2DEQ A;  3SWN B;  2DZ9 A;  3JB9 D;  1BIA A;  1KQ1 A;  5GAM g;  3JCM g;  3HSB A;  5GMK i;  4EMK B;  4M78 E;  5I21 A;  5LJ3 h;  5GMK m;  5LJ3 e;  4MMK A;  4JRI A;  4EMK C;  3JCM W;  1LJO A;  2FB7 A;  4F7U E;  3JCM d;  1Y96 B;  5GAN d;  2YHT A;  4PJO F;  3VU3 C;  4WF2 A;  5LJ3 g;  2RM4 A;  3L1A A;  4C8Q A;  3QUI A;  4F7U A;  5GAM j;  2I2L A;  3V8L A;  1X01 A;  4M7A E;  5GAN g;  3SWN C;  3GIB A;  2DZC A;  4XU0 A;  4F7U B;  3BDU A;  1WPY A;  3JCM Q;  1N9R A;  4M78 C;  3SWN A;  5LJ3 j;  2DVE A;  5GAO r;  4F7U G;  5GAO n;  4M7D G;  3RUX A;  4J6X A;  3HFN A;  4C8Q C;  4M7D E;  5GAN 8;  4M78 A;  5GAN j;  2VXE A;  4M75 G;  3JCM f;  4Y91 A;  4HT8 A;  1N9S A;  1BIB A;  3PGG A;  3QO3 A;  4OP0 A;  3V7S A;  4M7A D;  4EMG A;  2RD1 A;  2DTI A;  4C92 C;  4M75 F;  4RCB A;  4QVD A;  5LJ5 h;  1B34 B;  2JN0 A;  4M77 F;  4XTZ A;  4A53 A;  3JCM X;  5GAN 7;  4M78 D;  4C92 G;  4NL3 A;  3V7C A;  4X9D A;  4J6W A;  4JLI A;  4HA8 A;  4M75 E;  2YLB A;  5GAN 6;  4N0A C;  4X9C A;  4PJO C;  5GAN h;  4PJO D;  4A54 A;  3FJP A;  1M5Q 1;  2DTO A;  2E64 A;  5GAO l;  4XTX A;  2DKG A;  5DY9 A;  4C92 A;  2EJG A;  3JCM e;  4PJO A;  1U1T A;  4XTW A;  3JB9 I;  4C8Q F; 
#chains in the Genus database with same CATH topology
 5I22 A;  2RA2 A;  3OYH A;  1A0N B;  4DQ2 A;  4OMQ A;  2XDD A;  1NG2 A;  1V29 B;  4UC4 A;  2NUZ A;  1PC0 A;  1VQN T;  6AT1 B;  1U3O A;  4C5G A;  1WDX A;  3G6E Q;  2D8H A;  4PJO E;  1OQK A;  5LJ3 d;  2IIM A;  3L2W A;  2RQR A;  2ZPB B;  4PK4 A;  1KFZ A;  4QT7 A;  3T9N A;  1M90 R;  3RMQ A;  3L42 A;  1ZLM A;  1IRE B;  1D09 B;  2I0N A;  3OYE A;  3S3O A;  1UDL A;  1KQS P;  2DVJ A;  5I2M A;  2F5K A;  2O4X A;  1FYN A;  2X4W A;  5I2S A;  2RHZ A;  1E6H A;  2ED0 A;  1ARK A;  1Q81 C;  4JDS A;  4PLL A;  5GAN 5;  2QXF A;  5GAN f;  1W2B P;  3CCJ A;  1GFD A;  3OBW A;  3ULR B;  1KK7 A;  2RPN A;  3CC4 Q;  1N5Z A;  4MMK A;  4D8D A;  3PMT A;  5CK9 A;  2RF0 A;  4A63 B;  4WF2 A;  2HL3 A;  4JRP A;  1IB8 A;  4MZM A;  2DXC A;  3QPH A;  3QWY A;  3EGD B;  1UEC A;  2JMA A;  3HHT B;  1V1C A;  2YUQ A;  1UGS B;  2EKO A;  2JS0 A;  3EG0 A;  1IHW A;  2D1X A;  1YJN T;  1WX6 A;  3PGG A;  4ORZ A;  1CKA A;  1PKT A;  4IUQ A;  1PD0 A;  2VYT A;  1UEB A;  5IHI A;  3KUF A;  4QVZ A;  1Q86 U;  4AMC A;  3C95 A;  3JCM X;  3CPW S;  4M78 D;  3R6N A;  3V7C A;  3UAT A;  2QDL A;  1WHK A;  5GAO l;  5DY9 A;  3OQ5 A;  4D6W A;  3CCM Q;  5FW9 A;  3G1J A;  4TVR A;  2K5F A;  3G7Z A;  1M8M A;  1YJ9 A;  2KMT A;  3ASK A;  5KE3 A;  1UB4 A;  1ZUK A;  2DTH A;  1R0B G;  4FIB A;  1NPP A;  1GL5 A;  4M7D B;  3M0R A;  3INZ A;  4LUE A;  2K3Y A;  2LT1 A;  2NUP A;  1QWF A;  5FWC A;  2O9V A;  2LCS A;  3E9G A;  3WVE B;  1WI7 A;  4FSX A;  5CO7 A;  4M75 A;  1YIT Q;  2DL7 A;  1RAA B;  3MPU B;  5CQY A;  4JZ4 A;  3URG A;  3CQT A;  2L3R A;  2ROT A;  4PJO B;  3CME Q;  1JRI A;  2WAC A;  4AT1 B;  1X75 C;  1PM3 A;  1ABO A;  3JCM J;  2JZ2 A;  4R56 A;  1NJI U;  3RMS A;  1MMN A;  4BE2 A;  4OMP A;  2FO0 A;  4ESR A;  3RER A;  4AFZ C;  5LJ5 g;  1QP2 A;  1JJ2 A;  3QDF A;  1YCY A;  2L8D A;  3HKS A;  1M4Z A;  3E1S A;  2OTJ A;  1W1F A;  4PL6 A;  4BUG A;  1VQ5 A;  5GJW B;  1M1K R;  4E47 A;  4M78 E;  5GMK m;  1QVF S;  2XDB A;  3VUB A;  2JJ9 A;  3F70 A;  2RO0 A;  2MF2 A;  4JZ3 A;  1UJ0 A;  2F2X A;  2LQN A;  3CC2 T;  1D0Z A;  1N6A A;  3CC7 Q;  4ANJ A;  2CZ7 B;  1M1K U;  4IKF A;  1VQN Q;  5LJ3 j;  3ZBD A;  4M78 A;  2HEQ A;  1NEG A;  5GAN j;  1YJW Q;  2LNV A;  1MUZ A;  1AOJ A;  2BZ8 A;  4OB2 B;  4RCB A;  2BUD A;  4LDX A;  2XD0 A;  2DX1 A;  2VGM A;  1FMV A;  4WCI A;  4C92 G;  3TU4 K;  2QQ9 A;  2DM1 A;  3CXC A;  2QTV A;  4FM4 B;  3FJP A;  3CCQ T;  3M0T A;  2KK4 A;  1JJ2 S;  5GAO m;  3OW2 A;  2KGT A;  2E5Q A;  2ROL A;  4NOY A;  3A8G B;  1UGV A;  3OYY A;  1U1S A;  1IZ6 A;  1BU1 A;  4MML A;  1W4S A;  3OS5 A;  2K3X A;  5GAN 2;  1SPK A;  1IHV A;  1XNI A;  3BW1 A;  2EBP A;  2B86 A;  2O2O A;  1SKU B;  1I0C A;  3RNJ A;  3OYN A;  4XQ3 A;  4AG1 C;  3V8K A;  4M7D A;  1AEY A;  2L3S A;  3BDL A;  1MHN A;  2FHD A;  4HVW A;  3WVD B;  2K7A A;  4BDY A;  2EYX A;  2MIO A;  2JUF A;  4C8Q G;  2FG0 A;  1JXM A;  1MNE A;  3CD6 A;  3M0U A;  3PIO A;  1RAI B;  5LL6 S;  3PNW C;  4E6R A;  3FC3 A;  3A1P A;  4J9D A;  4XU1 A;  3HP9 A;  1NM7 A;  2LQ8 A;  2BZX A;  1Y57 A;  5ECA A;  1X43 A;  3QII A;  2LC4 A;  3OW2 P;  3UA6 A;  5GAM e;  5KYX A;  2DER A;  1WHL A;  5GAM g;  4B6M A;  4ZN3 A;  5I21 A;  2EYY A;  2L0A A;  2VVK A;  1FMW A;  1WHJ A;  2X9H A;  2SRC A;  1OUL A;  3L1A A;  1VQ5 T;  3OY9 A;  1OEB A;  1ABQ A;  5FU6 C;  2HKN A;  2VUB A;  1K9A A;  1TS9 A;  2JMC A;  2Z0W A;  3QYH B;  1FMK A;  3E9F A;  2LRQ A;  1MMD A;  1Q81 R;  4IUT A;  5D6Y A;  3GNG A;  4NL3 A;  2JOY A;  2E70 A;  1KD1 U;  4OVA A;  2M9U A;  2DTO A;  1JQQ A;  4XTX A;  2KVQ G;  3A5Z B;  1VQO A;  1FX7 A;  2J05 A;  2VXF A;  4JS4 A;  1MGQ A;  1KQS A;  2CS7 A;  4M7A G;  4BE1 A;  4ELZ C;  1D0Y A;  2GQV A;  1AWO A;  2FL7 A;  5FU7 C;  5LJ5 f;  2RN8 A;  1NBE B;  4FYW B;  1QVF A;  2K5L A;  2CZ1 B;  2EAY A;  2KEA A;  2HSE B;  3C0C A;  1WQ7 A;  4CRI A;  4IUR A;  2YLC A;  4KUL A;  1YIT A;  3CCS Q;  2C0O A;  4M78 B;  4QQ6 A;  4JS5 A;  2DXU A;  1OX8 A;  4C92 E;  1I07 A;  4XU3 A;  1VYT A;  5LJ5 j;  2V1R A;  4KH0 B;  5IHN A;  1AD5 A;  2DYB A;  4A4E A;  2KRS A;  3H8Z A;  4M7A C;  1KC8 C;  1BK2 A;  4IUU A;  3BY7 A;  3G4S T;  3VS1 A;  3RKW A;  2CRE A;  2KDS A;  2J6K A;  5EC7 A;  2KXC A;  3EGU A;  3CCR A;  4MDX A;  3RKY A;  4KUD K;  1GBQ A;  2M1H A;  3MCA B;  1YIJ A;  2DZ9 A;  4LUD A;  1ZA1 B;  3ZFJ A;  1W2B S;  3QBY A;  4Y92 A;  4GLM A;  4J9F A;  2FZC B;  1QVG P;  3L2U A;  4FU6 A;  5LJ3 g;  4F7U A;  3VS5 A;  2K9G A;  1W6X A;  4Z88 A;  5GAN g;  3H9N A;  3GIB A;  1LVK A;  4K11 A;  1K9M U;  1U8R A;  1T0J A;  4F7U G;  4A4K A;  3UWN A;  2ATC B;  1N27 A;  2XDP A;  1ZSZ B;  1K9M R;  5L23 A;  5GAN 7;  2LDM A;  1K8A R;  3CCJ T;  5D6X A;  1T3S A;  4ZGD B;  2WSE E;  2DKG A;  3EH2 A;  3EG1 A;  2EFI A;  3CCJ Q;  1O75 A;  3JB9 I;  2OTJ T;  1YWO A;  5HY6 A;  2EGE A;  3P8H A;  2J06 A;  2EWN A;  4JRK A;  1UE9 A;  4XAX B;  4L59 A;  2NUP B;  1K8A U;  4OGE A;  2PUK B;  4KGZ B;  4XTY A;  4RTT A;  3V8J A;  4LD6 A;  4D8K A;  3UA7 A;  5GAO q;  1OZ2 A;  1UGP B;  2AZS A;  1PD1 A;  1Y7X A;  1ACM B;  4FCY A;  1RAE B;  2COW A;  4LXC A;  3FIF A;  3G6E A;  1UHC A;  1JBM A;  4M4Z A;  2A3L A;  3C4S A;  1KD1 C;  2RI5 A;  4PFP A;  2CP3 A;  4EMH A;  4PNO A;  4HVU A;  2OX7 A;  3CEY A;  3V7R A;  5LJ5 e;  5KYU B;  1PRM C;  3CCQ A;  2RK1 A;  4GLK A;  1VQP A;  2JS2 A;  5KYW A;  5GMK h;  3JB9 D;  1KQ1 A;  1SSF A;  2DF6 A;  5CCA A;  3CCL T;  3LGF A;  4LDU A;  3VYG A;  2VGN A;  4MDW A;  1TWB A;  1BKB A;  3QWX X;  1YJW T;  2H8H A;  2SEM A;  3X20 B;  3J7A F;  2CKK A;  2RHI A;  3DKM A;  5J26 A;  4E7Z A;  1KD1 R;  4M7A E;  1X6G A;  4RUG A;  3OYK A;  3SWN C;  4IIO A;  3J81 E;  1VQK T;  3CCS T;  1RUW A;  4RTZ A;  3G71 Q;  3CC2 Q;  2E3I A;  2BE9 B;  2QYZ A;  4C8Q C;  4RG2 A;  3CCV T;  4Y91 A;  3OYA A;  4HT8 A;  1C6V X;  5M9O A;  2CSQ A;  4C92 C;  3OMG A;  4M75 F;  4JJN K;  2HQE A;  1KHI A;  2JTE A;  3LW5 E;  1B7T A;  4LDY A;  4J9H A;  2WSC E;  1D1B A;  4CC2 A;  1KQ2 A;  4PJO G;  2ZCF B;  2LNH B;  1BI0 A;  1TUC A;  1RAF B;  4J8O A;  3FLG A;  2XKO C;  3RKX A;  3OW2 S;  3VS0 A;  1VQK Q;  3HTR A;  1Z9Q A;  3M59 A;  4QQD A;  5A0G A;  2X4J A;  3GNF B;  5C0M A;  2P0K A;  5GAM f;  4KRT A;  3MEU A;  4KT0 E;  1DJ7 B;  3VS4 A;  5GAN e;  1N8R C;  3CCL Q;  2XG8 D;  4F7U F;  2D8J A;  1V76 A;  1WNL A;  2MOX A;  3A8L B;  1X2Q A;  4RG8 A;  4OMN A;  1TXQ A;  4M7A A;  4BI8 B;  5KYY A;  4M75 C;  2RH2 A;  4KH1 B;  4BDZ A;  4BD3 A;  2KRN A;  2X4Y A;  3TCJ A;  1PCX A;  3MJX A;  4M78 F;  5GMK l;  3C94 A;  2E6Z A;  2ZZD A;  2MMP A;  1VQ9 A;  5GAN 4;  4M77 C;  3PE0 A;  1HXD A;  2XID A;  4EDU A;  1H64 1;  4M77 B;  4C0D B;  1VQO T;  3CPW P;  1YHQ Q;  1BIA A;  1LPL A;  2X35 A;  2DD4 A;  2RQU A;  1KSW A;  4F16 A;  3JCM d;  2QA4 T;  2M02 A;  4PJO F;  1S72 T;  2PVO B;  3CME T;  4N4I A;  4CC4 B;  4C5H A;  2CUD A;  5J3B A;  1YP5 A;  4DBQ A;  4XU0 A;  4FSS A;  4PFZ A;  1KJW A;  1AVZ C;  5GAO r;  3M0S A;  2MYS A;  2IG0 A;  2EQM A;  4ZGE B;  3TEE A;  3S3N A;  1N9S A;  1BIB A;  5LJ5 h;  2GFU A;  4XTZ A;  3CCU T;  2QAZ A;  5CVI A;  1NYG A;  2QEX Q;  2YUP A;  1F1B B;  1VQ6 T;  3A8H B;  5HK3 A;  3EGX B;  1YWP A;  1YHQ T;  1YIJ T;  2D6F A;  5GJV B;  2MCN A;  1U5S A;  2CDT A;  4Z89 A;  2YRC A;  2KBT A;  1AWJ A;  2E4H A;  4RCC A;  3CD6 Q;  4KGX B;  2DA9 A;  4JLG A;  2LMJ A;  3U23 A;  1RL2 A;  3CMA A;  4M75 D;  2HNI A;  1X2K A;  2DL3 A;  3JCM h;  3DLL A;  4KGV B;  1T3L A;  3CMA Q;  4RTW A;  3I56 A;  3BFM A;  2E3H A;  2FPD A;  2EVR A;  4PKC C;  2K6D A;  1VIE A;  2W0Z A;  3OSS C;  4FYY B;  1MND A;  1K9M C;  3AT1 B;  1XJW B;  3QKJ A;  2YSQ A;  4C8Q B;  2D0Q B;  2W10 A;  2E10 A;  2PUO B;  1Y96 A;  2DL4 A;  1QCO A;  1OPK A;  2P4R A;  1GFC A;  3OYD A;  3VS7 A;  2OAW A;  2R5M A;  4DEX A;  4C92 D;  2RJD A;  2QGG A;  2D0N A;  3CXC P;  1HSQ A;  2OTL Q;  3JB9 F;  4DEY A;  3QZ5 B;  4QKU A;  1T0H A;  2BKD N;  3MP1 A;  4OB1 B;  4EMK B;  5LJ3 e;  4LN2 A;  4EPC A;  3JCM W;  3OYC A;  2PQW A;  2H3E B;  1AZG B;  3M54 A;  1RLP C;  3CBM A;  2C06 A;  2KT1 A;  4J9G A;  1VQM Q;  1OX9 A;  4ZTF A;  1X6O A;  1M90 C;  1JJ2 P;  4ZN1 A;  2NUT A;  1SEM A;  3HL8 A;  2WSF E;  4ATO A;  2LQW A;  3G6E T;  1M1K C;  1SSH A;  4OP0 A;  2RD1 A;  3LWI A;  1WA7 A;  3LYI A;  2PVD B;  2R57 A;  3JV3 A;  1TG0 A;  2EW3 A;  4BE0 A;  2HBW A;  2E64 A;  2O4X B;  2VV5 A;  5CKE A;  2QQB A;  4C8Q F;  1K73 C;  4PLI A;  1WXU A;  2PVG B;  2HDA A;  5CKD A;  1E7O A;  4R55 A;  1VQ7 A;  4OMF B;  4QQG A;  1JXO A;  2CGH A;  1I5L A;  3AHU A;  2XMF A;  2R5A A;  4C92 F;  4FL6 A;  1WXT A;  1ZX6 A;  1NPR A;  4PFO A;  2XI9 A;  3M4G A;  1AT1 B;  5AYF A;  1PNJ A;  1JB0 E;  1ZA2 B;  1Q86 R;  4DBH A;  2NUT B;  1OU8 A;  1XOV A;  1ZBX A;  4BB7 A;  3FEO A;  2BIV A;  2KR3 A;  2E1H A;  4E7S A;  4C0Z A;  1B07 A;  1BCM A;  2VKN A;  1VQ5 Q;  1Z9Z A;  3VUZ A;  8AT1 B;  4EIK A;  2KRM A;  3LX7 A;  3SD4 A;  2JNG A;  2CZ0 B;  1VQ6 Q;  2GQI A;  1BCO A;  5HKC A;  2CT3 A;  1VQ9 Q;  5IN1 A;  2EIF A;  4ZGJ B;  4BAC A;  1WHG A;  1RAB B;  4F7U E;  5HCK A;  3DLM A;  3CBP A;  3BE3 A;  2PNI A;  1FXX A;  1G83 A;  1M1G A;  3HRU A;  2BE7 D;  2G6F X;  4BY6 B;  1G3S A;  4M78 C;  4M7D E;  3REA B;  1NLP C;  3VS3 A;  1P92 A;  2LX9 A;  2JVV A;  3EG9 B;  3KXT A;  1SRM A;  3GLX A;  2FZG B;  2KYM A;  3UDC A;  2X3W D;  4E7L A;  4J6W A;  2VAS A;  5GAN 6;  2FZK B;  1VQP Q;  1YI2 T;  2ECZ A;  4PJO D;  3O8V A;  4JPB W;  1G3T A;  4C92 A;  4PJO A;  1WHH A;  4XTW A;  3JB9 H;  1PKS A;  3TVT A;  3OYB A;  1IXD A;  2RK2 A;  1H3Z A;  1BB9 A;  4N0A A;  3I55 A;  1K0X A;  5FWB A;  2RJE A;  4M7D D;  1NE8 A;  4QVC A;  3LLR A;  1LNX A;  4AFU C;  3SDZ A;  3H0H A;  1YBY A;  3OMC A;  2JT4 A;  3KBG A;  2K79 A;  4A4F A;  3P8D A;  3TSW A;  1B3Q A;  4CC7 A;  3QSU A;  3LH0 A;  4RMO A;  3SFM A;  2DIG A;  3NTH A;  3E19 A;  2DJZ A;  3M58 A;  3I5S A;  4IIM A;  4XTV A;  2HKQ B;  1TH7 A;  2CT4 A;  2K5I A;  2DMO A;  2EQJ A;  2CZ6 B;  1OV3 A;  4B9W A;  2QAS A;  4J9I A;  4KBM B;  2A28 A;  2LP5 A;  3SHW A;  2E5K A;  1UTI A;  1OU9 A;  2QEX T;  1GRI A;  5I11 A;  1O9S A;  4DA4 A;  2NYS A;  5CQX A;  3PFS A;  2EYZ A;  1EZZ B;  2M51 A;  2IVW A;  2F5T X;  4RTX A;  5KYU A;  2AKK A;  3QUI A;  4X34 A;  1XTD A;  1BBZ A;  2MWO A;  2I2L A;  3CMA T;  2L2P A;  4JRQ A;  2J6O A;  2ZPI B;  3NTI A;  3NHN A;  3JCM Q;  3E2U A;  4J7I A;  3A8M B;  4AG2 C;  1Q95 G;  4HCB A;  1RI9 A;  2GTJ A;  2V8J A;  3HFN A;  3OA6 A;  1G5V A;  1WXB A;  2AK5 A;  2K3B A;  3EH1 A;  4C5I A;  2F2W A;  4E7K A;  1QLY A;  1D1C A;  3CD6 T;  2CH4 W;  1YHQ A;  1SF9 A;  2XIC A;  2MI6 A;  1PHT A;  2YLB A;  4ELY C;  3MKD A;  2CP5 A;  4OGC A;  2K2V A;  2DD5 A;  1QWE A;  3JCM e;  4LE9 A;  2DEU A;  4J7F A;  3LWH A;  2AZV A;  2X51 A;  1WGS A;  3QXE B;  2E6N A;  5CAI A;  4JUV A;  2DK3 A;  1G8X A;  5FU7 B;  1VQ4 A;  3X28 B;  1S72 A;  2P0P A;  4C5E A;  2YRD A;  2E65 A;  2MK5 A;  2LQK A;  4C0G A;  4C8Q D;  3CME A;  1OI1 A;  2E41 A;  1I5O B;  4JJD A;  2KI7 A;  1R0C B;  3CPF A;  4HT9 A;  3M4Y A;  5L8R E;  5CKH A;  5KYN A;  1VQL T;  1S72 Q;  4LD9 K;  5IXF A;  2EQK A;  4YTL A;  1ZSG A;  3EAE A;  1AHJ B;  4ZNX A;  2RHY A;  4XTU A;  5GAO p;  5DLQ E;  1VQO Q;  2FRW A;  2QG9 B;  2FYK A;  2ZPF B;  2DL8 A;  2EGA A;  2O88 A;  3CXC S;  3C12 A;  1VIF A;  2DEQ A;  1HJD A;  4L5G A;  1WJS A;  3M53 A;  1YJ9 T;  1QCN A;  5LJ3 h;  4HKE A;  1UJY A;  1K4U S;  3CC7 T;  1X01 A;  2MAM A;  3G71 T;  3VRZ A;  1YJN A;  2LCL A;  1QCF A;  2ED1 A;  4OB0 B;  5KH6 A;  1R77 A;  4RKU E;  2QQR A;  3BDU A;  1M2V B;  2DNU A;  2XU8 A;  5GAO n;  1SHG A;  5KYX B;  3I56 T;  4M7D G;  2KAF A;  1FWZ A;  1OOT A;  1VQ4 Q;  3WXM B;  2MPX C;  3RR6 A;  2CP7 A;  5FRO A;  2JN0 A;  4A53 A;  1GCQ A;  4FYV B;  2AKL A;  4O6J A;  3I9Q A;  9ATC B;  1D1A A;  1S1N A;  4KUI A;  1I8F A;  3NFC A;  2DJQ A;  1TTH B;  3J80 E;  4E2F B;  2DET A;  2V8I A;  4B9X A;  1EIF A;  2DXT A;  1ZSZ A;  2M0Y A;  3OYI A;  2QI2 A;  2HSP A;  3S3M A;  1Q7Y C;  1M8V A;  1M1F A;  1H3H A;  4X1V A;  2L3P A;  1VQL Q;  3Q1J A;  1K73 U;  4OML A;  4Y28 E;  4DBF A;  2DBK A;  4LNP A;  2GNC A;  2HBP A;  1VQ9 T;  1YIT T;  2AIR B;  3GF5 A;  3EGX A;  2JTF A;  1I4K 1;  2ZPE B;  2CP2 A;  1R8O B;  2O9S A;  1LOJ A;  2HCK A;  1K8A C;  2OTL A;  4EMK A;  1YI2 A;  1IGU A;  1XQH A;  2EYW A;  3JB9 J;  2A0F B;  1UGR B;  3OYF A;  3D7S B;  1KC8 U;  2LZ6 B;  3MET A;  2HZY A;  3JCM g;  2LVM A;  1M9S A;  3ZEH A;  5DLO A;  5IHK A;  3M55 A;  2DLP A;  2ESW A;  2P4T A;  1LJO A;  2FB7 A;  1M2V A;  1KHC A;  3MP8 A;  2KY9 A;  2JM8 A;  4BY6 C;  3L2Q A;  1PSF A;  1QVF P;  1NJI R;  1ZQ1 A;  2DRK A;  1TUD A;  4ME7 A;  1PRL C;  3CC7 A;  2FEI A;  1MV3 A;  1YJN Q;  1U06 A;  2ABL A;  1G2B A;  2M16 A;  3V7S A;  2DTI A;  3REB B;  4E7J A;  1CSK A;  1WLP B;  3VRY A;  3ER0 A;  2PTK A;  3PVQ A;  2OTJ Q;  3A8O B;  4PJO C;  5CR2 A;  2A36 A;  2YDL A;  2QK0 A;  2QEX A;  1G3Y A;  2DL5 A;  1N8R R;  1GCQ C;  3L2Z A;  4M75 B;  4LDW A;  3A98 A;  4N4G A;  1JO8 A;  4M7D C;  3JCM V;  5GMK e;  3CCV Q;  1YJW A;  1W70 A;  1BYM A;  1HK9 A;  1QQJ A;  2YUN A;  2EQU A;  1VOM A;  1WHM A;  2LCC A;  3EFR A;  3CCS A;  4AFQ C;  1PSE A;  2K2M A;  2OI3 A;  3ME9 A;  4P5N A;  4RTU A;  2DAQ A;  1EX4 A;  2Y90 A;  1QVG A;  5CKF A;  2RI3 A;  3CCV A;  1RLQ C;  3QDR B;  5A0D A;  3M57 A;  4FT2 A;  4II1 A;  4C0F A;  2CP0 A;  3EFS A;  3M0Q A;  2COZ A;  3CCM A;  2DO3 A;  2FVU A;  4C8Q E;  1VQ8 A;  3PIP A;  2CP6 A;  4M77 A;  4CI0 C;  2YT6 A;  2OTL T;  3HSB A;  1I1J A;  3GOX A;  3NMZ C;  2LJ1 A;  2HD0 A;  1QVG S;  2YUO A;  4DBR A;  3P8B B;  1VQP T;  1Y96 B;  3VYH B;  1VQ4 T;  2QGF B;  2YHT A;  4FW1 A;  4PJJ A;  2ZAE A;  1BI1 A;  4A4H A;  2O01 E;  3CCL A;  3UF4 A;  2DXB A;  2RJF A;  3CCE Q;  2GBQ A;  1Y0M A;  1ZUU A;  3OS0 A;  2OAU A;  3PVL A;  2M0O A;  1JEG A;  2LX7 A;  2GCX A;  3O5Z A;  3VS6 A;  1VQK A;  3QO3 A;  4QVD A;  1KG1 A;  4GBQ A;  2PU9 B;  2JTM A;  4IUV A;  3CC4 A;  1VQ7 Q;  2D9T A;  2Y4Y A;  1QMC A;  2O31 A;  4HA8 A;  3TSZ A;  1M27 C;  4A54 A;  1KC8 R;  2RNA A;  3HPW A;  4OF1 A;  1CKB A;  2EJG A;  1U1T A;  4NS5 A;  2NLU A;  2HQH A;  3VV0 A;  3SEM A;  3EFO A;  4OMO A;  1M2O A;  5D7U A;  4M78 G;  3GP8 A;  3DB4 A;  3I5R A;  2LTO A;  5GAM h;  2HAX A;  4Z8A A;  2PZ1 A;  2RQV A;  2EJ9 A;  4M77 E;  3G71 A;  1VQL A;  1IRX A;  2H3J A;  3QHS A;  4M7A F;  4VUB A;  4AFS C;  3MEV A;  2P84 A;  1VQM A;  2EKH A;  5DM7 R;  2FPE A;  2GTO A;  3G4S A;  1K1Z A;  2VC8 A;  2AHJ B;  1Q82 U;  2A7Y A;  4J9C A;  1H8K A;  4RTV A;  3NTK A;  1J3T A;  5GAN 3;  1HD3 A;  4DOW A;  4V2S A;  3PT9 A;  1MV0 B;  4E7I A;  1IO6 A;  1RI0 A;  2HMA A;  2KNB B;  1C0M A;  3MHX A;  1SRL A;  2DYI A;  3CCQ Q;  1QVP A;  4M77 D;  5LJ5 d;  1Q82 R;  2BZY A;  3NGP A;  5A2Q E;  3THK A;  3TQ7 P;  3X24 B;  1QKX A;  1Q82 C;  1AZE A;  3VKI A;  3EHQ A;  4JJB A;  1NJI C;  1WJQ A;  2Y4X A;  4EMK C;  1UG1 A;  2VWF A;  1VQ8 T;  1BI3 A;  5GAN d;  4E7H A;  3EHR A;  5KYY B;  3EG3 A;  3R6O A;  1VYU A;  3OS1 A;  2DZC A;  5IAY A;  4J9E A;  5D6W A;  1UGQ B;  1WPY A;  1N9R A;  3SWN A;  2LT4 A;  2DVE A;  1GBR A;  2CUB A;  3H0I A;  2CH4 A;  4WTO B;  2F2V A;  2COY A;  2E12 A;  2DIQ A;  1RAC B;  4OMM A;  4Q5W A;  1X27 A;  1D0X A;  4A4G A;  3NPF A;  3I55 T;  2KT8 A;  1EFN A;  3UPU A;  1BI2 A;  1GCP A;  1M3B A;  8ATC B;  4MZP A;  3FB9 A;  1UFF A;  1Q86 C;  4F14 A;  2LJ0 A;  1MMA A;  2ZPH B;  4M7D F;  1W2B A;  4GY5 A;  1NLO C;  1UHF A;  3N5B B;  3JCM P;  2CSI A;  3L2R A;  1TU0 B;  2MWP A;  2QQA A;  1VQN A;  2DFU A;  3HFO A;  3EFO B;  5HK0 A;  1WZO A;  1B34 A;  1VYV A;  1K0S A;  5J39 A;  1M30 A;  4N4H A;  2CYZ B;  2XHC A;  2A08 A;  2KYB A;  1X69 A;  3JB9 G;  1WIE A;  2J6F A;  1YJ9 Q;  2DBM A;  4J9B A;  3EG9 A;  1LCK A;  3H41 A;  3OSV A;  2ZPG B;  3CCR Q;  2V26 A;  3MO8 A;  3UT1 A;  1TUG B;  1KIK A;  2KE9 A;  1WFW A;  2EGC A;  2F69 A;  3JAM E;  2V1Q A;  4JRI A;  4MZT A;  2XK0 A;  3ZL7 C;  5GAM j;  3V8L A;  2V8K A;  2BTT A;  4OB3 B;  5FU6 B;  2RMO A;  1AWW A;  1PG5 B;  2KXD A;  2C0I A;  4LDV A;  3RUX A;  5CIU A;  2FRY A;  3JCM f;  2X3X D;  2RI2 A;  1YN8 A;  2B8A A;  4R0K A;  1NZ9 A;  2VB6 A;  3M9Q A;  1MMG A;  4Z02 A;  1SG5 A;  4M77 F;  1QW1 A;  3MEA A;  1OPL A;  3CCM T;  3X25 B;  3CPW A;  3OYL A;  1QP3 A;  2OJ2 A;  1ZUY A;  3H0F A;  2QDY B;  3OYG A;  4ZTJ A;  5FRN A;  1WQW A;  4F04 B;  3CCE T;  4FW2 A;  1D3B B;  3JCM b;  1Q81 U;  2KQW A;  4J83 A;  3I56 Q;  1JU5 C;  1Q7Y R;  3X26 B;  1VQ7 T;  3CC2 A;  2RQW A;  3LGL A;  2C0T A;  2QTX A;  3JCM c;  4XU2 A;  2GGR A;  1M3C A;  2ZGW A;  1Q7Y U;  1Y71 A;  3I55 Q;  3FDR A;  4J6Y A;  2JM9 A;  3QYG B;  7AT1 B;  4NL2 A;  2QQS A;  2YRV A;  2DRM A;  1SHF A;  2R58 A;  5KE2 A;  5GMK j;  3S6W A;  2P0Q A;  3FJ5 A;  4RTY A;  2RJC A;  3RDV A;  4HXJ A;  3LH5 A;  2A37 A;  1M90 U;  1QKW A;  3DB3 A;  5GMK i;  4XK8 E;  2AT1 B;  4JJC A;  1VUB A;  2DIL A;  3OBY A;  1YFN A;  2RM4 A;  4C8Q A;  2ENM A;  2KSS A;  2DPP B;  4BI3 A;  3G4S Q;  5FLX E;  2YWW A;  3M0P A;  4BI4 A;  1M3A A;  3QG1 A;  1PWT A;  1X6B A;  5IT9 E;  5A0L A;  2IPO B;  4HVV A;  4J6X A;  5GAN 8;  1TSF A;  2GF7 A;  1K76 A;  3KFV A;  2VXE A;  4M75 G;  2K4Y A;  3EG2 A;  4M7A D;  5EG2 A;  4EMG A;  2FPF A;  1KQS S;  3JSC A;  5KYW B;  1GXI E;  1B34 B;  2RQT A;  1OZ3 A;  5CKB A;  1E6G A;  1RAG B;  3OS2 A;  4JLI A;  4PJL A;  3M56 A;  3GPL A;  4M75 E;  3FRN A;  1VQ8 Q;  4HCK A;  1VA7 A;  4IUP A;  3HRT A;  4X9C A;  2L89 A;  4DOV A;  1WYX A;  1D3B A;  2EQI A;  1YCS B;  4M77 G;  1I81 A;  2K57 A;  1K73 R;  4M7A B;  3SB2 A;  3HRS A;  3PTA A;  1ZSZ C;  3RIR A;  3IQL A;  3OB9 A;  4F17 A;  2QA4 A;  4O5V A;  2EJF A;  2RHX A;  1IGQ A;  2F1L A;  4FYX B;  4PJN A;  5C6S A;  1G3W A;  3CCE A;  2RB6 A;  3JRZ A;  3L2V A;  1RAD B;  2YXY A;  1Y07 A;  1YNZ A;  2J7I A;  3GBQ A;  2DE0 X;  1AWX A;  2KRO A;  3CC4 T;  4CC3 A;  4C92 B;  3CCU A;  5LJ3 f;  2LJ3 A;  1NYF A;  3OYJ A;  1YIJ Q;  2G3R A;  2X4X A;  5IXB A;  4C0D C;  1RAH B;  1VQ6 A;  3VS2 A;  5AT1 B;  1N8R U;  4PJM A;  1TOV A;  5GAM d;  4J5Y A;  3MEW A;  3RES A;  5IH2 A;  5KCH A;  3SWN B;  4HCC A;  2HL5 C;  4L6V 5;  3CCU Q;  2JXB A;  1UUE A;  2L5Q A;  3VJP A;  3M5A A;  1NEB A;  3QZ9 B;  3QJY A;  3VU3 C;  3RBB B;  1C1A A;  1H92 A;  4HCZ A;  3EGD A;  2EYQ A;  3MP6 A;  2HQX A;  1ZHI A;  2L3Q A;  3QJ6 A;  4F7U B;  1VQM T;  3I35 A;  1WJR A;  4QW2 A;  2RHU A;  3PMI A;  3H6Z A;  2QA4 Q;  1ZBJ A;  1OYX A;  1HYO A;  5KCO A;  2GFA A;  4X9D A;  2EPD A;  4FT4 A;  3TRE A;  4N0A C;  5FRM A;  2JW4 A;  1M5Q 1;  3CCR T;  1YI2 Q;  2NWM A;  3OYM A;  3CBO A;  5GAN h; 
#chains in the Genus database with same CATH homology
 2NLU A;  2RA2 A;  3JB9 H;  3OYH A;  5HY6 A;  3VV0 A;  3OYB A;  2RK2 A;  4DQ2 A;  1H3Z A;  2XDD A;  3P8H A;  4M78 G;  3GP8 A;  2EWN A;  1V29 B;  3DB4 A;  4JRK A;  4UC4 A;  4XAX B;  4N0A A;  4L59 A;  3I55 A;  1VQN T;  1K8A U;  2LTO A;  5GAM h;  2HAX A;  2RJE A;  4M7D D;  4OGE A;  4C5G A;  2PUK B;  1NE8 A;  4QVC A;  4XTY A;  3V8J A;  4LD6 A;  3LLR A;  4PJO E;  1LNX A;  5GAO q;  1OZ2 A;  2EJ9 A;  4M77 E;  3SDZ A;  1UGP B;  1YBY A;  3OMC A;  3G71 A;  1VQL A;  3KBG A;  5LJ3 d;  2H3J A;  3QHS A;  4M7A F;  1Y7X A;  4VUB A;  4A4F A;  3L2W A;  3P8D A;  3MEV A;  2ZPB B;  1VQM A;  3QSU A;  3LH0 A;  4RMO A;  3FIF A;  3SFM A;  3T9N A;  5DM7 R;  3G4S A;  2DIG A;  2VC8 A;  3NTH A;  3G6E A;  3E19 A;  2DJZ A;  3RMQ A;  3L42 A;  2AHJ B;  1IRE B;  3M58 A;  2A7Y A;  1JBM A;  1Q82 U;  2A3L A;  4XTV A;  3C4S A;  3NTK A;  1KD1 C;  3OYE A;  5GAN 3;  3S3O A;  1TH7 A;  2RI5 A;  5I2M A;  2K5I A;  2F5K A;  2O4X A;  2X4W A;  2EQJ A;  4DOW A;  2RHZ A;  5I2S A;  2CZ6 B;  1Q81 C;  4V2S A;  3PT9 A;  4JDS A;  4B9W A;  4PLL A;  4E7I A;  4EMH A;  1RI0 A;  5GAN 5;  2QXF A;  5GAN f;  4KBM B;  3MHX A;  4PNO A;  3CCJ A;  3CEY A;  3V7R A;  5LJ5 e;  1QVP A;  4M77 D;  5LJ5 d;  3CCQ A;  2RK1 A;  4GLK A;  5A2Q E;  3OBW A;  1VQP A;  2QEX T;  5GMK h;  1O9S A;  3JB9 D;  4DA4 A;  3X24 B;  5CQX A;  1KQ1 A;  3PFS A;  1Q82 C;  1SSF A;  3VKI A;  5CCA A;  3CCL T;  1NJI C;  1WJQ A;  2Y4X A;  3LGF A;  4MMK A;  2IVW A;  4EMK C;  4LDU A;  3VYG A;  2VGN A;  5CK9 A;  3PMT A;  4MDW A;  1VQ8 T;  1BI3 A;  2F5T X;  5GAN d;  1BKB A;  4E7H A;  1YJW T;  4WF2 A;  4JRP A;  3QUI A;  4X34 A;  1XTD A;  3X20 B;  3J7A F;  2CKK A;  2MWO A;  2I2L A;  4MZM A;  2RHI A;  3R6O A;  3DKM A;  3CMA T;  5J26 A;  4M7A E;  2DXC A;  3QPH A;  3OYK A;  4JRQ A;  2ZPI B;  3SWN C;  3J81 E;  3OS1 A;  2DZC A;  5IAY A;  1VQK T;  3NTI A;  5D6W A;  1UGQ B;  3JCM Q;  1WPY A;  3CCS T;  1N9R A;  4J7I A;  3SWN A;  3HHT B;  2LT4 A;  2DVE A;  3A8M B;  4HCB A;  2V8J A;  3HFN A;  4C8Q C;  1UGS B;  3OA6 A;  2EKO A;  1G5V A;  4RG2 A;  3CCV T;  1YJN T;  4Y91 A;  3OYA A;  4HT8 A;  3PGG A;  4C5I A;  2E12 A;  4IUQ A;  5M9O A;  2VYT A;  2DIQ A;  4C92 C;  3OMG A;  1UEB A;  4M75 F;  4JJN K;  2HQE A;  3KUF A;  4Q5W A;  4E7K A;  3CD6 T;  1KHI A;  4QVZ A;  1Q86 U;  3C95 A;  1YHQ A;  3JCM X;  3LW5 E;  3CPW S;  2XIC A;  4M78 D;  4LDY A;  2MI6 A;  3V7C A;  2YLB A;  4ELY C;  4A4G A;  2WSC E;  4OGC A;  2K2V A;  3I55 T;  5GAO l;  5DY9 A;  3UPU A;  2DD5 A;  3OQ5 A;  4D6W A;  1BI2 A;  3JCM e;  4MZP A;  1KQ2 A;  3FB9 A;  4TVR A;  4PJO G;  1Q86 C;  2K5F A;  4J7F A;  2ZCF B;  3LWH A;  3G7Z A;  1WGS A;  1BI0 A;  3QXE B;  1YJ9 A;  2E6N A;  5CAI A;  2KMT A;  4J8O A;  3ASK A;  3FLG A;  2XKO C;  4JUV A;  1UB4 A;  3RKX A;  5KE3 A;  2DK3 A;  2ZPH B;  2DTH A;  3OW2 S;  2OTJ T;  4M7D F;  4FIB A;  1W2B A;  1NPP A;  4GY5 A;  5FU7 B;  1VQ4 A;  3X28 B;  4M7D B;  1S72 A;  2P0P A;  4C5E A;  2E65 A;  3INZ A;  2LQK A;  4C0G A;  3N5B B;  2K3Y A;  2LT1 A;  1OI1 A;  3M59 A;  4C8Q D;  3CME A;  4QQD A;  3L2R A;  3JCM P;  2E41 A;  2MWP A;  3E9G A;  5A0G A;  3WVE B;  2QQA A;  2X4J A;  3GNF B;  4FSX A;  2P0K A;  4M75 A;  5CO7 A;  5C0M A;  5GAM f;  1VQN A;  3HFO A;  3MEU A;  4KT0 E;  1DJ7 B;  5HK0 A;  3URG A;  1B34 A;  5CQY A;  5GAN e;  1N8R C;  2L3R A;  3CPF A;  2XG8 D;  5J39 A;  4HT9 A;  4PJO B;  3M4Y A;  5L8R E;  5CKH A;  4F7U F;  4N4H A;  1WNL A;  1JRI A;  2CYZ B;  2WAC A;  3A8L B;  1VQL T;  1X75 C;  4RG8 A;  4LD9 K;  2XHC A;  3JCM J;  2EQK A;  2JZ2 A;  4R56 A;  1NJI U;  4M7A A;  4YTL A;  3RMS A;  4BI8 B;  3EAE A;  4M75 C;  1AHJ B;  4BE2 A;  2RH2 A;  3JB9 G;  2RHY A;  4BDZ A;  4XTU A;  5GAO p;  4BD3 A;  5DLQ E;  2X4Y A;  3RER A;  3TCJ A;  5LJ5 g;  1QP2 A;  4M78 F;  5GMK l;  3C94 A;  1JJ2 A;  2E6Z A;  2FYK A;  2ZPF B;  2MMP A;  2ZPG B;  1YCY A;  2ZZD A;  3OSV A;  1VQ9 A;  5GAN 4;  2L8D A;  4M77 C;  3HKS A;  1HXD A;  1M4Z A;  3E1S A;  3MO8 A;  3UT1 A;  3CXC S;  2XID A;  3C12 A;  4EDU A;  1VIF A;  2OTJ A;  1H64 1;  4M77 B;  4C0D B;  2DEQ A;  1VQO T;  4PL6 A;  4BUG A;  1BIA A;  1WJS A;  3M53 A;  4L5G A;  1VQ5 A;  1YJ9 T;  4E47 A;  2F69 A;  2X35 A;  4M78 E;  5LJ3 h;  5GMK m;  3JAM E;  1QVF S;  2XDB A;  3VUB A;  2DD4 A;  4HKE A;  4JRI A;  4MZT A;  2XK0 A;  3F70 A;  3JCM d;  2RO0 A;  2MF2 A;  3CC7 T;  2QA4 T;  4PJO F;  1S72 T;  2PVO B;  1VQO A;  5GAM j;  3CME T;  4N4I A;  3V8L A;  3CC2 T;  1X01 A;  2MAM A;  4C5H A;  2V8K A;  3G71 T;  5FU6 B;  4OB3 B;  1YJN A;  1N6A A;  5J3B A;  2LCL A;  4PJO A;  4OB0 B;  5KH6 A;  2CZ7 B;  4XU0 A;  1M1K U;  4RKU E;  4IKF A;  2QQR A;  3BDU A;  4LDV A;  5LJ3 j;  2XU8 A;  5GAO r;  5GAO n;  3I56 T;  3RUX A;  5CIU A;  3ZBD A;  4M7D G;  2IG0 A;  4M78 A;  2EQM A;  5GAN j;  4ZGE B;  2KAF A;  1FWZ A;  3JCM f;  2LNV A;  3TEE A;  1N9S A;  1BIB A;  2RI2 A;  3S3N A;  2B8A A;  3WXM B;  1NZ9 A;  4OB2 B;  3M9Q A;  4RCB A;  5LJ5 h;  2BUD A;  4LDX A;  2XD0 A;  4Z02 A;  5FRO A;  2GFU A;  2JN0 A;  1QW1 A;  4M77 F;  4XTZ A;  3MEA A;  4A53 A;  3CCU T;  2VGM A;  5CVI A;  4O6J A;  4C92 G;  3TU4 K;  2QQ9 A;  3CCM T;  3CXC A;  5GAN h;  4FM4 B;  1VQ6 T;  3FJP A;  3CCQ T;  3X25 B;  3A8H B;  3CPW A;  4KUI A;  2KK4 A;  5HK3 A;  3OYL A;  1I8F A;  3NFC A;  1JJ2 S;  1QP3 A;  5GAO m;  1YHQ T;  3OW2 A;  1YIJ T;  2E5Q A;  2D6F A;  3J80 E;  4NOY A;  4RCC A;  2QDY B;  3OYG A;  3A8G B;  4ZTJ A;  5FRN A;  3OYY A;  1WQW A;  4M7A D;  1U1S A;  1IZ6 A;  2V8I A;  4MML A;  4B9X A;  3JB9 I;  3CCE T;  4JLG A;  1D3B B;  3JCM b;  1EIF A;  1RL2 A;  1W4S A;  2DXT A;  1Q81 U;  3OS5 A;  2K3X A;  5GAN 2;  2KQW A;  1XNI A;  4J83 A;  3OYI A;  3CMA A;  3X26 B;  2QI2 A;  1VQ7 T;  3BW1 A;  3CC2 A;  4M75 D;  2HNI A;  3S3M A;  1Q7Y C;  1M8V A;  1M1F A;  3OYN A;  3LGL A;  4XQ3 A;  3V8K A;  2QTX A;  3JCM h;  3DLL A;  4M7D A;  3Q1J A;  3JCM c;  3BDL A;  1MHN A;  2FHD A;  3WVD B;  1K73 U;  4Y28 E;  3I56 A;  4XU2 A;  4BDY A;  3BFM A;  2JUF A;  4PKC C;  2HBP A;  2ZGW A;  1VQ9 T;  1YIT T;  1Q7Y U;  1Y71 A;  4C8Q G;  1VIE A;  3OSS C;  3GF5 A;  3FDR A;  1K9M C;  4J6Y A;  2JTF A;  1I4K 1;  2ZPE B;  3QKJ A;  4C8Q B;  2D0Q B;  3CD6 A;  2E10 A;  3PIO A;  2PUO B;  1Y96 A;  3QYG B;  5LL6 S;  1R8O B;  3PNW C;  3FC3 A;  1LOJ A;  4XU1 A;  3HP9 A;  4NL2 A;  2QQS A;  2YRV A;  2LQ8 A;  1K8A C;  2OTL A;  3OYD A;  4EMK A;  2R58 A;  1YI2 A;  5KE2 A;  2R5M A;  3S6W A;  5GMK j;  3QII A;  2LC4 A;  2P0Q A;  4C92 D;  1XQH A;  2RJD A;  3JB9 J;  5GAM e;  1UGR B;  2RJC A;  3OYF A;  3JB9 F;  1KC8 U;  3MET A;  3QZ5 B;  3MP1 A;  2BKD N;  4OB1 B;  3JCM g;  2LVM A;  5GAM g;  1M9S A;  3DB3 A;  3ZEH A;  4ZN3 A;  4EMK B;  5GMK i;  5I21 A;  5DLO A;  4XK8 E;  3M55 A;  5LJ3 e;  4EPC A;  1VUB A;  3JCM W;  3OYC A;  3OBY A;  2P4T A;  1LJO A;  2FB7 A;  2PQW A;  1KHC A;  3MP8 A;  3M54 A;  2RM4 A;  3L1A A;  4C8Q A;  3CBM A;  2KSS A;  2DPP B;  2C06 A;  4BI3 A;  2KY9 A;  3OY9 A;  1VQ5 T;  4BY6 C;  5FLX E;  3L2Q A;  1PSF A;  1ZQ1 A;  4BI4 A;  4ZTF A;  3QG1 A;  4ME7 A;  1X6O A;  5FU6 C;  1M90 C;  4ZN1 A;  3CC7 A;  5IT9 E;  5A0L A;  3HL8 A;  2WSF E;  4ATO A;  4J6X A;  2VUB A;  5GAN 8;  2GF7 A;  3G6E T;  2VXE A;  4M75 G;  2K4Y A;  2M16 A;  1M1K C;  4OP0 A;  3QYH B;  5EG2 A;  3V7S A;  4EMG A;  2RD1 A;  3E9F A;  3LWI A;  2LRQ A;  2DTI A;  1KQS S;  3LYI A;  3JSC A;  1GXI E;  1B34 B;  4E7J A;  4IUT A;  2PVD B;  1OZ3 A;  2R57 A;  3ER0 A;  5CKB A;  5D6Y A;  3GNG A;  4NL3 A;  3OS2 A;  2JOY A;  4JLI A;  2E70 A;  3M56 A;  3GPL A;  1KD1 U;  4M75 E;  3FRN A;  3A8O B;  4IUP A;  3HRT A;  4X9C A;  4PJO C;  2L89 A;  4OVA A;  4DOV A;  2M9U A;  2DTO A;  5CR2 A;  2E64 A;  4BE0 A;  4XTX A;  2KVQ G;  2O4X B;  2VV5 A;  5CKE A;  2QQB A;  1D3B A;  4C8Q F;  1K73 C;  3A5Z B;  4M77 G;  1I81 A;  1G3Y A;  2K57 A;  1FX7 A;  4PLI A;  2VXF A;  4M7A B;  3HRS A;  2PVG B;  3SB2 A;  3PTA A;  4JS4 A;  3L2Z A;  5CKD A;  1MGQ A;  4R55 A;  4M75 B;  1KQS A;  4LDW A;  4OMF B;  2CS7 A;  1VQ7 A;  4QQG A;  4BE1 A;  4M7A G;  4N4G A;  4ELZ C;  2CGH A;  2GQV A;  3RIR A;  1I5L A;  3OB9 A;  3AHU A;  2FL7 A;  5FU7 C;  2R5A A;  5LJ5 f;  4M7D C;  2QA4 A;  4C92 F;  3JCM V;  5GMK e;  4FL6 A;  4O5V A;  1YJW A;  1QVF A;  2K5L A;  2EJF A;  2CZ1 B;  2RHX A;  2EAY A;  1BYM A;  1HK9 A;  1NPR A;  1WQ7 A;  4CRI A;  4IUR A;  2XI9 A;  2YLC A;  4KUL A;  2EQU A;  3M4G A;  1YIT A;  2LCC A;  3EFR A;  5AYF A;  4M78 B;  1G3W A;  4QQ6 A;  5C6S A;  3CCE A;  3CCS A;  1JB0 E;  4JS5 A;  2DXU A;  1PSE A;  4C92 E;  3ME9 A;  2RB6 A;  4P5N A;  4XU3 A;  2DAQ A;  3JRZ A;  2Y90 A;  3L2V A;  5LJ5 j;  1QVG A;  1Y07 A;  2RI3 A;  5CKF A;  3CCV A;  1XOV A;  3QDR B;  1ZBX A;  4BB7 A;  3FEO A;  3M57 A;  5A0D A;  2BIV A;  4FT2 A;  2E1H A;  4II1 A;  3CC4 T;  4A4E A;  4C0F A;  4C0Z A;  4C92 B;  3CCU A;  2QEX A;  5LJ3 f;  3H8Z A;  4M7A C;  1KC8 C;  3EFS A;  4IUU A;  3BY7 A;  3G4S T;  3VUZ A;  3OYJ A;  3RKW A;  2G3R A;  2X4X A;  2DO3 A;  3CCM A;  3LX7 A;  4C0D C;  2KDS A;  1VQ6 A;  3SD4 A;  1N8R U;  2JNG A;  3CCR A;  4MDX A;  2CZ0 B;  3RKY A;  5GAM d;  2FVU A;  4KUD K;  4C8Q E;  5HKC A;  4J5Y A;  1VQ8 A;  3PIP A;  4M77 A;  3MEW A;  2M1H A;  3RES A;  3MCA B;  5KCH A;  5IN1 A;  3SWN B;  2DZ9 A;  1YIJ A;  4HCC A;  4CI0 C;  2OTL T;  4L6V 5;  2EIF A;  3ZFJ A;  1W2B S;  3HSB A;  4ZGJ B;  3QBY A;  4BAC A;  3GOX A;  2HD0 A;  2L5Q A;  3VJP A;  1QVG S;  3M5A A;  4F7U E;  3QZ9 B;  3P8B B;  3L2U A;  4FU6 A;  1VQP T;  1Y96 B;  3VYH B;  1VQ4 T;  3DLM A;  2YHT A;  3QJY A;  3VU3 C;  3CBP A;  5LJ3 g;  4F7U A;  1FXX A;  4HCZ A;  1BI1 A;  2EYQ A;  4A4H A;  2O01 E;  1M1G A;  3MP6 A;  2HQX A;  1M90 U;  5GAN g;  1ZHI A;  3HRU A;  3CCL A;  2DXB A;  3GIB A;  2RJF A;  3QJ6 A;  4F7U B;  4BY6 B;  1K9M U;  1G3S A;  4M78 C;  3OS0 A;  1VQM T;  1U8R A;  1WJR A;  2OAU A;  4F7U G;  4M7D E;  2M0O A;  4QW2 A;  2RHU A;  4A4K A;  3UWN A;  3PMI A;  3H6Z A;  2GCX A;  1VQK A;  3QO3 A;  1P92 A;  2LX9 A;  1N27 A;  2JVV A;  3KXT A;  4QVD A;  4NS5 A;  1KG1 A;  1OYX A;  3GLX A;  3UDC A;  2PU9 B;  2JTM A;  2XDP A;  4IUV A;  3CC4 A;  4E7L A;  2D9T A;  5KCO A;  2Y4Y A;  2GFA A;  5GAN 7;  2LDM A;  4X9D A;  4FT4 A;  4J6W A;  4HA8 A;  3CCJ T;  3TRE A;  5GAN 6;  4N0A C;  5D6X A;  1YI2 T;  5FRM A;  4ZGD B;  4PJO D;  4A54 A;  2WSE E;  1M5Q 1;  3O8V A;  3HPW A;  3CCR T;  2DKG A;  1G3T A;  4OF1 A;  2EJG A;  4C92 A;  3CBO A;  2EFI A;  3OYM A;  1U1T A;  4XTW A;  1O75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...