5LJ3j

Structure of the core of the yeast spliceosome immediately after branching
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 13
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj3j00
1KQ1A 2DJZA 5GAN8 4X9DA 4DQ2A 4PJOE 2DXTA 1HK9A 1HXDA 5GAMd 2ZGWA 1B34B 1JRIA 3HFOA 4PJOD 3QUIA 4M78G 4NL2A 3QO3A 4M78A 4M75C 4C92G 4C92A 2VXFA 2DEQA 1KQ2A 1TH7A 2DKGA 5GANh 4F7UB 3L1AA 4C92F 4M75B 4M75D 4JUVA 5GAN6 4C8QA 4OP0A 5GAMj 5GAOp 4EMHA 1MGQA 4J6YA 4JRKA 3SWNB 4XTYA 4F7UE 4QVDA 4XTUA 5GAOr 3SWNA 3SB2A 2EJFA 4M7DF 5CAIA 4C8QB 3FJPA 4M7DA 3PGGA 4M7AF 4QVCA 4NOYA 4EMKA 4M78C 3HSBA 4M75E 4M77A 1B34A 5LJ3f 3RIRA 5I21A 3RKYA 3BY7A 2DTOA 3EFRA 2K57A 4RCCA 4XTZA 1WPYA 1U1SA 1WQ7A 3JCMf 4F7UA 3JB9F 1I8FA 4M78E 3BFMA 3V7CA 1D3BB 5LJ5e 5GAN7 4XTVA 4C8QF 5GAOl 1JBMA 5LJ3g 5LJ5h 3GIBA 2DXUA 4EMGA 1LNXA 2FYKA 2VC8A 5GAMg 3JB9J 4M7AA 4M7AG 2YHTA 5GAMh 4M7DE 3FIFA 1BIAA 2VXEA 2E64A 5LJ5f 4V2SA 3FB9A 1Y96A 4J6WA 4M77D 2EJGA 4PJOF 3EFSA 4J6XA 3V8JA 1N9RA 4XU2A 5GMKi 2EJ9A 4Y91A 5GAN5 2I2LA 3JCMh 3SWNC 4MMLA 5GAOq 4M7AD 2E1HA 5LJ3h 5GAN4 3V8KA 2E65A 5GAN2 1WNLA 2E10A 3JCMX 2DTIA 2YLCA 4XTXA 5GANe 1WQWA 4M7AC 4XU3A 1X01A 4JRIA 2DZCA 3JCMV 5LJ5d 3JB9I 3BDUA 5DY9A 5GAN3 3RERA 4PJOB 2RA2A 2EWNA 1D3BA 4C92D 3V7SA 3JCMW 5GMKe 2HNIA 3AHUA 4PJOA 5LJ5j 4M77C 3JCMd 5GANg 3V7RA 4C92C 4EMKC 2QTXA 4M77G 5GAOn 5LJ3d 3BW1A 4NL3A 4M77B 3QSUA 3RKXA 3RKWA 1M8VA 4JLIA 4EMKB 4PNOA 2RM4A 4F7UG 3INZA 2YLBA 4C8QD 4M75G 5GMKm 2RD1A 2RB6A 4M75A 4M77E 4C8QE 4C92E 3RUXA 3JB9G 1LOJA 4RCBA 4HT9A 4XU1A 4PJOC 2FB7A 5LJ3j 2JN0A 4N0AC 4M78F 1YCYA 4XQ3A 4XTWA 4C8QG 4M77F 2EAYA 1Y96B 2DTHA 3JCMJ 5GANj 2DVEA 1I4K1 1I81A 4M7AB 4F7UF 3JCMe 5GMKl 1U1TA 4X9CA 4HA8A 5LJ3e 4M78B 4M7DD 4WF2A 4C92B 5LJ5g 4M7AE 4M7DG 3JCMc 3L2ZA 1N9SA 4C8QC 4M7DB 3VU3C 5GAMe 4XU0A 5GAMf 5GMKh 5GMKj 5GANf 1LJOA 4J5YA 3M4GA 4M75F 4MMKA 1H641 3JCMQ 3JCMg 3RESA 3HFNA 5GANd 4M7DC 2CGHA 1BIBA 3QHSA 3JB9D 3JB9H 4N0AA 4M78D 1I5LA 3JCMb 5GAOm 4PJOG 3JCMP 1M5Q1 3V8LA 4A53A 4HT8A 4A54A 2DZ9A 2Y90A 2E41A
chains in the Genus database with same CATH superfamily
1KQ1A 5KE2A 1Z9QA 4JJCA 2VXFA 3H41A 1EFNA 5CKDA 2BUDA 4J6YA 4Z8AA 3OYEA 4YTLA 2ZPIB 4DBHA 3MHXA 2EJFA 3CCLQ 3PNWC 3CCMA 1Q81R 1Y07A 2K2VA 4NOYA 4JS4A 2JM8A 4CI0C 1UGQB 2LDMA 4E47A 4OGEA 2DVJA 4D6WA 5I11A 2M0OA 3PFSA 1E6GA 1MNDA 5CK9A 2VKNA 4JZ3A 2YXYA 5LJ5e 1X6BA 2RHUA 1YI2Q 2QQRA 1NM7A 5D6WA 3X26B 1BIAA 2E64A 3OSSC 2GFUA 2X3XD 5GMKi 2E3HA 3H0HA 3EGUA 3RNJA 5GAN4 2PNIA 4IIOA 1WQWA 1SG5A 1ZSZA 4JRIA 1OZ2A 3CCSQ 3JCMW 3M53A 4OB0B 2G3RA 1QVFS 3ER0A 2E5QA 3QKJA 4QW2A 1LCKA 3VS7A 1JXOA 2DM1A 2WSFE 2DX1A 3MPUB 5GJVB 3L2ZA 2AZSA 1R0CB 3M4YA 1AZEA 1QKXA 3QWYA 3VUZA 3I5RA 2AK5A 2XDBA 5CKFA 3VS5A 3JB9H 1QVFP 1FXXA 2CH4W 1LVKA 3OYMA 3X28B 1VQOA 7AT1B 1M3BA 1KJWA 1ZQ1A 1KSWA 4C8QA 1SRLA 1IXDA 3X25B 4FYWB 3OS5A 1K4US 2MMPA 2HDAA 2CP3A 2KDSA 1G3YA 2VGMA 2XK0A 3BFMA 3CCJT 3OYNA 4E7LA 4M7AA 3CD6T 4GLKA 3URGA 1GFCA 5IHKA 3HP9A 1N5ZA 4HVUA 3RR6A 1YITT 1ZLMA 2YLCA 1BK2A 3QYHB 3M59A 2ED0A 3JCMV 1VYTA 1VQ4T 1YJ9A 2EWNA 1Q81C 4PLLA 4UC4A 2JZ2A 2O4XB 5HK0A 4OMNA 3CMAQ 2XICA 4BI3A 1G8XA 1ZBJA 3QBYA 2ED1A 4L59A 3OYGA 3UA6A 1QP2A 5J39A 2R57A 4M78F 1R77A 1YCYA 1X2QA 2DBKA 1Y96B 3CBPA 4KGZB 3I56Q 1NLOC 4JJBA 1M4ZA 2MK5A 5LJ3e 3OMCA 4D8KA 1M3CA 1UGVA 1RUWA 3JCMc 3QIIA 4BE2A 1QCFA 4J9BA 2H3JA 2WSCE 1KC8U 2F2VA 3M58A 5IN1A 3JCMg 2V1QA 4L6V5 4DBRA 1X69A 3EG3A 3CCEA 1N8RC 2L3PA 1WFWA 4EPCA 1JJ2A 3CCMT 3EG2A 1SEMA 5FU7B 2DILA 2FZGB 1M2OA 2VB6A 4F7UE 2BZYA 2C0IA 2KE9A 2DL4A 4RTXA 3CC2T 2LNVA 1AWOA 3S6WA 1I8FA 1VQ9A 2X9HA 1IGUA 2CREA 2LQNA 3REBB 4J6WA 3MEAA 4C0ZA 2JXBA 2D0QB 5IT9E 3SWNC 4MMLA 4LUEA 1RADB 1VQPQ 3OA6A 2RN8A 2M51A 1WNLA 4Z02A 1M1GA 5FWCA 1X01A 2E6ZA 3CXCA 4MDWA 1YBYA 4E6RA 3BDUA 5GAN3 1IO6A 1VQPA 4HCKA 1I5OB 1W2BP 1XNIA 2Z0WA 2EQJA 4PJOA 4Y28E 1QVPA 2LC4A 1KK7A 4TVRA 3OYAA 1YJNT 2RK1A 2P0PA 5LJ3j 3JCMe 1QVFA 2A36A 1G3SA 4WF2A 2O88A 1N9SA 1P92A 4XU0A 2JMCA 1WDXA 4PJJA 2ZPGB 2OI3A 5CKEA 1VQ6Q 2CP7A 4A4FA 1KQSP 2FZCB 2E4HA 3JCMQ 2D9TA 2CDTA 2ABLA 1NYGA 2CGHA 1GFDA 4ZTJA 1Q82C 2A3LA 2OTLT 4J9FA 3DB3A 3JCMP 2NUZA 3EGXB 4PJMA 2QGFB 2RQVA 2R5MA 3EAEA 2RJEA 3HFOA 2GQIA 4NL2A 3OY9A 4C5EA 4M75C 1MMDA 1Q95G 1UGPB 1UE9A 1KQ2A 2DKGA 4OMFB 3L1AA 1VUBA 3A8OB 4J9IA 2CSQA 4FW2A 3SWNB 4PFPA 1PKSA 3OYLA 2L2PA 2RI2A 1PCXA 2E5KA 4IUQA 2P4TA 1YIJQ 2BE7D 4RTZA 3H8ZA 3I56A 2CP0A 5KYUB 3CC7Q 2ZPHB 3MJXA 1JB0E 1MMAA 2CYZB 3JB9F 1E7OA 2BKDN 5FLXE 3GOXA 2ENMA 4KUIA 3OBWA 2K6DA 5I2SA 2E70A 1M1KC 3QZ9B 2D1XA 5IAYA 3UDCA 1ACMB 4DEYA 1VYUA 2VASA 3L2VA 1YJNQ 4N4IA 4M7AD 5LJ3h 4C0DC 4F16A 1QWEA 1GBQA 3FJ5A 3C12A 2P84A 4N4HA 3J7AF 3JB9I 1B07A 3UT1A 2FPFA 1EX4A 1O9SA 1VQ8Q 3VYGA 3CC7T 2NLUA 1F1BB 1BU1A 2RH2A 2LNHB 3BW1A 2HZYA 3EG1A 4EMKB 1UG1A 4XU1A 4J9HA 4E7IA 3OS0A 3EG0A 2EGAA 1K1ZA 3RMSA 2PTKA 4FYVB 2XD0A 4KH0B 2F2XA 5LJ5g 2KXCA 2M16A 1D1CA 1GRIA 2AIRB 4LDVA 1XJWB 4DBQA 4J5YA 4MMKA 5GANd 1JU5C 1ZUKA 1OULA 1MV3A 4E7HA 2EQKA 1OPLA 2LJ0A 2DYIA 2FZKB 4B9XA 4WCIA 1YHQT 2EKHA 1U5SA 3M0QA 1AZGB 2HCKA 1OI1A 2LX7A 1YHQQ 2L3RA 1K73R 1RL2A 1NLPC 1PD1A 2KT8A 4JJNK 1IGQA 1BCOA 3PGGA 3CC7A 4KGVB 2B86A 1QVGA 2KROA 5LJ3f 2EPDA 3S3MA 4L5GA 4QQGA 1YWOA 1KQSS 1KD1U 3V7CA 2OJ2A 1Z9ZA 3JB9J 4AMCA 1O75A 2P4RA 2YHTA 2OTLQ 2VXEA 1PRMC 4V2SA 4FSSA 4PJOF 2RHYA 5KYXA 1N9RA 2D8HA 3LH0A 4ELZC 1VQ8A 2NUTA 2YDLA 1BI3A 1K73C 3NGPA 4XTXA 2K4YA 5CKBA 3CCUA 1G3TA 5LJ5d 1H3ZA 3A5ZB 2YUNA 3G1JA 1KD1R 3I9QA 1VQ6A 1X2KA 1YFNA 2L8DA 2DK3A 2NUTB 3NTIA 4J83A 4NL3A 2XU8A 4F7UG 3INZA 5GMKm 1V1CA 2O2OA 3JB9G 2QEXA 2RQTA 1WHLA 3QZ5B 2QQ9A 4M77F 2EAYA 2A37A 4GLMA 3MO8A 1I4K1 2F5KA 1B3QA 2EFIA 1VQLA 4M78B 4M7DD 2EVRA 1XTDA 4VUBA 3CPWS 2KQWA 1IHWA 3M0RA 2IPOB 1M30A 4ZN3A 3NPFA 3OYKA 3PMIA 4II1A 2Y90A 1OX8A 5GAMd 2ZGWA 1VQKT 1TH7A 1JO8A 1VQNA 3OYIA 4AT1B 5J3BA 1KD1C 1BI1A 4NS5A 4XTYA 2EQUA 3EGDB 1HD3A 2XDDA 2V8KA 2JUFA 5KYYA 3HTRA 3VRYA 2CUBA 4J9EA 4M75E 3GNGA 2AT1B 4BY6B 3PIPA 1WPYA 1SRMA 1UJYA 1WQ7A 1MV0B 4Y92A 4M7DE 1ABOA 3MP1A 3OS1A 4LD9K 4J7FA 1OU8A 4CRIA 2HSPA 1VQKA 2F2WA 1OX9A 4LNPA 3D7SB 4KT0E 1UGRB 3N5BB 2JT4A 1C6VX 3G4SA 4IUTA 2YSQA 4AFZC 3LYIA 1D0YA 4JRQA 2MCNA 4RTYA 4PJOB 2OTJA 2LJ1A 1ZBXA 2J6OA 2LVMA 4A4GA 3AHUA 5LJ5j 4X34A 2V8JA 3CCET 1T0JA 4E7SA 1S1NA 3RKXA 2ATCB 3JRZA 1GXIE 2HEQA 2QGGA 2G6FX 1TUGB 3HHTB 3ZEHA 3TSZA 3ULRB 2RK2A 3QPHA 4X9CA 4PLIA 2K2MA 1G5VA 1LJOA 4M75F 1YJ9T 2KRSA 4FSXA 1WHMA 5CIUA 1M3AA 3G6ET 2EQIA 1VQLT 4CC4B 4JDSA 2J05A 2O4XA 3CCQT 3Q1JA 3VS3A 4QVDA 4LDWA 1RI0A 3OYJA 4J9CA 4OB3B 1AT1B 3CMEQ 3M0UA 5CKHA 1VYVA 4LUDA 2ZAEA 1B7TA 2GTOA 5GJWB 2JM9A 3QJYA 3G6EQ 4MZMA 2NWMA 3JAME 3FJPA 4LXCA 5KYWB 1QCNA 2DJQA 4ME7A 4QVCA 1SF9A 2JTMA 3DLMA 4M77A 3RIRA 2XMFA 1NJIR 2J7IA 2A7YA 1QW1A 1D3BB 3CCRT 2CSIA 4M7AG 1NEBA 3FIFA 1KHIA 4M77D 3EFSA 2I2LA 4A4HA 4ATOA 3J81E 3CCLT 2E10A 2DF6A 1XOVA 5GANe 2KT1A 2PVGB 2K3BA 3META 2HD0A 4IURA 1WXTA 2RA2A 3E1SA 3CCVQ 2CP2A 1UJ0A 4LD6A 2EYXA 1M8VA 1GCQC 4EIKA 3OYBA 2QQSA 1VQMQ 2OTJT 2YLBA 1NYFA 3HPWA 1HYOA 1LOJA 2LT1A 1AEYA 4AFUC 3TCJA 4J9GA 2GQVA 4XQ3A 1YJWA 4FYXB 5KCHA 1Y0MA 2LTOA 1VQMA 2ZPFB 2KR3A 1NZ9A 4B9WA 2DIQA 4M7DG 4RG2A 3VU3C 5GAMf 2X4JA 5GMKh 1K73U 3OBYA 3I5SA 4QVZA 4WTOB 2YRCA 1U06A 2FO0A 2FEIA 2Y4YA 2XIDA 1I5LA 1M9SA 3A8MB 2O9VA 2HKQB 4FL6A 2LRQA 2V1RA 4PJOG 2RHZA 2NUPB 4A53A 4IUPA 3UPUA 4HT8A 2YRVA 1YJNA 5GAN8 5L8RE 2VGNA 1HK9A 3GP8A 1B34B 1JRIA 5AYFA 1WXUA 3WVDB 1K0XA 4M78A 4C92G 3PVQA 3QJ6A 2MAMA 5C0MA 2PQWA 4KBMB 5KH6A 4M75B 1SHGA 3P8HA 4EMHA 3CXCS 2DNUA 5CAIA 1AVZC 2QAZA 1BCMA 4ANJA 1WIEA 4OGCA 4M78C 2EQMA 1R0BG 2K9GA 1B34A 5M9OA 1VQNT 2YT6A 2RQRA 4RTTA 4A63B 4OB2B 5DLQE 1ZHIA 3WVEB 4EMGA 4C0FA 1G2BA 3CC4T 3JV3A 1TG0A 5LJ5f 3KXTA 3FB9A 4MZTA 2QG9B 1W4SA 1YITQ 2MWPA 4XU2A 3MEUA 4PFOA 2A0FB 5IH2A 4LDYA 4J9DA 1JXMA 1FMKA 5J26A 4FIBA 1T0HA 2EGCA 2HSEB 1NJIU 3L42A 2IVWA 1YNZA 2L89A 1X27A 4C92D 2KRMA 2HNIA 4C92C 5GAOn 3M0SA 3A8HB 5LJ3d 5KYUA 4C8QD 2GFAA 4OB1B 1UUEA 1WGSA 5FRNA 1ZSZC 3T9NA 4C5IA 1NPPA 1BI2A 1YIJA 2RI3A 2FL7A 1WHHA 4C0DB 5CCAA 4PJNA 3X24B 3CCQA 2XI9A 1WJQA 3G6EA 1ZX6A 3I55T 3M4GA 2LCSA 1H641 2PVDB 1NE8A 3QHSA 2EYYA 2MIOA 2LQWA 3VJPA 2HL3A 1X43A 4A54A 4IIMA 2QI2A 3C0CA 2KEAA 3A98A 3G71A 3GLXA 3F70A 1RAHB 1ZA2B 5DM7R 3DLLA 2NYSA 5GANh 2DERA 1MHNA 5GAOp 3CC2A 4XTUA 2C06A 2V26A 1TU0B 3EHRA 3AT1B 4GBQA 2K3XA 3I55A 2K57A 4F14A 1QCOA 1SHFA 2O9SA 3NMZC 3CBMA 5FW9A 5GAOl 5LJ5h 5IXFA 2DXUA 2VC8A 2FYKA 1K76A 1N8RU 2LCLA 1WYXA 5IXBA 3HKSA 3REAB 3R6OA 4C5GA 4AFQC 2DL5A 3JCMh 1OPKA 5GAOq 1VQ4A 3HRSA 1BB9A 2CKKA 2RQWA 3CCEQ 1ZUUA 4DA4A 3JCMX 4IUVA 3G4SQ 1JJ2P 4R55A 2OAWA 5HK3A 2RJFA 3M54A 1X6OA 2ROLA 2DD4A 2DL3A 3TREA 3RERA 1BI0A 1QKWA 1D3BA 1RABB 4BI4A 2SEMA 3CCQQ 4KGXB 4OMQA 4Q5WA 1WX6A 1H8KA 2Y4XA 3UATA 1VQLQ 3VKIA 1M1FA 3LWIA 3S3NA 4JLIA 1AWXA 4PKCC 4J8OA 2EW3A 2YUPA 4C8QE 2FRWA 2DYBA 5HCKA 2FG0A 4XTWA 1M8MA 1PSFA 1LPLA 1UB4A 1K9AA 4KUDK 3ME9A 1FX7A 2J6FA 3CCUQ 1S72T 3E9FA 4E7JA 4BUGA 5LL6S 2QA4A 1YP5A 3SHWA 3JSCA 1ZA1B 1JQQA 1M5Q1 3V8LA 2DZ9A 1IRXA 2E41A 1WJRA 5A2QE 2DXTA 2IG0A 3VS2A 1YITA 3KFVA 2DRKA 5CQYA 3OYHA 2OTLA 1WLPB 2QEXT 5GAN6 2DFUA 1FWZA 4QT7A 1MGQA 3H6ZA 2F5TX 5FRMA 1S72Q 1PHTA 1OV3A 1K8AR 2CP6A 1EZZB 3LX7A 3CQTA 1TXQA 3RKYA 1NBEB 1H92A 4QQDA 2SRCA 5IHNA 4XTVA 2DA9A 2JW4A 4C8QF 3TEEA 2RI5A 3O5ZA 2WACA 2YRDA 4J7IA 5GAN5 3G71T 1D0ZA 2M1HA 2R5AA 4FW1A 1K8AU 1YJ9Q 2KK4A 1M1KR 3J80E 8AT1B 3OMGA 3CD6Q 5KE3A 1VA7A 3CC4A 2DZCA 2DBMA 3BDLA 1WA7A 5CQXA 5A0LA 4BD3A 3CEYA 3TQ7P 2DL8A 1ZSGA 4XAXB 2A08A 2KY9A 1N27A 2K5IA 5KYYB 1U8RA 3O8VA 3H0IA 4M77G 2F69A 1YJWT 2QK0A 2PVOB 4ZNXA 4HXJA 2RD1A 1RAIB 2ROTA 2RPNA 4A4KA 4CC3A 4HT9A 1YJWQ 1VQ6T 2KMTA 1I07A 4MDXA 1OZ3A 2GNCA 4QQ6A 1SKUB 3JCMJ 4IKFA 3GNFB 2DAQA 2VWFA 1G83A 4C92B 2WSEE 2DD5A 3MCAB 5FWBA 1Q82R 2EBPA 4BB7A 2CS7A 2K79A 3OSVA 4BDZA 1CSKA 2C0TA 1MMGA 1RLQC 3HFNA 1VQ7T 2QQAA 3I35A 1VQOQ 1UGSB 2CT4A 4JS5A 1T3SA 3JB9D 3JCMb 4Z88A 1Q86C 1UHCA 2QYZA 2DEUA 2K3YA 1K0SA 1VQ5A 4HCBA 3QO3A 2CZ7B 5AT1B 3HRTA 1QMCA 2QTVA 1GCQA 3CPFA 2JMAA 1W2BS 1TTHB 1KHCA 3H9NA 1VQMT 5ECAA 2EIFA 3MEVA 4C5HA 4M7AF 4F17A 1D09B 4EMKA 3SDZA 4HVVA 2DRMA 3DKMA 1RAEB 1V76A 2H3EB 4F7UA 1U1SA 2QXFA 4M78E 2CT3A 3NHNA 1GBRA 5GAMg 2EGEA 2JS0A 3V8JA 4FCYA 3OYDA 2D6FA 2X35A 2FHDA 4AFSC 2DTIA 4M7AC 2RHXA 3FDRA 2ESWA 5D6XA 4KULA 4FM4B 1RI9A 1J3TA 1KFZA 1KIKA 5CR2A 4ZN1A 2K5FA 2JTEA 1YI2A 3FRNA 1SPKA 3M9QA 4C8QG 3OQ5A 1QLYA 4M7AB 3ZL7C 1U1TA 1V29B 2DLPA 2DO3A 3CCLA 3OYFA 4M7DB 1W1FA 1SSFA 3G4ST 5GMKj 1PG5B 3KUFA 3PMTA 4R0KA 2GBQA 3M0TA 1FYNA 2MF2A 2RMOA 3OW2A 3S3OA 1CKBA 4M78D 2M0YA 5CO7A 4ZGEB 2HBPA 5A0GA 2ECZA 1VQKQ 4PJOE 2YWWA 4ZGDB 2K7AA 3SFMA 2LT4A 1PWTA 1W70A 3EGDA 3QXEB 3CXCP 3CCUT 1KQSA 2L5QA 3CCJA 3NTHA 2J6KA 4JPBW 3EH1A 3OYCA 4OVAA 1WHJA 3E9GA 2HBWA 2BZXA 2COYA 1DJ7B 4LN2A 5FU6B 1IHVA 1VQNQ 2KYBA 1ARKA 4KH1B 2LMJA 1M2VB 2FPDA 2NUPA 2AZVA 4O6JA 1R8OB 1WHGA 3CC4Q 1NPRA 2LP5A 3CCVT 2AHJB 3CCST 5KYWA 4LE9A 1Q86U 4EMKC 3C95A 4HCCA 4M77B 1OQKA 2RM4A 1VQ9Q 5KCOA 3M56A 4BY6C 2XDPA 4C92E 2QASA 3QDFA 1UTIA 1TWBA 4PJOC 2HL5C 2QEXQ 3G7ZA 5GANj 1Q7YC 4F7UF 4OF1A 4HA8A 4JRPA 1T3LA 3PIOA 1S72A 1JEGA 1RAFB 2P0KA 1C1AA 5I22A 4C0GA 2ZPBB 2JTFA 4QKUA 1K9MC 2HKNA 3U23A 1AHJB 4RTVA 1Q81U 4RTUA 2EKOA 4LDXA 4C8QC 3EFOA 2VVKA 2DJZA 3CMET 3EGXA 4PJOD 1D0XA 1Y71A 3QUIA 2VYTA 3EHQA 3LLRA 3THKA 4C92F 4JUVA 2JS2A 5GAMj 4JRKA 5C6SA 2COWA 3PTAA 2BE9B 3A8LB 2DETA 2AKKA 1M1KU 2JNGA 1YWPA 1RLPC 4E7KA 5I21A 1VIEA 1M90R 1RAGB 3PT9A 3MP6A 3VV0A 1UEBA 2CZ0B 4F04B 1CKAA 1JBMA 2RNAA 3E19A 5LJ3g 3I56T 1LNXA 1YHQA 4PJLA 3X20B 2DMOA 3L2RA 4IUUA 2ZPEB 2W10A 3CMAA 4PK4A 2HQHA 2HAXA 3RDVA 1ZUYA 3UA7A 3V8KA 2JVVA 2L0AA 2RF0A 4FYYB 1PSEA 3UF4A 1D1BA 1QQJA 1VQ4Q 2OX7A 2DPPB 4RKUE 2DL7A 2K5LA 3V7SA 1N8RR 3JCMd 2M9UA 2DXBA 3V7RA 3LH5A 1Q82U 4OMMA 3LWHA 3BE3A 2MI6A 4PNOA 1VOMA 4FT4A 2HMAA 4FT2A 2CP5A 2EYQA 3RUXA 1ABQA 3I55Q 4B6MA 3HL8A 9ATCB 2RQUA 3E2UA 1E6HA 4E2FB 2J06A 3CCJQ 2DVEA 5HY6A 3PE0A 4E7ZA 1Q7YR 1N6AA 2PU9B 1YN8A 1M27C 1Q86R 5GANf 1MMNA 1AOJA 2JOYA 1BIBA 4N0AA 5GAOm 3TU4K 4FU6A 3GIBA 1VQ8T 3CCRQ 4X9DA 2LX9A 1HXDA 1PM3A 2QDLA 6AT1B 1WJSA 4M78G 1G3WA 4C92A 2I0NA 3CPWA 2GTJA 2HQXA 1Y57A 3ZFJA 1WXBA 2PZ1A 3VS0A 1HSQA 5GAOr 5IHIA 3SWNA 3OW2S 1WI7A 2LCCA 3NTKA 4LDUA 4M7DA 2X3WD 5DLOA 4ZGJB 4KRTA 5CVIA 2AKLA 3P8DA 3RMQA 1A0NB 2DTOA 1WHKA 3CCMQ 3EFRA 4RCCA 4XTZA 2XG8D 1YCSB 3L2QA 4HKEA 1TOVA 3FLGA 2P0QA 2PUOB 4HCZA 1VQ5Q 3MEWA 3C4SA 4RG8A 5FROA 4BACA 2E1HA 2YUQA 4ESRA 2E65A 5GAN2 1MUZA 1FMWA 2C0OA 3M55A 4M4ZA 4OMOA 3FC3A 1AWJA 2IIMA 1K9MU 2ZZDA 2KVQG 4DOVA 4MZPA 3PVLA 5GMKe 3OB9A 2QTXA 1UDLA 2LJ3A 1K8AC 1KC8R 3RKWA 1M2VA 4BDYA 3QSUA 4JZ4A 2D0NA 2RB6A 4M75A 1QVGS 4RUGA 3MKDA 4RCBA 2FB7A 2GCXA 1I1JA 3EG9A 4AG1C 4N4GA 1PKTA 4N0AC 1EIFA 3ZBDA 3NFCA 2B8AA 5L23A 1Y7XA 3CMAT 1X75C 3R6NA 1K9MR 1W6XA 2L3QA 3IQLA 3QYGB 2RO0A 3L2UA 4M7AE 2EYZA 1NG2A 2X51A 3SEMA 2KRNA 2KSSA 2DIGA 3RESA 3EG9B 1UFFA 2KAFA 3OYYA 4DBFA 1W2BA 1KG1A 2A28A 5EG2A 2GGRA 3CCRA 1AD5A 2PUKB 2LQ8A 3QWXX 5D7UA 4X1VA 4R56A 2BTTA 2KGTA 1QWFA 2L3SA 3LGLA 2XKOC 2O31A 2DEQA 1KC8C 2CZ1B 4DOWA 4OP0A 3GF5A 1ZSZB 2BZ8A 3SB2A 8ATCB 3LW5E 4M7DF 1VQ7Q 4C8QB 1M90C 4BI8B 4CC7A 3EH2A 2MPXC 1YI2T 2E3IA 3L2WA 3M0PA 4AG2C 2KI7A 2DXCA 4P5NA 4JLGA 5GAN7 3GPLA 2V8IA 2KNBB 3RBBB 1H3HA 4XK8E 3EFOB 2RHIA 2EJGA 4J6XA 2H8HA 2FRYA 4Y91A 1PC0A 3SD4A 1BYMA 3CCVA 1U3OA 3HRUA 2BIVA 2LZ6B 2QA4Q 3CD6A 5HKCA 1I0CA 5DY9A 3FEOA 2QDYB 2D8JA 5GANg 3WXMB 2QQBA 5A0DA 1PNJA 2CUDA 1OYXA 4M77E 1OEBA 4PL6A 1NJIC 3QDRB 4DEXA 3VS6A 1MNEA 2JN0A 1BBZA 4CC2A 3A8GB 1XQHA 2DTHA 1NEGA 1PRLC 1AWWA 1I81A 2FPEA 1GL5A 2R58A 5GAMe 2QA4T 4OMLA 4Z89A 1VIFA 3GBQA 1VQPT 3MP8A 5EC7A 1VQOT 1VQ9T 2E12A 3CMEA 4A4EA 1FMVA 2VV5A 1WZOA 5KYXB 3OS2A 2KBTA 3CBOA 1M90U 2KXDA 4DQ2A 1QVGP 1UECA 1IB8A 2EYWA 3VS1A 4RMOA 4F7UB 3A1PA 3KBGA 2VUBA 4HVWA 4M75D 4JJDA 1GCPA 2RJDA 1PD0A 2M02A 5FU7C 3M5AA 5KYNA 1TSFA 1TUDA 4PFZA 4K11A 3HSBA 1JJ2S 3BY7A 3VUBA 1VQ7A 4ELYC 2COZA 3JCMf 3VRZA 1QP3A 4D8DA 1C0MA 2CZ6B 3LGFA 3M57A 5GAMh 1YIJT 2FVUA 1Y96A 3ASKA 2X4WA 4BE1A 2EJ9A 3QG1A 3TVTA 2OTJQ 4EDUA 3VYHB 2LQKA 2YUOA 4ZTFA 1TUCA 1RACB 1D1AA 2MYSA 4XU3A 2F1LA 1OU9A 2OAUA 1HJDA 1SSHA 3DB4A 3UWNA 4OMPA 1Q7YU 2KYMA 3OW2P 2MOXA 2HQEA 1IZ6A 4M77C 5FU6C 4RTWA 2E6NA 2ZCFB 4M75G 3H0FA 2X4XA 2RJCA 4O5VA 2W0ZA 5GMKl 2GF7A 4BE0A 1OOTA 3CPWP 2X4YA 2MWOA 3CC2Q 3C94A 3P8BB 3VS4A 4ORZA 2JJ9A 1IREB 5I2MA 1TS9A 3CCSA 4GY5A 1RAAB 4M7DC 1X6GA 2XHCA 1VQ5T 5D6YA 3G71Q 3TSWA 1BKBA 2CH4A 2DE0X 1UHFA 2O01E
chains in the Genus database with same CATH topology
1KQ1A 2DJZA 5KE2A 3CMET 4PJOD 3G71A 3GLXA 3F70A 1Y71A 3QUIA 1OI1A 2VXFA 5DM7R 2VYTA 3DLLA 5GANh 3LLRA 2L3RA 4C92F 4JUVA 5CKDA 1RL2A 5GAMj 1MHNA 2BUDA 5GAOp 3CC2A 4J6YA 4JRKA 3OYEA 4YTLA 5C6SA 2ZPIB 4XTUA 3PTAA 3MHXA 2EJFA 4JJNK 3PNWC 3CCMA 2C06A 3A8LB 1Y07A 1M1KU 3PGGA 3CC7A 2JNGA 2K2VA 1QVGA 4NOYA 4JS4A 4CI0C 4E7KA 1UGQB 2LDMA 4E47A 4OGEA 5LJ3f 4D6WA 5I21A 1VIEA 2M0OA 2K3XA 3PFSA 3S3MA 4L5GA 3PT9A 3MP6A 2K57A 1UEBA 4QQGA 3VV0A 5CK9A 3I55A 2CZ0B 1KQSS 1KD1U 3V7CA 3CBMA 5LJ5e 5GAOl 1JBMA 3E19A 5LJ3g 5LJ5h 3I56T 2RHUA 2DXUA 1LNXA 2FYKA 2VC8A 2QQRA 3JB9J 1O75A 2LCLA 2YHTA 5D6WA 3X26B 1YHQA 1N8RU 1BIAA 2VXEA 2E64A 3HKSA 3X20B 4V2SA 3L2RA 3OSSC 4IUUA 2ZPEB 4PJOF 2RHYA 3R6OA 2GFUA 4C5GA 5GMKi 1N9RA 3LH0A 4ELZC 3CMAA 1VQ8A 3JCMh 5GAOq 1VQ4A 3HRSA 2CKKA 2HAXA 1BI3A 5GAN4 3V8KA 2JVVA 4DA4A 1K73C 3JCMX 4IUVA 4XTXA 4R55A 1WQWA 5HK3A 2K4YA 2RJFA 1PSEA 3M54A 4JRIA 5CKBA 1X6OA 1G3TA 5LJ5d 3CCUA 1H3ZA 2DD4A 3A5ZB 1OZ2A 3TREA 3RERA 1BI0A 2DPPB 1D3BA 4RKUE 3V7SA 2K5LA 3JCMW 1VQ6A 3M53A 4OB0B 3JCMd 4BI4A 2L8DA 2M9UA 2DK3A 2DXBA 3V7RA 4Q5WA 1Q82U 2Y4XA 3NTIA 4J83A 3VKIA 1M1FA 4NL3A 3LWHA 3LWIA 2MI6A 2XU8A 3S3NA 4JLIA 4PNOA 4FT4A 2G3RA 4PKCC 4F7UG 3INZA 4J8OA 4FT2A 5GMKm 4C8QE 1QVFS 3ER0A 2EYQA 3RUXA 3JB9G 2QEXA 3HL8A 3QZ5B 2E5QA 4XTWA 2QQ9A 3QKJA 2EAYA 4M77F 4QW2A 1PSFA 3MO8A 2DVEA 1I4K1 2F5KA 2WSFE 2EFIA 5HY6A 1VQLA 4M78B 4M7DD 1N6AA 1XTDA 2PU9B 4VUBA 3L2ZA 3CPWS 3M4YA 2KQWA 1UB4A 5GANf 4KUDK 3ME9A 1FX7A 3VUZA 2XDBA 2JOYA 5CKFA 3E9FA 1BIBA 4BUGA 4E7JA 1S72T 3JB9H 4N0AA 4ZN3A 5LL6S 2QA4A 5GAOm 3OYKA 1FXXA 3TU4K 3JSCA 3PMIA 1M5Q1 3V8LA 4FU6A 4II1A 3GIBA 2DZ9A 2Y90A 2E41A 1VQ8T 1WJRA 5A2QE 3OYMA 4X9DA 2DXTA 1HXDA 2IG0A 2LX9A 2ZGWA 3X28B 5GAMd 1YITA 1VQOA 5CQYA 1WJSA 4M78G 1G3WA 4C92A 3OYHA 1VQKT 3CPWA 2OTLA 1TH7A 2HQXA 1ZQ1A 3OYIA 1VQNA 2QEXT 3ZFJA 5GAN6 4C8QA 5J3BA 1FWZA 1BI1A 1KD1C 1MGQA 3H6ZA 4NS5A 2F5TX 4XTYA 2EQUA 5FRMA 5GAOr 3SWNA 3OW2S 2XDDA 2LCCA 2V8KA 3X25B 3NTKA 2JUFA 4LDUA 4M7DA 3LX7A 5DLOA 4ZGJB 3OS5A 5CVIA 4M75E 2MMPA 3GNGA 3P8DA 3RMQA 3RKYA 2DTOA 4BY6B 2KDSA 3EFRA 3PIPA 4RCCA 4XTZA 1WPYA 1WQ7A 1G3YA 2XG8D 2VGMA 4QQDA 2XK0A 3L2QA 4HKEA 3BFMA 3CCJT 3OYNA 4XTVA 4C8QF 3TEEA 4E7LA 3FLGA 2P0QA 4M7DE 3MP1A 2RI5A 3CD6T 4M7AA 4GLKA 3URGA 3OS1A 4J7FA 4LD9K 2PUOB 4CRIA 2WACA 5GAN5 4J7IA 3HP9A 4HCZA 3G71T 3MEWA 1VQKA 3C4SA 2M1HA 2R5AA 4RG8A 5FROA 1YITT 4BACA 2E1HA 1K8AU 2KK4A 3J80E 4M7DB 2E65A 5GAN2 4KT0E 3OMGA 2YLCA 5KE3A 1UGRB 3N5BB 3CC4A 3QYHB 3M59A 3M55A 3G4SA 4IUTA 3FC3A 2DZCA 3BDLA 3JCMV 3LYIA 4JRQA 5CQXA 5A0LA 1VQ4T 1K9MU 4BD3A 1YJ9A 4PJOB 2EWNA 2ZZDA 3CEYA 4PLLA 1Q81C 4UC4A 2JZ2A 2KVQG 2O4XB 4DOVA 5HK0A 1ZBXA 2OTJA 4MZPA 2XICA 5GMKe 2LVMA 4XAXB 2KY9A 4A4GA 4BI3A 1N27A 2K5IA 3AHUA 5LJ5j 1U8RA 3OB9A 3O8VA 3QBYA 2QTXA 4M77G 2F69A 2V8JA 4X34A 1YJWT 3CCET 1K8AC 3QSUA 3RKXA 3RKWA 4L59A 4BDYA 3OYGA 2PVOB 3JRZA 1QP2A 2RD1A 2RB6A 4M75A 1GXIE 1QVGS 4A4KA 4RCBA 4HT9A 5J39A 2FB7A 2GCXA 1VQ6T 2R57A 4N0AC 4M78F 1YCYA 2KMTA 1EIFA 4N4GA 3ZBDA 4MDXA 3NFCA 1OZ3A 3HHTB 1Y96B 2B8AA 3CBPA 4QQ6A 3ZEHA 1Y7XA 3JCMJ 3CMAT 2RK2A 1X75C 1K9MC 3QYGB 3GNFB 4IKFA 3QPHA 1M4ZA 4X9CA 2DAQA 2RO0A 5LJ3e 3L2UA 3OMCA 4PLIA 4C92B 2WSEE 4M7AE 3JCMc 2DD5A 3MCAB 3QIIA 4BE2A 1G5VA 4BB7A 2CS7A 3OSVA 4BDZA 2KSSA 1LJOA 4M75F 2H3JA 2WSCE 1YJ9T 1KC8U 3M58A 5IN1A 2DIGA 3RESA 3HFNA 3JCMg 1VQ7T 4FSXA 2QQAA 2KAFA 3OYYA 1W2BA 1KG1A 1UGSB 4L6V5 5CIUA 5EG2A 4JS5A 3JB9D 3G6ET 3JCMb 1VQLT 4JDSA 3CCRA 2PUKB 1Q86C 2O4XA 3CCQT 3Q1JA 2LQ8A 3CCEA 1N8RC 2K3YA 4QVDA 4LDWA 4R56A 1RI0A 3OYJA 4EPCA 1JJ2A 1VQ5A 4HCBA 3LGLA 2XKOC 4OB3B 3QO3A 2CZ7B 3CCMT 2DEQA 5CKHA 3HRTA 1KC8C 2CZ1B 5FU7B 4DOWA 3CPFA 4OP0A 3GF5A 3QJYA 4MZMA 4F7UE 3SB2A 1W2BS 3LW5E 4M7DF 3JAME 1KHCA 4C8QB 1VQMT 3FJPA 2EIFA 3MEVA 4C5HA 1M90C 4BI8B 4ME7A 4QVCA 4M7AF 4EMKA 3CC2T 2JTMA 2LNVA 3DLMA 4M77A 3SDZA 1YI2T 3RIRA 3S6WA 3L2WA 3DKMA 4F7UA 1U1SA 2DXCA 4P5NA 1I8FA 2A7YA 2QXFA 1QW1A 4JLGA 4M78E 1D3BB 5GAN7 3GPLA 3CCRT 2V8IA 1VQ9A 5GAMg 4M7AG 4XK8E 3FIFA 1KHIA 2RHIA 4J6WA 2EJGA 3MEAA 3EFSA 4J6XA 4M77D 3V8JA 4C0ZA 2D0QB 4Y91A 3OYDA 2I2LA 5IT9E 4A4HA 4ATOA 3SD4A 3J81E 3SWNC 4MMLA 3CCLT 3CCVA 2D6FA 1BYMA 2X35A 2FHDA 3OA6A 3HRUA 1WNLA 2E10A 2BIVA 1XOVA 2DTIA 5GANe 4Z02A 1M1GA 4M7AC 2PVGB 1X01A 2E6ZA 3CD6A 2RHXA 5HKCA 3CXCA 3FDRA 1YBYA 3META 4MDWA 5D6XA 3BDUA 4KULA 2HD0A 5DY9A 4IURA 3FEOA 5GAN3 4FM4B 2RA2A 3E1SA 1VQPA 4LD6A 2QDYB 1XNIA 5CR2A 2EQJA 4PJOA 4Y28E 4ZN1A 5GANg 1QVPA 3WXMB 2LC4A 2QQBA 5A0DA 3OYBA 1M8VA 2K5FA 1YI2A 2QQSA 3FRNA 4TVRA 3OYAA 1YJNT 1OYXA 2OTJT 2YLBA 2RK1A 3HPWA 4M77E 2P0PA 4PL6A 1LOJA 2LT1A 3M9QA 3QDRB 1NJIC 3TCJA 5LJ3j 2GQVA 2JN0A 4XQ3A 1YJWA 4C8QG 3A8GB 3OQ5A 5KCHA 1XQHA 2DTHA 2LTOA 1VQMA 3JCMe 4M7AB 1I81A 2ZPFB 1QVFA 1U1TA 1G3SA 1NZ9A 4B9WA 1V29B 2R58A 2DIQA 2DO3A 4WF2A 3CCLA 4M7DG 3OYFA 1N9SA 1P92A 4RG2A 3VU3C 4C8QC 1SSFA 2X4JA 4XU0A 5GAMe 5GAMf 5GMKh 5CKEA 3G4ST 2ZPGB 5GMKj 2QA4T 1K73U 1VIFA 3OBYA 4QVZA 4F7UB 1VQPT 4A4FA 3KUFA 3MP8A 3PMTA 2D9TA 3JCMQ 1VQOT 1VQ9T 2E12A 3CMEA 2CGHA 4A4EA 3OW2A 2MF2A 2Y4YA 3S3OA 4ZTJA 2VV5A 2XIDA 1I5LA 1M9SA 4M78D 3A8MB 5CO7A 4ZGEB 4FL6A 2LRQA 2A3LA 4PJOG 1Q82C 3DB3A 2RHZA 3JCMP 2OTLT 4A53A 4IUPA 3OS2A 2HBPA 3UPUA 4HT8A 3CBOA 2YRVA 5A0GA 1YJNA 1M90U 2R5MA 5L8RE 2VGNA 5GAN8 3EAEA 4DQ2A 2RJEA 1HK9A 3GP8A 4PJOE 1B34B 1JRIA 3HFOA 5AYFA 3WVDB 4NL2A 3OY9A 4M78A 4M75C 4C5EA 1UGPB 4C92G 4RMOA 1KQ2A 3QJ6A 4ZGDB 2DKGA 4OMFB 2MAMA 5C0MA 2PQWA 4KBMB 3SFMA 3KBGA 3L1AA 2VUBA 4M75B 2LT4A 1VUBA 3A8OB 4M75D 5KH6A 2RJDA 3P8HA 4EMHA 3CXCS 3SWNB 3QXEB 5FU7C 3M5AA 5CAIA 3CCUT 1KQSA 3OYLA 2RI2A 2L5QA 4IUQA 3CCJA 2P4TA 3NTHA 4OGCA 4M78C 3H8ZA 2EQMA 3OYCA 3I56A 3HSBA 2ZPHB 1B34A 5M9OA 1VQNT 1JB0E 4OVAA 1JJ2S 3BY7A 3VUBA 1VQ7A 4ELYC 2CYZB 3E9GA 3JCMf 3JB9F 1QP3A 2BKDN 5FLXE 4OB2B 5DLQE 3GOXA 1DJ7B 1ZHIA 5FU6B 3WVEB 2CZ6B 3LGFA 3OBWA 4KUIA 4C0FA 4EMGA 3CC4T 3M57A 5I2SA 5GAMh 5LJ5f 1YIJT 3KXTA 2E70A 2FVUA 3FB9A 1Y96A 3QZ9B 4MZTA 1M1KC 1W4SA 3ASKA 2MWPA 2X4WA 2EJ9A 3QG1A 3MEUA 4XU2A 3UDCA 5IAYA 4BE1A 3L2VA 4N4IA 4M7AD 4EDUA 3VYHB 4LDYA 5LJ3h 4C0DC 2LQKA 4O6JA 1R8OB 4ZTFA 5J26A 4XU3A 4FIBA 3C12A 4N4HA 1NJIU 3J7AF 3JB9I 3L42A 2IVWA 1NPRA 2OAUA 3UT1A 3CCVT 2AHJB 3DB4A 2L89A 3UWNA 3CCST 1O9SA 4C92D 1Q7YU 1YHQT 2HNIA 2HQEA 1IZ6A 3VYGA 3CC7T 4M77C 4C92C 1Q86U 4EMKC 3C95A 5FU6C 2NLUA 5GAOn 4HCCA 3A8HB 5LJ3d 2RH2A 3BW1A 4M77B 4EMKB 2E6NA 2RM4A 5KCOA 3M56A 2ZCFB 4C8QD 4M75G 2GFAA 4OB1B 1WGSA 2XDPA 4BY6C 4C92E 5FRNA 4XU1A 4PJOC 2X4XA 3T9NA 4C5IA 4E7IA 2RJCA 1NPPA 3OS0A 3G7ZA 1BI2A 4O5VA 2RI3A 5GANj 2FL7A 3RMSA 1YIJA 4F7UF 4OF1A 1Q7YC 4C0DB 2GF7A 5GMKl 4BE0A 2XD0A 4HA8A 2X4YA 5CCAA 5LJ5g 3X24B 3PIOA 3CCQA 4JRPA 1S72A 2M16A 2XI9A 1WJQA 2MWOA 3G6EA 2P0KA 3C94A 3P8BB 4LDVA 3I55T 4C0GA 4J5YA 3M4GA 2ZPBB 1IREB 2JTFA 1H641 2PVDB 4MMKA 1NE8A 5I2MA 3CCSA 4GY5A 5GANd 4M7DC 2XHCA 1VQ5T 5D6YA 1AHJB 2EQKA 3QHSA 4E7HA 1Q81U 3VJPA 1BKBA 2O01E 4B9XA 2EKOA 4LDXA 4A54A 2QI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ1 A;  2DJZ A;  5GAN 8;  4X9D A;  4DQ2 A;  4PJO E;  2DXT A;  1HK9 A;  1HXD A;  5GAM d;  2ZGW A;  1B34 B;  1JRI A;  3HFO A;  4PJO D;  3QUI A;  4M78 G;  4NL2 A;  3QO3 A;  4M78 A;  4M75 C;  4C92 G;  4C92 A;  2VXF A;  2DEQ A;  1KQ2 A;  1TH7 A;  2DKG A;  5GAN h;  4F7U B;  3L1A A;  4C92 F;  4M75 B;  4M75 D;  4JUV A;  5GAN 6;  4C8Q A;  4OP0 A;  5GAM j;  5GAO p;  4EMH A;  1MGQ A;  4J6Y A;  4JRK A;  3SWN B;  4XTY A;  4F7U E;  4QVD A;  4XTU A;  5GAO r;  3SWN A;  3SB2 A;  2EJF A;  4M7D F;  5CAI A;  4C8Q B;  3FJP A;  4M7D A;  3PGG A;  4M7A F;  4QVC A;  4NOY A;  4EMK A;  4M78 C;  3HSB A;  4M75 E;  4M77 A;  1B34 A;  5LJ3 f;  3RIR A;  5I21 A;  3RKY A;  3BY7 A;  2DTO A;  3EFR A;  2K57 A;  4RCC A;  4XTZ A;  1WPY A;  1U1S A;  1WQ7 A;  3JCM f;  4F7U A;  3JB9 F;  1I8F A;  4M78 E;  3BFM A;  3V7C A;  1D3B B;  5LJ5 e;  5GAN 7;  4XTV A;  4C8Q F;  5GAO l;  1JBM A;  5LJ3 g;  5LJ5 h;  3GIB A;  2DXU A;  4EMG A;  1LNX A;  2FYK A;  2VC8 A;  5GAM g;  3JB9 J;  4M7A A;  4M7A G;  2YHT A;  5GAM h;  4M7D E;  3FIF A;  1BIA A;  2VXE A;  2E64 A;  5LJ5 f;  4V2S A;  3FB9 A;  1Y96 A;  4J6W A;  4M77 D;  2EJG A;  4PJO F;  3EFS A;  4J6X A;  3V8J A;  1N9R A;  4XU2 A;  5GMK i;  2EJ9 A;  4Y91 A;  5GAN 5;  2I2L A;  3JCM h;  3SWN C;  4MML A;  5GAO q;  4M7A D;  2E1H A;  5LJ3 h;  5GAN 4;  3V8K A;  2E65 A;  5GAN 2;  1WNL A;  2E10 A;  3JCM X;  2DTI A;  2YLC A;  4XTX A;  5GAN e;  1WQW A;  4M7A C;  4XU3 A;  1X01 A;  4JRI A;  2DZC A;  3JCM V;  5LJ5 d;  3JB9 I;  3BDU A;  5DY9 A;  5GAN 3;  3RER A;  4PJO B;  2RA2 A;  2EWN A;  1D3B A;  4C92 D;  3V7S A;  3JCM W;  5GMK e;  2HNI A;  3AHU A;  4PJO A;  5LJ5 j;  4M77 C;  3JCM d;  5GAN g;  3V7R A;  4C92 C;  4EMK C;  2QTX A;  4M77 G;  5GAO n;  5LJ3 d;  3BW1 A;  4NL3 A;  4M77 B;  3QSU A;  3RKX A;  3RKW A;  1M8V A;  4JLI A;  4EMK B;  4PNO A;  2RM4 A;  4F7U G;  3INZ A;  2YLB A;  4C8Q D;  4M75 G;  5GMK m;  2RD1 A;  2RB6 A;  4M75 A;  4M77 E;  4C8Q E;  4C92 E;  3RUX A;  3JB9 G;  1LOJ A;  4RCB A;  4HT9 A;  4XU1 A;  4PJO C;  2FB7 A;  5LJ3 j;  2JN0 A;  4N0A C;  4M78 F;  1YCY A;  4XQ3 A;  4XTW A;  4C8Q G;  4M77 F;  2EAY A;  1Y96 B;  2DTH A;  3JCM J;  5GAN j;  2DVE A;  1I4K 1;  1I81 A;  4M7A B;  4F7U F;  3JCM e;  5GMK l;  1U1T A;  4X9C A;  4HA8 A;  5LJ3 e;  4M78 B;  4M7D D;  4WF2 A;  4C92 B;  5LJ5 g;  4M7A E;  4M7D G;  3JCM c;  3L2Z A;  1N9S A;  4C8Q C;  4M7D B;  3VU3 C;  5GAM e;  4XU0 A;  5GAM f;  5GMK h;  5GMK j;  5GAN f;  1LJO A;  4J5Y A;  3M4G A;  4M75 F;  4MMK A;  1H64 1;  3JCM Q;  3JCM g;  3RES A;  3HFN A;  5GAN d;  4M7D C;  2CGH A;  1BIB A;  3QHS A;  3JB9 D;  3JB9 H;  4N0A A;  4M78 D;  1I5L A;  3JCM b;  5GAO m;  4PJO G;  3JCM P;  1M5Q 1;  3V8L A;  4A53 A;  4HT8 A;  4A54 A;  2DZ9 A;  2Y90 A;  2E41 A; 
#chains in the Genus database with same CATH topology
 1KQ1 A;  5KE2 A;  1Z9Q A;  4JJC A;  2VXF A;  3H41 A;  1EFN A;  5CKD A;  2BUD A;  4J6Y A;  4Z8A A;  3OYE A;  4YTL A;  2ZPI B;  4DBH A;  3MHX A;  2EJF A;  3CCL Q;  3PNW C;  3CCM A;  1Q81 R;  1Y07 A;  2K2V A;  4NOY A;  4JS4 A;  2JM8 A;  4CI0 C;  1UGQ B;  2LDM A;  4E47 A;  4OGE A;  2DVJ A;  4D6W A;  5I11 A;  2M0O A;  3PFS A;  1E6G A;  1MND A;  5CK9 A;  2VKN A;  4JZ3 A;  2YXY A;  5LJ5 e;  1X6B A;  2RHU A;  1YI2 Q;  2QQR A;  1NM7 A;  5D6W A;  3X26 B;  1BIA A;  2E64 A;  3OSS C;  2GFU A;  2X3X D;  5GMK i;  2E3H A;  3H0H A;  3EGU A;  3RNJ A;  5GAN 4;  2PNI A;  4IIO A;  1WQW A;  1SG5 A;  1ZSZ A;  4JRI A;  1OZ2 A;  3CCS Q;  3JCM W;  3M53 A;  4OB0 B;  2G3R A;  1QVF S;  3ER0 A;  2E5Q A;  3QKJ A;  4QW2 A;  1LCK A;  3VS7 A;  1JXO A;  2DM1 A;  2WSF E;  2DX1 A;  3MPU B;  5GJV B;  3L2Z A;  2AZS A;  1R0C B;  3M4Y A;  1AZE A;  1QKX A;  3QWY A;  3VUZ A;  3I5R A;  2AK5 A;  2XDB A;  5CKF A;  3VS5 A;  3JB9 H;  1QVF P;  1FXX A;  2CH4 W;  1LVK A;  3OYM A;  3X28 B;  1VQO A;  7AT1 B;  1M3B A;  1KJW A;  1ZQ1 A;  1KSW A;  4C8Q A;  1SRL A;  1IXD A;  3X25 B;  4FYW B;  3OS5 A;  1K4U S;  2MMP A;  2HDA A;  2CP3 A;  2KDS A;  1G3Y A;  2VGM A;  2XK0 A;  3BFM A;  3CCJ T;  3OYN A;  4E7L A;  4M7A A;  3CD6 T;  4GLK A;  3URG A;  1GFC A;  5IHK A;  3HP9 A;  1N5Z A;  4HVU A;  3RR6 A;  1YIT T;  1ZLM A;  2YLC A;  1BK2 A;  3QYH B;  3M59 A;  2ED0 A;  3JCM V;  1VYT A;  1VQ4 T;  1YJ9 A;  2EWN A;  1Q81 C;  4PLL A;  4UC4 A;  2JZ2 A;  2O4X B;  5HK0 A;  4OMN A;  3CMA Q;  2XIC A;  4BI3 A;  1G8X A;  1ZBJ A;  3QBY A;  2ED1 A;  4L59 A;  3OYG A;  3UA6 A;  1QP2 A;  5J39 A;  2R57 A;  4M78 F;  1R77 A;  1YCY A;  1X2Q A;  2DBK A;  1Y96 B;  3CBP A;  4KGZ B;  3I56 Q;  1NLO C;  4JJB A;  1M4Z A;  2MK5 A;  5LJ3 e;  3OMC A;  4D8K A;  1M3C A;  1UGV A;  1RUW A;  3JCM c;  3QII A;  4BE2 A;  1QCF A;  4J9B A;  2H3J A;  2WSC E;  1KC8 U;  2F2V A;  3M58 A;  5IN1 A;  3JCM g;  2V1Q A;  4L6V 5;  4DBR A;  1X69 A;  3EG3 A;  3CCE A;  1N8R C;  2L3P A;  1WFW A;  4EPC A;  1JJ2 A;  3CCM T;  3EG2 A;  1SEM A;  5FU7 B;  2DIL A;  2FZG B;  1M2O A;  2VB6 A;  4F7U E;  2BZY A;  2C0I A;  2KE9 A;  2DL4 A;  4RTX A;  3CC2 T;  2LNV A;  1AWO A;  3S6W A;  1I8F A;  1VQ9 A;  2X9H A;  1IGU A;  2CRE A;  2LQN A;  3REB B;  4J6W A;  3MEA A;  4C0Z A;  2JXB A;  2D0Q B;  5IT9 E;  3SWN C;  4MML A;  4LUE A;  1RAD B;  1VQP Q;  3OA6 A;  2RN8 A;  2M51 A;  1WNL A;  4Z02 A;  1M1G A;  5FWC A;  1X01 A;  2E6Z A;  3CXC A;  4MDW A;  1YBY A;  4E6R A;  3BDU A;  5GAN 3;  1IO6 A;  1VQP A;  4HCK A;  1I5O B;  1W2B P;  1XNI A;  2Z0W A;  2EQJ A;  4PJO A;  4Y28 E;  1QVP A;  2LC4 A;  1KK7 A;  4TVR A;  3OYA A;  1YJN T;  2RK1 A;  2P0P A;  5LJ3 j;  3JCM e;  1QVF A;  2A36 A;  1G3S A;  4WF2 A;  2O88 A;  1N9S A;  1P92 A;  4XU0 A;  2JMC A;  1WDX A;  4PJJ A;  2ZPG B;  2OI3 A;  5CKE A;  1VQ6 Q;  2CP7 A;  4A4F A;  1KQS P;  2FZC B;  2E4H A;  3JCM Q;  2D9T A;  2CDT A;  2ABL A;  1NYG A;  2CGH A;  1GFD A;  4ZTJ A;  1Q82 C;  2A3L A;  2OTL T;  4J9F A;  3DB3 A;  3JCM P;  2NUZ A;  3EGX B;  4PJM A;  2QGF B;  2RQV A;  2R5M A;  3EAE A;  2RJE A;  3HFO A;  2GQI A;  4NL2 A;  3OY9 A;  4C5E A;  4M75 C;  1MMD A;  1Q95 G;  1UGP B;  1UE9 A;  1KQ2 A;  2DKG A;  4OMF B;  3L1A A;  1VUB A;  3A8O B;  4J9I A;  2CSQ A;  4FW2 A;  3SWN B;  4PFP A;  1PKS A;  3OYL A;  2L2P A;  2RI2 A;  1PCX A;  2E5K A;  4IUQ A;  2P4T A;  1YIJ Q;  2BE7 D;  4RTZ A;  3H8Z A;  3I56 A;  2CP0 A;  5KYU B;  3CC7 Q;  2ZPH B;  3MJX A;  1JB0 E;  1MMA A;  2CYZ B;  3JB9 F;  1E7O A;  2BKD N;  5FLX E;  3GOX A;  2ENM A;  4KUI A;  3OBW A;  2K6D A;  5I2S A;  2E70 A;  1M1K C;  3QZ9 B;  2D1X A;  5IAY A;  3UDC A;  1ACM B;  4DEY A;  1VYU A;  2VAS A;  3L2V A;  1YJN Q;  4N4I A;  4M7A D;  5LJ3 h;  4C0D C;  4F16 A;  1QWE A;  1GBQ A;  3FJ5 A;  3C12 A;  2P84 A;  4N4H A;  3J7A F;  3JB9 I;  1B07 A;  3UT1 A;  2FPF A;  1EX4 A;  1O9S A;  1VQ8 Q;  3VYG A;  3CC7 T;  2NLU A;  1F1B B;  1BU1 A;  2RH2 A;  2LNH B;  3BW1 A;  2HZY A;  3EG1 A;  4EMK B;  1UG1 A;  4XU1 A;  4J9H A;  4E7I A;  3OS0 A;  3EG0 A;  2EGA A;  1K1Z A;  3RMS A;  2PTK A;  4FYV B;  2XD0 A;  4KH0 B;  2F2X A;  5LJ5 g;  2KXC A;  2M16 A;  1D1C A;  1GRI A;  2AIR B;  4LDV A;  1XJW B;  4DBQ A;  4J5Y A;  4MMK A;  5GAN d;  1JU5 C;  1ZUK A;  1OUL A;  1MV3 A;  4E7H A;  2EQK A;  1OPL A;  2LJ0 A;  2DYI A;  2FZK B;  4B9X A;  4WCI A;  1YHQ T;  2EKH A;  1U5S A;  3M0Q A;  1AZG B;  2HCK A;  1OI1 A;  2LX7 A;  1YHQ Q;  2L3R A;  1K73 R;  1RL2 A;  1NLP C;  1PD1 A;  2KT8 A;  4JJN K;  1IGQ A;  1BCO A;  3PGG A;  3CC7 A;  4KGV B;  2B86 A;  1QVG A;  2KRO A;  5LJ3 f;  2EPD A;  3S3M A;  4L5G A;  4QQG A;  1YWO A;  1KQS S;  1KD1 U;  3V7C A;  2OJ2 A;  1Z9Z A;  3JB9 J;  4AMC A;  1O75 A;  2P4R A;  2YHT A;  2OTL Q;  2VXE A;  1PRM C;  4V2S A;  4FSS A;  4PJO F;  2RHY A;  5KYX A;  1N9R A;  2D8H A;  3LH0 A;  4ELZ C;  1VQ8 A;  2NUT A;  2YDL A;  1BI3 A;  1K73 C;  3NGP A;  4XTX A;  2K4Y A;  5CKB A;  3CCU A;  1G3T A;  5LJ5 d;  1H3Z A;  3A5Z B;  2YUN A;  3G1J A;  1KD1 R;  3I9Q A;  1VQ6 A;  1X2K A;  1YFN A;  2L8D A;  2DK3 A;  2NUT B;  3NTI A;  4J83 A;  4NL3 A;  2XU8 A;  4F7U G;  3INZ A;  5GMK m;  1V1C A;  2O2O A;  3JB9 G;  2QEX A;  2RQT A;  1WHL A;  3QZ5 B;  2QQ9 A;  4M77 F;  2EAY A;  2A37 A;  4GLM A;  3MO8 A;  1I4K 1;  2F5K A;  1B3Q A;  2EFI A;  1VQL A;  4M78 B;  4M7D D;  2EVR A;  1XTD A;  4VUB A;  3CPW S;  2KQW A;  1IHW A;  3M0R A;  2IPO B;  1M30 A;  4ZN3 A;  3NPF A;  3OYK A;  3PMI A;  4II1 A;  2Y90 A;  1OX8 A;  5GAM d;  2ZGW A;  1VQK T;  1TH7 A;  1JO8 A;  1VQN A;  3OYI A;  4AT1 B;  5J3B A;  1KD1 C;  1BI1 A;  4NS5 A;  4XTY A;  2EQU A;  3EGD B;  1HD3 A;  2XDD A;  2V8K A;  2JUF A;  5KYY A;  3HTR A;  3VRY A;  2CUB A;  4J9E A;  4M75 E;  3GNG A;  2AT1 B;  4BY6 B;  3PIP A;  1WPY A;  1SRM A;  1UJY A;  1WQ7 A;  1MV0 B;  4Y92 A;  4M7D E;  1ABO A;  3MP1 A;  3OS1 A;  4LD9 K;  4J7F A;  1OU8 A;  4CRI A;  2HSP A;  1VQK A;  2F2W A;  1OX9 A;  4LNP A;  3D7S B;  4KT0 E;  1UGR B;  3N5B B;  2JT4 A;  1C6V X;  3G4S A;  4IUT A;  2YSQ A;  4AFZ C;  3LYI A;  1D0Y A;  4JRQ A;  2MCN A;  4RTY A;  4PJO B;  2OTJ A;  2LJ1 A;  1ZBX A;  2J6O A;  2LVM A;  4A4G A;  3AHU A;  5LJ5 j;  4X34 A;  2V8J A;  3CCE T;  1T0J A;  4E7S A;  1S1N A;  3RKX A;  2ATC B;  3JRZ A;  1GXI E;  2HEQ A;  2QGG A;  2G6F X;  1TUG B;  3HHT B;  3ZEH A;  3TSZ A;  3ULR B;  2RK2 A;  3QPH A;  4X9C A;  4PLI A;  2K2M A;  1G5V A;  1LJO A;  4M75 F;  1YJ9 T;  2KRS A;  4FSX A;  1WHM A;  5CIU A;  1M3A A;  3G6E T;  2EQI A;  1VQL T;  4CC4 B;  4JDS A;  2J05 A;  2O4X A;  3CCQ T;  3Q1J A;  3VS3 A;  4QVD A;  4LDW A;  1RI0 A;  3OYJ A;  4J9C A;  4OB3 B;  1AT1 B;  3CME Q;  3M0U A;  5CKH A;  1VYV A;  4LUD A;  2ZAE A;  1B7T A;  2GTO A;  5GJW B;  2JM9 A;  3QJY A;  3G6E Q;  4MZM A;  2NWM A;  3JAM E;  3FJP A;  4LXC A;  5KYW B;  1QCN A;  2DJQ A;  4ME7 A;  4QVC A;  1SF9 A;  2JTM A;  3DLM A;  4M77 A;  3RIR A;  2XMF A;  1NJI R;  2J7I A;  2A7Y A;  1QW1 A;  1D3B B;  3CCR T;  2CSI A;  4M7A G;  1NEB A;  3FIF A;  1KHI A;  4M77 D;  3EFS A;  2I2L A;  4A4H A;  4ATO A;  3J81 E;  3CCL T;  2E10 A;  2DF6 A;  1XOV A;  5GAN e;  2KT1 A;  2PVG B;  2K3B A;  3MET A;  2HD0 A;  4IUR A;  1WXT A;  2RA2 A;  3E1S A;  3CCV Q;  2CP2 A;  1UJ0 A;  4LD6 A;  2EYX A;  1M8V A;  1GCQ C;  4EIK A;  3OYB A;  2QQS A;  1VQM Q;  2OTJ T;  2YLB A;  1NYF A;  3HPW A;  1HYO A;  1LOJ A;  2LT1 A;  1AEY A;  4AFU C;  3TCJ A;  4J9G A;  2GQV A;  4XQ3 A;  1YJW A;  4FYX B;  5KCH A;  1Y0M A;  2LTO A;  1VQM A;  2ZPF B;  2KR3 A;  1NZ9 A;  4B9W A;  2DIQ A;  4M7D G;  4RG2 A;  3VU3 C;  5GAM f;  2X4J A;  5GMK h;  1K73 U;  3OBY A;  3I5S A;  4QVZ A;  4WTO B;  2YRC A;  1U06 A;  2FO0 A;  2FEI A;  2Y4Y A;  2XID A;  1I5L A;  1M9S A;  3A8M B;  2O9V A;  2HKQ B;  4FL6 A;  2LRQ A;  2V1R A;  4PJO G;  2RHZ A;  2NUP B;  4A53 A;  4IUP A;  3UPU A;  4HT8 A;  2YRV A;  1YJN A;  5GAN 8;  5L8R E;  2VGN A;  1HK9 A;  3GP8 A;  1B34 B;  1JRI A;  5AYF A;  1WXU A;  3WVD B;  1K0X A;  4M78 A;  4C92 G;  3PVQ A;  3QJ6 A;  2MAM A;  5C0M A;  2PQW A;  4KBM B;  5KH6 A;  4M75 B;  1SHG A;  3P8H A;  4EMH A;  3CXC S;  2DNU A;  5CAI A;  1AVZ C;  2QAZ A;  1BCM A;  4ANJ A;  1WIE A;  4OGC A;  4M78 C;  2EQM A;  1R0B G;  2K9G A;  1B34 A;  5M9O A;  1VQN T;  2YT6 A;  2RQR A;  4RTT A;  4A63 B;  4OB2 B;  5DLQ E;  1ZHI A;  3WVE B;  4EMG A;  4C0F A;  1G2B A;  3CC4 T;  3JV3 A;  1TG0 A;  5LJ5 f;  3KXT A;  3FB9 A;  4MZT A;  2QG9 B;  1W4S A;  1YIT Q;  2MWP A;  4XU2 A;  3MEU A;  4PFO A;  2A0F B;  5IH2 A;  4LDY A;  4J9D A;  1JXM A;  1FMK A;  5J26 A;  4FIB A;  1T0H A;  2EGC A;  2HSE B;  1NJI U;  3L42 A;  2IVW A;  1YNZ A;  2L89 A;  1X27 A;  4C92 D;  2KRM A;  2HNI A;  4C92 C;  5GAO n;  3M0S A;  3A8H B;  5LJ3 d;  5KYU A;  4C8Q D;  2GFA A;  4OB1 B;  1UUE A;  1WGS A;  5FRN A;  1ZSZ C;  3T9N A;  4C5I A;  1NPP A;  1BI2 A;  1YIJ A;  2RI3 A;  2FL7 A;  1WHH A;  4C0D B;  5CCA A;  4PJN A;  3X24 B;  3CCQ A;  2XI9 A;  1WJQ A;  3G6E A;  1ZX6 A;  3I55 T;  3M4G A;  2LCS A;  1H64 1;  2PVD B;  1NE8 A;  3QHS A;  2EYY A;  2MIO A;  2LQW A;  3VJP A;  2HL3 A;  1X43 A;  4A54 A;  4IIM A;  2QI2 A;  3C0C A;  2KEA A;  3A98 A;  3G71 A;  3GLX A;  3F70 A;  1RAH B;  1ZA2 B;  5DM7 R;  3DLL A;  2NYS A;  5GAN h;  2DER A;  1MHN A;  5GAO p;  3CC2 A;  4XTU A;  2C06 A;  2V26 A;  1TU0 B;  3EHR A;  3AT1 B;  4GBQ A;  2K3X A;  3I55 A;  2K57 A;  4F14 A;  1QCO A;  1SHF A;  2O9S A;  3NMZ C;  3CBM A;  5FW9 A;  5GAO l;  5LJ5 h;  5IXF A;  2DXU A;  2VC8 A;  2FYK A;  1K76 A;  1N8R U;  2LCL A;  1WYX A;  5IXB A;  3HKS A;  3REA B;  3R6O A;  4C5G A;  4AFQ C;  2DL5 A;  3JCM h;  1OPK A;  5GAO q;  1VQ4 A;  3HRS A;  1BB9 A;  2CKK A;  2RQW A;  3CCE Q;  1ZUU A;  4DA4 A;  3JCM X;  4IUV A;  3G4S Q;  1JJ2 P;  4R55 A;  2OAW A;  5HK3 A;  2RJF A;  3M54 A;  1X6O A;  2ROL A;  2DD4 A;  2DL3 A;  3TRE A;  3RER A;  1BI0 A;  1QKW A;  1D3B A;  1RAB B;  4BI4 A;  2SEM A;  3CCQ Q;  4KGX B;  4OMQ A;  4Q5W A;  1WX6 A;  1H8K A;  2Y4X A;  3UAT A;  1VQL Q;  3VKI A;  1M1F A;  3LWI A;  3S3N A;  4JLI A;  1AWX A;  4PKC C;  4J8O A;  2EW3 A;  2YUP A;  4C8Q E;  2FRW A;  2DYB A;  5HCK A;  2FG0 A;  4XTW A;  1M8M A;  1PSF A;  1LPL A;  1UB4 A;  1K9A A;  4KUD K;  3ME9 A;  1FX7 A;  2J6F A;  3CCU Q;  1S72 T;  3E9F A;  4E7J A;  4BUG A;  5LL6 S;  2QA4 A;  1YP5 A;  3SHW A;  3JSC A;  1ZA1 B;  1JQQ A;  1M5Q 1;  3V8L A;  2DZ9 A;  1IRX A;  2E41 A;  1WJR A;  5A2Q E;  2DXT A;  2IG0 A;  3VS2 A;  1YIT A;  3KFV A;  2DRK A;  5CQY A;  3OYH A;  2OTL A;  1WLP B;  2QEX T;  5GAN 6;  2DFU A;  1FWZ A;  4QT7 A;  1MGQ A;  3H6Z A;  2F5T X;  5FRM A;  1S72 Q;  1PHT A;  1OV3 A;  1K8A R;  2CP6 A;  1EZZ B;  3LX7 A;  3CQT A;  1TXQ A;  3RKY A;  1NBE B;  1H92 A;  4QQD A;  2SRC A;  5IHN A;  4XTV A;  2DA9 A;  2JW4 A;  4C8Q F;  3TEE A;  2RI5 A;  3O5Z A;  2WAC A;  2YRD A;  4J7I A;  5GAN 5;  3G71 T;  1D0Z A;  2M1H A;  2R5A A;  4FW1 A;  1K8A U;  1YJ9 Q;  2KK4 A;  1M1K R;  3J80 E;  8AT1 B;  3OMG A;  3CD6 Q;  5KE3 A;  1VA7 A;  3CC4 A;  2DZC A;  2DBM A;  3BDL A;  1WA7 A;  5CQX A;  5A0L A;  4BD3 A;  3CEY A;  3TQ7 P;  2DL8 A;  1ZSG A;  4XAX B;  2A08 A;  2KY9 A;  1N27 A;  2K5I A;  5KYY B;  1U8R A;  3O8V A;  3H0I A;  4M77 G;  2F69 A;  1YJW T;  2QK0 A;  2PVO B;  4ZNX A;  4HXJ A;  2RD1 A;  1RAI B;  2ROT A;  2RPN A;  4A4K A;  4CC3 A;  4HT9 A;  1YJW Q;  1VQ6 T;  2KMT A;  1I07 A;  4MDX A;  1OZ3 A;  2GNC A;  4QQ6 A;  1SKU B;  3JCM J;  4IKF A;  3GNF B;  2DAQ A;  2VWF A;  1G83 A;  4C92 B;  2WSE E;  2DD5 A;  3MCA B;  5FWB A;  1Q82 R;  2EBP A;  4BB7 A;  2CS7 A;  2K79 A;  3OSV A;  4BDZ A;  1CSK A;  2C0T A;  1MMG A;  1RLQ C;  3HFN A;  1VQ7 T;  2QQA A;  3I35 A;  1VQO Q;  1UGS B;  2CT4 A;  4JS5 A;  1T3S A;  3JB9 D;  3JCM b;  4Z88 A;  1Q86 C;  1UHC A;  2QYZ A;  2DEU A;  2K3Y A;  1K0S A;  1VQ5 A;  4HCB A;  3QO3 A;  2CZ7 B;  5AT1 B;  3HRT A;  1QMC A;  2QTV A;  1GCQ A;  3CPF A;  2JMA A;  1W2B S;  1TTH B;  1KHC A;  3H9N A;  1VQM T;  5ECA A;  2EIF A;  3MEV A;  4C5H A;  4M7A F;  4F17 A;  1D09 B;  4EMK A;  3SDZ A;  4HVV A;  2DRM A;  3DKM A;  1RAE B;  1V76 A;  2H3E B;  4F7U A;  1U1S A;  2QXF A;  4M78 E;  2CT3 A;  3NHN A;  1GBR A;  5GAM g;  2EGE A;  2JS0 A;  3V8J A;  4FCY A;  3OYD A;  2D6F A;  2X35 A;  2FHD A;  4AFS C;  2DTI A;  4M7A C;  2RHX A;  3FDR A;  2ESW A;  5D6X A;  4KUL A;  4FM4 B;  1RI9 A;  1J3T A;  1KFZ A;  1KIK A;  5CR2 A;  4ZN1 A;  2K5F A;  2JTE A;  1YI2 A;  3FRN A;  1SPK A;  3M9Q A;  4C8Q G;  3OQ5 A;  1QLY A;  4M7A B;  3ZL7 C;  1U1T A;  1V29 B;  2DLP A;  2DO3 A;  3CCL A;  3OYF A;  4M7D B;  1W1F A;  1SSF A;  3G4S T;  5GMK j;  1PG5 B;  3KUF A;  3PMT A;  4R0K A;  2GBQ A;  3M0T A;  1FYN A;  2MF2 A;  2RMO A;  3OW2 A;  3S3O A;  1CKB A;  4M78 D;  2M0Y A;  5CO7 A;  4ZGE B;  2HBP A;  5A0G A;  2ECZ A;  1VQK Q;  4PJO E;  2YWW A;  4ZGD B;  2K7A A;  3SFM A;  2LT4 A;  1PWT A;  1W70 A;  3EGD A;  3QXE B;  3CXC P;  3CCU T;  1KQS A;  2L5Q A;  3CCJ A;  3NTH A;  2J6K A;  4JPB W;  3EH1 A;  3OYC A;  4OVA A;  1WHJ A;  3E9G A;  2HBW A;  2BZX A;  2COY A;  1DJ7 B;  4LN2 A;  5FU6 B;  1IHV A;  1VQN Q;  2KYB A;  1ARK A;  4KH1 B;  2LMJ A;  1M2V B;  2FPD A;  2NUP A;  2AZV A;  4O6J A;  1R8O B;  1WHG A;  3CC4 Q;  1NPR A;  2LP5 A;  3CCV T;  2AHJ B;  3CCS T;  5KYW A;  4LE9 A;  1Q86 U;  4EMK C;  3C95 A;  4HCC A;  4M77 B;  1OQK A;  2RM4 A;  1VQ9 Q;  5KCO A;  3M56 A;  4BY6 C;  2XDP A;  4C92 E;  2QAS A;  3QDF A;  1UTI A;  1TWB A;  4PJO C;  2HL5 C;  2QEX Q;  3G7Z A;  5GAN j;  1Q7Y C;  4F7U F;  4OF1 A;  4HA8 A;  4JRP A;  1T3L A;  3PIO A;  1S72 A;  1JEG A;  1RAF B;  2P0K A;  1C1A A;  5I22 A;  4C0G A;  2ZPB B;  2JTF A;  4QKU A;  1K9M C;  2HKN A;  3U23 A;  1AHJ B;  4RTV A;  1Q81 U;  4RTU A;  2EKO A;  4LDX A;  4C8Q C;  3EFO A;  2VVK A;  2DJZ A;  3CME T;  3EGX A;  4PJO D;  1D0X A;  1Y71 A;  3QUI A;  2VYT A;  3EHQ A;  3LLR A;  3THK A;  4C92 F;  4JUV A;  2JS2 A;  5GAM j;  4JRK A;  5C6S A;  2COW A;  3PTA A;  2BE9 B;  3A8L B;  2DET A;  2AKK A;  1M1K U;  2JNG A;  1YWP A;  1RLP C;  4E7K A;  5I21 A;  1VIE A;  1M90 R;  1RAG B;  3PT9 A;  3MP6 A;  3VV0 A;  1UEB A;  2CZ0 B;  4F04 B;  1CKA A;  1JBM A;  2RNA A;  3E19 A;  5LJ3 g;  3I56 T;  1LNX A;  1YHQ A;  4PJL A;  3X20 B;  2DMO A;  3L2R A;  4IUU A;  2ZPE B;  2W10 A;  3CMA A;  4PK4 A;  2HQH A;  2HAX A;  3RDV A;  1ZUY A;  3UA7 A;  3V8K A;  2JVV A;  2L0A A;  2RF0 A;  4FYY B;  1PSE A;  3UF4 A;  1D1B A;  1QQJ A;  1VQ4 Q;  2OX7 A;  2DPP B;  4RKU E;  2DL7 A;  2K5L A;  3V7S A;  1N8R R;  3JCM d;  2M9U A;  2DXB A;  3V7R A;  3LH5 A;  1Q82 U;  4OMM A;  3LWH A;  3BE3 A;  2MI6 A;  4PNO A;  1VOM A;  4FT4 A;  2HMA A;  4FT2 A;  2CP5 A;  2EYQ A;  3RUX A;  1ABQ A;  3I55 Q;  4B6M A;  3HL8 A;  9ATC B;  2RQU A;  3E2U A;  1E6H A;  4E2F B;  2J06 A;  3CCJ Q;  2DVE A;  5HY6 A;  3PE0 A;  4E7Z A;  1Q7Y R;  1N6A A;  2PU9 B;  1YN8 A;  1M27 C;  1Q86 R;  5GAN f;  1MMN A;  1AOJ A;  2JOY A;  1BIB A;  4N0A A;  5GAO m;  3TU4 K;  4FU6 A;  3GIB A;  1VQ8 T;  3CCR Q;  4X9D A;  2LX9 A;  1HXD A;  1PM3 A;  2QDL A;  6AT1 B;  1WJS A;  4M78 G;  1G3W A;  4C92 A;  2I0N A;  3CPW A;  2GTJ A;  2HQX A;  1Y57 A;  3ZFJ A;  1WXB A;  2PZ1 A;  3VS0 A;  1HSQ A;  5GAO r;  5IHI A;  3SWN A;  3OW2 S;  1WI7 A;  2LCC A;  3NTK A;  4LDU A;  4M7D A;  2X3W D;  5DLO A;  4ZGJ B;  4KRT A;  5CVI A;  2AKL A;  3P8D A;  3RMQ A;  1A0N B;  2DTO A;  1WHK A;  3CCM Q;  3EFR A;  4RCC A;  4XTZ A;  2XG8 D;  1YCS B;  3L2Q A;  4HKE A;  1TOV A;  3FLG A;  2P0Q A;  2PUO B;  4HCZ A;  1VQ5 Q;  3MEW A;  3C4S A;  4RG8 A;  5FRO A;  4BAC A;  2E1H A;  2YUQ A;  4ESR A;  2E65 A;  5GAN 2;  1MUZ A;  1FMW A;  2C0O A;  3M55 A;  4M4Z A;  4OMO A;  3FC3 A;  1AWJ A;  2IIM A;  1K9M U;  2ZZD A;  2KVQ G;  4DOV A;  4MZP A;  3PVL A;  5GMK e;  3OB9 A;  2QTX A;  1UDL A;  2LJ3 A;  1K8A C;  1KC8 R;  3RKW A;  1M2V A;  4BDY A;  3QSU A;  4JZ4 A;  2D0N A;  2RB6 A;  4M75 A;  1QVG S;  4RUG A;  3MKD A;  4RCB A;  2FB7 A;  2GCX A;  1I1J A;  3EG9 A;  4AG1 C;  4N4G A;  1PKT A;  4N0A C;  1EIF A;  3ZBD A;  3NFC A;  2B8A A;  5L23 A;  1Y7X A;  3CMA T;  1X75 C;  3R6N A;  1K9M R;  1W6X A;  2L3Q A;  3IQL A;  3QYG B;  2RO0 A;  3L2U A;  4M7A E;  2EYZ A;  1NG2 A;  2X51 A;  3SEM A;  2KRN A;  2KSS A;  2DIG A;  3RES A;  3EG9 B;  1UFF A;  2KAF A;  3OYY A;  4DBF A;  1W2B A;  1KG1 A;  2A28 A;  5EG2 A;  2GGR A;  3CCR A;  1AD5 A;  2PUK B;  2LQ8 A;  3QWX X;  5D7U A;  4X1V A;  4R56 A;  2BTT A;  2KGT A;  1QWF A;  2L3S A;  3LGL A;  2XKO C;  2O31 A;  2DEQ A;  1KC8 C;  2CZ1 B;  4DOW A;  4OP0 A;  3GF5 A;  1ZSZ B;  2BZ8 A;  3SB2 A;  8ATC B;  3LW5 E;  4M7D F;  1VQ7 Q;  4C8Q B;  1M90 C;  4BI8 B;  4CC7 A;  3EH2 A;  2MPX C;  1YI2 T;  2E3I A;  3L2W A;  3M0P A;  4AG2 C;  2KI7 A;  2DXC A;  4P5N A;  4JLG A;  5GAN 7;  3GPL A;  2V8I A;  2KNB B;  3RBB B;  1H3H A;  4XK8 E;  3EFO B;  2RHI A;  2EJG A;  4J6X A;  2H8H A;  2FRY A;  4Y91 A;  1PC0 A;  3SD4 A;  1BYM A;  3CCV A;  1U3O A;  3HRU A;  2BIV A;  2LZ6 B;  2QA4 Q;  3CD6 A;  5HKC A;  1I0C A;  5DY9 A;  3FEO A;  2QDY B;  2D8J A;  5GAN g;  3WXM B;  2QQB A;  5A0D A;  1PNJ A;  2CUD A;  1OYX A;  4M77 E;  1OEB A;  4PL6 A;  1NJI C;  3QDR B;  4DEX A;  3VS6 A;  1MNE A;  2JN0 A;  1BBZ A;  4CC2 A;  3A8G B;  1XQH A;  2DTH A;  1NEG A;  1PRL C;  1AWW A;  1I81 A;  2FPE A;  1GL5 A;  2R58 A;  5GAM e;  2QA4 T;  4OML A;  4Z89 A;  1VIF A;  3GBQ A;  1VQP T;  3MP8 A;  5EC7 A;  1VQO T;  1VQ9 T;  2E12 A;  3CME A;  4A4E A;  1FMV A;  2VV5 A;  1WZO A;  5KYX B;  3OS2 A;  2KBT A;  3CBO A;  1M90 U;  2KXD A;  4DQ2 A;  1QVG P;  1UEC A;  1IB8 A;  2EYW A;  3VS1 A;  4RMO A;  4F7U B;  3A1P A;  3KBG A;  2VUB A;  4HVW A;  4M75 D;  4JJD A;  1GCP A;  2RJD A;  1PD0 A;  2M02 A;  5FU7 C;  3M5A A;  5KYN A;  1TSF A;  1TUD A;  4PFZ A;  4K11 A;  3HSB A;  1JJ2 S;  3BY7 A;  3VUB A;  1VQ7 A;  4ELY C;  2COZ A;  3JCM f;  3VRZ A;  1QP3 A;  4D8D A;  1C0M A;  2CZ6 B;  3LGF A;  3M57 A;  5GAM h;  1YIJ T;  2FVU A;  1Y96 A;  3ASK A;  2X4W A;  4BE1 A;  2EJ9 A;  3QG1 A;  3TVT A;  2OTJ Q;  4EDU A;  3VYH B;  2LQK A;  2YUO A;  4ZTF A;  1TUC A;  1RAC B;  1D1A A;  2MYS A;  4XU3 A;  2F1L A;  1OU9 A;  2OAU A;  1HJD A;  1SSH A;  3DB4 A;  3UWN A;  4OMP A;  1Q7Y U;  2KYM A;  3OW2 P;  2MOX A;  2HQE A;  1IZ6 A;  4M77 C;  5FU6 C;  4RTW A;  2E6N A;  2ZCF B;  4M75 G;  3H0F A;  2X4X A;  2RJC A;  4O5V A;  2W0Z A;  5GMK l;  2GF7 A;  4BE0 A;  1OOT A;  3CPW P;  2X4Y A;  2MWO A;  3CC2 Q;  3C94 A;  3P8B B;  3VS4 A;  4ORZ A;  2JJ9 A;  1IRE B;  5I2M A;  1TS9 A;  3CCS A;  4GY5 A;  1RAA B;  4M7D C;  1X6G A;  2XHC A;  1VQ5 T;  5D6Y A;  3G71 Q;  3TSW A;  1BKB A;  2CH4 A;  2DE0 X;  1UHF A;  2O01 E; 
#chains in the Genus database with same CATH homology
 1KQ1 A;  2DJZ A;  5KE2 A;  3CME T;  4PJO D;  3G71 A;  3GLX A;  3F70 A;  1Y71 A;  3QUI A;  1OI1 A;  2VXF A;  5DM7 R;  2VYT A;  3DLL A;  5GAN h;  3LLR A;  2L3R A;  4C92 F;  4JUV A;  5CKD A;  1RL2 A;  5GAM j;  1MHN A;  2BUD A;  5GAO p;  3CC2 A;  4J6Y A;  4JRK A;  3OYE A;  4YTL A;  5C6S A;  2ZPI B;  4XTU A;  3PTA A;  3MHX A;  2EJF A;  4JJN K;  3PNW C;  3CCM A;  2C06 A;  3A8L B;  1Y07 A;  1M1K U;  3PGG A;  3CC7 A;  2JNG A;  2K2V A;  1QVG A;  4NOY A;  4JS4 A;  4CI0 C;  4E7K A;  1UGQ B;  2LDM A;  4E47 A;  4OGE A;  5LJ3 f;  4D6W A;  5I21 A;  1VIE A;  2M0O A;  2K3X A;  3PFS A;  3S3M A;  4L5G A;  3PT9 A;  3MP6 A;  2K57 A;  1UEB A;  4QQG A;  3VV0 A;  5CK9 A;  3I55 A;  2CZ0 B;  1KQS S;  1KD1 U;  3V7C A;  3CBM A;  5LJ5 e;  5GAO l;  1JBM A;  3E19 A;  5LJ3 g;  5LJ5 h;  3I56 T;  2RHU A;  2DXU A;  1LNX A;  2FYK A;  2VC8 A;  2QQR A;  3JB9 J;  1O75 A;  2LCL A;  2YHT A;  5D6W A;  3X26 B;  1YHQ A;  1N8R U;  1BIA A;  2VXE A;  2E64 A;  3HKS A;  3X20 B;  4V2S A;  3L2R A;  3OSS C;  4IUU A;  2ZPE B;  4PJO F;  2RHY A;  3R6O A;  2GFU A;  4C5G A;  5GMK i;  1N9R A;  3LH0 A;  4ELZ C;  3CMA A;  1VQ8 A;  3JCM h;  5GAO q;  1VQ4 A;  3HRS A;  2CKK A;  2HAX A;  1BI3 A;  5GAN 4;  3V8K A;  2JVV A;  4DA4 A;  1K73 C;  3JCM X;  4IUV A;  4XTX A;  4R55 A;  1WQW A;  5HK3 A;  2K4Y A;  2RJF A;  1PSE A;  3M54 A;  4JRI A;  5CKB A;  1X6O A;  1G3T A;  5LJ5 d;  3CCU A;  1H3Z A;  2DD4 A;  3A5Z B;  1OZ2 A;  3TRE A;  3RER A;  1BI0 A;  2DPP B;  1D3B A;  4RKU E;  3V7S A;  2K5L A;  3JCM W;  1VQ6 A;  3M53 A;  4OB0 B;  3JCM d;  4BI4 A;  2L8D A;  2M9U A;  2DK3 A;  2DXB A;  3V7R A;  4Q5W A;  1Q82 U;  2Y4X A;  3NTI A;  4J83 A;  3VKI A;  1M1F A;  4NL3 A;  3LWH A;  3LWI A;  2MI6 A;  2XU8 A;  3S3N A;  4JLI A;  4PNO A;  4FT4 A;  2G3R A;  4PKC C;  4F7U G;  3INZ A;  4J8O A;  4FT2 A;  5GMK m;  4C8Q E;  1QVF S;  3ER0 A;  2EYQ A;  3RUX A;  3JB9 G;  2QEX A;  3HL8 A;  3QZ5 B;  2E5Q A;  4XTW A;  2QQ9 A;  3QKJ A;  2EAY A;  4M77 F;  4QW2 A;  1PSF A;  3MO8 A;  2DVE A;  1I4K 1;  2F5K A;  2WSF E;  2EFI A;  5HY6 A;  1VQL A;  4M78 B;  4M7D D;  1N6A A;  1XTD A;  2PU9 B;  4VUB A;  3L2Z A;  3CPW S;  3M4Y A;  2KQW A;  1UB4 A;  5GAN f;  4KUD K;  3ME9 A;  1FX7 A;  3VUZ A;  2XDB A;  2JOY A;  5CKF A;  3E9F A;  1BIB A;  4BUG A;  4E7J A;  1S72 T;  3JB9 H;  4N0A A;  4ZN3 A;  5LL6 S;  2QA4 A;  5GAO m;  3OYK A;  1FXX A;  3TU4 K;  3JSC A;  3PMI A;  1M5Q 1;  3V8L A;  4FU6 A;  4II1 A;  3GIB A;  2DZ9 A;  2Y90 A;  2E41 A;  1VQ8 T;  1WJR A;  5A2Q E;  3OYM A;  4X9D A;  2DXT A;  1HXD A;  2IG0 A;  2LX9 A;  2ZGW A;  3X28 B;  5GAM d;  1YIT A;  1VQO A;  5CQY A;  1WJS A;  4M78 G;  1G3W A;  4C92 A;  3OYH A;  1VQK T;  3CPW A;  2OTL A;  1TH7 A;  2HQX A;  1ZQ1 A;  3OYI A;  1VQN A;  2QEX T;  3ZFJ A;  5GAN 6;  4C8Q A;  5J3B A;  1FWZ A;  1BI1 A;  1KD1 C;  1MGQ A;  3H6Z A;  4NS5 A;  2F5T X;  4XTY A;  2EQU A;  5FRM A;  5GAO r;  3SWN A;  3OW2 S;  2XDD A;  2LCC A;  2V8K A;  3X25 B;  3NTK A;  2JUF A;  4LDU A;  4M7D A;  3LX7 A;  5DLO A;  4ZGJ B;  3OS5 A;  5CVI A;  4M75 E;  2MMP A;  3GNG A;  3P8D A;  3RMQ A;  3RKY A;  2DTO A;  4BY6 B;  2KDS A;  3EFR A;  3PIP A;  4RCC A;  4XTZ A;  1WPY A;  1WQ7 A;  1G3Y A;  2XG8 D;  2VGM A;  4QQD A;  2XK0 A;  3L2Q A;  4HKE A;  3BFM A;  3CCJ T;  3OYN A;  4XTV A;  4C8Q F;  3TEE A;  4E7L A;  3FLG A;  2P0Q A;  4M7D E;  3MP1 A;  2RI5 A;  3CD6 T;  4M7A A;  4GLK A;  3URG A;  3OS1 A;  4J7F A;  4LD9 K;  2PUO B;  4CRI A;  2WAC A;  5GAN 5;  4J7I A;  3HP9 A;  4HCZ A;  3G71 T;  3MEW A;  1VQK A;  3C4S A;  2M1H A;  2R5A A;  4RG8 A;  5FRO A;  1YIT T;  4BAC A;  2E1H A;  1K8A U;  2KK4 A;  3J80 E;  4M7D B;  2E65 A;  5GAN 2;  4KT0 E;  3OMG A;  2YLC A;  5KE3 A;  1UGR B;  3N5B B;  3CC4 A;  3QYH B;  3M59 A;  3M55 A;  3G4S A;  4IUT A;  3FC3 A;  2DZC A;  3BDL A;  3JCM V;  3LYI A;  4JRQ A;  5CQX A;  5A0L A;  1VQ4 T;  1K9M U;  4BD3 A;  1YJ9 A;  4PJO B;  2EWN A;  2ZZD A;  3CEY A;  4PLL A;  1Q81 C;  4UC4 A;  2JZ2 A;  2KVQ G;  2O4X B;  4DOV A;  5HK0 A;  1ZBX A;  2OTJ A;  4MZP A;  2XIC A;  5GMK e;  2LVM A;  4XAX B;  2KY9 A;  4A4G A;  4BI3 A;  1N27 A;  2K5I A;  3AHU A;  5LJ5 j;  1U8R A;  3OB9 A;  3O8V A;  3QBY A;  2QTX A;  4M77 G;  2F69 A;  2V8J A;  4X34 A;  1YJW T;  3CCE T;  1K8A C;  3QSU A;  3RKX A;  3RKW A;  4L59 A;  4BDY A;  3OYG A;  2PVO B;  3JRZ A;  1QP2 A;  2RD1 A;  2RB6 A;  4M75 A;  1GXI E;  1QVG S;  4A4K A;  4RCB A;  4HT9 A;  5J39 A;  2FB7 A;  2GCX A;  1VQ6 T;  2R57 A;  4N0A C;  4M78 F;  1YCY A;  2KMT A;  1EIF A;  4N4G A;  3ZBD A;  4MDX A;  3NFC A;  1OZ3 A;  3HHT B;  1Y96 B;  2B8A A;  3CBP A;  4QQ6 A;  3ZEH A;  1Y7X A;  3JCM J;  3CMA T;  2RK2 A;  1X75 C;  1K9M C;  3QYG B;  3GNF B;  4IKF A;  3QPH A;  1M4Z A;  4X9C A;  2DAQ A;  2RO0 A;  5LJ3 e;  3L2U A;  3OMC A;  4PLI A;  4C92 B;  2WSE E;  4M7A E;  3JCM c;  2DD5 A;  3MCA B;  3QII A;  4BE2 A;  1G5V A;  4BB7 A;  2CS7 A;  3OSV A;  4BDZ A;  2KSS A;  1LJO A;  4M75 F;  2H3J A;  2WSC E;  1YJ9 T;  1KC8 U;  3M58 A;  5IN1 A;  2DIG A;  3RES A;  3HFN A;  3JCM g;  1VQ7 T;  4FSX A;  2QQA A;  2KAF A;  3OYY A;  1W2B A;  1KG1 A;  1UGS B;  4L6V 5;  5CIU A;  5EG2 A;  4JS5 A;  3JB9 D;  3G6E T;  3JCM b;  1VQL T;  4JDS A;  3CCR A;  2PUK B;  1Q86 C;  2O4X A;  3CCQ T;  3Q1J A;  2LQ8 A;  3CCE A;  1N8R C;  2K3Y A;  4QVD A;  4LDW A;  4R56 A;  1RI0 A;  3OYJ A;  4EPC A;  1JJ2 A;  1VQ5 A;  4HCB A;  3LGL A;  2XKO C;  4OB3 B;  3QO3 A;  2CZ7 B;  3CCM T;  2DEQ A;  5CKH A;  3HRT A;  1KC8 C;  2CZ1 B;  5FU7 B;  4DOW A;  3CPF A;  4OP0 A;  3GF5 A;  3QJY A;  4MZM A;  4F7U E;  3SB2 A;  1W2B S;  3LW5 E;  4M7D F;  3JAM E;  1KHC A;  4C8Q B;  1VQM T;  3FJP A;  2EIF A;  3MEV A;  4C5H A;  1M90 C;  4BI8 B;  4ME7 A;  4QVC A;  4M7A F;  4EMK A;  3CC2 T;  2JTM A;  2LNV A;  3DLM A;  4M77 A;  3SDZ A;  1YI2 T;  3RIR A;  3S6W A;  3L2W A;  3DKM A;  4F7U A;  1U1S A;  2DXC A;  4P5N A;  1I8F A;  2A7Y A;  2QXF A;  1QW1 A;  4JLG A;  4M78 E;  1D3B B;  5GAN 7;  3GPL A;  3CCR T;  2V8I A;  1VQ9 A;  5GAM g;  4M7A G;  4XK8 E;  3FIF A;  1KHI A;  2RHI A;  4J6W A;  2EJG A;  3MEA A;  3EFS A;  4J6X A;  4M77 D;  3V8J A;  4C0Z A;  2D0Q B;  4Y91 A;  3OYD A;  2I2L A;  5IT9 E;  4A4H A;  4ATO A;  3SD4 A;  3J81 E;  3SWN C;  4MML A;  3CCL T;  3CCV A;  2D6F A;  1BYM A;  2X35 A;  2FHD A;  3OA6 A;  3HRU A;  1WNL A;  2E10 A;  2BIV A;  1XOV A;  2DTI A;  5GAN e;  4Z02 A;  1M1G A;  4M7A C;  2PVG B;  1X01 A;  2E6Z A;  3CD6 A;  2RHX A;  5HKC A;  3CXC A;  3FDR A;  1YBY A;  3MET A;  4MDW A;  5D6X A;  3BDU A;  4KUL A;  2HD0 A;  5DY9 A;  4IUR A;  3FEO A;  5GAN 3;  4FM4 B;  2RA2 A;  3E1S A;  1VQP A;  4LD6 A;  2QDY B;  1XNI A;  5CR2 A;  2EQJ A;  4PJO A;  4Y28 E;  4ZN1 A;  5GAN g;  1QVP A;  3WXM B;  2LC4 A;  2QQB A;  5A0D A;  3OYB A;  1M8V A;  2K5F A;  1YI2 A;  2QQS A;  3FRN A;  4TVR A;  3OYA A;  1YJN T;  1OYX A;  2OTJ T;  2YLB A;  2RK1 A;  3HPW A;  4M77 E;  2P0P A;  4PL6 A;  1LOJ A;  2LT1 A;  3M9Q A;  3QDR B;  1NJI C;  3TCJ A;  5LJ3 j;  2GQV A;  2JN0 A;  4XQ3 A;  1YJW A;  4C8Q G;  3A8G B;  3OQ5 A;  5KCH A;  1XQH A;  2DTH A;  2LTO A;  1VQM A;  3JCM e;  4M7A B;  1I81 A;  2ZPF B;  1QVF A;  1U1T A;  1G3S A;  1NZ9 A;  4B9W A;  1V29 B;  2R58 A;  2DIQ A;  2DO3 A;  4WF2 A;  3CCL A;  4M7D G;  3OYF A;  1N9S A;  1P92 A;  4RG2 A;  3VU3 C;  4C8Q C;  1SSF A;  2X4J A;  4XU0 A;  5GAM e;  5GAM f;  5GMK h;  5CKE A;  3G4S T;  2ZPG B;  5GMK j;  2QA4 T;  1K73 U;  1VIF A;  3OBY A;  4QVZ A;  4F7U B;  1VQP T;  4A4F A;  3KUF A;  3MP8 A;  3PMT A;  2D9T A;  3JCM Q;  1VQO T;  1VQ9 T;  2E12 A;  3CME A;  2CGH A;  4A4E A;  3OW2 A;  2MF2 A;  2Y4Y A;  3S3O A;  4ZTJ A;  2VV5 A;  2XID A;  1I5L A;  1M9S A;  4M78 D;  3A8M B;  5CO7 A;  4ZGE B;  4FL6 A;  2LRQ A;  2A3L A;  4PJO G;  1Q82 C;  3DB3 A;  2RHZ A;  3JCM P;  2OTL T;  4A53 A;  4IUP A;  3OS2 A;  2HBP A;  3UPU A;  4HT8 A;  3CBO A;  2YRV A;  5A0G A;  1YJN A;  1M90 U;  2R5M A;  5L8R E;  2VGN A;  5GAN 8;  3EAE A;  4DQ2 A;  2RJE A;  1HK9 A;  3GP8 A;  4PJO E;  1B34 B;  1JRI A;  3HFO A;  5AYF A;  3WVD B;  4NL2 A;  3OY9 A;  4M78 A;  4M75 C;  4C5E A;  1UGP B;  4C92 G;  4RMO A;  1KQ2 A;  3QJ6 A;  4ZGD B;  2DKG A;  4OMF B;  2MAM A;  5C0M A;  2PQW A;  4KBM B;  3SFM A;  3KBG A;  3L1A A;  2VUB A;  4M75 B;  2LT4 A;  1VUB A;  3A8O B;  4M75 D;  5KH6 A;  2RJD A;  3P8H A;  4EMH A;  3CXC S;  3SWN B;  3QXE B;  5FU7 C;  3M5A A;  5CAI A;  3CCU T;  1KQS A;  3OYL A;  2RI2 A;  2L5Q A;  4IUQ A;  3CCJ A;  2P4T A;  3NTH A;  4OGC A;  4M78 C;  3H8Z A;  2EQM A;  3OYC A;  3I56 A;  3HSB A;  2ZPH B;  1B34 A;  5M9O A;  1VQN T;  1JB0 E;  4OVA A;  1JJ2 S;  3BY7 A;  3VUB A;  1VQ7 A;  4ELY C;  2CYZ B;  3E9G A;  3JCM f;  3JB9 F;  1QP3 A;  2BKD N;  5FLX E;  4OB2 B;  5DLQ E;  3GOX A;  1DJ7 B;  1ZHI A;  5FU6 B;  3WVE B;  2CZ6 B;  3LGF A;  3OBW A;  4KUI A;  4C0F A;  4EMG A;  3CC4 T;  3M57 A;  5I2S A;  5GAM h;  5LJ5 f;  1YIJ T;  3KXT A;  2E70 A;  2FVU A;  3FB9 A;  1Y96 A;  3QZ9 B;  4MZT A;  1M1K C;  1W4S A;  3ASK A;  2MWP A;  2X4W A;  2EJ9 A;  3QG1 A;  3MEU A;  4XU2 A;  3UDC A;  5IAY A;  4BE1 A;  3L2V A;  4N4I A;  4M7A D;  4EDU A;  3VYH B;  4LDY A;  5LJ3 h;  4C0D C;  2LQK A;  4O6J A;  1R8O B;  4ZTF A;  5J26 A;  4XU3 A;  4FIB A;  3C12 A;  4N4H A;  1NJI U;  3J7A F;  3JB9 I;  3L42 A;  2IVW A;  1NPR A;  2OAU A;  3UT1 A;  3CCV T;  2AHJ B;  3DB4 A;  2L89 A;  3UWN A;  3CCS T;  1O9S A;  4C92 D;  1Q7Y U;  1YHQ T;  2HNI A;  2HQE A;  1IZ6 A;  3VYG A;  3CC7 T;  4M77 C;  4C92 C;  1Q86 U;  4EMK C;  3C95 A;  5FU6 C;  2NLU A;  5GAO n;  4HCC A;  3A8H B;  5LJ3 d;  2RH2 A;  3BW1 A;  4M77 B;  4EMK B;  2E6N A;  2RM4 A;  5KCO A;  3M56 A;  2ZCF B;  4C8Q D;  4M75 G;  2GFA A;  4OB1 B;  1WGS A;  2XDP A;  4BY6 C;  4C92 E;  5FRN A;  4XU1 A;  4PJO C;  2X4X A;  3T9N A;  4C5I A;  4E7I A;  2RJC A;  1NPP A;  3OS0 A;  3G7Z A;  1BI2 A;  4O5V A;  2RI3 A;  5GAN j;  2FL7 A;  3RMS A;  1YIJ A;  4F7U F;  4OF1 A;  1Q7Y C;  4C0D B;  2GF7 A;  5GMK l;  4BE0 A;  2XD0 A;  4HA8 A;  2X4Y A;  5CCA A;  5LJ5 g;  3X24 B;  3PIO A;  3CCQ A;  4JRP A;  1S72 A;  2M16 A;  2XI9 A;  1WJQ A;  2MWO A;  3G6E A;  2P0K A;  3C94 A;  3P8B B;  4LDV A;  3I55 T;  4C0G A;  4J5Y A;  3M4G A;  2ZPB B;  1IRE B;  2JTF A;  1H64 1;  2PVD B;  4MMK A;  1NE8 A;  5I2M A;  3CCS A;  4GY5 A;  5GAN d;  4M7D C;  2XHC A;  1VQ5 T;  5D6Y A;  1AHJ B;  2EQK A;  3QHS A;  4E7H A;  1Q81 U;  3VJP A;  1BKB A;  2O01 E;  4B9X A;  2EKO A;  4LDX A;  4A54 A;  2QI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...