5LJ3j

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 13
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3j00
1BIAA 4MMLA 4M7AE 3JB9I 1WPYA 4XTUA 5GAN7 2VXFA 1B34B 2Y90A 4M7AB 5GAN2 4PJOG 1I8FA 3JB9H 3V8JA 1I5LA 2RM4A 2I2LA 3VU3C 4QVCA 4Y91A 5LJ5d 2CGHA 5GAN8 5GAN4 5GAOn 2E1HA 4J5YA 4C92B 3JB9J 4M7AG 2E64A 4MMKA 4F7UA 3FJPA 4A54A 5GAMf 5GAMh 5GANf 3RESA 3BDUA 4F7UE 3HFOA 4F7UF 4X9CA 5GAMg 5GAOl 1HXDA 3JCMJ 3JCMQ 3JCMV 1WNLA 5GMKj 4EMGA 3PGGA 2RA2A 4M7AC 4F7UB 5GAOp 2DTHA 4C8QA 3QSUA 4OP0A 5GAN3 1WQ7A 4PJOD 4C8QE 1MGQA 4C8QF 5GAOq 2E41A 5LJ3h 5LJ3g 4M78A 4F7UG 5GMKm 4C8QB 4M7AD 4M78F 2EJFA 2EJGA 1BIBA 4JRIA 1D3BB 5LJ5j 4EMHA 3V8LA 1U1TA 4HT8A 4EMKA 4C8QG 3FB9A 4C92D 4M77A 5LJ5e 2ZGWA 4M77E 4M77F 2RB6A 4JLIA 5GAN5 1N9RA 2DXTA 3BY7A 3SWNA 4EMKB 4C8QC 3JCMW 3JB9D 1M8VA 4M77B 5GMKh 4XQ3A 3JCMf 3QHSA 3JCMg 2DZCA 4WF2A 5GANh 4XTXA 3JCMb 5GANg 3QO3A 4M77G 3EFSA 2RD1A 4C8QD 4M7DA 4J6YA 1JBMA 2EWNA 2DVEA 4M7DE 4EMKC 1N9SA 1I81A 2VXEA 4M77C 5LJ5f 4M7DF 3HSBA 5LJ5g 2YLCA 2E10A 3V7RA 5GAOr 4M7AA 2EAYA 4M75A 1JRIA 4M78E 3SWNC 1H641 4XU2A 4M75E 2YHTA 3SB2A 4M75F 2DKGA 1M5Q1 4RCBA 2K57A 1KQ1A 4M78B 3M4GA 1TH7A 4M7DG 4M77D 1LOJA 2DZ9A 5LJ3d 5GMKi 5GAOm 4JUVA 1LJOA 1X01A 2DTOA 4QVDA 2JN0A 4M78G 5I21A 4M7DC 1KQ2A 4M75G 4RCCA 3L1AA 4XTYA 5GAN6 4XU0A 1Y96A 4HA8A 3JCMh 2FB7A 4DQ2A 4M78C 3GIBA 4J6XA 3V8KA 4M75C 3SWNB 1LNXA 2DTIA 4XTWA 3INZA 4PJOA 4M7DD 3RKXA 5GAMe 3EFRA 4PJOF 3RUXA 3JCMc 5DY9A 4N0AA 4M78D 2YLBA 5LJ5h 5LJ3j 5GAMd 4M75D 5GANd 4M7AF 4XU1A 4M7DB 4XTZA 4XTVA 3QUIA 5LJ3e 4C92A 4PNOA 1WQWA 4C92E 5GMKl 2FYKA 4C92F 4M75B 3BW1A 4NL2A 4XU3A 4V2SA 3RERA 1HK9A 2DEQA 2QTXA 1YCYA 3V7SA 3AHUA 3JB9F 5CAIA 4PJOC 3JCMP 4HT9A 2DJZA 3L2ZA 4N0AC 3RKYA 3RKWA 4JRKA 4C92G 4J6WA 3HFNA 1I4K1 1U1SA 2DXUA 2E65A 3V7CA 5GMKe 5GAMj 5GANj 3JB9G 1D3BA 5LJ3f 2HNIA 4C92C 3JCMe 3RIRA 1Y96B 2EJ9A 4A53A 5GANe 4PJOE 3BFMA 3JCMX 2VC8A 1B34A 4NL3A 3FIFA 4X9DA 3JCMd 4NOYA 4PJOB
chains in the Genus database with same CATH superfamily
1I07A 1BIAA 1VQ4Q 2LX7A 1B34B 1OX8A 3OYFA 2K7AA 4IUUA 2I2LA 1QW1A 2VGMA 4BY6C 1YWPA 5GAMg 1UUEA 2E12A 2LJ1A 3HRTA 3JCMJ 3M0RA 5GMKj 5J39A 3LLRA 1NLPC 2E6ZA 5KE3A 1GCQC 3CMAQ 4C0DB 3NGPA 2QQRA 3FB9A 3SDZA 4RKUE 1TWBA 1H92A 2JM9A 3U23A 1JEGA 4RTVA 3FJ5A 3EG3A 3CXCS 1R0BG 3NTHA 4O6JA 3VS3A 5GAOr 4IUPA 5HK3A 5CIUA 1K8AU 1WHHA 1ZA1B 1S72T 5GAOm 2V1RA 2JN0A 5HKCA 1S72A 3C95A 3E19A 4J9BA 3RKXA 3EG9A 2AHJB 1X6GA 4OGCA 1RAFB 5LJ5h 1BI0A 2CDTA 3SHWA 5LJ3e 4LD6A 4L6V5 5CKEA 1Q86C 2VYTA 3HL8A 3ZL7C 3CEYA 2JMCA 3QKJA 4BE2A 3JV3A 1K4US 1PCXA 3RKYA 5IHKA 4KUDK 4VUBA 3GF5A 2LZ6B 2J6FA 3CMAT 3FEOA 3CPWS 1JJ2S 1HYOA 3CMAA 1NEBA 1B07A 2CH4A 5KYWA 5FLXE 3A98A 1QWEA 1PD0A 1UG1A 2XU8A 5GAN2 5KYYA 1VQOQ 1WHGA 2A3LA 1G3WA 4K11A 1WX6A 4J5YA 2F2VA 2E3IA 2KY9A 3HFOA 1GL5A 2BTTA 4GLMA 4C8QA 1D1AA 1U5SA 2E41A 1N8RR 4MZTA 2HZYA 2JW4A 4BB7A 2EJGA 4CI0C 2RHXA 5I2SA 1KK7A 4PJJA 2DBKA 1M3AA 2Z0WA 4FYVB 2K3XA 4JPBW 2EQUA 5GJVB 1PG5B 3A1PA 3KBGA 4M4ZA 4XQ3A 4BI8B 1WHMA 2DZCA 1SHFA 2EGAA 1WXBA 1UEBA 4DBFA 2R5AA 1G2BA 5LJ5g 4N4IA 4E47A 2RQUA 3KXTA 1OPKA 4DBRA 1G3SA 2RI3A 3S3MA 2EYQA 2F2XA 1G3TA 4KRTA 2DERA 3EG2A 1Q7YC 4JRQA 2V8IA 3L2UA 3QG1A 3RUXA 4DA4A 2FG0A 1AEYA 5DLQE 4ZTFA 2L3RA 4OMLA 2LTOA 4C92A 2QEXT 2ZPFB 1BB9A 4PNOA 2AKLA 1UHCA 2CUBA 2QEXA 4C5HA 3RERA 1EFNA 4R0KA 1GFCA 3DLMA 4N0AC 1M2VB 2L3PA 2XI9A 2KQWA 3NTIA 1JXMA 1C1AA 1MNDA 2QA4Q 1W6XA 1BI2A 2CSIA 2HBPA 3QXEB 1C0MA 3F70A 4M7AA 1X2KA 1KQSP 1K0SA 1N8RU 2R58A 2KYBA 3P8BB 2DK3A 3REAB 1IXDA 2E1HA 5GAMf 2SEMA 4DOWA 5GANf 4X9CA 3L2VA 1HXDA 2C06A 4RTZA 3EG0A 4PL6A 1D1CA 2K9GA 1QKWA 2DIGA 3V8LA 1JQQA 2HQHA 1YITQ 1W4SA 2DRMA 4JJNK 3L2RA 3TVTA 1Y57A 4JLIA 1BKBA 3JCMW 2COZA 2KT1A 2L5QA 3M53A 2HKNA 4A4EA 1T3SA 2XKOC 2KRMA 4B9XA 2X3XD 2DX1A 2JNGA 1OV3A 1AWJA 2MWPA 2E6NA 1R77A 2LCLA 3EGUA 3EFOA 2YHTA 2VV5A 4L5GA 1RI0A 1ABQA 2CUDA 3LH5A 3OB9A 3MCAB 2E3HA 2KMTA 1UJYA 1IGQA 4KULA 1NE8A 2QA4T 2O31A 4QKUA 4MDWA 3CPFA 2DL5A 2QA4A 2LCCA 3QIIA 1NEGA 5D6XA 3OYIA 2DD4A 5CCAA 4M78D 3CCUQ 3WXMB 4JLGA 5CQYA 1KC8C 1H3ZA 3AHUA 5I11A 3T9NA 2R57A 4KUIA 3QPHA 3L2ZA 3DKMA 1K1ZA 5CKFA 3OYJA 5GJWB 1YITT 3GNFB 2FVUA 1YITA 4PKCC 2HSEB 2M9UA 1IB8A 3JB9J 1SSHA 2DL8A 2F2WA 3HTRA 2OTLT 3JSCA 1TUDA 1JXOA 2OTLA 1VQ9Q 2LX9A 3CC4Q 1PHTA 1ZSZB 2GF7A 4M78F 1K9MU 3HRSA 2VKNA 4IURA 2EQMA 3MP6A 3QYGB 4CC3A 1U1TA 1IO6A 1GXIE 1NM7A 5A0DA 4J7FA 4PFZA 4PJLA 2ZPHB 4WCIA 4RTWA 4IKFA 2YDLA 3A8MB 4C8QD 4D8DA 3PIPA 4AG2C 2O4XB 1BCMA 3RNJA 5LJ5f 1W1FA 3GBQA 2EAYA 4M78E 3FDRA 3QWYA 1BI1A 3M58A 4RCBA 2YUOA 1X01A 1Q82U 3P8DA 1QQJA 1QVGA 4XU0A 1FX7A 3GIBA 1WJQA 4FYYB 5HCKA 2FL7A 1YJ9Q 5GAMe 2A0FB 2P4RA 4NS5A 4E7SA 1TTHB 4J9FA 4IIOA 2J06A 1VQPQ 2ZPBB 4PK4A 4XTZA 1MHNA 2RQRA 4PJMA 3EH2A 4BE0A 2QGFB 2DL4A 4A4KA 4HT9A 2KRNA 2HKQB 2H3EB 1VQ9T 1OI1A 4RUGA 4JRKA 3CC4T 1NJIC 3HFNA 5DM7R 1NLOC 1VQ9A 3JB9G 4Y92A 3CC4A 2HL5C 4NL3A 2OTJT 1XJWB 3OS2A 3JB9I 3OYNA 1X43A 2JTMA 2OTJA 5FRMA 1KG1A 1PRLC 4LXCA 3LGLA 1VIFA 2FRWA 5CKBA 1M90R 1OPLA 1ZSGA 4CC4B 1K73U 2DEUA 4OB0B 2X4WA 4C8QE 3PFSA 4KGZB 1VQ7Q 1RUWA 4M7AD 4JRIA 1HD3A 4BY6B 5LL6S 2L3QA 3JB9D 3QJ6A 2HSPA 1D09B 2RO0A 2EGEA 1VQNQ 1T0HA 3KUFA 3QO3A 2OAWA 3C12A 2LRQA 4OGEA 1VQPT 2DIQA 1AZEA 3NHNA 1VQPA 4HCBA 2KBTA 3OYHA 2VUBA 4M75A 3SWNC 1H641 2AKKA 3SB2A 1ZBXA 3EAEA 5FW9A 2ZPIB 4M78B 5IAYA 3CBOA 4KT0E 1M1KR 1UGSB 2DRKA 4BUGA 4JS4A 2P4TA 2KROA 2RHYA 3EH1A 4HKEA 1KSWA 2OAUA 4DQ2A 3JCMh 5HY6A 1VQKQ 1RAIB 2DTIA 5FWCA 2ED1A 2PTKA 3OMGA 5LJ3j 5GAMd 5GANd 4M7AF 1OZ3A 2PVOB 3EGXA 2XMFA 3M0SA 4AFSC 3JAME 1ZUYA 4C92E 1UDLA 5GMKl 2ABLA 4JZ4A 4NL2A 1HK9A 2HQXA 4PJOC 2FHDA 3JB9F 2RJEA 4CRIA 1QMCA 1TSFA 1VQ7T 1D3BA 3G7ZA 2BKDN 1KD1R 1VQ7A 3GNGA 3SFMA 2AZSA 3OYGA 3L2WA 4M7AE 4JDSA 2LQWA 5KYWB 1K8AC 2NLUA 1QVFA 1VQNT 1TG0A 4N4GA 3PE0A 3VU3C 2CP2A 3A8HB 4A54A 4E7LA 1VQNA 2JUFA 3LWIA 2D6FA 1KIKA 3PNWC 3PGGA 1JB0E 4EMGA 1MMNA 3VS0A 3PIOA 3QSUA 1BBZA 1WXTA 2NUTA 4IIMA 4C8QB 3DLLA 3X25B 1ZUUA 1WYXA 4PLIA 2XHCA 1DJ7B 4E7IA 2DJQA 2IVWA 3QHSA 3JCMg 5I2MA 1WGSA 5GANg 3EFSA 1O9SA 4BI3A 2AZVA 2OX7A 4KBMB 1IHWA 2MK5A 2J6KA 3OYAA 2EPDA 3HSBA 4BACA 4EIKA 4HVWA 3AT1B 1X75C 2EKOA 1VUBA 2YT6A 4DEXA 4LN2A 3OBYA 1EX4A 1KQ2A 4XTYA 1VQ5Q 3CD6Q 4M78C 3H8ZA 1PD1A 4QQ6A 3ZEHA 1Z9ZA 5CKDA 3I5RA 3OYEA 1KJWA 1SF9A 1M9SA 1KD1U 1OULA 2NUPB 2X4JA 4ESRA 1ZLMA 4LDUA 3GOXA 2E65A 1SKUB 4J7IA 4KGXB 1VQ4T 4E7KA 2BZYA 3HHTB 3SEMA 2L3SA 2QQ9A 3NTKA 4MMLA 1VQ4A 1YJWQ 2RJFA 2VXFA 1WI7A 4M7AB 1ACMB 3M0TA 4LDWA 2E70A 1KQSS 2D8HA 5LJ5d 4F7UA 1UB4A 2X4XA 3TSZA 2CP3A 1Q86R 2DNUA 1MGQA 1XNIA 5C0MA 2DAQA 3M0PA 1G5VA 1WJRA 3ME9A 4M77A 1VQ5T 3CD6T 4PFPA 1YI2Q 3OS0A 1N5ZA 3PTAA 2YWWA 4C8QC 1VQ5A 3CD6A 2GBQA 5L23A 3OYKA 1SSFA 3JCMb 2V8JA 1KHIA 4M7DA 2EW3A 2EWNA 2M0YA 2O9SA 4AG1C 1N9SA 3LWHA 2K3YA 3V7RA 3CCQQ 3G71Q 3CCEQ 3OW2A 1P92A 1RL2A 1Y71A 1N8RC 4MDXA 3PVQA 3OS1A 1NG2A 5KE2A 1ZHIA 4FT4A 3TQ7P 2RQTA 1UGRB 3CC7Q 2DLPA 3CMEQ 1U3OA 4GLKA 1V1CA 2LNVA 2NWMA 2JS2A 1YJWT 2VGNA 4QQDA 2X51A 4RTYA 4D8KA 3OYYA 2YLBA 1RACB 4CC2A 1QP2A 1YJWA 2MAMA 4M75D 1AD5A 3I56Q 2DVJA 2R5MA 3CCMQ 2COYA 4FW1A 2GNCA 3CC2Q 2FZCB 3R6OA 1YN8A 2XDBA 2XDPA 1H3HA 2CKKA 4ZGDB 4ZN3A 3OMCA 2EYWA 2FPEA 5GMKe 2KSSA 2D9TA 3H0IA 4C92C 4A53A 2FPFA 2E5KA 2VC8A 5IH2A 3N5BB 1YWOA 3X28B 2JTEA 1WPYA 1UECA 2P84A 5GAN7 1VQOT 3VJPA 3A8LB 3V8JA 1VQOA 4J9DA 1T3LA 4JRPA 2VASA 2K5LA 3M5AA 1YP5A 4M7AC 4JJDA 2FRYA 1I5OB 4PJOD 2KXCA 1FYNA 4A63B 2YXYA 5LJ3h 3CCQA 1NYGA 1QVPA 2IIMA 4E7HA 4HT8A 8AT1B 2KEAA 3CC7T 1FMKA 3CMET 1GBQA 2O9VA 3CXCA 2CP7A 3CC7A 3JCMf 3CMEA 1QCNA 1RAHB 3TREA 3I56T 3NFCA 3MEVA 2E10A 3CC2T 5ECAA 3I56A 1GCPA 4M75E 1D0ZA 1ZA2B 2QI2A 3CC2A 2YSQA 2CZ1B 1LOJA 3CCRQ 4M78G 4C0FA 1PKTA 5J26A 4HA8A 1OQKA 2FB7A 1A0NB 2DXBA 4Y28E 1TXQA 3P8HA 9ATCB 1KFZA 2KVQG 2HDAA 1VQMQ 3CCVQ 4PJOF 3C4SA 3H9NA 3L2QA 3X26B 2CP0A 1PSFA 4XTVA 1K9MC 3PMIA 3M0QA 4HVUA 4LE9A 2FYKA 4HCCA 3NPFA 1VQLQ 2CYZB 4L59A 3TCJA 3CPWA 2HBWA 1JJ2A 2CSQA 2GCXA 4LDVA 2ROLA 4LD9K 2HNIA 4OB1B 3RIRA 2JM8A 3H0HA 4PJOE 4LUEA 4C0GA 2QASA 3VS6A 1RLQC 2DFUA 5KYUB 3LX7A 3REBB 3X24B 1I5LA 1YNZA 2V26A 3OYBA 2YRCA 3ULRB 1SG5A 2RJDA 1Q82C 3BDUA 1RLPC 1WJSA 3UA7A 1WNLA 1PKSA 4XK8E 3I55Q 1R0CB 2DTHA 1M2OA 5A2QE 1WQ7A 2GQVA 1AWXA 2KGTA 2VWFA 4J9GA 3CCRT 5CO7A 4EMKA 4C8QG 3S6WA 4XAXB 4J9IA 3CCRA 1N9RA 4FT2A 3BY7A 1VQMT 4OMPA 3CCVT 4XTXA 2K2MA 1VQMA 3VV0A 2RD1A 2ED0A 3CCVA 3RMQA 5CR2A 3EGDB 2L0AA 1IREB 2QTVA 1W70A 1JRIA 2DXCA 2KYMA 2RNAA 1VQLT 2LC4A 4ME7A 4M77D 1NBEB 4RTUA 3RDVA 1VQLA 4EDUA 1RAEB 1AT1B 4JUVA 1VQ6Q 1M2VA 1UE9A 2ECZA 2COWA 4RCCA 1W2BS 1QVGP 3EHQA 2EQJA 2DD5A 1M3BA 2WSEE 3SWNB 3HKSA 4M7DD 1K73C 1PM3A 3CCUT 1QKXA 2BE9B 2M1HA 3HPWA 4F16A 3CCUA 2X35A 4XU1A 3LGFA 1BK2A 4II1A 4ZTJA 3UF4A 4RTXA 3CBMA 1D0YA 1AWOA 2JT4A 2C0IA 3I55T 2KAFA 3G4SQ 2DMOA 2DJZA 3UPUA 3I55A 1VQ8Q 3RKWA 4C92G 2KI7A 3JCMe 1Y96B 5GANe 2GQIA 2E5QA 3JCMX 2F5TX 4PJOB 2VVKA 2Y90A 1KHCA 2QQBA 2JXBA 4Y91A 2K6DA 2QXFA 4M7AG 3OYLA 1HSQA 1UGPB 3ZBDA 2K5IA 4F7UE 3OYDA 1WA7A 1X69A 3UT1A 4LDYA 3JCMQ 5A0GA 3PVLA 4OP0A 2CT3A 2LVMA 3VS5A 5FU6B 4C8QF 5CVIA 2LT4A 1MV0B 1VQ6T 4EMHA 2CZ0B 2NUTB 1NJIR 4C92D 3S3OA 1VQ6A 4M77E 1Y7XA 5I22A 4FM4B 3C0CA 2K3BA 2DL3A 2LQKA 3CQTA 2LP5A 1G8XA 3QDFA 4WF2A 3J80E 1PSEA 1X6OA 2GTOA 3FRNA 4M7DE 2CH4W 1I81A 4JJCA 3NMZC 1TU0B 1XQHA 2RN8A 4BDZA 4GY5A 3G4ST 1TH7A 2B8AA 3GLXA 3HRUA 4Z02A 3FC3A 1LJOA 4ATOA 4KH1B 2HCKA 3G4SA 7AT1B 2PNIA 3ZFJA 5I21A 2GFAA 3GP8A 1YJ9T 4FSSA 4HVVA 1JO8A 1YFNA 4M75C 2EQKA 1VYTA 1YJ9A 1OX9A 2PUKB 4J9CA 1I1JA 2PU9B 1X27A 4OMMA 2ZZDA 5AYFA 3C94A 1QWFA 2EYZA 4C92F 1WXUA 4XU3A 3M57A 4V2SA 3J7AF 3QBYA 1ZSZA 2IPOB 2DXUA 3D7SB 1WHKA 5LJ3f 4QT7A 2YUQA 3CCLQ 1WFWA 1X6BA 3JCMd 3EG9B 1UJ0A 1QVFP 1PRMC 5GAOn 2LQ8A 1LVKA 3A8GB 1VOMA 2K79A 4MMKA 3FJPA 5GAMh 2O4XA 5GAOl 1OU8A 3MP1A 4F7UB 1YBYA 1M90U 4ELZC 4RMOA 2RH2A 1Y0MA 2LMJA 1VYVA 4UC4A 1XOVA 1T0JA 1BIBA 2MI6A 4QQGA 1JU5C 2DE0X 1W2BA 4ANJA 4OVAA 2MYSA 5LJ5e 1KD1C 3HP9A 4X34A 5FU6C 2KXDA 1UGVA 2DXTA 3WVEB 1RADB 4M77B 5KCHA 1K0XA 5KYYB 1CKBA 1YIJQ 2EKHA 1QCOA 2KE9A 4ZGEB 5D6WA 3CCSQ 2NYSA 2BZXA 4RTTA 1K8AR 3META 2K2VA 2VXEA 1Q81R 3GPLA 4QVZA 2FPDA 1X2QA 5FROA 2DKGA 5A0LA 1AWWA 3OSSC 1AOJA 4CC7A 1VQKT 3G6EQ 1CKAA 3OYMA 1BYMA 2YRDA 4DOVA 2KRSA 1VQKA 2JJ9A 4FYXB 1M1KU 4J6XA 3CCLT 2P0KA 4LDXA 5FU7B 4IUQA 2L2PA 3CCLA 2NUZA 2JMAA 2J6OA 5KYNA 1OU9A 1UTIA 3QJYA 3M56A 1WQWA 2ZPGB 4E6RA 2M51A 1C6VX 1YCYA 3VS4A 3OQ5A 2BE7D 2ATCB 1F1BB 5IXFA 3RBBB 4O5VA 1PC0A 2SRCA 1BI3A 4R56A 4PFOA 5CKHA 2MIOA 2MCNA 4R55A 2CZ6B 2BUDA 1OYXA 1LCKA 4KGVB 3PMTA 1GCQA 2MMPA 1YIJT 3EHRA 3TSWA 1WHJA 1GRIA 2RM4A 2LJ3A 4PLLA 4QVCA 5GAN8 2G6FX 4C92B 1YIJA 3CCST 2ESWA 4F17A 3CCSA 2RA2A 5GAOp 2RJCA 4Q5WA 2EVRA 2XIDA 4M78A 5GMKm 4C5EA 1WIEA 2M0OA 3G6ET 1Q81U 1M30A 1RAAB 1E7OA 3G6EA 5KH6A 5GAN5 2QDYB 2DYBA 3I35A 4FYWB 3QZ9B 4GBQA 1FWZA 3CBPA 2HEQA 4AFQC 3A5ZB 4C5IA 2HAXA 5M9OA 2F1LA 1QLYA 3E9GA 2DVEA 4M77C 1HJDA 1G3YA 2K5FA 1J3TA 2LQNA 4KH0B 3OW2P 2JZ2A 1M5Q1 1EZZB 2K57A 3M4GA 1VA7A 4P5NA 4RG8A 2DZ9A 4N4HA 4QVDA 6AT1B 2Y4XA 4M7DC 2DF6A 4M75G 2LNHB 2QQAA 1IGUA 2EFIA 4B6MA 2EYYA 3IQLA 2V8KA 1M4ZA 1G83A 2C0OA 1CSKA 1VYUA 5DY9A 3H41A 1RABB 2D0QB 5FU7C 2A08A 3MEUA 3EFOB 3BE3A 5FWBA 2QEXQ 2P0PA 2DETA 2RHIA 4AFUC 1BCOA 1E6GA 1U1SA 2OJ2A 4EPCA 1E6HA 4ZNXA 2DPPB 5KYXA 3JRZA 2F69A 2EJ9A 1B34A 1RAGB 2PVGB 3VUZA 4X9DA 3LYIA 4FSXA 2O2OA 2XDDA 4PJOG 4RG2A 4C0DC 2MF2A 3RESA 3JCMV 3OY9A 1FXXA 1N6AA 2O88A 4A4FA 1M1FA 1NPPA 3MJXA 2EYXA 4IUTA 3M0UA 2Y4YA 1Q86U 2OI3A 1YI2T 1M27C 3URGA 3UATA 1Q7YR 1YI2A 1MNEA 3CXCP 4DEYA 1ARKA 2DYIA 5EG2A 4EMKB 1D1BA 5DLOA 2JOYA 3KFVA 1AVZC 1Z9QA 4J6YA 3CCQT 3G71T 2LCSA 1SPKA 3CCET 1B3QA 1M3CA 2DM1A 3OBWA 2WSFE 2KR3A 3G71A 4BD3A 3CCEA 2NUPA 2XD0A 4M75F 3MPUB 1KQ1A 1YHQQ 5LJ3d 5GMKi 3M59A 3RR6A 4AMCA 2AK5A 2RPNA 3QDRB 3M54A 3MEWA 3O8VA 4D6WA 3V8KA 3G1JA 1PNJA 3INZA 1QVGS 3EFRA 1WLPB 1UGQB 3JCMc 4N0AA 3CCMT 5IHIA 5L8RE 4YTLA 4OF1A 3CCMA 1VIEA 5D6YA 2QQSA 1K9AA 2YUNA 2QK0A 2D1XA 1I0CA 1Y07A 3CPWP 1JJ2P 3I5SA 4WTOB 2DBMA 1I4K1 2DO3A 5GAMj 5GANj 2KK4A 3UA6A 3MHXA 4OMQA 2X4YA 2AIRB 2PZ1A 2A37A 2ZCFB 1TS9A 1KQSA 2ZAEA 2X9HA 4Z88A 1M1GA 2EGCA 2FZGB 2HD0A 1I8FA 1U06A 3S3NA 1WHLA 2PVDB 2E64A 4OMFB 1IHVA 1YCSB 1Q7YU 2D8JA 4X1VA 2PUOB 1K9MR 4FW2A 3VRYA 4OMNA 4J83A 5GAN3 2X3WD 4J8OA 5GAOq 2RQWA 2OTLQ 5LJ3g 1QP3A 4ZN1A 3M9QA 4F7UG 1YHQT 2EJFA 1YHQA 2KNBB 2C0TA 4TVRA 2E4HA 1TUCA 2RB6A 3R6NA 5IXBA 2XG8D 5GMKh 3SD4A 3LH0A 3OYCA 1FMVA 3WVDB 4Z8AA 2PQWA 3VS7A 5CK9A 4A4GA 4M77G 3VYHB 4EMKC 2XK0A 3M55A 1SEMA 1KC8R 2J05A 1Q82R 4XU2A 4AT1B 2RI5A 2B86A 4M7DG 2I0NA 3LW5E 4BDYA 2EBPA 2GTJA 2FZKB 1OOTA 3L1AA 4E7ZA 2W10A 1SRLA 2CP6A 4JS5A 3QYHB 4E2FB 5AT1B 2F5KA 4ORZA 1RI9A 2AT1B 1ZX6A 4BI4A 4IUVA 2V1QA 5CQXA 1V76A 1TUGB 4FL6A 2W0ZA 1SHGA 1EIFA 3X20B 4M75B 3BW1A 2EQIA 4JJBA 2DEQA 2QTXA 1NZ9A 5J3BA 5EC7A 1D0XA 5FRNA 4E7JA 2RK1A 3MKDA 2RK2A 4JZ3A 3V7CA 1BU1A 4DBQA 5D7UA 3MEAA 3BFMA 2D0NA 3FIFA 4XTUA 3VS1A 2OTJQ 1PWTA 2QGGA 4J9HA 4HCKA 1K73R 5GAN4 3M4YA 3EGXB 1ZUKA 1QVFS 2RHUA 4F7UF 2HQEA 3E9FA 1YJNQ 2WSCE 1LPLA 2H8HA 2QYZA 3OA6A 2RHZA 1MUZA 1MMGA 1D3BB 5LJ5j 1GBRA 2GFUA 3VYGA 1WZOA 3TU4K 4MZMA 1KC8U 2P0QA 4M77F 2RI2A 3THKA 2ZPEB 3ASKA 2A7YA 2VB6A 2LJ0A 3H6ZA 4FCYA 4M7DF 2CT4A 4ELYC 3VUBA 2JVVA 4PJNA 2H3JA 4OB3B 4LUDA 2YRVA 1FMWA 2YUPA 3TEEA 4F04B 2LT1A 1S1NA 1MV3A 1OEBA 3VRZA 4A4HA 4HXJA 2QAZA 2A28A 1LNXA 4XTWA 1XTDA 3Q1JA 1M90C 3UWNA 4F14A 2JTFA 5KYUA 5KCOA 2MOXA 4Z89A 3OS5A 4ZGJB 2DILA 3DB4A 3CCJQ 2IG0A 1YJNT 3E2UA 3V7SA 1VQ8T 2M16A 4C5GA 5CAIA 2KT8A 3JCMP 1WDXA 1NYFA 1YJNA 3DB3A 4FU6A 1VQ8A 1UFFA 3J81E 2CZ7B 4J6WA 1TOVA 2M02A 4LNPA 1Q95G 1ZQ1A 2FEIA 2RF0A 4C0ZA 4NOYA 3H0FA 2BIVA 5IHNA 2A36A 3JB9H 1ZSZC 4HCZA 3VS2A 2CGHA 3EG1A 3L42A 2EIFA 2XICA 3EGDA 1H8KA 4MZPA 3RMSA 2LDMA 5C6SA 2L89A 1ABOA 1M1KC 2CREA 2FO0A 1V29B 4QW2A 2DA9A 3A8OB 1W2BP 1IRXA 3VKIA 2HMAA 1R8OB 2ZGWA 3MP8A 1OZ2A 3SWNA 1M8VA 2MPXC 2RMOA 2GGRA 2QDLA 1NJIU 2BZ8A 5GANh 3FLGA 3QWXX 3OSVA 1MMDA 4B9WA 2MWOA 1JBMA 4DBHA 3QZ5B 1U8RA 2YLCA 2DL7A 3CCJT 1M8MA 4FIBA 1MMAA 3CCJA 2CS7A 5IN1A 2DTOA 3BDLA 4OMOA 5IT9E 3OW2S 1QCFA 3I9QA 2RQVA 1NPRA 1SRMA 4BE1A 2ROTA 2L8DA 3PT9A 5GAN6 1Y96A 2K4YA 4J9EA 4PJOA 1IZ6A 2G3RA 5HK0A 2HL3A 1GFDA 1AZGB 4M7DB 1N27A 2KDSA 3QUIA 3MO8A 1O75A 2J7IA 1B7TA 2O01E 2WACA 1Q81C 2ENMA 2CP5A 4AFZC 4OB2B 1AHJB 1S72Q 8ATCB 3UDCA 1ZBJA 1UHFA 3O5ZA 3E1SA 2QG9B 1K76A 2JS0A 5KYXB 3ER0A
chains in the Genus database with same CATH topology
1BIAA 3JB9I 3OYNA 1B34B 2JTMA 5FRMA 4FSXA 2OTJA 3OYFA 1KG1A 3LX7A 2XDDA 4PJOG 3X24B 1I5LA 4IUUA 3LGLA 1VIFA 4RG2A 2I2LA 5CKBA 3OYBA 4C0DC 2MF2A 2RJDA 1QW1A 1Q82C 2VGMA 3RESA 3BDUA 4BY6C 5GAMg 1WJSA 2E12A 3HRTA 3JCMJ 3JCMV 1WNLA 5GMKj 4XK8E 3OY9A 5J39A 1FXXA 3LLRA 2DTHA 1N6AA 1K73U 5A2QE 4OB0B 2E6ZA 4A4FA 5KE3A 1M1FA 1WQ7A 2X4WA 4C8QE 1NPPA 2GQVA 3PFSA 4IUTA 4M7AD 2Y4YA 4C0DB 4JRIA 1Q86U 3CCRT 1YI2T 4BY6B 5CO7A 4EMKA 2QQRA 3FB9A 5LL6S 3SDZA 3URGA 3S6WA 4C8QG 4RKUE 4XAXB 3CCRA 1YI2A 1N9RA 4FT2A 3BY7A 5EG2A 4EMKB 3JB9D 5DLOA 3QJ6A 1VQMT 3CCVT 2RO0A 4XTXA 3KUFA 2JOYA 3QO3A 3CXCS 1VQMA 3C12A 2LRQA 2RD1A 4OGEA 3VV0A 3CCVA 1VQPT 2DIQA 4J6YA 3RMQA 3CCQT 3G71T 5CR2A 3NTHA 4O6JA 3CCET 3OBWA 1IREB 1VQPA 2WSFE 3OYHA 4HCBA 2VUBA 3G71A 5GAOr 4BD3A 4M75A 1JRIA 2DXCA 3CCEA 4IUPA 3SWNC 1H641 5HK3A 1VQLT 2XD0A 3SB2A 1ZBXA 2LC4A 4M75F 3EAEA 5CIUA 1K8AU 4ME7A 1KQ1A 2ZPIB 4M78B 4M77D 5IAYA 1S72T 3CBOA 4KT0E 1VQLA 1UGSB 5LJ3d 4EDUA 3M59A 4JUVA 5GMKi 5GAOm 2JN0A 5HKCA 4BUGA 4JS4A 1S72A 2P4TA 3C95A 2RHYA 4RCCA 3QDRB 1W2BS 4HKEA 2OAUA 4DQ2A 3JCMh 5HY6A 2EQJA 2DD5A 3M54A 2WSEE 3MEWA 3O8VA 3V8KA 4D6WA 3SWNB 2DTIA 3E19A 3HKSA 3INZA 4M7DD 3RKXA 1QVGS 1K73C 3CCUT 3EFRA 2AHJB 4OGCA 1UGQB 3JCMc 3OMGA 2M1HA 4N0AA 3HPWA 5LJ5h 3CCMT 5LJ3j 5GAMd 3CCUA 5GANd 4M7AF 2X35A 4XU1A 3LGFA 1BI0A 5L8RE 4YTLA 4II1A 5LJ3e 1OZ3A 2PVOB 4L6V5 4LD6A 4OF1A 2VYTA 5CKEA 3JAME 3CCMA 4ZTJA 1Q86C 4C92E 5GMKl 3HL8A 1VIEA 5D6YA 3CBMA 2QQSA 4NL2A 3I55T 1HK9A 2KAFA 2HQXA 3CEYA 4PJOC 2FHDA 3JB9F 3QKJA 1Y07A 2RJEA 4BE2A 2DJZA 3UPUA 3I55A 4CRIA 3RKWA 3RKYA 4C92G 4KUDK 4VUBA 2DO3A 1I4K1 3GF5A 5GAMj 1VQ7T 5GANj 2KK4A 3CMAT 3FEOA 1D3BA 3JCMe 3G7ZA 3CPWS 1Y96B 1JJ2S 2BKDN 3MHXA 5GANe 1VQ7A 2E5QA 2X4YA 3JCMX 3CMAA 2ZCFB 2F5TX 3GNGA 3SFMA 3OYGA 5FLXE 4PJOB 3L2WA 4M7AE 4JDSA 1KQSA 2Y90A 2XU8A 5GAN2 1M1GA 1K8AC 2NLUA 1KHCA 1I8FA 2HD0A 1QVFA 2QQBA 1VQNT 2A3LA 1G3WA 4N4GA 3VU3C 3S3NA 4Y91A 2QXFA 4J5YA 4M7AG 2PVDB 2E64A 3OYLA 4OMFB 3A8HB 1UGPB 4A54A 3ZBDA 2JUFA 2K5IA 4F7UE 3OYDA 3LWIA 2KY9A 3HFOA 3UT1A 1Q7YU 2D6FA 4LDYA 3JCMQ 5A0GA 2PUOB 3PGGA 1JB0E 3PNWC 4EMGA 3PIOA 4C8QA 3QSUA 4OP0A 4J83A 5GAN3 2LVMA 4J8OA 5FU6B 5GAOq 4C8QF 5CVIA 2E41A 4MZTA 1QP3A 4ZN1A 3M9QA 4F7UG 5LJ3g 4E7LA 2LT4A 4BB7A 4C8QB 3DLLA 1YHQT 2EJFA 2EJGA 4CI0C 1VQ6T 2RHXA 3X25B 5I2SA 4EMHA 2CZ0B 1YHQA 4TVRA 4C92D 4PLIA 3S3OA 1VQ6A 4M77E 2XHCA 2K3XA 2RB6A 2XG8D 2EQUA 1Y7XA 4FM4B 5GMKh 1DJ7B 3KBGA 4XQ3A 3SD4A 3LH0A 2LQKA 4BI8B 3OYCA 2IVWA 3QHSA 3JCMg 2DZCA 5I2MA 4WF2A 3WVDB 1WGSA 2PQWA 5GANg 3J80E 5CK9A 1PSEA 4A4GA 4M77G 3EFSA 1X6OA 1O9SA 4BI3A 1UEBA 3FRNA 4KBMB 3VYHB 4M7DE 4EMKC 2R5AA 3OYAA 1I81A 2XK0A 3M55A 3HSBA 5LJ5g 4BACA 4N4IA 4E47A 1XQHA 1X75C 2EKOA 1VUBA 4XU2A 4GY5A 4BDZA 2RI5A 3KXTA 3G4ST 1TH7A 2B8AA 1G3SA 3GLXA 2RI3A 3HRUA 4Z02A 2EYQA 3FC3A 3LW5E 3S3MA 4M7DG 1LJOA 4ATOA 3OBYA 4BDYA 3G4SA 3ZFJA 5I21A 2GFAA 1KQ2A 4XTYA 3L1AA 1G3TA 3GP8A 1YJ9T 4M78C 4JS5A 3QYHB 4M75C 1Q7YC 2EQKA 2F5KA 3H8ZA 4QQ6A 1YJ9A 4JRQA 2V8IA 3L2UA 3ZEHA 5CKDA 2PUKB 3QG1A 4BI4A 3RUXA 4IUVA 4DA4A 5CQXA 5DLQE 2PU9B 3OYEA 4ZTFA 2L3RA 1M9SA 4FL6A 2LTOA 4C92A 2ZZDA 2ZPFB 2QEXT 4PNOA 3C94A 5AYFA 1KD1U 4C92F 1EIFA 3X20B 4M75B 3BW1A 4XU3A 3M57A 2QEXA 2X4JA 4C5HA 3RERA 2DEQA 2QTXA 4V2SA 3J7AF 1NZ9A 3QBYA 5J3BA 4LDUA 5FRNA 3DLMA 2RK1A 4E7JA 4N0AC 3GOXA 2RK2A 2XI9A 2DXUA 2E65A 2KQWA 3V7CA 3NTIA 4J7IA 5LJ3f 3MEAA 1BI2A 2HBPA 3QXEB 1VQ4T 3BFMA 4E7KA 3F70A 3FIFA 3HHTB 4M7AA 3JCMd 4E7IA 2QQ9A 3NTKA 4MMLA 1VQ4A 4XTUA 2RJFA 2VXFA 1N8RU 4M7AB 2R58A 3P8BB 4LDWA 2DK3A 2E70A 1KQSS 5GAOn 5GAN4 5LJ5d 2LQ8A 3M4YA 2E1HA 3A8GB 4MMKA 4F7UA 1UB4A 3FJPA 5GAMf 5GAMh 4DOWA 5GANf 1QVFS 2RHUA 2X4XA 2O4XA 4X9CA 2HQEA 4F7UF 1HXDA 3E9FA 3MP1A 5GAOl 3L2VA 2WSCE 2C06A 3OA6A 4F7UB 1YBYA 1M90U 4ELZC 4RMOA 2RH2A 1MGQA 2RHZA 1XNIA 4UC4A 4PL6A 1XOVA 1BIBA 5C0MA 1D3BB 2DAQA 2MI6A 5LJ5j 4QQGA 1G5VA 2DIGA 1WJRA 2GFUA 3ME9A 3V8LA 3VYGA 1W2BA 1W4SA 4M77A 4OVAA 5LJ5e 4JJNK 1VQ5T 3L2RA 3TU4K 3HP9A 4MZMA 4X34A 5FU6C 1KC8U 1KD1C 2P0QA 4M77F 4JLIA 3CD6T 3OS0A 3PTAA 2DXTA 3WVEB 1BKBA 3JCMW 4C8QC 2RI2A 1VQ5A 4M77B 2L5QA 5KCHA 3M53A 3CD6A 4A4EA 2ZPEB 3ASKA 2XKOC 2A7YA 3OYKA 1SSFA 3JCMb 2V8JA 4ZGEB 5D6WA 4B9XA 1KHIA 3H6ZA 4M7DA 2EWNA 3META 2K2VA 2JNGA 1N9SA 2VXEA 3LWHA 4M7DF 2MWPA 4ELYC 3VUBA 2K3YA 3V7RA 3GPLA 4QVZA 2E6NA 2JVVA 2LCLA 2YHTA 2VV5A 4L5GA 1RI0A 5FROA 2DKGA 2H3JA 4OB3B 3OW2A 1P92A 1RL2A 3OB9A 3MCAB 3OSSC 5A0LA 1Y71A 1N8RC 2YRVA 4MDXA 3OS1A 1VQKT 3TEEA 2KMTA 2LT1A 1ZHIA 4KULA 5KE2A 3OYMA 4FT4A 1BYMA 1NE8A 4DOVA 2QA4T 1VQKA 1UGRB 4A4HA 1M1KU 4J6XA 4MDWA 3CPFA 4GLKA 3CCLT 1LNXA 2LCCA 2LNVA 2P0KA 3QIIA 4XTWA 5FU7B 1XTDA 2QA4A 4LDXA 1YJWT 2VGNA 3Q1JA 1M90C 4IUQA 4QQDA 3CCLA 3UWNA 5D6XA 3OYIA 2DD4A 5CCAA 2JTFA 5KCOA 3OYYA 1VQNA 4M78D 2YLBA 1YJWA 1QP2A 2MAMA 3OS5A 4M75D 4ZGJB 3QJYA 2R5MA 3M56A 3WXMB 1WQWA 3DB4A 4JLGA 2ZPGB 5CQYA 2IG0A 3R6OA 1YJNT 2XDBA 2XDPA 3V7SA 1KC8C 1YCYA 2CKKA 2M16A 4C5GA 5CAIA 1VQ8T 3AHUA 4ZGDB 1H3ZA 3LYIA 3JCMP 3T9NA 4ZN3A 2R57A 1YJNA 3DB3A 3OQ5A 4KUIA 3OMCA 3QPHA 4FU6A 3L2ZA 1VQ8A 3DKMA 3J81E 2CZ7B 4J6WA 5GMKe 2KSSA 2D9TA 5CKFA 3OYJA 4O5VA 4C92C 1ZQ1A 4A53A 1BI3A 4R56A 1YITT 2VC8A 5CKHA 3GNFB 2FVUA 4C0ZA 4R55A 3N5BB 2CZ6B 4NOYA 3X28B 2BIVA 2BUDA 1OYXA 1WPYA 5GAN7 1VQOT 3PMTA 1YITA 2MMPA 4PKCC 3VJPA 1YIJT 3A8LB 3V8JA 1VQOA 3JB9H 2M9UA 4HCZA 2RM4A 4PLLA 4QVCA 5GAN8 2CGHA 3JB9J 4JRPA 4C92B 1YIJA 3CCST 3L42A 2EIFA 2XICA 2K5LA 3M5AA 4MZPA 3RMSA 2OTLT 4M7AC 3CCSA 2LDMA 2RA2A 5GAOp 3JSCA 5C6SA 2L89A 1M1KC 2RJCA 4PJOD 4Q5WA 2OTLA 2XIDA 2LX9A 5LJ3h 4M78A 3CCQA 5GMKm 4C5EA 2GF7A 4M78F 1V29B 1K9MU 1QVPA 3HRSA 4E7HA 2M0OA 4QW2A 4IURA 3A8OB 3G6ET 2EQMA 3MP6A 3QYGB 1U1TA 4HT8A 1Q81U 3VKIA 1GXIE 1R8OB 2ZGWA 3MP8A 3G6EA 3CC7T 5KH6A 5GAN5 2QDYB 3CMET 3CXCA 1OZ2A 3SWNA 5A0DA 1M8VA 3QZ9B 3CC7A 3JCMf 1FWZA 4J7FA 3CMEA 1NJIU 3CBPA 5GANh 2ZPHB 3FLGA 3A5ZB 4C5IA 2HAXA 5M9OA 3OSVA 4B9WA 4IKFA 3E9GA 3TREA 3A8MB 4C8QD 2MWOA 3PIPA 1JBMA 2DVEA 2O4XB 3I56T 3NFCA 3QZ5B 1G3YA 3MEVA 4M77C 5LJ5f 1U8RA 2YLCA 2E10A 2K5FA 3CCJT 3CC2T 2EAYA 4M78E 4FIBA 3I56A 4M75E 3FDRA 2JZ2A 1BI1A 3M58A 1M5Q1 2QI2A 2K57A 4RCBA 3CCJA 3M4GA 2CS7A 3CC2A 4P5NA 4RG8A 2CZ1B 5IN1A 1LOJA 2DZ9A 4N4HA 1X01A 4QVDA 2DTOA 3BDLA 2Y4XA 5IT9E 3OW2S 1Q82U 4M78G 4M7DC 3P8DA 4C0FA 1NPRA 4M75G 2QQAA 3PT9A 2L8DA 4BE1A 1QVGA 5GAN6 4XU0A 5J26A 1Y96A 2EFIA 2K4YA 2FB7A 4HA8A 1FX7A 2DXBA 1WJQA 3P8HA 4Y28E 3GIBA 2KVQG 2FL7A 2V8KA 4PJOA 5GAMe 1IZ6A 2G3RA 5HK0A 1M4ZA 4PJOF 3C4SA 4NS5A 3L2QA 5DY9A 3X26B 2ZPBB 1PSFA 4M7DB 4XTZA 1N27A 4XTVA 2KDSA 3QUIA 2D0QB 1MHNA 1K9MC 3MO8A 1O75A 3PMIA 5FU7C 2FYKA 4HCCA 2O01E 2WACA 1Q81C 3MEUA 4BE0A 2CYZB 4L59A 1AHJB 2P0PA 4OB2B 3TCJA 4A4KA 4HT9A 1VQ9T 1OI1A 3CPWA 2RHIA 1JJ2A 4JRKA 3UDCA 3CC4T 2GCXA 1NJIC 3HFNA 4LDVA 5DM7R 1U1SA 4EPCA 1VQ9A 3JB9G 4LD9K 2DPPB 2HNIA 3JRZA 4OB1B 3CC4A 2F69A 2EJ9A 3RIRA 3E1SA 4PJOE 1B34A 2PVGB 3VUZA 4NL3A 2OTJT 4X9DA 4C0GA 3OS2A 3ER0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIA A;  4MML A;  4M7A E;  3JB9 I;  1WPY A;  4XTU A;  5GAN 7;  2VXF A;  1B34 B;  2Y90 A;  4M7A B;  5GAN 2;  4PJO G;  1I8F A;  3JB9 H;  3V8J A;  1I5L A;  2RM4 A;  2I2L A;  3VU3 C;  4QVC A;  4Y91 A;  5LJ5 d;  2CGH A;  5GAN 8;  5GAN 4;  5GAO n;  2E1H A;  4J5Y A;  4C92 B;  3JB9 J;  4M7A G;  2E64 A;  4MMK A;  4F7U A;  3FJP A;  4A54 A;  5GAM f;  5GAM h;  5GAN f;  3RES A;  3BDU A;  4F7U E;  3HFO A;  4F7U F;  4X9C A;  5GAM g;  5GAO l;  1HXD A;  3JCM J;  3JCM Q;  3JCM V;  1WNL A;  5GMK j;  4EMG A;  3PGG A;  2RA2 A;  4M7A C;  4F7U B;  5GAO p;  2DTH A;  4C8Q A;  3QSU A;  4OP0 A;  5GAN 3;  1WQ7 A;  4PJO D;  4C8Q E;  1MGQ A;  4C8Q F;  5GAO q;  2E41 A;  5LJ3 h;  5LJ3 g;  4M78 A;  4F7U G;  5GMK m;  4C8Q B;  4M7A D;  4M78 F;  2EJF A;  2EJG A;  1BIB A;  4JRI A;  1D3B B;  5LJ5 j;  4EMH A;  3V8L A;  1U1T A;  4HT8 A;  4EMK A;  4C8Q G;  3FB9 A;  4C92 D;  4M77 A;  5LJ5 e;  2ZGW A;  4M77 E;  4M77 F;  2RB6 A;  4JLI A;  5GAN 5;  1N9R A;  2DXT A;  3BY7 A;  3SWN A;  4EMK B;  4C8Q C;  3JCM W;  3JB9 D;  1M8V A;  4M77 B;  5GMK h;  4XQ3 A;  3JCM f;  3QHS A;  3JCM g;  2DZC A;  4WF2 A;  5GAN h;  4XTX A;  3JCM b;  5GAN g;  3QO3 A;  4M77 G;  3EFS A;  2RD1 A;  4C8Q D;  4M7D A;  4J6Y A;  1JBM A;  2EWN A;  2DVE A;  4M7D E;  4EMK C;  1N9S A;  1I81 A;  2VXE A;  4M77 C;  5LJ5 f;  4M7D F;  3HSB A;  5LJ5 g;  2YLC A;  2E10 A;  3V7R A;  5GAO r;  4M7A A;  2EAY A;  4M75 A;  1JRI A;  4M78 E;  3SWN C;  1H64 1;  4XU2 A;  4M75 E;  2YHT A;  3SB2 A;  4M75 F;  2DKG A;  1M5Q 1;  4RCB A;  2K57 A;  1KQ1 A;  4M78 B;  3M4G A;  1TH7 A;  4M7D G;  4M77 D;  1LOJ A;  2DZ9 A;  5LJ3 d;  5GMK i;  5GAO m;  4JUV A;  1LJO A;  1X01 A;  2DTO A;  4QVD A;  2JN0 A;  4M78 G;  5I21 A;  4M7D C;  1KQ2 A;  4M75 G;  4RCC A;  3L1A A;  4XTY A;  5GAN 6;  4XU0 A;  1Y96 A;  4HA8 A;  3JCM h;  2FB7 A;  4DQ2 A;  4M78 C;  3GIB A;  4J6X A;  3V8K A;  4M75 C;  3SWN B;  1LNX A;  2DTI A;  4XTW A;  3INZ A;  4PJO A;  4M7D D;  3RKX A;  5GAM e;  3EFR A;  4PJO F;  3RUX A;  3JCM c;  5DY9 A;  4N0A A;  4M78 D;  2YLB A;  5LJ5 h;  5LJ3 j;  5GAM d;  4M75 D;  5GAN d;  4M7A F;  4XU1 A;  4M7D B;  4XTZ A;  4XTV A;  3QUI A;  5LJ3 e;  4C92 A;  4PNO A;  1WQW A;  4C92 E;  5GMK l;  2FYK A;  4C92 F;  4M75 B;  3BW1 A;  4NL2 A;  4XU3 A;  4V2S A;  3RER A;  1HK9 A;  2DEQ A;  2QTX A;  1YCY A;  3V7S A;  3AHU A;  3JB9 F;  5CAI A;  4PJO C;  3JCM P;  4HT9 A;  2DJZ A;  3L2Z A;  4N0A C;  3RKY A;  3RKW A;  4JRK A;  4C92 G;  4J6W A;  3HFN A;  1I4K 1;  1U1S A;  2DXU A;  2E65 A;  3V7C A;  5GMK e;  5GAM j;  5GAN j;  3JB9 G;  1D3B A;  5LJ3 f;  2HNI A;  4C92 C;  3JCM e;  3RIR A;  1Y96 B;  2EJ9 A;  4A53 A;  5GAN e;  4PJO E;  3BFM A;  3JCM X;  2VC8 A;  1B34 A;  4NL3 A;  3FIF A;  4X9D A;  3JCM d;  4NOY A;  4PJO B; 
#chains in the Genus database with same CATH topology
 1I07 A;  1BIA A;  1VQ4 Q;  2LX7 A;  1B34 B;  1OX8 A;  3OYF A;  2K7A A;  4IUU A;  2I2L A;  1QW1 A;  2VGM A;  4BY6 C;  1YWP A;  5GAM g;  1UUE A;  2E12 A;  2LJ1 A;  3HRT A;  3JCM J;  3M0R A;  5GMK j;  5J39 A;  3LLR A;  1NLP C;  2E6Z A;  5KE3 A;  1GCQ C;  3CMA Q;  4C0D B;  3NGP A;  2QQR A;  3FB9 A;  3SDZ A;  4RKU E;  1TWB A;  1H92 A;  2JM9 A;  3U23 A;  1JEG A;  4RTV A;  3FJ5 A;  3EG3 A;  3CXC S;  1R0B G;  3NTH A;  4O6J A;  3VS3 A;  5GAO r;  4IUP A;  5HK3 A;  5CIU A;  1K8A U;  1WHH A;  1ZA1 B;  1S72 T;  5GAO m;  2V1R A;  2JN0 A;  5HKC A;  1S72 A;  3C95 A;  3E19 A;  4J9B A;  3RKX A;  3EG9 A;  2AHJ B;  1X6G A;  4OGC A;  1RAF B;  5LJ5 h;  1BI0 A;  2CDT A;  3SHW A;  5LJ3 e;  4LD6 A;  4L6V 5;  5CKE A;  1Q86 C;  2VYT A;  3HL8 A;  3ZL7 C;  3CEY A;  2JMC A;  3QKJ A;  4BE2 A;  3JV3 A;  1K4U S;  1PCX A;  3RKY A;  5IHK A;  4KUD K;  4VUB A;  3GF5 A;  2LZ6 B;  2J6F A;  3CMA T;  3FEO A;  3CPW S;  1JJ2 S;  1HYO A;  3CMA A;  1NEB A;  1B07 A;  2CH4 A;  5KYW A;  5FLX E;  3A98 A;  1QWE A;  1PD0 A;  1UG1 A;  2XU8 A;  5GAN 2;  5KYY A;  1VQO Q;  1WHG A;  2A3L A;  1G3W A;  4K11 A;  1WX6 A;  4J5Y A;  2F2V A;  2E3I A;  2KY9 A;  3HFO A;  1GL5 A;  2BTT A;  4GLM A;  4C8Q A;  1D1A A;  1U5S A;  2E41 A;  1N8R R;  4MZT A;  2HZY A;  2JW4 A;  4BB7 A;  2EJG A;  4CI0 C;  2RHX A;  5I2S A;  1KK7 A;  4PJJ A;  2DBK A;  1M3A A;  2Z0W A;  4FYV B;  2K3X A;  4JPB W;  2EQU A;  5GJV B;  1PG5 B;  3A1P A;  3KBG A;  4M4Z A;  4XQ3 A;  4BI8 B;  1WHM A;  2DZC A;  1SHF A;  2EGA A;  1WXB A;  1UEB A;  4DBF A;  2R5A A;  1G2B A;  5LJ5 g;  4N4I A;  4E47 A;  2RQU A;  3KXT A;  1OPK A;  4DBR A;  1G3S A;  2RI3 A;  3S3M A;  2EYQ A;  2F2X A;  1G3T A;  4KRT A;  2DER A;  3EG2 A;  1Q7Y C;  4JRQ A;  2V8I A;  3L2U A;  3QG1 A;  3RUX A;  4DA4 A;  2FG0 A;  1AEY A;  5DLQ E;  4ZTF A;  2L3R A;  4OML A;  2LTO A;  4C92 A;  2QEX T;  2ZPF B;  1BB9 A;  4PNO A;  2AKL A;  1UHC A;  2CUB A;  2QEX A;  4C5H A;  3RER A;  1EFN A;  4R0K A;  1GFC A;  3DLM A;  4N0A C;  1M2V B;  2L3P A;  2XI9 A;  2KQW A;  3NTI A;  1JXM A;  1C1A A;  1MND A;  2QA4 Q;  1W6X A;  1BI2 A;  2CSI A;  2HBP A;  3QXE B;  1C0M A;  3F70 A;  4M7A A;  1X2K A;  1KQS P;  1K0S A;  1N8R U;  2R58 A;  2KYB A;  3P8B B;  2DK3 A;  3REA B;  1IXD A;  2E1H A;  5GAM f;  2SEM A;  4DOW A;  5GAN f;  4X9C A;  3L2V A;  1HXD A;  2C06 A;  4RTZ A;  3EG0 A;  4PL6 A;  1D1C A;  2K9G A;  1QKW A;  2DIG A;  3V8L A;  1JQQ A;  2HQH A;  1YIT Q;  1W4S A;  2DRM A;  4JJN K;  3L2R A;  3TVT A;  1Y57 A;  4JLI A;  1BKB A;  3JCM W;  2COZ A;  2KT1 A;  2L5Q A;  3M53 A;  2HKN A;  4A4E A;  1T3S A;  2XKO C;  2KRM A;  4B9X A;  2X3X D;  2DX1 A;  2JNG A;  1OV3 A;  1AWJ A;  2MWP A;  2E6N A;  1R77 A;  2LCL A;  3EGU A;  3EFO A;  2YHT A;  2VV5 A;  4L5G A;  1RI0 A;  1ABQ A;  2CUD A;  3LH5 A;  3OB9 A;  3MCA B;  2E3H A;  2KMT A;  1UJY A;  1IGQ A;  4KUL A;  1NE8 A;  2QA4 T;  2O31 A;  4QKU A;  4MDW A;  3CPF A;  2DL5 A;  2QA4 A;  2LCC A;  3QII A;  1NEG A;  5D6X A;  3OYI A;  2DD4 A;  5CCA A;  4M78 D;  3CCU Q;  3WXM B;  4JLG A;  5CQY A;  1KC8 C;  1H3Z A;  3AHU A;  5I11 A;  3T9N A;  2R57 A;  4KUI A;  3QPH A;  3L2Z A;  3DKM A;  1K1Z A;  5CKF A;  3OYJ A;  5GJW B;  1YIT T;  3GNF B;  2FVU A;  1YIT A;  4PKC C;  2HSE B;  2M9U A;  1IB8 A;  3JB9 J;  1SSH A;  2DL8 A;  2F2W A;  3HTR A;  2OTL T;  3JSC A;  1TUD A;  1JXO A;  2OTL A;  1VQ9 Q;  2LX9 A;  3CC4 Q;  1PHT A;  1ZSZ B;  2GF7 A;  4M78 F;  1K9M U;  3HRS A;  2VKN A;  4IUR A;  2EQM A;  3MP6 A;  3QYG B;  4CC3 A;  1U1T A;  1IO6 A;  1GXI E;  1NM7 A;  5A0D A;  4J7F A;  4PFZ A;  4PJL A;  2ZPH B;  4WCI A;  4RTW A;  4IKF A;  2YDL A;  3A8M B;  4C8Q D;  4D8D A;  3PIP A;  4AG2 C;  2O4X B;  1BCM A;  3RNJ A;  5LJ5 f;  1W1F A;  3GBQ A;  2EAY A;  4M78 E;  3FDR A;  3QWY A;  1BI1 A;  3M58 A;  4RCB A;  2YUO A;  1X01 A;  1Q82 U;  3P8D A;  1QQJ A;  1QVG A;  4XU0 A;  1FX7 A;  3GIB A;  1WJQ A;  4FYY B;  5HCK A;  2FL7 A;  1YJ9 Q;  5GAM e;  2A0F B;  2P4R A;  4NS5 A;  4E7S A;  1TTH B;  4J9F A;  4IIO A;  2J06 A;  1VQP Q;  2ZPB B;  4PK4 A;  4XTZ A;  1MHN A;  2RQR A;  4PJM A;  3EH2 A;  4BE0 A;  2QGF B;  2DL4 A;  4A4K A;  4HT9 A;  2KRN A;  2HKQ B;  2H3E B;  1VQ9 T;  1OI1 A;  4RUG A;  4JRK A;  3CC4 T;  1NJI C;  3HFN A;  5DM7 R;  1NLO C;  1VQ9 A;  3JB9 G;  4Y92 A;  3CC4 A;  2HL5 C;  4NL3 A;  2OTJ T;  1XJW B;  3OS2 A;  3JB9 I;  3OYN A;  1X43 A;  2JTM A;  2OTJ A;  5FRM A;  1KG1 A;  1PRL C;  4LXC A;  3LGL A;  1VIF A;  2FRW A;  5CKB A;  1M90 R;  1OPL A;  1ZSG A;  4CC4 B;  1K73 U;  2DEU A;  4OB0 B;  2X4W A;  4C8Q E;  3PFS A;  4KGZ B;  1VQ7 Q;  1RUW A;  4M7A D;  4JRI A;  1HD3 A;  4BY6 B;  5LL6 S;  2L3Q A;  3JB9 D;  3QJ6 A;  2HSP A;  1D09 B;  2RO0 A;  2EGE A;  1VQN Q;  1T0H A;  3KUF A;  3QO3 A;  2OAW A;  3C12 A;  2LRQ A;  4OGE A;  1VQP T;  2DIQ A;  1AZE A;  3NHN A;  1VQP A;  4HCB A;  2KBT A;  3OYH A;  2VUB A;  4M75 A;  3SWN C;  1H64 1;  2AKK A;  3SB2 A;  1ZBX A;  3EAE A;  5FW9 A;  2ZPI B;  4M78 B;  5IAY A;  3CBO A;  4KT0 E;  1M1K R;  1UGS B;  2DRK A;  4BUG A;  4JS4 A;  2P4T A;  2KRO A;  2RHY A;  3EH1 A;  4HKE A;  1KSW A;  2OAU A;  4DQ2 A;  3JCM h;  5HY6 A;  1VQK Q;  1RAI B;  2DTI A;  5FWC A;  2ED1 A;  2PTK A;  3OMG A;  5LJ3 j;  5GAM d;  5GAN d;  4M7A F;  1OZ3 A;  2PVO B;  3EGX A;  2XMF A;  3M0S A;  4AFS C;  3JAM E;  1ZUY A;  4C92 E;  1UDL A;  5GMK l;  2ABL A;  4JZ4 A;  4NL2 A;  1HK9 A;  2HQX A;  4PJO C;  2FHD A;  3JB9 F;  2RJE A;  4CRI A;  1QMC A;  1TSF A;  1VQ7 T;  1D3B A;  3G7Z A;  2BKD N;  1KD1 R;  1VQ7 A;  3GNG A;  3SFM A;  2AZS A;  3OYG A;  3L2W A;  4M7A E;  4JDS A;  2LQW A;  5KYW B;  1K8A C;  2NLU A;  1QVF A;  1VQN T;  1TG0 A;  4N4G A;  3PE0 A;  3VU3 C;  2CP2 A;  3A8H B;  4A54 A;  4E7L A;  1VQN A;  2JUF A;  3LWI A;  2D6F A;  1KIK A;  3PNW C;  3PGG A;  1JB0 E;  4EMG A;  1MMN A;  3VS0 A;  3PIO A;  3QSU A;  1BBZ A;  1WXT A;  2NUT A;  4IIM A;  4C8Q B;  3DLL A;  3X25 B;  1ZUU A;  1WYX A;  4PLI A;  2XHC A;  1DJ7 B;  4E7I A;  2DJQ A;  2IVW A;  3QHS A;  3JCM g;  5I2M A;  1WGS A;  5GAN g;  3EFS A;  1O9S A;  4BI3 A;  2AZV A;  2OX7 A;  4KBM B;  1IHW A;  2MK5 A;  2J6K A;  3OYA A;  2EPD A;  3HSB A;  4BAC A;  4EIK A;  4HVW A;  3AT1 B;  1X75 C;  2EKO A;  1VUB A;  2YT6 A;  4DEX A;  4LN2 A;  3OBY A;  1EX4 A;  1KQ2 A;  4XTY A;  1VQ5 Q;  3CD6 Q;  4M78 C;  3H8Z A;  1PD1 A;  4QQ6 A;  3ZEH A;  1Z9Z A;  5CKD A;  3I5R A;  3OYE A;  1KJW A;  1SF9 A;  1M9S A;  1KD1 U;  1OUL A;  2NUP B;  2X4J A;  4ESR A;  1ZLM A;  4LDU A;  3GOX A;  2E65 A;  1SKU B;  4J7I A;  4KGX B;  1VQ4 T;  4E7K A;  2BZY A;  3HHT B;  3SEM A;  2L3S A;  2QQ9 A;  3NTK A;  4MML A;  1VQ4 A;  1YJW Q;  2RJF A;  2VXF A;  1WI7 A;  4M7A B;  1ACM B;  3M0T A;  4LDW A;  2E70 A;  1KQS S;  2D8H A;  5LJ5 d;  4F7U A;  1UB4 A;  2X4X A;  3TSZ A;  2CP3 A;  1Q86 R;  2DNU A;  1MGQ A;  1XNI A;  5C0M A;  2DAQ A;  3M0P A;  1G5V A;  1WJR A;  3ME9 A;  4M77 A;  1VQ5 T;  3CD6 T;  4PFP A;  1YI2 Q;  3OS0 A;  1N5Z A;  3PTA A;  2YWW A;  4C8Q C;  1VQ5 A;  3CD6 A;  2GBQ A;  5L23 A;  3OYK A;  1SSF A;  3JCM b;  2V8J A;  1KHI A;  4M7D A;  2EW3 A;  2EWN A;  2M0Y A;  2O9S A;  4AG1 C;  1N9S A;  3LWH A;  2K3Y A;  3V7R A;  3CCQ Q;  3G71 Q;  3CCE Q;  3OW2 A;  1P92 A;  1RL2 A;  1Y71 A;  1N8R C;  4MDX A;  3PVQ A;  3OS1 A;  1NG2 A;  5KE2 A;  1ZHI A;  4FT4 A;  3TQ7 P;  2RQT A;  1UGR B;  3CC7 Q;  2DLP A;  3CME Q;  1U3O A;  4GLK A;  1V1C A;  2LNV A;  2NWM A;  2JS2 A;  1YJW T;  2VGN A;  4QQD A;  2X51 A;  4RTY A;  4D8K A;  3OYY A;  2YLB A;  1RAC B;  4CC2 A;  1QP2 A;  1YJW A;  2MAM A;  4M75 D;  1AD5 A;  3I56 Q;  2DVJ A;  2R5M A;  3CCM Q;  2COY A;  4FW1 A;  2GNC A;  3CC2 Q;  2FZC B;  3R6O A;  1YN8 A;  2XDB A;  2XDP A;  1H3H A;  2CKK A;  4ZGD B;  4ZN3 A;  3OMC A;  2EYW A;  2FPE A;  5GMK e;  2KSS A;  2D9T A;  3H0I A;  4C92 C;  4A53 A;  2FPF A;  2E5K A;  2VC8 A;  5IH2 A;  3N5B B;  1YWO A;  3X28 B;  2JTE A;  1WPY A;  1UEC A;  2P84 A;  5GAN 7;  1VQO T;  3VJP A;  3A8L B;  3V8J A;  1VQO A;  4J9D A;  1T3L A;  4JRP A;  2VAS A;  2K5L A;  3M5A A;  1YP5 A;  4M7A C;  4JJD A;  2FRY A;  1I5O B;  4PJO D;  2KXC A;  1FYN A;  4A63 B;  2YXY A;  5LJ3 h;  3CCQ A;  1NYG A;  1QVP A;  2IIM A;  4E7H A;  4HT8 A;  8AT1 B;  2KEA A;  3CC7 T;  1FMK A;  3CME T;  1GBQ A;  2O9V A;  3CXC A;  2CP7 A;  3CC7 A;  3JCM f;  3CME A;  1QCN A;  1RAH B;  3TRE A;  3I56 T;  3NFC A;  3MEV A;  2E10 A;  3CC2 T;  5ECA A;  3I56 A;  1GCP A;  4M75 E;  1D0Z A;  1ZA2 B;  2QI2 A;  3CC2 A;  2YSQ A;  2CZ1 B;  1LOJ A;  3CCR Q;  4M78 G;  4C0F A;  1PKT A;  5J26 A;  4HA8 A;  1OQK A;  2FB7 A;  1A0N B;  2DXB A;  4Y28 E;  1TXQ A;  3P8H A;  9ATC B;  1KFZ A;  2KVQ G;  2HDA A;  1VQM Q;  3CCV Q;  4PJO F;  3C4S A;  3H9N A;  3L2Q A;  3X26 B;  2CP0 A;  1PSF A;  4XTV A;  1K9M C;  3PMI A;  3M0Q A;  4HVU A;  4LE9 A;  2FYK A;  4HCC A;  3NPF A;  1VQL Q;  2CYZ B;  4L59 A;  3TCJ A;  3CPW A;  2HBW A;  1JJ2 A;  2CSQ A;  2GCX A;  4LDV A;  2ROL A;  4LD9 K;  2HNI A;  4OB1 B;  3RIR A;  2JM8 A;  3H0H A;  4PJO E;  4LUE A;  4C0G A;  2QAS A;  3VS6 A;  1RLQ C;  2DFU A;  5KYU B;  3LX7 A;  3REB B;  3X24 B;  1I5L A;  1YNZ A;  2V26 A;  3OYB A;  2YRC A;  3ULR B;  1SG5 A;  2RJD A;  1Q82 C;  3BDU A;  1RLP C;  1WJS A;  3UA7 A;  1WNL A;  1PKS A;  4XK8 E;  3I55 Q;  1R0C B;  2DTH A;  1M2O A;  5A2Q E;  1WQ7 A;  2GQV A;  1AWX A;  2KGT A;  2VWF A;  4J9G A;  3CCR T;  5CO7 A;  4EMK A;  4C8Q G;  3S6W A;  4XAX B;  4J9I A;  3CCR A;  1N9R A;  4FT2 A;  3BY7 A;  1VQM T;  4OMP A;  3CCV T;  4XTX A;  2K2M A;  1VQM A;  3VV0 A;  2RD1 A;  2ED0 A;  3CCV A;  3RMQ A;  5CR2 A;  3EGD B;  2L0A A;  1IRE B;  2QTV A;  1W70 A;  1JRI A;  2DXC A;  2KYM A;  2RNA A;  1VQL T;  2LC4 A;  4ME7 A;  4M77 D;  1NBE B;  4RTU A;  3RDV A;  1VQL A;  4EDU A;  1RAE B;  1AT1 B;  4JUV A;  1VQ6 Q;  1M2V A;  1UE9 A;  2ECZ A;  2COW A;  4RCC A;  1W2B S;  1QVG P;  3EHQ A;  2EQJ A;  2DD5 A;  1M3B A;  2WSE E;  3SWN B;  3HKS A;  4M7D D;  1K73 C;  1PM3 A;  3CCU T;  1QKX A;  2BE9 B;  2M1H A;  3HPW A;  4F16 A;  3CCU A;  2X35 A;  4XU1 A;  3LGF A;  1BK2 A;  4II1 A;  4ZTJ A;  3UF4 A;  4RTX A;  3CBM A;  1D0Y A;  1AWO A;  2JT4 A;  2C0I A;  3I55 T;  2KAF A;  3G4S Q;  2DMO A;  2DJZ A;  3UPU A;  3I55 A;  1VQ8 Q;  3RKW A;  4C92 G;  2KI7 A;  3JCM e;  1Y96 B;  5GAN e;  2GQI A;  2E5Q A;  3JCM X;  2F5T X;  4PJO B;  2VVK A;  2Y90 A;  1KHC A;  2QQB A;  2JXB A;  4Y91 A;  2K6D A;  2QXF A;  4M7A G;  3OYL A;  1HSQ A;  1UGP B;  3ZBD A;  2K5I A;  4F7U E;  3OYD A;  1WA7 A;  1X69 A;  3UT1 A;  4LDY A;  3JCM Q;  5A0G A;  3PVL A;  4OP0 A;  2CT3 A;  2LVM A;  3VS5 A;  5FU6 B;  4C8Q F;  5CVI A;  2LT4 A;  1MV0 B;  1VQ6 T;  4EMH A;  2CZ0 B;  2NUT B;  1NJI R;  4C92 D;  3S3O A;  1VQ6 A;  4M77 E;  1Y7X A;  5I22 A;  4FM4 B;  3C0C A;  2K3B A;  2DL3 A;  2LQK A;  3CQT A;  2LP5 A;  1G8X A;  3QDF A;  4WF2 A;  3J80 E;  1PSE A;  1X6O A;  2GTO A;  3FRN A;  4M7D E;  2CH4 W;  1I81 A;  4JJC A;  3NMZ C;  1TU0 B;  1XQH A;  2RN8 A;  4BDZ A;  4GY5 A;  3G4S T;  1TH7 A;  2B8A A;  3GLX A;  3HRU A;  4Z02 A;  3FC3 A;  1LJO A;  4ATO A;  4KH1 B;  2HCK A;  3G4S A;  7AT1 B;  2PNI A;  3ZFJ A;  5I21 A;  2GFA A;  3GP8 A;  1YJ9 T;  4FSS A;  4HVV A;  1JO8 A;  1YFN A;  4M75 C;  2EQK A;  1VYT A;  1YJ9 A;  1OX9 A;  2PUK B;  4J9C A;  1I1J A;  2PU9 B;  1X27 A;  4OMM A;  2ZZD A;  5AYF A;  3C94 A;  1QWF A;  2EYZ A;  4C92 F;  1WXU A;  4XU3 A;  3M57 A;  4V2S A;  3J7A F;  3QBY A;  1ZSZ A;  2IPO B;  2DXU A;  3D7S B;  1WHK A;  5LJ3 f;  4QT7 A;  2YUQ A;  3CCL Q;  1WFW A;  1X6B A;  3JCM d;  3EG9 B;  1UJ0 A;  1QVF P;  1PRM C;  5GAO n;  2LQ8 A;  1LVK A;  3A8G B;  1VOM A;  2K79 A;  4MMK A;  3FJP A;  5GAM h;  2O4X A;  5GAO l;  1OU8 A;  3MP1 A;  4F7U B;  1YBY A;  1M90 U;  4ELZ C;  4RMO A;  2RH2 A;  1Y0M A;  2LMJ A;  1VYV A;  4UC4 A;  1XOV A;  1T0J A;  1BIB A;  2MI6 A;  4QQG A;  1JU5 C;  2DE0 X;  1W2B A;  4ANJ A;  4OVA A;  2MYS A;  5LJ5 e;  1KD1 C;  3HP9 A;  4X34 A;  5FU6 C;  2KXD A;  1UGV A;  2DXT A;  3WVE B;  1RAD B;  4M77 B;  5KCH A;  1K0X A;  5KYY B;  1CKB A;  1YIJ Q;  2EKH A;  1QCO A;  2KE9 A;  4ZGE B;  5D6W A;  3CCS Q;  2NYS A;  2BZX A;  4RTT A;  1K8A R;  3MET A;  2K2V A;  2VXE A;  1Q81 R;  3GPL A;  4QVZ A;  2FPD A;  1X2Q A;  5FRO A;  2DKG A;  5A0L A;  1AWW A;  3OSS C;  1AOJ A;  4CC7 A;  1VQK T;  3G6E Q;  1CKA A;  3OYM A;  1BYM A;  2YRD A;  4DOV A;  2KRS A;  1VQK A;  2JJ9 A;  4FYX B;  1M1K U;  4J6X A;  3CCL T;  2P0K A;  4LDX A;  5FU7 B;  4IUQ A;  2L2P A;  3CCL A;  2NUZ A;  2JMA A;  2J6O A;  5KYN A;  1OU9 A;  1UTI A;  3QJY A;  3M56 A;  1WQW A;  2ZPG B;  4E6R A;  2M51 A;  1C6V X;  1YCY A;  3VS4 A;  3OQ5 A;  2BE7 D;  2ATC B;  1F1B B;  5IXF A;  3RBB B;  4O5V A;  1PC0 A;  2SRC A;  1BI3 A;  4R56 A;  4PFO A;  5CKH A;  2MIO A;  2MCN A;  4R55 A;  2CZ6 B;  2BUD A;  1OYX A;  1LCK A;  4KGV B;  3PMT A;  1GCQ A;  2MMP A;  1YIJ T;  3EHR A;  3TSW A;  1WHJ A;  1GRI A;  2RM4 A;  2LJ3 A;  4PLL A;  4QVC A;  5GAN 8;  2G6F X;  4C92 B;  1YIJ A;  3CCS T;  2ESW A;  4F17 A;  3CCS A;  2RA2 A;  5GAO p;  2RJC A;  4Q5W A;  2EVR A;  2XID A;  4M78 A;  5GMK m;  4C5E A;  1WIE A;  2M0O A;  3G6E T;  1Q81 U;  1M30 A;  1RAA B;  1E7O A;  3G6E A;  5KH6 A;  5GAN 5;  2QDY B;  2DYB A;  3I35 A;  4FYW B;  3QZ9 B;  4GBQ A;  1FWZ A;  3CBP A;  2HEQ A;  4AFQ C;  3A5Z B;  4C5I A;  2HAX A;  5M9O A;  2F1L A;  1QLY A;  3E9G A;  2DVE A;  4M77 C;  1HJD A;  1G3Y A;  2K5F A;  1J3T A;  2LQN A;  4KH0 B;  3OW2 P;  2JZ2 A;  1M5Q 1;  1EZZ B;  2K57 A;  3M4G A;  1VA7 A;  4P5N A;  4RG8 A;  2DZ9 A;  4N4H A;  4QVD A;  6AT1 B;  2Y4X A;  4M7D C;  2DF6 A;  4M75 G;  2LNH B;  2QQA A;  1IGU A;  2EFI A;  4B6M A;  2EYY A;  3IQL A;  2V8K A;  1M4Z A;  1G83 A;  2C0O A;  1CSK A;  1VYU A;  5DY9 A;  3H41 A;  1RAB B;  2D0Q B;  5FU7 C;  2A08 A;  3MEU A;  3EFO B;  3BE3 A;  5FWB A;  2QEX Q;  2P0P A;  2DET A;  2RHI A;  4AFU C;  1BCO A;  1E6G A;  1U1S A;  2OJ2 A;  4EPC A;  1E6H A;  4ZNX A;  2DPP B;  5KYX A;  3JRZ A;  2F69 A;  2EJ9 A;  1B34 A;  1RAG B;  2PVG B;  3VUZ A;  4X9D A;  3LYI A;  4FSX A;  2O2O A;  2XDD A;  4PJO G;  4RG2 A;  4C0D C;  2MF2 A;  3RES A;  3JCM V;  3OY9 A;  1FXX A;  1N6A A;  2O88 A;  4A4F A;  1M1F A;  1NPP A;  3MJX A;  2EYX A;  4IUT A;  3M0U A;  2Y4Y A;  1Q86 U;  2OI3 A;  1YI2 T;  1M27 C;  3URG A;  3UAT A;  1Q7Y R;  1YI2 A;  1MNE A;  3CXC P;  4DEY A;  1ARK A;  2DYI A;  5EG2 A;  4EMK B;  1D1B A;  5DLO A;  2JOY A;  3KFV A;  1AVZ C;  1Z9Q A;  4J6Y A;  3CCQ T;  3G71 T;  2LCS A;  1SPK A;  3CCE T;  1B3Q A;  1M3C A;  2DM1 A;  3OBW A;  2WSF E;  2KR3 A;  3G71 A;  4BD3 A;  3CCE A;  2NUP A;  2XD0 A;  4M75 F;  3MPU B;  1KQ1 A;  1YHQ Q;  5LJ3 d;  5GMK i;  3M59 A;  3RR6 A;  4AMC A;  2AK5 A;  2RPN A;  3QDR B;  3M54 A;  3MEW A;  3O8V A;  4D6W A;  3V8K A;  3G1J A;  1PNJ A;  3INZ A;  1QVG S;  3EFR A;  1WLP B;  1UGQ B;  3JCM c;  4N0A A;  3CCM T;  5IHI A;  5L8R E;  4YTL A;  4OF1 A;  3CCM A;  1VIE A;  5D6Y A;  2QQS A;  1K9A A;  2YUN A;  2QK0 A;  2D1X A;  1I0C A;  1Y07 A;  3CPW P;  1JJ2 P;  3I5S A;  4WTO B;  2DBM A;  1I4K 1;  2DO3 A;  5GAM j;  5GAN j;  2KK4 A;  3UA6 A;  3MHX A;  4OMQ A;  2X4Y A;  2AIR B;  2PZ1 A;  2A37 A;  2ZCF B;  1TS9 A;  1KQS A;  2ZAE A;  2X9H A;  4Z88 A;  1M1G A;  2EGC A;  2FZG B;  2HD0 A;  1I8F A;  1U06 A;  3S3N A;  1WHL A;  2PVD B;  2E64 A;  4OMF B;  1IHV A;  1YCS B;  1Q7Y U;  2D8J A;  4X1V A;  2PUO B;  1K9M R;  4FW2 A;  3VRY A;  4OMN A;  4J83 A;  5GAN 3;  2X3W D;  4J8O A;  5GAO q;  2RQW A;  2OTL Q;  5LJ3 g;  1QP3 A;  4ZN1 A;  3M9Q A;  4F7U G;  1YHQ T;  2EJF A;  1YHQ A;  2KNB B;  2C0T A;  4TVR A;  2E4H A;  1TUC A;  2RB6 A;  3R6N A;  5IXB A;  2XG8 D;  5GMK h;  3SD4 A;  3LH0 A;  3OYC A;  1FMV A;  3WVD B;  4Z8A A;  2PQW A;  3VS7 A;  5CK9 A;  4A4G A;  4M77 G;  3VYH B;  4EMK C;  2XK0 A;  3M55 A;  1SEM A;  1KC8 R;  2J05 A;  1Q82 R;  4XU2 A;  4AT1 B;  2RI5 A;  2B86 A;  4M7D G;  2I0N A;  3LW5 E;  4BDY A;  2EBP A;  2GTJ A;  2FZK B;  1OOT A;  3L1A A;  4E7Z A;  2W10 A;  1SRL A;  2CP6 A;  4JS5 A;  3QYH B;  4E2F B;  5AT1 B;  2F5K A;  4ORZ A;  1RI9 A;  2AT1 B;  1ZX6 A;  4BI4 A;  4IUV A;  2V1Q A;  5CQX A;  1V76 A;  1TUG B;  4FL6 A;  2W0Z A;  1SHG A;  1EIF A;  3X20 B;  4M75 B;  3BW1 A;  2EQI A;  4JJB A;  2DEQ A;  2QTX A;  1NZ9 A;  5J3B A;  5EC7 A;  1D0X A;  5FRN A;  4E7J A;  2RK1 A;  3MKD A;  2RK2 A;  4JZ3 A;  3V7C A;  1BU1 A;  4DBQ A;  5D7U A;  3MEA A;  3BFM A;  2D0N A;  3FIF A;  4XTU A;  3VS1 A;  2OTJ Q;  1PWT A;  2QGG A;  4J9H A;  4HCK A;  1K73 R;  5GAN 4;  3M4Y A;  3EGX B;  1ZUK A;  1QVF S;  2RHU A;  4F7U F;  2HQE A;  3E9F A;  1YJN Q;  2WSC E;  1LPL A;  2H8H A;  2QYZ A;  3OA6 A;  2RHZ A;  1MUZ A;  1MMG A;  1D3B B;  5LJ5 j;  1GBR A;  2GFU A;  3VYG A;  1WZO A;  3TU4 K;  4MZM A;  1KC8 U;  2P0Q A;  4M77 F;  2RI2 A;  3THK A;  2ZPE B;  3ASK A;  2A7Y A;  2VB6 A;  2LJ0 A;  3H6Z A;  4FCY A;  4M7D F;  2CT4 A;  4ELY C;  3VUB A;  2JVV A;  4PJN A;  2H3J A;  4OB3 B;  4LUD A;  2YRV A;  1FMW A;  2YUP A;  3TEE A;  4F04 B;  2LT1 A;  1S1N A;  1MV3 A;  1OEB A;  3VRZ A;  4A4H A;  4HXJ A;  2QAZ A;  2A28 A;  1LNX A;  4XTW A;  1XTD A;  3Q1J A;  1M90 C;  3UWN A;  4F14 A;  2JTF A;  5KYU A;  5KCO A;  2MOX A;  4Z89 A;  3OS5 A;  4ZGJ B;  2DIL A;  3DB4 A;  3CCJ Q;  2IG0 A;  1YJN T;  3E2U A;  3V7S A;  1VQ8 T;  2M16 A;  4C5G A;  5CAI A;  2KT8 A;  3JCM P;  1WDX A;  1NYF A;  1YJN A;  3DB3 A;  4FU6 A;  1VQ8 A;  1UFF A;  3J81 E;  2CZ7 B;  4J6W A;  1TOV A;  2M02 A;  4LNP A;  1Q95 G;  1ZQ1 A;  2FEI A;  2RF0 A;  4C0Z A;  4NOY A;  3H0F A;  2BIV A;  5IHN A;  2A36 A;  3JB9 H;  1ZSZ C;  4HCZ A;  3VS2 A;  2CGH A;  3EG1 A;  3L42 A;  2EIF A;  2XIC A;  3EGD A;  1H8K A;  4MZP A;  3RMS A;  2LDM A;  5C6S A;  2L89 A;  1ABO A;  1M1K C;  2CRE A;  2FO0 A;  1V29 B;  4QW2 A;  2DA9 A;  3A8O B;  1W2B P;  1IRX A;  3VKI A;  2HMA A;  1R8O B;  2ZGW A;  3MP8 A;  1OZ2 A;  3SWN A;  1M8V A;  2MPX C;  2RMO A;  2GGR A;  2QDL A;  1NJI U;  2BZ8 A;  5GAN h;  3FLG A;  3QWX X;  3OSV A;  1MMD A;  4B9W A;  2MWO A;  1JBM A;  4DBH A;  3QZ5 B;  1U8R A;  2YLC A;  2DL7 A;  3CCJ T;  1M8M A;  4FIB A;  1MMA A;  3CCJ A;  2CS7 A;  5IN1 A;  2DTO A;  3BDL A;  4OMO A;  5IT9 E;  3OW2 S;  1QCF A;  3I9Q A;  2RQV A;  1NPR A;  1SRM A;  4BE1 A;  2ROT A;  2L8D A;  3PT9 A;  5GAN 6;  1Y96 A;  2K4Y A;  4J9E A;  4PJO A;  1IZ6 A;  2G3R A;  5HK0 A;  2HL3 A;  1GFD A;  1AZG B;  4M7D B;  1N27 A;  2KDS A;  3QUI A;  3MO8 A;  1O75 A;  2J7I A;  1B7T A;  2O01 E;  2WAC A;  1Q81 C;  2ENM A;  2CP5 A;  4AFZ C;  4OB2 B;  1AHJ B;  1S72 Q;  8ATC B;  3UDC A;  1ZBJ A;  1UHF A;  3O5Z A;  3E1S A;  2QG9 B;  1K76 A;  2JS0 A;  5KYX B;  3ER0 A; 
#chains in the Genus database with same CATH homology
 1BIA A;  3JB9 I;  3OYN A;  1B34 B;  2JTM A;  5FRM A;  4FSX A;  2OTJ A;  3OYF A;  1KG1 A;  3LX7 A;  2XDD A;  4PJO G;  3X24 B;  1I5L A;  4IUU A;  3LGL A;  1VIF A;  4RG2 A;  2I2L A;  5CKB A;  3OYB A;  4C0D C;  2MF2 A;  2RJD A;  1QW1 A;  1Q82 C;  2VGM A;  3RES A;  3BDU A;  4BY6 C;  5GAM g;  1WJS A;  2E12 A;  3HRT A;  3JCM J;  3JCM V;  1WNL A;  5GMK j;  4XK8 E;  3OY9 A;  5J39 A;  1FXX A;  3LLR A;  2DTH A;  1N6A A;  1K73 U;  5A2Q E;  4OB0 B;  2E6Z A;  4A4F A;  5KE3 A;  1M1F A;  1WQ7 A;  2X4W A;  4C8Q E;  1NPP A;  2GQV A;  3PFS A;  4IUT A;  4M7A D;  2Y4Y A;  4C0D B;  4JRI A;  1Q86 U;  3CCR T;  1YI2 T;  4BY6 B;  5CO7 A;  4EMK A;  2QQR A;  3FB9 A;  5LL6 S;  3SDZ A;  3URG A;  3S6W A;  4C8Q G;  4RKU E;  4XAX B;  3CCR A;  1YI2 A;  1N9R A;  4FT2 A;  3BY7 A;  5EG2 A;  4EMK B;  3JB9 D;  5DLO A;  3QJ6 A;  1VQM T;  3CCV T;  2RO0 A;  4XTX A;  3KUF A;  2JOY A;  3QO3 A;  3CXC S;  1VQM A;  3C12 A;  2LRQ A;  2RD1 A;  4OGE A;  3VV0 A;  3CCV A;  1VQP T;  2DIQ A;  4J6Y A;  3RMQ A;  3CCQ T;  3G71 T;  5CR2 A;  3NTH A;  4O6J A;  3CCE T;  3OBW A;  1IRE B;  1VQP A;  2WSF E;  3OYH A;  4HCB A;  2VUB A;  3G71 A;  5GAO r;  4BD3 A;  4M75 A;  1JRI A;  2DXC A;  3CCE A;  4IUP A;  3SWN C;  1H64 1;  5HK3 A;  1VQL T;  2XD0 A;  3SB2 A;  1ZBX A;  2LC4 A;  4M75 F;  3EAE A;  5CIU A;  1K8A U;  4ME7 A;  1KQ1 A;  2ZPI B;  4M78 B;  4M77 D;  5IAY A;  1S72 T;  3CBO A;  4KT0 E;  1VQL A;  1UGS B;  5LJ3 d;  4EDU A;  3M59 A;  4JUV A;  5GMK i;  5GAO m;  2JN0 A;  5HKC A;  4BUG A;  4JS4 A;  1S72 A;  2P4T A;  3C95 A;  2RHY A;  4RCC A;  3QDR B;  1W2B S;  4HKE A;  2OAU A;  4DQ2 A;  3JCM h;  5HY6 A;  2EQJ A;  2DD5 A;  3M54 A;  2WSE E;  3MEW A;  3O8V A;  3V8K A;  4D6W A;  3SWN B;  2DTI A;  3E19 A;  3HKS A;  3INZ A;  4M7D D;  3RKX A;  1QVG S;  1K73 C;  3CCU T;  3EFR A;  2AHJ B;  4OGC A;  1UGQ B;  3JCM c;  3OMG A;  2M1H A;  4N0A A;  3HPW A;  5LJ5 h;  3CCM T;  5LJ3 j;  5GAM d;  3CCU A;  5GAN d;  4M7A F;  2X35 A;  4XU1 A;  3LGF A;  1BI0 A;  5L8R E;  4YTL A;  4II1 A;  5LJ3 e;  1OZ3 A;  2PVO B;  4L6V 5;  4LD6 A;  4OF1 A;  2VYT A;  5CKE A;  3JAM E;  3CCM A;  4ZTJ A;  1Q86 C;  4C92 E;  5GMK l;  3HL8 A;  1VIE A;  5D6Y A;  3CBM A;  2QQS A;  4NL2 A;  3I55 T;  1HK9 A;  2KAF A;  2HQX A;  3CEY A;  4PJO C;  2FHD A;  3JB9 F;  3QKJ A;  1Y07 A;  2RJE A;  4BE2 A;  2DJZ A;  3UPU A;  3I55 A;  4CRI A;  3RKW A;  3RKY A;  4C92 G;  4KUD K;  4VUB A;  2DO3 A;  1I4K 1;  3GF5 A;  5GAM j;  1VQ7 T;  5GAN j;  2KK4 A;  3CMA T;  3FEO A;  1D3B A;  3JCM e;  3G7Z A;  3CPW S;  1Y96 B;  1JJ2 S;  2BKD N;  3MHX A;  5GAN e;  1VQ7 A;  2E5Q A;  2X4Y A;  3JCM X;  3CMA A;  2ZCF B;  2F5T X;  3GNG A;  3SFM A;  3OYG A;  5FLX E;  4PJO B;  3L2W A;  4M7A E;  4JDS A;  1KQS A;  2Y90 A;  2XU8 A;  5GAN 2;  1M1G A;  1K8A C;  2NLU A;  1KHC A;  1I8F A;  2HD0 A;  1QVF A;  2QQB A;  1VQN T;  2A3L A;  1G3W A;  4N4G A;  3VU3 C;  3S3N A;  4Y91 A;  2QXF A;  4J5Y A;  4M7A G;  2PVD B;  2E64 A;  3OYL A;  4OMF B;  3A8H B;  1UGP B;  4A54 A;  3ZBD A;  2JUF A;  2K5I A;  4F7U E;  3OYD A;  3LWI A;  2KY9 A;  3HFO A;  3UT1 A;  1Q7Y U;  2D6F A;  4LDY A;  3JCM Q;  5A0G A;  2PUO B;  3PGG A;  1JB0 E;  3PNW C;  4EMG A;  3PIO A;  4C8Q A;  3QSU A;  4OP0 A;  4J83 A;  5GAN 3;  2LVM A;  4J8O A;  5FU6 B;  5GAO q;  4C8Q F;  5CVI A;  2E41 A;  4MZT A;  1QP3 A;  4ZN1 A;  3M9Q A;  4F7U G;  5LJ3 g;  4E7L A;  2LT4 A;  4BB7 A;  4C8Q B;  3DLL A;  1YHQ T;  2EJF A;  2EJG A;  4CI0 C;  1VQ6 T;  2RHX A;  3X25 B;  5I2S A;  4EMH A;  2CZ0 B;  1YHQ A;  4TVR A;  4C92 D;  4PLI A;  3S3O A;  1VQ6 A;  4M77 E;  2XHC A;  2K3X A;  2RB6 A;  2XG8 D;  2EQU A;  1Y7X A;  4FM4 B;  5GMK h;  1DJ7 B;  3KBG A;  4XQ3 A;  3SD4 A;  3LH0 A;  2LQK A;  4BI8 B;  3OYC A;  2IVW A;  3QHS A;  3JCM g;  2DZC A;  5I2M A;  4WF2 A;  3WVD B;  1WGS A;  2PQW A;  5GAN g;  3J80 E;  5CK9 A;  1PSE A;  4A4G A;  4M77 G;  3EFS A;  1X6O A;  1O9S A;  4BI3 A;  1UEB A;  3FRN A;  4KBM B;  3VYH B;  4M7D E;  4EMK C;  2R5A A;  3OYA A;  1I81 A;  2XK0 A;  3M55 A;  3HSB A;  5LJ5 g;  4BAC A;  4N4I A;  4E47 A;  1XQH A;  1X75 C;  2EKO A;  1VUB A;  4XU2 A;  4GY5 A;  4BDZ A;  2RI5 A;  3KXT A;  3G4S T;  1TH7 A;  2B8A A;  1G3S A;  3GLX A;  2RI3 A;  3HRU A;  4Z02 A;  2EYQ A;  3FC3 A;  3LW5 E;  3S3M A;  4M7D G;  1LJO A;  4ATO A;  3OBY A;  4BDY A;  3G4S A;  3ZFJ A;  5I21 A;  2GFA A;  1KQ2 A;  4XTY A;  3L1A A;  1G3T A;  3GP8 A;  1YJ9 T;  4M78 C;  4JS5 A;  3QYH B;  4M75 C;  1Q7Y C;  2EQK A;  2F5K A;  3H8Z A;  4QQ6 A;  1YJ9 A;  4JRQ A;  2V8I A;  3L2U A;  3ZEH A;  5CKD A;  2PUK B;  3QG1 A;  4BI4 A;  3RUX A;  4IUV A;  4DA4 A;  5CQX A;  5DLQ E;  2PU9 B;  3OYE A;  4ZTF A;  2L3R A;  1M9S A;  4FL6 A;  2LTO A;  4C92 A;  2ZZD A;  2ZPF B;  2QEX T;  4PNO A;  3C94 A;  5AYF A;  1KD1 U;  4C92 F;  1EIF A;  3X20 B;  4M75 B;  3BW1 A;  4XU3 A;  3M57 A;  2QEX A;  2X4J A;  4C5H A;  3RER A;  2DEQ A;  2QTX A;  4V2S A;  3J7A F;  1NZ9 A;  3QBY A;  5J3B A;  4LDU A;  5FRN A;  3DLM A;  2RK1 A;  4E7J A;  4N0A C;  3GOX A;  2RK2 A;  2XI9 A;  2DXU A;  2E65 A;  2KQW A;  3V7C A;  3NTI A;  4J7I A;  5LJ3 f;  3MEA A;  1BI2 A;  2HBP A;  3QXE B;  1VQ4 T;  3BFM A;  4E7K A;  3F70 A;  3FIF A;  3HHT B;  4M7A A;  3JCM d;  4E7I A;  2QQ9 A;  3NTK A;  4MML A;  1VQ4 A;  4XTU A;  2RJF A;  2VXF A;  1N8R U;  4M7A B;  2R58 A;  3P8B B;  4LDW A;  2DK3 A;  2E70 A;  1KQS S;  5GAO n;  5GAN 4;  5LJ5 d;  2LQ8 A;  3M4Y A;  2E1H A;  3A8G B;  4MMK A;  4F7U A;  1UB4 A;  3FJP A;  5GAM f;  5GAM h;  4DOW A;  5GAN f;  1QVF S;  2RHU A;  2X4X A;  2O4X A;  4X9C A;  2HQE A;  4F7U F;  1HXD A;  3E9F A;  3MP1 A;  5GAO l;  3L2V A;  2WSC E;  2C06 A;  3OA6 A;  4F7U B;  1YBY A;  1M90 U;  4ELZ C;  4RMO A;  2RH2 A;  1MGQ A;  2RHZ A;  1XNI A;  4UC4 A;  4PL6 A;  1XOV A;  1BIB A;  5C0M A;  1D3B B;  2DAQ A;  2MI6 A;  5LJ5 j;  4QQG A;  1G5V A;  2DIG A;  1WJR A;  2GFU A;  3ME9 A;  3V8L A;  3VYG A;  1W2B A;  1W4S A;  4M77 A;  4OVA A;  5LJ5 e;  4JJN K;  1VQ5 T;  3L2R A;  3TU4 K;  3HP9 A;  4MZM A;  4X34 A;  5FU6 C;  1KC8 U;  1KD1 C;  2P0Q A;  4M77 F;  4JLI A;  3CD6 T;  3OS0 A;  3PTA A;  2DXT A;  3WVE B;  1BKB A;  3JCM W;  4C8Q C;  2RI2 A;  1VQ5 A;  4M77 B;  2L5Q A;  5KCH A;  3M53 A;  3CD6 A;  4A4E A;  2ZPE B;  3ASK A;  2XKO C;  2A7Y A;  3OYK A;  1SSF A;  3JCM b;  2V8J A;  4ZGE B;  5D6W A;  4B9X A;  1KHI A;  3H6Z A;  4M7D A;  2EWN A;  3MET A;  2K2V A;  2JNG A;  1N9S A;  2VXE A;  3LWH A;  4M7D F;  2MWP A;  4ELY C;  3VUB A;  2K3Y A;  3V7R A;  3GPL A;  4QVZ A;  2E6N A;  2JVV A;  2LCL A;  2YHT A;  2VV5 A;  4L5G A;  1RI0 A;  5FRO A;  2DKG A;  2H3J A;  4OB3 B;  3OW2 A;  1P92 A;  1RL2 A;  3OB9 A;  3MCA B;  3OSS C;  5A0L A;  1Y71 A;  1N8R C;  2YRV A;  4MDX A;  3OS1 A;  1VQK T;  3TEE A;  2KMT A;  2LT1 A;  1ZHI A;  4KUL A;  5KE2 A;  3OYM A;  4FT4 A;  1BYM A;  1NE8 A;  4DOV A;  2QA4 T;  1VQK A;  1UGR B;  4A4H A;  1M1K U;  4J6X A;  4MDW A;  3CPF A;  4GLK A;  3CCL T;  1LNX A;  2LCC A;  2LNV A;  2P0K A;  3QII A;  4XTW A;  5FU7 B;  1XTD A;  2QA4 A;  4LDX A;  1YJW T;  2VGN A;  3Q1J A;  1M90 C;  4IUQ A;  4QQD A;  3CCL A;  3UWN A;  5D6X A;  3OYI A;  2DD4 A;  5CCA A;  2JTF A;  5KCO A;  3OYY A;  1VQN A;  4M78 D;  2YLB A;  1YJW A;  1QP2 A;  2MAM A;  3OS5 A;  4M75 D;  4ZGJ B;  3QJY A;  2R5M A;  3M56 A;  3WXM B;  1WQW A;  3DB4 A;  4JLG A;  2ZPG B;  5CQY A;  2IG0 A;  3R6O A;  1YJN T;  2XDB A;  2XDP A;  3V7S A;  1KC8 C;  1YCY A;  2CKK A;  2M16 A;  4C5G A;  5CAI A;  1VQ8 T;  3AHU A;  4ZGD B;  1H3Z A;  3LYI A;  3JCM P;  3T9N A;  4ZN3 A;  2R57 A;  1YJN A;  3DB3 A;  3OQ5 A;  4KUI A;  3OMC A;  3QPH A;  4FU6 A;  3L2Z A;  1VQ8 A;  3DKM A;  3J81 E;  2CZ7 B;  4J6W A;  5GMK e;  2KSS A;  2D9T A;  5CKF A;  3OYJ A;  4O5V A;  4C92 C;  1ZQ1 A;  4A53 A;  1BI3 A;  4R56 A;  1YIT T;  2VC8 A;  5CKH A;  3GNF B;  2FVU A;  4C0Z A;  4R55 A;  3N5B B;  2CZ6 B;  4NOY A;  3X28 B;  2BIV A;  2BUD A;  1OYX A;  1WPY A;  5GAN 7;  1VQO T;  3PMT A;  1YIT A;  2MMP A;  4PKC C;  3VJP A;  1YIJ T;  3A8L B;  3V8J A;  1VQO A;  3JB9 H;  2M9U A;  4HCZ A;  2RM4 A;  4PLL A;  4QVC A;  5GAN 8;  2CGH A;  3JB9 J;  4JRP A;  4C92 B;  1YIJ A;  3CCS T;  3L42 A;  2EIF A;  2XIC A;  2K5L A;  3M5A A;  4MZP A;  3RMS A;  2OTL T;  4M7A C;  3CCS A;  2LDM A;  2RA2 A;  5GAO p;  3JSC A;  5C6S A;  2L89 A;  1M1K C;  2RJC A;  4PJO D;  4Q5W A;  2OTL A;  2XID A;  2LX9 A;  5LJ3 h;  4M78 A;  3CCQ A;  5GMK m;  4C5E A;  2GF7 A;  4M78 F;  1V29 B;  1K9M U;  1QVP A;  3HRS A;  4E7H A;  2M0O A;  4QW2 A;  4IUR A;  3A8O B;  3G6E T;  2EQM A;  3MP6 A;  3QYG B;  1U1T A;  4HT8 A;  1Q81 U;  3VKI A;  1GXI E;  1R8O B;  2ZGW A;  3MP8 A;  3G6E A;  3CC7 T;  5KH6 A;  5GAN 5;  2QDY B;  3CME T;  3CXC A;  1OZ2 A;  3SWN A;  5A0D A;  1M8V A;  3QZ9 B;  3CC7 A;  3JCM f;  1FWZ A;  4J7F A;  3CME A;  1NJI U;  3CBP A;  5GAN h;  2ZPH B;  3FLG A;  3A5Z B;  4C5I A;  2HAX A;  5M9O A;  3OSV A;  4B9W A;  4IKF A;  3E9G A;  3TRE A;  3A8M B;  4C8Q D;  2MWO A;  3PIP A;  1JBM A;  2DVE A;  2O4X B;  3I56 T;  3NFC A;  3QZ5 B;  1G3Y A;  3MEV A;  4M77 C;  5LJ5 f;  1U8R A;  2YLC A;  2E10 A;  2K5F A;  3CCJ T;  3CC2 T;  2EAY A;  4M78 E;  4FIB A;  3I56 A;  4M75 E;  3FDR A;  2JZ2 A;  1BI1 A;  3M58 A;  1M5Q 1;  2QI2 A;  2K57 A;  4RCB A;  3CCJ A;  3M4G A;  2CS7 A;  3CC2 A;  4P5N A;  4RG8 A;  2CZ1 B;  5IN1 A;  1LOJ A;  2DZ9 A;  4N4H A;  1X01 A;  4QVD A;  2DTO A;  3BDL A;  2Y4X A;  5IT9 E;  3OW2 S;  1Q82 U;  4M78 G;  4M7D C;  3P8D A;  4C0F A;  1NPR A;  4M75 G;  2QQA A;  3PT9 A;  2L8D A;  4BE1 A;  1QVG A;  5GAN 6;  4XU0 A;  5J26 A;  1Y96 A;  2EFI A;  2K4Y A;  2FB7 A;  4HA8 A;  1FX7 A;  2DXB A;  1WJQ A;  3P8H A;  4Y28 E;  3GIB A;  2KVQ G;  2FL7 A;  2V8K A;  4PJO A;  5GAM e;  1IZ6 A;  2G3R A;  5HK0 A;  1M4Z A;  4PJO F;  3C4S A;  4NS5 A;  3L2Q A;  5DY9 A;  3X26 B;  2ZPB B;  1PSF A;  4M7D B;  4XTZ A;  1N27 A;  4XTV A;  2KDS A;  3QUI A;  2D0Q B;  1MHN A;  1K9M C;  3MO8 A;  1O75 A;  3PMI A;  5FU7 C;  2FYK A;  4HCC A;  2O01 E;  2WAC A;  1Q81 C;  3MEU A;  4BE0 A;  2CYZ B;  4L59 A;  1AHJ B;  2P0P A;  4OB2 B;  3TCJ A;  4A4K A;  4HT9 A;  1VQ9 T;  1OI1 A;  3CPW A;  2RHI A;  1JJ2 A;  4JRK A;  3UDC A;  3CC4 T;  2GCX A;  1NJI C;  3HFN A;  4LDV A;  5DM7 R;  1U1S A;  4EPC A;  1VQ9 A;  3JB9 G;  4LD9 K;  2DPP B;  2HNI A;  3JRZ A;  4OB1 B;  3CC4 A;  2F69 A;  2EJ9 A;  3RIR A;  3E1S A;  4PJO E;  1B34 A;  2PVG B;  3VUZ A;  4NL3 A;  2OTJ T;  4X9D A;  4C0G A;  3OS2 A;  3ER0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...