5LJ5d

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 14
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5d00
5GAN2 1HXDA 5LJ5j 4PJOE 5GAMg 1Y96A 4M7DF 1B34B 5GAOp 3HSBA 2YLBA 3HFOA 3V8JA 4HA8A 4F7UB 1LNXA 4EMHA 1YCYA 4M75G 3RIRA 2E1HA 5GAMh 2DXTA 2E65A 4DQ2A 1B34A 4MMLA 3V8LA 4M7DE 3JCMh 5GMKi 3JCMP 3EFSA 4M77G 5GAMd 3AHUA 5GMKj 4M7AD 3JB9J 4M75A 3INZA 3JCMV 3JB9H 1WPYA 4C92F 4NOYA 4M7AA 1I4K1 4A54A 1TH7A 4J6YA 3QO3A 5GAOl 4M7AF 1I5LA 4M75C 5GAN3 4PJOF 3V7CA 1H641 4HT9A 1KQ2A 4PJOC 2E10A 2JN0A 2DZCA 4JLIA 3JCMf 5GAMj 4M77D 3GIBA 3BFMA 1D3BB 3L1AA 4M7DC 4M77B 3JB9G 2VXEA 2FYKA 5GMKl 2K57A 1WQ7A 5LJ5h 5GMKh 1N9RA 4F7UF 4Y91A 3QSUA 5LJ3f 4XTVA 4EMGA 4M77E 4M78C 4NL3A 3V8KA 4J5YA 4WF2A 3RKYA 1WNLA 3QUIA 4C8QC 4C92E 1M8VA 3RKXA 2DZ9A 1N9SA 1Y96B 2HNIA 2FB7A 2VXFA 5GAOm 3M4GA 4OP0A 4XU3A 3RERA 4XU2A 4X9CA 3BW1A 4M78A 2DTOA 5GANf 4PJOD 4MMKA 1U1TA 3SB2A 1LJOA 4X9DA 3SWNC 4NL2A 4J6XA 3BDUA 4XTZA 4PNOA 5LJ3j 5GAOq 5LJ5d 4V2SA 1I81A 2DTHA 2EAYA 4C8QA 4XTUA 5GANj 2YHTA 1KQ1A 2DXUA 3PGGA 3QHSA 5GAMf 1LOJA 3VU3C 4EMKB 5GANg 4C92C 5GAOr 1M5Q1 5LJ3d 5LJ5g 5GAN6 4M7AC 4XTXA 4QVCA 5LJ3h 4XU0A 3RUXA 3RKWA 2EWNA 4M7AG 4M75B 5LJ5f 3JCMd 5GANd 3JB9D 2RA2A 4RCBA 4M75D 5LJ3g 5GAOn 4XQ3A 2RD1A 3FJPA 3L2ZA 4M77C 4M7DB 5GMKm 4J6WA 1BIAA 4M7DD 3RESA 3JCMW 4XU1A 4XTWA 5GAN8 4QVDA 3V7SA 4M77A 2DEQA 3JCMg 5DY9A 3V7RA 4M78B 4C8QF 5GANe 2E41A 5GANh 5GAN7 2EJ9A 5LJ5e 4C92A 3JCMQ 5GMKe 4JRKA 3FIFA 4C8QD 4C92G 2DTIA 2Y90A 2EJFA 1U1SA 1HK9A 3JCMb 3BY7A 3JCMX 2YLCA 4M78E 4PJOB 2DKGA 3EFRA 4EMKA 5LJ3e 5I21A 3JB9I 4JRIA 1WQWA 4M75F 3SWNA 4F7UE 2DJZA 5GAMe 3JB9F 4A53A 2I2LA 2DVEA 4M77F 1JBMA 4M78F 4C8QE 4HT8A 4M78D 3JCMc 4PJOA 2QTXA 3JCMe 4N0AA 5GAN5 1I8FA 2ZGWA 1D3BA 4N0AC 4RCCA 4EMKC 4C8QB 4M7DG 4C92B 4JUVA 4XTYA 4M7DA 4C92D 4PJOG 1MGQA 2EJGA 4C8QG 3FB9A 1X01A 4M7AB 1BIBA 2VC8A 4M78G 3JCMJ 4F7UA 5CAIA 2E64A 1JRIA 2CGHA 4M75E 5GAN4 4F7UG 3SWNB 3HFNA 2RM4A 2RB6A 4M7AE
chains in the Genus database with same CATH superfamily
3CCSA 1M1KR 4M7DF 3V8JA 3VUZA 1WHGA 2FPDA 4HXJA 5HKCA 1UJYA 4E7JA 1OPLA 1Q86U 3AHUA 1NJIC 4LXCA 4RTWA 4AMCA 4OMNA 2EYXA 1I4K1 1TH7A 1YFNA 3HRSA 5FROA 2LQ8A 3BFMA 4JJDA 1RLPC 4Z02A 1PRLC 2CP3A 3CPWP 1KHCA 2MF2A 3CXCA 2DF6A 1VQMT 1TTHB 2RHZA 4RTYA 3JRZA 2QA4Q 2LQNA 4Z89A 1B3QA 3M4YA 4X9CA 3A5ZB 5GANf 2JJ9A 2JZ2A 3OW2P 1UHCA 3ULRB 2XG8D 2R58A 3UA7A 3DLLA 4C8QA 2OX7A 5GANj 2YXYA 1G3WA 3VS0A 3X28B 2M0YA 5GAOr 1X43A 3PIPA 1ABQA 1YWOA 3LW5E 4OB3B 1M8MA 5FW9A 2KVQG 1QKXA 2OTJT 5LJ5f 3GNGA 5IHIA 1O75A 2V8JA 5LJ3g 3PVQA 4M7DB 4J6WA 2XIDA 1AEYA 1PHTA 1BI1A 2LJ3A 5DY9A 1Q81C 2YRCA 3G4SA 1VQ5T 3CMEA 4D8KA 2RQWA 3OYAA 3CD6A 2JTMA 2EYZA 1YN8A 3JB9I 2X4JA 1U8RA 2MMPA 2F1LA 3TSWA 4FT4A 1K4US 4RUGA 3MEUA 4LDVA 3DLMA 1G3SA 2VWFA 2ZZDA 1OU9A 2VYTA 1WXTA 1Q86R 2LC4A 1X6OA 2EKHA 1QWEA 4DEXA 4M75E 1YJNT 3CBOA 3OS1A 3CBPA 4F7UB 4C5IA 5DM7R 3CCLQ 1Q7YC 3RIRA 4ATOA 5CQXA 4AFQC 3H0IA 4OB2B 1JO8A 3PNWC 1RLQC 2LCLA 5FRNA 4J6YA 4M7AF 4M77D 1D3BB 3EG3A 1UTIA 3ZFJA 2RJCA 5LJ5h 1M4ZA 4ORZA 1PC0A 4RG8A 4LNPA 1VQ9Q 4C92E 1MMDA 4E7HA 2CSQA 2YUOA 3OYCA 4X34A 2F5TX 1MV0B 1KD1U 2C06A 2KR3A 4X9DA 1IHWA 5GAOq 2WSEE 2D8JA 4R56A 2OTLQ 1UGPB 2DTHA 1NZ9A 2EAYA 3PE0A 4CC4B 1WX6A 1RAAB 1NE8A 1RUWA 2CH4W 5KYYB 1TWBA 1M5Q1 5C0MA 4MZPA 1O9SA 4P5NA 4PFPA 1AD5A 3M0QA 1Z9QA 4R55A 5CKDA 3PVLA 3CCQQ 4XU1A 4RTVA 1H3ZA 5KYWB 1VQ6Q 4JS5A 4OMQA 3E2UA 2VV5A 2QA4T 2JTEA 5A0DA 1RAEB 2CS7A 4M78E 2HL5C 1S72A 2GQVA 2EGCA 1M3BA 1VYUA 3C95A 4IUVA 3OYMA 3L2QA 2JXBA 4C8QB 4OMOA 5I2SA 4BI3A 2LDMA 3QZ5B 2EJGA 1FMKA 4N4GA 3TU4K 5J39A 1QCOA 2DBKA 4DBHA 2M16A 2QQAA 4HA8A 4L59A 4HKEA 4FT2A 5IXBA 2MYSA 3M59A 3CC4T 4E47A 1K9MC 3EH1A 1YITQ 3V7CA 2DYIA 1RAGB 3I55Q 3QJ6A 1UB4A 2OI3A 3JB9G 4Y91A 1MMGA 4LD6A 5LJ3f 3V8KA 1NBEB 2O4XA 1BBZA 2LCSA 3DB4A 1TXQA 1Y96B 2DL7A 3SD4A 3QPHA 4M78A 3A8GB 5CKFA 3KXTA 1YI2A 1X2KA 2CYZB 4ZGJB 1KQ1A 3PGGA 1ZUUA 5IXFA 2V26A 3QWYA 3CPWS 1T3SA 4A4FA 1IZ6A 2GGRA 2JS0A 5GANd 4XQ3A 4OMLA 4F16A 2CSIA 4M7DD 3RR6A 3M0RA 2AHJB 2ED0A 2QXFA 2EVRA 3M53A 2L5QA 5HCKA 2BZ8A 4HCCA 2QAZA 4J7IA 4KBMB 1T3LA 2EQIA 4EPCA 3UDCA 3EGDB 1YCSB 4B6MA 5I21A 4CI0C 3FLGA 1I0CA 2A7YA 2VB6A 2D6FA 2LTOA 1MMNA 3OW2A 5EG2A 4XTYA 3L2UA 2DA9A 3R6NA 1OQKA 5KE2A 1KFZA 1WA7A 3MP6A 2NUPB 2VC8A 4M78G 3JCMJ 1A0NB 5CO7A 5ECAA 5IAYA 4PJOE 1WI7A 2P0KA 2K2VA 5IH2A 2DXTA 1B34A 3FC3A 1XNIA 1GCQC 2KYMA 3LGLA 5GAMd 3G4ST 2Y4XA 2D0QB 4M75A 2HBWA 4PJMA 2L2PA 3VS1A 3WXMB 3G71A 1KQ2A 4PJOC 3GIBA 1KSWA 2DD4A 1TUDA 3KBGA 3CPWA 4OMFB 4C0FA 2DO3A 2E3HA 1SHFA 2GF7A 3J80E 1CKAA 2JW4A 1G5VA 1YIJA 4AG1C 2O9SA 2CP5A 2M9UA 1BU1A 2RJEA 4BE1A 3QDFA 2ZAEA 4PNOA 2DXUA 2ECZA 3TEEA 4RTZA 2K3BA 4JJCA 1JJ2P 1ZSZA 5KYUA 1TS9A 3CCVQ 4QVCA 1JXOA 3CCRQ 3NPFA 1YJ9Q 4M7AG 3G71T 2JM8A 2LJ0A 4RCBA 1SF9A 3CCEQ 3L2ZA 5CKBA 2O01E 3JCMW 4XK8E 1VQ7A 2ZPGB 1Q82U 2X3WD 2RK1A 1PSFA 1G3YA 3QG1A 5LJ5e 3CCLT 2EPDA 3VYGA 1PD1A 1K9MR 1UJ0A 3OYDA 1WJRA 4IUTA 1LCKA 2XKOC 4M77F 3KUFA 1K8AC 2KT8A 1YJWT 4FYYB 1K73R 1MGQA 2X4WA 3DB3A 2DIGA 5GAN4 2COYA 2WACA 1ZHIA 2R5MA 2X9HA 1VQ6A 1YCYA 4J9FA 2VKNA 3X25B 2C0OA 5GMKi 2X3XD 1K76A 4RTTA 5GAOl 4BY6C 2OTLA 4PJLA 1ZQ1A 4M7DC 2XMFA 2FYKA 2VXEA 2DVJA 2HQEA 3OYLA 5D7UA 3QUIA 4GLMA 3CCVT 4CC3A 3RNJA 2HBPA 2DTOA 2DL4A 1IXDA 2NUPA 3GF5A 2PQWA 4PJNA 3OYHA 1FMWA 2QEXQ 3EGDA 3P8HA 1CSKA 4DOWA 1Y0MA 4E7IA 3E1SA 1VQ7Q 4ME7A 1X75C 3ASKA 2F2VA 1Y71A 3EG9B 4A4KA 3RKWA 3CC2T 1UFFA 2KGTA 2KAFA 3PMTA 4KGVB 1BIAA 4J9BA 3RESA 4PLIA 4CC2A 5GAN8 2ROTA 1PSEA 3V7SA 2DL3A 4C8QF 3VS4A 4EIKA 2BUDA 3GP8A 1QW1A 2PU9B 1VOMA 1RADB 2CREA 5KH6A 3G4SQ 2DTIA 4JJNK 3REAB 1VQ5Q 2DKGA 4F17A 5AT1B 2A08A 3OA6A 3JB9F 1JBMA 2X51A 4N4HA 3JCMc 1PKTA 2E5QA 4PJOA 4N0AA 5FWBA 3ER0A 4OGCA 3OMCA 1K73C 2HZYA 3CC2Q 2R57A 3MEWA 1ZBJA 2A28A 3JV3A 1K1ZA 2HL3A 4NS5A 2D8HA 4ZNXA 1LNXA 1FYNA 2DEUA 4BACA 4BDZA 3OSSC 4OMPA 1QKWA 4LDUA 3INZA 2J6KA 5CKEA 1BK2A 1JEGA 3JAME 4A54A 3L42A 3MHXA 2FEIA 2PVOB 1ZSZC 4PJOF 1YJ9T 2BKDN 2HCKA 4TVRA 4AG2C 2EGAA 1YJWQ 1VQOQ 1GBRA 1Q81R 3C12A 2K3XA 4CC7A 2B86A 1PD0A 2AKLA 2KNBB 4MDWA 1VQ7T 3M0TA 3RKYA 1WHKA 1UG1A 4A4GA 3AT1B 2FRWA 4OP0A 5DLQE 2XDDA 2RHYA 3M5AA 1JQQA 4XU2A 3CMAQ 5KE3A 5LJ5d 3NTIA 2YRVA 3C94A 4DBQA 5GAMf 1M1GA 2ZPIB 1AOJA 5LJ5g 4ZGEB 2RF0A 2FG0A 1QP2A 2KYBA 4KGZB 2A0FB 4OGEA 3RUXA 1VQLA 2KRSA 2RI2A 2PVDB 3S3OA 3QDRB 3OYGA 4QKUA 1AWOA 4D6WA 4QVDA 3BE3A 4FW1A 2JMCA 3E9FA 4ELZC 1SPKA 1EFNA 4AT1B 1XOVA 7AT1B 3UF4A 4DA4A 3NFCA 2OTLT 1YJNA 2QTXA 4DOVA 3UT1A 2FPFA 1N8RR 1KG1A 3MP1A 1YIJQ 5KCHA 4M7DG 3HHTB 2E12A 2FO0A 2WSCE 1WYXA 1ZA2B 1VA7A 1X01A 2R5AA 5AYFA 1VQPT 4F7UA 2NYSA 5KYWA 1NLPC 3HFNA 1VQPA 1G8XA 5GAN2 1QMCA 1B34B 3NMZC 1VQ5A 3CCRA 4BD3A 1M90R 1SRMA 5IN1A 2QEXT 3SEMA 3PFSA 1H92A 4PFOA 4ANJA 2RI3A 2MI6A 1NEGA 4M77B 2B8AA 2DL5A 2FHDA 4CRIA 2JNGA 4JRQA 2K57A 1WQ7A 4M4ZA 1YHQA 1YWPA 2Z0WA 2JS2A 3WVDB 5L23A 1YHQT 1M8VA 1TSFA 1N9SA 2P4TA 3M9QA 1OYXA 4J6XA 3U23A 1WHHA 2QDYB 1M1KU 1H8KA 1J3TA 1D1AA 3QYGB 5HK0A 1KK7A 1XTDA 1D09B 1QP3A 2HD0A 3VU3C 1QVGP 1D0XA 3CCUQ 1RI0A 4QW2A 2QYZA 1M27C 2CZ7B 5HK3A 3EG2A 4M7AC 2LT4A 4L6V5 4XTXA 4E7ZA 2KXCA 1KC8U 1K9MU 1AHJB 1GFDA 1SG5A 2KI7A 1U3OA 2RD1A 3THKA 3VYHB 2RNAA 3VS2A 2CP6A 2DEQA 1QCFA 2RHXA 4M78B 2G3RA 1I07A 2HKQB 3JCMQ 3J7AF 1N8RU 5GMKe 4FYXB 4JRKA 4E7SA 4E2FB 2DMOA 2EJFA 4F14A 4GLKA 1LPLA 2CZ0B 2VGMA 1NJIR 2PUOB 1WQWA 2D0NA 3CCST 3I35A 3OYJA 2DVEA 1VQ4A 2H3JA 4C0GA 3MEVA 3L2WA 2GQIA 4OB1B 4C92B 2XICA 1VQ6T 1ABOA 2ZCFB 2X4YA 4FM4B 1JRIA 2KK4A 2KMTA 1W2BA 2KY9A 4HCZA 1HXDA 5GAMg 2F2WA 2EGEA 2F2XA 3SDZA 3MJXA 1G2BA 4JRPA 4EMHA 4WTOB 4FIBA 1YI2Q 4M75G 4DQ2A 2CT4A 4M7DE 3V8LA 1VQNA 3JCMh 1HJDA 1D0YA 3EH2A 2HEQA 1GBQA 3JCMV 2LP5A 4C92F 2A3LA 3A8HB 4KULA 1UECA 1AWWA 1PNJA 1D0ZA 5GMKl 3HKSA 2D9TA 1K0SA 2MWOA 1KD1R 3QBYA 2DPPB 3CCUT 2KROA 1KC8R 1BKBA 3PIOA 4NL2A 1AVZC 1VQLQ 4V2SA 2OTJQ 4PJJA 2QASA 2LX9A 2VASA 3OB9A 1VQ9T 2CUBA 2LX7A 2RHIA 1I5OB 4DEYA 2K5IA 1MHNA 1RAFB 1PKSA 1IB8A 4GY5A 2EQJA 3ME9A 5HY6A 1QVFP 2RQTA 5GJWB 3S6WA 4IUQA 1WDXA 1NJIU 1EIFA 3FJPA 3VS6A 1VQ4T 3ZL7C 2E41A 2KBTA 1N27A 5CKHA 3VS3A 4FYWB 2LNVA 2QGFB 1H3HA 2NLUA 3JCMb 2NWMA 1W2BS 1C6VX 1SKUB 2DJZA 3VS7A 4F7UE 5KYNA 3GBQA 2H8HA 2YUQA 3LX7A 2DLPA 3CPFA 3OSVA 1OX9A 4IIMA 3CCQT 2K79A 5GAN5 2KXDA 1VQ8T 1UGQB 1V29B 1Q7YU 2LMJA 2BE9B 4RTUA 3O5ZA 2V1QA 2BZYA 3CCRT 2DAQA 1SHGA 5LL6S 3EG9A 2JVVA 3QKJA 4UC4A 2YLBA 3HFOA 2EQMA 1V1CA 3CMET 3NHNA 4MMLA 3TVTA 1X69A 4M7AD 4MDXA 2GBQA 4LDYA 3QYHB 3QO3A 1I5LA 1H641 2JUFA 4AFSC 5I11A 3A1PA 2DZCA 4C0DB 2P0PA 3L1AA 1PWTA 2DRKA 3QXEB 1VYTA 1N9RA 2L3RA 9ATCB 3P8DA 4F04B 1WNLA 3X24B 3LWIA 2DZ9A 2K5LA 2HNIA 5FU7C 3M4GA 1M30A 4C0ZA 1T0JA 4PJOD 3VRZA 1YITT 4BDYA 5KCOA 3FEOA 2Y4YA 1WJQA 2DM1A 2HKNA 2RMOA 3QHSA 2L3PA 2M51A 2E5KA 1TOVA 3CC7T 2GNCA 4WCIA 2E70A 1OEBA 4XU0A 4OF1A 4BI4A 2RJDA 3OMGA 4M75D 1BB9A 3TSZA 1WHJA 3V7RA 2W10A 5GANh 2HSPA 1Q82C 2KDSA 4J9GA 4KGXB 3FIFA 4J7FA 2P4RA 1MV3A 2GFUA 2LQWA 1ZBXA 3EFRA 2C0IA 3IQLA 5GAMe 2DERA 1WGSA 1FWZA 2I2LA 3A8LB 2JMAA 1MNEA 3RMSA 1M2VB 3HTRA 4D8DA 3OBWA 2YWWA 3M58A 1M90U 4A63B 1W2BP 3T9NA 1M9SA 1BIBA 1U06A 5CAIA 2DYBA 2VVKA 2PUKB 4F7UG 2RB6A 5DLOA 5LJ5j 3G6EA 1ZX6A 1N8RC 1GXIE 5GAOp 2RPNA 3CCMQ 2E1HA 2ZPEB 2E65A 3L2VA 4E6RA 3EFSA 3F70A 1OPKA 3FJ5A 1VQNT 3JB9H 4RG2A 4NOYA 2DXBA 2ZPBB 2OAUA 2NUTA 1E6HA 2DBMA 1VQOA 4RMOA 4J9IA 2DILA 1KHIA 4J9HA 2EYWA 3CCUA 3M55A 4PLLA 5CIUA 2IG0A 4IUUA 4XU3A 2OAWA 3M56A 4J83A 3A8OB 2XD0A 3BW1A 4MMKA 2A37A 2MIOA 1OOTA 1VQNQ 1K9AA 2ESWA 2LQKA 1ZLMA 2KEAA 5CR2A 2GCXA 2D1XA 1B07A 2CT3A 3H0HA 1UHFA 1GRIA 4KH0B 3DKMA 3Q1JA 1VQOT 5KYXA 1YJNQ 3MEAA 3NTKA 1QVGS 1OZ3A 1VQLT 3QWXX 5J26A 2G6FX 3CCLA 2K4YA 5CQYA 4DBRA 1UGRB 3N5BB 5GJVB 1UGSB 2XHCA 5FRMA 4C92G 1FX7A 2LT1A 2J06A 3H41A 2K7AA 3JCMX 4PJOB 1OV3A 3HRTA 4C8QE 2LCCA 1WZOA 2ZGWA 3LGFA 5D6WA 5A0GA 1I1JA 4JUVA 3META 3EAEA 3FB9A 2MOXA 2K3YA 2KSSA 2EYYA 3EHQA 3VJPA 1M3AA 3CMEQ 1SSFA 2YDLA 1PRMC 2KRNA 2LRQA 2JM9A 1VUBA 2O88A 3BDLA 1IHVA 1N5ZA 1S1NA 3GOXA 4OB0B 3KFVA 4ZTJA 1BI2A 3E19A 2EKOA 1HYOA 4M7AA 3A98A 3G6EQ 4GBQA 4J9DA 4M75C 1MMAA 2NUZA 2E10A 3X20B 4BI8B 3QJYA 2ROLA 4E7KA 2LVMA 3X26B 1NM7A 4F7UF 3CCQA 4M78C 3D7SB 2SRCA 4ZGDB 2ABLA 4NL3A 1VQ9A 3NGPA 2FB7A 1W6XA 3GLXA 4JJBA 1AWXA 1U1TA 2H3EB 2K5FA 1IGUA 3OYEA 2J6OA 1AT1B 8ATCB 1QVFA 1OX8A 3TCJA 2M1HA 5LJ3d 3CCSQ 1RAIB 4Z8AA 3I56T 3CC2A 2F5KA 2DIQA 2L8DA 4M75B 3CEYA 4KH1B 2J05A 2YRDA 2PNIA 2CZ6B 4RKUE 5GMKm 1VQPQ 1UDLA 5GANe 1Y07A 2EJ9A 5IHKA 2RHUA 4C5GA 3G1JA 2CZ1B 2Y90A 4PFZA 1E6GA 4B9XA 3BY7A 4IUPA 1ZSGA 2YLCA 3S3NA 1YITA 1VQKT 4J9CA 2IPOB 4JPBW 1K8AU 3I55T 4IKFA 5FWCA 4N0AC 2MK5A 2ZPHB 1AZGB 2RJFA 1D1BA 2PTKA 2MWPA 1YNZA 2P0QA 2AIRB 1CKBA 3SWNB 4WF2A 4FYVB 3HSBA 1M2VA 2QK0A 5IT9E 3VUBA 1K0XA 3TQ7P 3CD6Q 1W70A 1HD3A 3RDVA 4QVZA 2F69A 2P84A 2ATCB 3I56A 3CMAA 4XTVA 4EMGA 2V8KA 1VYVA 3EHRA 4QT7A 1IRXA 2BIVA 2HQXA 3RKXA 5GAOm 1YJWA 3SWNC 3SB2A 4XTZA 5LJ3j 3SHWA 4FU6A 1JJ2A 2PZ1A 1I81A 5CVIA 3H8ZA 3UA6A 1EZZB 1WHMA 3RMQA 2DFUA 5GAN6 1D1CA 2L3SA 2CP2A 1R8OB 1QLYA 3EGXA 3CCMA 2CDTA 2WSFE 1KQSA 1Q86C 4Y92A 3C0CA 2QI2A 3G7ZA 1M3CA 1TU0B 4XTWA 2K9GA 4K11A 2KT1A 1WXUA 3LWHA 3J81E 1M1FA 3C4SA 3OYKA 1HK9A 3QIIA 4KUDK 4LE9A 4YTLA 2IIMA 4C0DC 3UPUA 1X2QA 4M75F 3UATA 2FZCB 4M78D 1KJWA 1D3BA 1SSHA 5FLXE 4IIOA 4EMKC 3CCVA 2ENMA 2KQWA 3TREA 4C92D 3PMIA 1LVKA 2QQRA 2O31A 4LDWA 1IREB 2E4HA 2CGHA 1NEBA 4HVUA 4M7AE 3LH5A 3EFOA 1WJSA 2FZGB 4ZN3A 2QEXA 2QDLA 1UE9A 4A4HA 4FSXA 5GMKj 4E7LA 3UWNA 1VIFA 3VKIA 1YIJT 2QTVA 6AT1B 1S72T 2L3QA 4R0KA 1F1BB 3CCET 5GMKh 4BE2A 1XJWB 2DXCA 4ELYC 4OVAA 5A2QE 1M2OA 2FPEA 4C5EA 1SEMA 1KQSP 4JLGA 3ZEHA 3OY9A 3I55A 1ACMB 1KQSS 2I0NA 2HSEB 3BDUA 1RACB 1VQKQ 1OU8A 4ESRA 3RBBB 1R0CB 4B9WA 3M54A 2LZ6B 2DETA 5GANg 3I5RA 2ZPFB 2EBPA 3OYNA 1NPPA 3FDRA 4MZMA 2CP0A 4VUBA 2EWNA 4QQGA 4FW2A 4RTXA 1JXMA 1ARKA 5GAOn 1VQ4Q 1U5SA 2VUBA 4L5GA 4FL6A 4KRTA 4AFUC 2QGGA 1UEBA 2BZXA 4JZ4A 2MCNA 3GPLA 2RQUA 1NYGA 4C92A 3CMAT 1QWFA 4FSSA 3CBMA 4QQ6A 3CCMT 2M02A 4FCYA 2RK2A 1NYFA 4EMKA 5D6XA 1KIKA 1GCPA 1QVGA 1VQ8Q 2V1RA 5A0LA 2YSQA 3CC7A 4LUDA 1W1FA 2YUPA 2FRYA 1PM3A 2DL8A 2SEMA 4PJOG 2BE7D 2OTJA 4A4EA 1PCXA 4J9EA 2O4XB 3REBB 1YHQQ 1Y96A 4N4IA 2PVGB 4OMMA 3CXCS 1PG5B 1BYMA 3ZBDA 2V8IA 3MO8A 4M77G 1VIEA 2HDAA 4HVVA 2EFIA 2W0ZA 2OJ2A 3HRUA 1V76A 2LJ1A 2L89A 1KC8C 4HT9A 5FU6C 2JN0A 1Q95G 3JCMf 4XAXB 3M0UA 2DK3A 1WFWA 2DRMA 1JB0E 1TUCA 2DD5A 3HPWA 4J5YA 4LD9K 2VXFA 3MKDA 3RERA 1QCNA 4O5VA 3JSCA 3OYFA 3G6ET 1ZUYA 5IHNA 5KYXB 4Y28E 2EYQA 2RO0A 3LYIA 1AZEA 4DBFA 3EFOB 3E9GA 2YHTA 3CCJQ 2HAXA 2QQSA 2FZKB 1MUZA 4C92C 2DNUA 2JTFA 3NTHA 2RI5A 1VQMQ 2RN8A 4KUIA 2CUDA 3M0SA 2M0OA 2CP7A 3L2RA 4BY6B 3SFMA 2MPXC 3JB9D 2C0TA 4O6JA 1GFCA 2AK5A 2EQUA 4II1A 1K8AR 4M77A 1QVPA 5GAN7 1QVFS 2VGNA 2XK0A 1Q82R 4C8QD 3OYBA 2K2MA 1U1SA 5I22A 1GL5A 3OS2A 3CCJT 1RI9A 3LH0A 3OS0A 1S72Q 2AT1B 4J8OA 4A53A 2QA4A 4M78F 2AZSA 4EDUA 3JCMe 1VQ8A 2ED1A 1Q7YR 1I8FA 3OBYA 3H9NA 4LUEA 1EX4A 3VRYA 2FL7A 1YP5A 1C0MA 3A8MB 1XQHA 2KE9A 1K73U 3URGA 1Z9ZA 4JZ3A 3S3MA 3GNFB 2BTTA 2GTJA 2XDPA 2J7IA 5GAMh 4BE0A 3OYYA 1IO6A 1N6AA 2YUNA 3MPUB 3EGUA 2O9VA 2GTOA 5GAN3 3PT9A 3EG0A 2DJQA 1WLPB 2A36A 5D6YA 2EIFA 1IGQA 2RH2A 4M77E 2JOYA 3OS5A 4IURA 1FXXA 1ZUKA 1RABB 2COWA 1AWJA 3OQ5A 3M57A 3CD6T 2X35A 2E3IA 3MP8A 1LJOA 4HCBA 5I2MA 2JT4A 3H0FA 4XTUA 3PTAA 2HQHA 5C6SA 4ZTFA 1LOJA 1OI1A 1KD1C 4EMKB 1T0HA 4QQDA 3EGXB 1BI0A 4LDXA 4BB7A 2L0AA 4ZN1A 2DE0X 1QQJA 1C1AA 4KT0E 1ZSZB 5KYUB 3CCJA 1R0BG 1JJ2S 2O2OA 1VQMA 1RL2A 2CH4A 4C5HA 1OULA 4MZTA 2IVWA 1W4SA 1ZA1B 3CC7Q 3MCAB 3O8VA 5LJ3e 1B7TA 4JRIA 4AFZC 3SWNA 2QQBA 2QQ9A 1UUEA 2K6DA 4HCKA 8AT1B 3CQTA 5M9OA 3M0PA 4M7DA 5FU7B 2EW3A 2GFAA 4Z88A 5L8RE 2E64A 2XI9A 3VS5A 2RM4A 3CC4A 1FMVA 3I5SA 2XDBA 1TUGB 4BUGA 1DJ7B 2KRMA 2E6ZA 4PKCC 1P92A 2CKKA 1BCOA 5CK9A 3JCMP 5EC7A 1GCQA 3JB9J 1WPYA 1NG2A 1RAHB 4X1VA 4PL6A 1HSQA 1VQKA 3G71Q 4JLIA 5GAMj 1MNDA 5CCAA 2COZA 3QSUA 5J3BA 1Q81U 4C8QC 1X27A 5KYYA 1JU5C 2AZVA 4JDSA 4Q5WA 1YBYA 2HMAA 3LLRA 2EQKA 3CC4Q 3CCEA 2AKKA 1OZ2A 2E6NA 3I9QA 3HL8A 1M1KC 1NPRA 3QZ9B 2X4XA 1X6GA 3I56Q 1UGVA 1G83A 2J6FA 2XU8A 2RQVA 2FVUA 1BCMA 1Y7XA 5LJ3h 3JCMd 2RA2A 1YJ9A 1X6BA 4JS4A 3FRNA 3H6ZA 4M77C 1BI3A 3WVEB 3CXCP 3JCMg 3R6OA 3OW2S 1SRLA 4PK4A 2YT6A 3VV0A 1Y57A 1YI2T 2NUTB 3OYIA 3EG1A 1R77A 4HVWA 1E7OA 5FU6B 1WHLA 1M90C 2LNHB 4HT8A 3HP9A 2MAMA 4RCCA 4LN2A 1TG0A 1WIEA 2QG9B 4C8QG 1WXBA 4M7AB 1G3TA 2RQRA 1NLOC 2DX1A 3P8BB
chains in the Genus database with same CATH topology
3CCSA 3QKJA 4M7DF 4UC4A 1ZHIA 2R5MA 1WJSA 2YLBA 2EQMA 3HFOA 3V8JA 3VUZA 3CMET 1VQ6A 1YCYA 4ZN3A 4MMLA 3X25B 5HKCA 5GMKi 2QEXA 4E7JA 1Q86U 3AHUA 4A4HA 4FSXA 5GMKj 1NJIC 4M7AD 4MDXA 4E7LA 3UWNA 1I4K1 4LDYA 1TH7A 1VIFA 3QYHB 3QO3A 5GAOl 4BY6C 1I5LA 3HRSA 3VKIA 1H641 2JUFA 5FROA 2OTLA 2DZCA 4C0DB 1YIJT 2P0PA 1ZQ1A 2LQ8A 3BFMA 3L1AA 1S72T 4M7DC 3QXEB 3CCET 2FYKA 2VXEA 4Z02A 5GMKh 1N9RA 4BE2A 2L3RA 2HQEA 1KHCA 2MF2A 2DXCA 4ELYC 3CXCA 3P8DA 4OVAA 5A2QE 3OYLA 4C5EA 1VQMT 1WNLA 3QUIA 3CCVT 2RHZA 4JLGA 3ZEHA 3X24B 3OY9A 3LWIA 3I55A 2DZ9A 2K5LA 2HNIA 5FU7C 3JRZA 3M4GA 3M4YA 4C0ZA 1KQSS 4X9CA 3A5ZB 2HBPA 2DTOA 5GANf 4PJOD 2JZ2A 1YITT 3GF5A 2XG8D 2R58A 2PQWA 3BDUA 5KCOA 4BDYA 3FEOA 3OYHA 2Y4YA 3DLLA 1WJQA 4C8QA 5GANj 1G3WA 3QHSA 4B9WA 3M54A 3X28B 3P8HA 5GANg 5GAOr 2ZPFB 4DOWA 3PIPA 4E7IA 3CC7T 3E1SA 3LW5E 3OYNA 1NPPA 4OB3B 2E70A 4ME7A 1X75C 3ASKA 3FDRA 1Y71A 4MZMA 4VUBA 4XU0A 4A4KA 2KVQG 3RKWA 4OF1A 2EWNA 4BI4A 2OTJT 5LJ5f 3GNGA 2RJDA 3OMGA 1O75A 4QQGA 2V8JA 4M75D 3CC2T 5LJ3g 5GAOn 1KG1A 2KAFA 3PMTA 4M7DB 2VUBA 4J6WA 1BIAA 4L5GA 4FL6A 2XIDA 3RESA 4PLIA 5GAN8 1BI1A 1PSEA 3V7SA 4C8QF 1UEBA 5DY9A 3V7RA 3GPLA 2BUDA 5GANh 3GP8A 1Q81C 1QW1A 4C92A 3G4SA 2PU9B 3CMAT 1Q82C 2KDSA 1VQ5T 5KH6A 3FIFA 3CMEA 2DTIA 4J7FA 4JJNK 3CBMA 4QQ6A 3CCMT 3OYAA 2GFUA 3CD6A 2JTMA 2RK2A 2DKGA 1ZBXA 3EFRA 4EMKA 5D6XA 3JB9I 2X4JA 3OA6A 5GAMe 3JB9F 1WGSA 1FWZA 2I2LA 2MMPA 1U8RA 1JBMA 1QVGA 3A8LB 4N4HA 3JCMc 3RMSA 2E5QA 4FT4A 5A0LA 4PJOA 3OBWA 3MEUA 4N0AA 4LDVA 3M58A 3CC7A 3DLMA 1M90U 1G3SA 3ER0A 3OMCA 4OGCA 1K73C 2ZZDA 2VYTA 4PJOG 3T9NA 2LC4A 2R57A 1M9SA 1X6OA 4A4EA 1BIBA 3MEWA 2OTJA 5CAIA 2O4XB 4M75E 2PUKB 1YJNT 4F7UG 2RB6A 3CBOA 5DLOA 5LJ5j 1Y96A 3G6EA 4N4IA 1N8RC 4NS5A 1GXIE 3OS1A 5GAOp 2PVGB 3CBPA 4C5IA 4F7UB 5DM7R 3CXCS 1Q7YC 1LNXA 3RIRA 2E1HA 2ZPEB 2E65A 4BACA 5CQXA 4ATOA 3L2VA 4BDZA 1BYMA 3ZBDA 2V8IA 3MO8A 3OSSC 3EFSA 3F70A 4M77G 1VIEA 1VQNT 4OB2B 4LDUA 3INZA 3JB9H 3PNWC 4RG2A 5CKEA 2EFIA 2LCLA 2DXBA 2ZPBB 4NOYA 4A54A 3L42A 2OAUA 3HRUA 4J6YA 3JAME 3MHXA 1KC8C 2L89A 4M7AF 2PVOB 4PJOF 1VQOA 1YJ9T 2BKDN 4HT9A 4RMOA 5FU6C 2JN0A 4TVRA 3JCMf 4M77D 4XAXB 1D3BB 1KHIA 3C12A 2DK3A 3ZFJA 2RJCA 2K3XA 5LJ5h 1JB0E 3CCUA 1M4ZA 3M55A 4PLLA 5CIUA 2DD5A 3HPWA 4MDWA 4RG8A 1VQ7T 4J5YA 3RKYA 4LD9K 4C92E 4A4GA 4E7HA 2IG0A 4IUUA 3OYCA 4X34A 2F5TX 2VXFA 4OP0A 5DLQE 4O5VA 4XU3A 2XDDA 2RHYA 3JSCA 3OYFA 3RERA 3M5AA 3M56A 4J83A 3A8OB 4XU2A 3G6ET 1KD1U 2XD0A 3BW1A 4MMKA 2C06A 4X9DA 4Y28E 5GAOq 2EYQA 2WSEE 5KE3A 2RO0A 5LJ5d 4R56A 1UGPB 2DTHA 1NZ9A 3LYIA 2EAYA 3NTIA 2YRVA 3C94A 3E9GA 2YHTA 5GAMf 1M1GA 2ZPIB 2LQKA 1NE8A 2QQSA 2HAXA 4C92C 5CR2A 3NTHA 1M5Q1 2JTFA 2GCXA 2RI5A 4ZGEB 5LJ5g 5C0MA 4MZPA 1O9SA 4P5NA 4KUIA 1QP2A 4OGEA 1VQLA 3RUXA 2M0OA 3DKMA 3L2RA 4BY6B 2RI2A 3Q1JA 3SFMA 3JB9D 1VQOT 4M7DE 3MEAA 2PVDB 3NTKA 1QVGS 1OZ3A 3S3OA 3QDRB 4O6JA 4R55A 5CKDA 3OYGA 1VQLT 2EQUA 4II1A 4XU1A 1H3ZA 4D6WA 4QVDA 5J26A 4M77A 3CCLA 1QVPA 5GAN7 2K4YA 5CQYA 3E9FA 4JS5A 4ELZC 1UGRB 3N5BB 1QVFS 2XK0A 2VGNA 2VV5A 1UGSB 2XHCA 5FRMA 4C8QD 4C92G 3OYBA 1FX7A 2QA4T 1U1SA 5A0DA 1XOVA 2LT1A 2CS7A 3OS2A 3JCMX 4M78E 4PJOB 3CCJT 3LH0A 1S72A 4DA4A 3OS0A 3NFCA 2GQVA 2OTLT 4A53A 4J8OA 2QA4A 3HRTA 4M78F 1YJNA 4C8QE 4EDUA 2QTXA 3JCMe 1VQ8A 2LCCA 3UT1A 4DOVA 1I8FA 2ZGWA 3C95A 3LGFA 3OBYA 4IUVA 3MP1A 5D6WA 3OYMA 3L2QA 4C8QB 5KCHA 5A0GA 4M7DG 3HHTB 4JUVA 5I2SA 2E12A 4BI3A 2FL7A 2LDMA 2WSCE 3META 3QZ5B 2EJGA 3EAEA 3FB9A 1X01A 3A8MB 2K3YA 2R5AA 4N4GA 1XQHA 5AYFA 2KSSA 4F7UA 5J39A 3TU4K 1VQPT 1K73U 3URGA 3VJPA 3HFNA 1SSFA 1VQPA 5GAN2 2LRQA 3S3MA 1B34B 1VUBA 2M16A 2QQAA 3GNFB 4HA8A 1VQ5A 3CCRA 2XDPA 3BDLA 4L59A 5GAMh 4BE0A 3OYYA 4HKEA 4FT2A 3GOXA 4BD3A 4OB0B 4ZTJA 1N6AA 1BI2A 5IN1A 3E19A 2QEXT 2EKOA 3M59A 3CC4T 3PFSA 4M7AA 4E47A 1K9MC 4M75C 5GAN3 3V7CA 3PT9A 2E10A 2RI3A 2MI6A 3X20B 4BI8B 3QJ6A 2B8AA 2FHDA 3QJYA 4M77B 1UB4A 2JNGA 4CRIA 4JRQA 3JB9G 2K57A 1WQ7A 5D6YA 2EIFA 4E7KA 2LVMA 3X26B 4Y91A 4F7UF 5LJ3f 2RH2A 4LD6A 1YHQA 4M77E 3CCQA 2JOYA 3OS5A 4IURA 4M78C 4ZGDB 4NL3A 1FXXA 3V8KA 2O4XA 3WVDB 1YHQT 1M8VA 3DB4A 1VQ9A 1N9SA 1Y96B 2P4TA 2FB7A 3GLXA 3M9QA 3OQ5A 3QPHA 3SD4A 1OYXA 3M57A 3CD6T 2X35A 4M78A 1U1TA 3A8GB 1LJOA 2K5FA 3MP8A 5CKFA 4J6XA 3KXTA 1YI2A 3OYEA 4HCBA 2CYZB 2QDYB 5I2MA 1M1KU 3QYGB 4XTUA 4ZGJB 5HK0A 3PTAA 1KQ1A 3PGGA 5C6SA 1XTDA 4ZTFA 1LOJA 1QVFA 1QP3A 2HD0A 3VU3C 1OI1A 1KD1C 3TCJA 4EMKB 1RI0A 4QW2A 2M1HA 5HK3A 2CZ7B 5LJ3d 4QQDA 1BI0A 3CPWS 4LDXA 4BB7A 4M7AC 2LT4A 4L6V5 4XTXA 2F5KA 4A4FA 4ZN1A 3I56T 1IZ6A 2DIQA 1KC8U 1K9MU 3CC2A 2L8DA 1AHJB 4KT0E 4M75B 3CEYA 5GANd 3CCJA 4XQ3A 2RD1A 2CZ6B 4RKUE 5GMKm 4M7DD 3VYHB 1JJ2S 2AHJB 1VQMA 1RL2A 2QXFA 2DEQA 3M53A 4C5HA 5GANe 2RHXA 4M78B 2G3RA 2L5QA 4MZTA 1Y07A 2EJ9A 2IVWA 1W4SA 3JCMQ 1N8RU 4HCCA 5GMKe 3J7AF 2RHUA 4C5GA 4JRKA 2CZ1B 2EJFA 2Y90A 4J7IA 4KBMB 4GLKA 2CZ0B 4B9XA 3BY7A 3MCAB 4IUPA 2YLCA 4EPCA 3UDCA 3S3NA 2VGMA 3O8VA 5LJ3e 5I21A 2PUOB 4JRIA 4CI0C 1WQWA 1YITA 3SWNA 3FLGA 3CCST 2QQBA 3OYJA 1VQKT 2A7YA 2DVEA 2QQ9A 2D6FA 2LTOA 1VQ4A 2H3JA 4C0GA 3MEVA 1K8AU 5M9OA 3I55T 4IKFA 3L2WA 4N0AC 2ZPHB 4OB1B 4C92B 2XICA 3OW2A 5EG2A 1VQ6T 4XTYA 2RJFA 3L2UA 4M7DA 2ZCFB 5FU7B 5KE2A 2GFAA 2MWPA 3MP6A 5L8RE 2X4YA 2VC8A 4M78G 3JCMJ 2E64A 2XI9A 1JRIA 2KK4A 2KMTA 2P0QA 4FM4B 5CO7A 3SWNB 4WF2A 2RM4A 1W2BA 2KY9A 4HCZA 5IAYA 1HXDA 3CC4A 4PJOE 5GAMg 2XDBA 3HSBA 5IT9E 2P0KA 3SDZA 1DJ7B 4BUGA 4JRPA 4EMHA 2K2VA 4FIBA 4M75G 2E6ZA 2DXTA 4PKCC 1P92A 1B34A 2CKKA 3V8LA 4DQ2A 3JCMh 5CK9A 3FC3A 3JCMP 1XNIA 1VQNA 3VUBA 3LGLA 5GAMd 3G4ST 2Y4XA 3JB9J 2D0QB 4M75A 3JCMV 1WPYA 4C92F 2A3LA 3A8HB 4KULA 3WXMB 3G71A 4PL6A 4QVZA 2F69A 1VQKA 1KQ2A 4PJOC 3GIBA 4JLIA 5GAMj 5CCAA 3I56A 2DD4A 5GMKl 3HKSA 3CMAA 3QSUA 5J3BA 4XTVA 1Q81U 4EMGA 2D9TA 2V8KA 5FRNA 3KBGA 2MWOA 4C8QC 3CPWA 4OMFB 2BIVA 2HQXA 4C0FA 3RKXA 2DO3A 2DPPB 3QBYA 4JDSA 5GAOm 3CCUT 1YJWA 4Q5WA 2GF7A 3J80E 1YBYA 3LLRA 3CCEA 2EQKA 1G5VA 1BKBA 1YIJA 3PIOA 3SWNC 3SB2A 1OZ2A 2E6NA 2M9UA 2RJEA 4NL2A 4XTZA 4PNOA 5LJ3j 4FU6A 4BE1A 3HL8A 1JJ2A 4V2SA 1I81A 1M1KC 2LX9A 3OB9A 1VQ9T 1NPRA 3QZ9B 2DXUA 5CVIA 2RHIA 3H8ZA 3TEEA 2X4XA 2XU8A 3RMQA 5GAN6 2K5IA 1MHNA 2FVUA 4QVCA 1Y7XA 5LJ3h 1R8OB 2EQJA 3ME9A 4GY5A 5HY6A 3CCMA 4M7AG 3JCMd 3G71T 2RA2A 1YJ9A 2WSFE 4RCBA 3S6WA 4IUQA 1KQSA 4JS4A 1Q86C 3FRNA 3H6ZA 1NJIU 1EIFA 3FJPA 3L2ZA 4M77C 2QI2A 5CKBA 1BI3A 3WVEB 2O01E 3G7ZA 3JCMW 4XK8E 4XTWA 1VQ7A 2ZPGB 1VQ4T 1Q82U 3JCMg 3R6OA 3OW2S 2RK1A 2E41A 1PSFA 3LWHA 1N27A 1G3YA 3QG1A 5LJ5e 5CKHA 3VV0A 3CCLT 1YI2T 3J81E 1M1FA 3C4SA 2LNVA 3VYGA 3OYIA 2NLUA 3OYKA 1HK9A 3QIIA 3JCMb 4KUDK 3OYDA 1W2BS 4YTLA 5FU6B 1WJRA 4C0DC 4IUTA 3UPUA 4M75F 4F7UE 2DJZA 2XKOC 1M90C 4M77F 4HT8A 3LX7A 3OSVA 3CPFA 4M78D 3KUFA 3HP9A 3CCQT 1K8AC 5GAN5 1YJWT 1D3BA 2MAMA 4RCCA 5FLXE 4EMKC 3CCVA 1VQ8T 2KQWA 1UGQB 1V29B 3TREA 1MGQA 3PMIA 4C92D 4C8QG 1Q7YU 1G3TA 2QQRA 4M7AB 3CCRT 2X4WA 2DAQA 1IREB 4LDWA 3DB3A 2DIGA 5LL6S 2CGHA 5GAN4 3P8BB 2WACA 2JVVA 4M7AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 2;  1HXD A;  5LJ5 j;  4PJO E;  5GAM g;  1Y96 A;  4M7D F;  1B34 B;  5GAO p;  3HSB A;  2YLB A;  3HFO A;  3V8J A;  4HA8 A;  4F7U B;  1LNX A;  4EMH A;  1YCY A;  4M75 G;  3RIR A;  2E1H A;  5GAM h;  2DXT A;  2E65 A;  4DQ2 A;  1B34 A;  4MML A;  3V8L A;  4M7D E;  3JCM h;  5GMK i;  3JCM P;  3EFS A;  4M77 G;  5GAM d;  3AHU A;  5GMK j;  4M7A D;  3JB9 J;  4M75 A;  3INZ A;  3JCM V;  3JB9 H;  1WPY A;  4C92 F;  4NOY A;  4M7A A;  1I4K 1;  4A54 A;  1TH7 A;  4J6Y A;  3QO3 A;  5GAO l;  4M7A F;  1I5L A;  4M75 C;  5GAN 3;  4PJO F;  3V7C A;  1H64 1;  4HT9 A;  1KQ2 A;  4PJO C;  2E10 A;  2JN0 A;  2DZC A;  4JLI A;  3JCM f;  5GAM j;  4M77 D;  3GIB A;  3BFM A;  1D3B B;  3L1A A;  4M7D C;  4M77 B;  3JB9 G;  2VXE A;  2FYK A;  5GMK l;  2K57 A;  1WQ7 A;  5LJ5 h;  5GMK h;  1N9R A;  4F7U F;  4Y91 A;  3QSU A;  5LJ3 f;  4XTV A;  4EMG A;  4M77 E;  4M78 C;  4NL3 A;  3V8K A;  4J5Y A;  4WF2 A;  3RKY A;  1WNL A;  3QUI A;  4C8Q C;  4C92 E;  1M8V A;  3RKX A;  2DZ9 A;  1N9S A;  1Y96 B;  2HNI A;  2FB7 A;  2VXF A;  5GAO m;  3M4G A;  4OP0 A;  4XU3 A;  3RER A;  4XU2 A;  4X9C A;  3BW1 A;  4M78 A;  2DTO A;  5GAN f;  4PJO D;  4MMK A;  1U1T A;  3SB2 A;  1LJO A;  4X9D A;  3SWN C;  4NL2 A;  4J6X A;  3BDU A;  4XTZ A;  4PNO A;  5LJ3 j;  5GAO q;  5LJ5 d;  4V2S A;  1I81 A;  2DTH A;  2EAY A;  4C8Q A;  4XTU A;  5GAN j;  2YHT A;  1KQ1 A;  2DXU A;  3PGG A;  3QHS A;  5GAM f;  1LOJ A;  3VU3 C;  4EMK B;  5GAN g;  4C92 C;  5GAO r;  1M5Q 1;  5LJ3 d;  5LJ5 g;  5GAN 6;  4M7A C;  4XTX A;  4QVC A;  5LJ3 h;  4XU0 A;  3RUX A;  3RKW A;  2EWN A;  4M7A G;  4M75 B;  5LJ5 f;  3JCM d;  5GAN d;  3JB9 D;  2RA2 A;  4RCB A;  4M75 D;  5LJ3 g;  5GAO n;  4XQ3 A;  2RD1 A;  3FJP A;  3L2Z A;  4M77 C;  4M7D B;  5GMK m;  4J6W A;  1BIA A;  4M7D D;  3RES A;  3JCM W;  4XU1 A;  4XTW A;  5GAN 8;  4QVD A;  3V7S A;  4M77 A;  2DEQ A;  3JCM g;  5DY9 A;  3V7R A;  4M78 B;  4C8Q F;  5GAN e;  2E41 A;  5GAN h;  5GAN 7;  2EJ9 A;  5LJ5 e;  4C92 A;  3JCM Q;  5GMK e;  4JRK A;  3FIF A;  4C8Q D;  4C92 G;  2DTI A;  2Y90 A;  2EJF A;  1U1S A;  1HK9 A;  3JCM b;  3BY7 A;  3JCM X;  2YLC A;  4M78 E;  4PJO B;  2DKG A;  3EFR A;  4EMK A;  5LJ3 e;  5I21 A;  3JB9 I;  4JRI A;  1WQW A;  4M75 F;  3SWN A;  4F7U E;  2DJZ A;  5GAM e;  3JB9 F;  4A53 A;  2I2L A;  2DVE A;  4M77 F;  1JBM A;  4M78 F;  4C8Q E;  4HT8 A;  4M78 D;  3JCM c;  4PJO A;  2QTX A;  3JCM e;  4N0A A;  5GAN 5;  1I8F A;  2ZGW A;  1D3B A;  4N0A C;  4RCC A;  4EMK C;  4C8Q B;  4M7D G;  4C92 B;  4JUV A;  4XTY A;  4M7D A;  4C92 D;  4PJO G;  1MGQ A;  2EJG A;  4C8Q G;  3FB9 A;  1X01 A;  4M7A B;  1BIB A;  2VC8 A;  4M78 G;  3JCM J;  4F7U A;  5CAI A;  2E64 A;  1JRI A;  2CGH A;  4M75 E;  5GAN 4;  4F7U G;  3SWN B;  3HFN A;  2RM4 A;  2RB6 A;  4M7A E; 
#chains in the Genus database with same CATH topology
 3CCS A;  1M1K R;  4M7D F;  3V8J A;  3VUZ A;  1WHG A;  2FPD A;  4HXJ A;  5HKC A;  1UJY A;  4E7J A;  1OPL A;  1Q86 U;  3AHU A;  1NJI C;  4LXC A;  4RTW A;  4AMC A;  4OMN A;  2EYX A;  1I4K 1;  1TH7 A;  1YFN A;  3HRS A;  5FRO A;  2LQ8 A;  3BFM A;  4JJD A;  1RLP C;  4Z02 A;  1PRL C;  2CP3 A;  3CPW P;  1KHC A;  2MF2 A;  3CXC A;  2DF6 A;  1VQM T;  1TTH B;  2RHZ A;  4RTY A;  3JRZ A;  2QA4 Q;  2LQN A;  4Z89 A;  1B3Q A;  3M4Y A;  4X9C A;  3A5Z B;  5GAN f;  2JJ9 A;  2JZ2 A;  3OW2 P;  1UHC A;  3ULR B;  2XG8 D;  2R58 A;  3UA7 A;  3DLL A;  4C8Q A;  2OX7 A;  5GAN j;  2YXY A;  1G3W A;  3VS0 A;  3X28 B;  2M0Y A;  5GAO r;  1X43 A;  3PIP A;  1ABQ A;  1YWO A;  3LW5 E;  4OB3 B;  1M8M A;  5FW9 A;  2KVQ G;  1QKX A;  2OTJ T;  5LJ5 f;  3GNG A;  5IHI A;  1O75 A;  2V8J A;  5LJ3 g;  3PVQ A;  4M7D B;  4J6W A;  2XID A;  1AEY A;  1PHT A;  1BI1 A;  2LJ3 A;  5DY9 A;  1Q81 C;  2YRC A;  3G4S A;  1VQ5 T;  3CME A;  4D8K A;  2RQW A;  3OYA A;  3CD6 A;  2JTM A;  2EYZ A;  1YN8 A;  3JB9 I;  2X4J A;  1U8R A;  2MMP A;  2F1L A;  3TSW A;  4FT4 A;  1K4U S;  4RUG A;  3MEU A;  4LDV A;  3DLM A;  1G3S A;  2VWF A;  2ZZD A;  1OU9 A;  2VYT A;  1WXT A;  1Q86 R;  2LC4 A;  1X6O A;  2EKH A;  1QWE A;  4DEX A;  4M75 E;  1YJN T;  3CBO A;  3OS1 A;  3CBP A;  4F7U B;  4C5I A;  5DM7 R;  3CCL Q;  1Q7Y C;  3RIR A;  4ATO A;  5CQX A;  4AFQ C;  3H0I A;  4OB2 B;  1JO8 A;  3PNW C;  1RLQ C;  2LCL A;  5FRN A;  4J6Y A;  4M7A F;  4M77 D;  1D3B B;  3EG3 A;  1UTI A;  3ZFJ A;  2RJC A;  5LJ5 h;  1M4Z A;  4ORZ A;  1PC0 A;  4RG8 A;  4LNP A;  1VQ9 Q;  4C92 E;  1MMD A;  4E7H A;  2CSQ A;  2YUO A;  3OYC A;  4X34 A;  2F5T X;  1MV0 B;  1KD1 U;  2C06 A;  2KR3 A;  4X9D A;  1IHW A;  5GAO q;  2WSE E;  2D8J A;  4R56 A;  2OTL Q;  1UGP B;  2DTH A;  1NZ9 A;  2EAY A;  3PE0 A;  4CC4 B;  1WX6 A;  1RAA B;  1NE8 A;  1RUW A;  2CH4 W;  5KYY B;  1TWB A;  1M5Q 1;  5C0M A;  4MZP A;  1O9S A;  4P5N A;  4PFP A;  1AD5 A;  3M0Q A;  1Z9Q A;  4R55 A;  5CKD A;  3PVL A;  3CCQ Q;  4XU1 A;  4RTV A;  1H3Z A;  5KYW B;  1VQ6 Q;  4JS5 A;  4OMQ A;  3E2U A;  2VV5 A;  2QA4 T;  2JTE A;  5A0D A;  1RAE B;  2CS7 A;  4M78 E;  2HL5 C;  1S72 A;  2GQV A;  2EGC A;  1M3B A;  1VYU A;  3C95 A;  4IUV A;  3OYM A;  3L2Q A;  2JXB A;  4C8Q B;  4OMO A;  5I2S A;  4BI3 A;  2LDM A;  3QZ5 B;  2EJG A;  1FMK A;  4N4G A;  3TU4 K;  5J39 A;  1QCO A;  2DBK A;  4DBH A;  2M16 A;  2QQA A;  4HA8 A;  4L59 A;  4HKE A;  4FT2 A;  5IXB A;  2MYS A;  3M59 A;  3CC4 T;  4E47 A;  1K9M C;  3EH1 A;  1YIT Q;  3V7C A;  2DYI A;  1RAG B;  3I55 Q;  3QJ6 A;  1UB4 A;  2OI3 A;  3JB9 G;  4Y91 A;  1MMG A;  4LD6 A;  5LJ3 f;  3V8K A;  1NBE B;  2O4X A;  1BBZ A;  2LCS A;  3DB4 A;  1TXQ A;  1Y96 B;  2DL7 A;  3SD4 A;  3QPH A;  4M78 A;  3A8G B;  5CKF A;  3KXT A;  1YI2 A;  1X2K A;  2CYZ B;  4ZGJ B;  1KQ1 A;  3PGG A;  1ZUU A;  5IXF A;  2V26 A;  3QWY A;  3CPW S;  1T3S A;  4A4F A;  1IZ6 A;  2GGR A;  2JS0 A;  5GAN d;  4XQ3 A;  4OML A;  4F16 A;  2CSI A;  4M7D D;  3RR6 A;  3M0R A;  2AHJ B;  2ED0 A;  2QXF A;  2EVR A;  3M53 A;  2L5Q A;  5HCK A;  2BZ8 A;  4HCC A;  2QAZ A;  4J7I A;  4KBM B;  1T3L A;  2EQI A;  4EPC A;  3UDC A;  3EGD B;  1YCS B;  4B6M A;  5I21 A;  4CI0 C;  3FLG A;  1I0C A;  2A7Y A;  2VB6 A;  2D6F A;  2LTO A;  1MMN A;  3OW2 A;  5EG2 A;  4XTY A;  3L2U A;  2DA9 A;  3R6N A;  1OQK A;  5KE2 A;  1KFZ A;  1WA7 A;  3MP6 A;  2NUP B;  2VC8 A;  4M78 G;  3JCM J;  1A0N B;  5CO7 A;  5ECA A;  5IAY A;  4PJO E;  1WI7 A;  2P0K A;  2K2V A;  5IH2 A;  2DXT A;  1B34 A;  3FC3 A;  1XNI A;  1GCQ C;  2KYM A;  3LGL A;  5GAM d;  3G4S T;  2Y4X A;  2D0Q B;  4M75 A;  2HBW A;  4PJM A;  2L2P A;  3VS1 A;  3WXM B;  3G71 A;  1KQ2 A;  4PJO C;  3GIB A;  1KSW A;  2DD4 A;  1TUD A;  3KBG A;  3CPW A;  4OMF B;  4C0F A;  2DO3 A;  2E3H A;  1SHF A;  2GF7 A;  3J80 E;  1CKA A;  2JW4 A;  1G5V A;  1YIJ A;  4AG1 C;  2O9S A;  2CP5 A;  2M9U A;  1BU1 A;  2RJE A;  4BE1 A;  3QDF A;  2ZAE A;  4PNO A;  2DXU A;  2ECZ A;  3TEE A;  4RTZ A;  2K3B A;  4JJC A;  1JJ2 P;  1ZSZ A;  5KYU A;  1TS9 A;  3CCV Q;  4QVC A;  1JXO A;  3CCR Q;  3NPF A;  1YJ9 Q;  4M7A G;  3G71 T;  2JM8 A;  2LJ0 A;  4RCB A;  1SF9 A;  3CCE Q;  3L2Z A;  5CKB A;  2O01 E;  3JCM W;  4XK8 E;  1VQ7 A;  2ZPG B;  1Q82 U;  2X3W D;  2RK1 A;  1PSF A;  1G3Y A;  3QG1 A;  5LJ5 e;  3CCL T;  2EPD A;  3VYG A;  1PD1 A;  1K9M R;  1UJ0 A;  3OYD A;  1WJR A;  4IUT A;  1LCK A;  2XKO C;  4M77 F;  3KUF A;  1K8A C;  2KT8 A;  1YJW T;  4FYY B;  1K73 R;  1MGQ A;  2X4W A;  3DB3 A;  2DIG A;  5GAN 4;  2COY A;  2WAC A;  1ZHI A;  2R5M A;  2X9H A;  1VQ6 A;  1YCY A;  4J9F A;  2VKN A;  3X25 B;  2C0O A;  5GMK i;  2X3X D;  1K76 A;  4RTT A;  5GAO l;  4BY6 C;  2OTL A;  4PJL A;  1ZQ1 A;  4M7D C;  2XMF A;  2FYK A;  2VXE A;  2DVJ A;  2HQE A;  3OYL A;  5D7U A;  3QUI A;  4GLM A;  3CCV T;  4CC3 A;  3RNJ A;  2HBP A;  2DTO A;  2DL4 A;  1IXD A;  2NUP A;  3GF5 A;  2PQW A;  4PJN A;  3OYH A;  1FMW A;  2QEX Q;  3EGD A;  3P8H A;  1CSK A;  4DOW A;  1Y0M A;  4E7I A;  3E1S A;  1VQ7 Q;  4ME7 A;  1X75 C;  3ASK A;  2F2V A;  1Y71 A;  3EG9 B;  4A4K A;  3RKW A;  3CC2 T;  1UFF A;  2KGT A;  2KAF A;  3PMT A;  4KGV B;  1BIA A;  4J9B A;  3RES A;  4PLI A;  4CC2 A;  5GAN 8;  2ROT A;  1PSE A;  3V7S A;  2DL3 A;  4C8Q F;  3VS4 A;  4EIK A;  2BUD A;  3GP8 A;  1QW1 A;  2PU9 B;  1VOM A;  1RAD B;  2CRE A;  5KH6 A;  3G4S Q;  2DTI A;  4JJN K;  3REA B;  1VQ5 Q;  2DKG A;  4F17 A;  5AT1 B;  2A08 A;  3OA6 A;  3JB9 F;  1JBM A;  2X51 A;  4N4H A;  3JCM c;  1PKT A;  2E5Q A;  4PJO A;  4N0A A;  5FWB A;  3ER0 A;  4OGC A;  3OMC A;  1K73 C;  2HZY A;  3CC2 Q;  2R57 A;  3MEW A;  1ZBJ A;  2A28 A;  3JV3 A;  1K1Z A;  2HL3 A;  4NS5 A;  2D8H A;  4ZNX A;  1LNX A;  1FYN A;  2DEU A;  4BAC A;  4BDZ A;  3OSS C;  4OMP A;  1QKW A;  4LDU A;  3INZ A;  2J6K A;  5CKE A;  1BK2 A;  1JEG A;  3JAM E;  4A54 A;  3L42 A;  3MHX A;  2FEI A;  2PVO B;  1ZSZ C;  4PJO F;  1YJ9 T;  2BKD N;  2HCK A;  4TVR A;  4AG2 C;  2EGA A;  1YJW Q;  1VQO Q;  1GBR A;  1Q81 R;  3C12 A;  2K3X A;  4CC7 A;  2B86 A;  1PD0 A;  2AKL A;  2KNB B;  4MDW A;  1VQ7 T;  3M0T A;  3RKY A;  1WHK A;  1UG1 A;  4A4G A;  3AT1 B;  2FRW A;  4OP0 A;  5DLQ E;  2XDD A;  2RHY A;  3M5A A;  1JQQ A;  4XU2 A;  3CMA Q;  5KE3 A;  5LJ5 d;  3NTI A;  2YRV A;  3C94 A;  4DBQ A;  5GAM f;  1M1G A;  2ZPI B;  1AOJ A;  5LJ5 g;  4ZGE B;  2RF0 A;  2FG0 A;  1QP2 A;  2KYB A;  4KGZ B;  2A0F B;  4OGE A;  3RUX A;  1VQL A;  2KRS A;  2RI2 A;  2PVD B;  3S3O A;  3QDR B;  3OYG A;  4QKU A;  1AWO A;  4D6W A;  4QVD A;  3BE3 A;  4FW1 A;  2JMC A;  3E9F A;  4ELZ C;  1SPK A;  1EFN A;  4AT1 B;  1XOV A;  7AT1 B;  3UF4 A;  4DA4 A;  3NFC A;  2OTL T;  1YJN A;  2QTX A;  4DOV A;  3UT1 A;  2FPF A;  1N8R R;  1KG1 A;  3MP1 A;  1YIJ Q;  5KCH A;  4M7D G;  3HHT B;  2E12 A;  2FO0 A;  2WSC E;  1WYX A;  1ZA2 B;  1VA7 A;  1X01 A;  2R5A A;  5AYF A;  1VQP T;  4F7U A;  2NYS A;  5KYW A;  1NLP C;  3HFN A;  1VQP A;  1G8X A;  5GAN 2;  1QMC A;  1B34 B;  3NMZ C;  1VQ5 A;  3CCR A;  4BD3 A;  1M90 R;  1SRM A;  5IN1 A;  2QEX T;  3SEM A;  3PFS A;  1H92 A;  4PFO A;  4ANJ A;  2RI3 A;  2MI6 A;  1NEG A;  4M77 B;  2B8A A;  2DL5 A;  2FHD A;  4CRI A;  2JNG A;  4JRQ A;  2K57 A;  1WQ7 A;  4M4Z A;  1YHQ A;  1YWP A;  2Z0W A;  2JS2 A;  3WVD B;  5L23 A;  1YHQ T;  1M8V A;  1TSF A;  1N9S A;  2P4T A;  3M9Q A;  1OYX A;  4J6X A;  3U23 A;  1WHH A;  2QDY B;  1M1K U;  1H8K A;  1J3T A;  1D1A A;  3QYG B;  5HK0 A;  1KK7 A;  1XTD A;  1D09 B;  1QP3 A;  2HD0 A;  3VU3 C;  1QVG P;  1D0X A;  3CCU Q;  1RI0 A;  4QW2 A;  2QYZ A;  1M27 C;  2CZ7 B;  5HK3 A;  3EG2 A;  4M7A C;  2LT4 A;  4L6V 5;  4XTX A;  4E7Z A;  2KXC A;  1KC8 U;  1K9M U;  1AHJ B;  1GFD A;  1SG5 A;  2KI7 A;  1U3O A;  2RD1 A;  3THK A;  3VYH B;  2RNA A;  3VS2 A;  2CP6 A;  2DEQ A;  1QCF A;  2RHX A;  4M78 B;  2G3R A;  1I07 A;  2HKQ B;  3JCM Q;  3J7A F;  1N8R U;  5GMK e;  4FYX B;  4JRK A;  4E7S A;  4E2F B;  2DMO A;  2EJF A;  4F14 A;  4GLK A;  1LPL A;  2CZ0 B;  2VGM A;  1NJI R;  2PUO B;  1WQW A;  2D0N A;  3CCS T;  3I35 A;  3OYJ A;  2DVE A;  1VQ4 A;  2H3J A;  4C0G A;  3MEV A;  3L2W A;  2GQI A;  4OB1 B;  4C92 B;  2XIC A;  1VQ6 T;  1ABO A;  2ZCF B;  2X4Y A;  4FM4 B;  1JRI A;  2KK4 A;  2KMT A;  1W2B A;  2KY9 A;  4HCZ A;  1HXD A;  5GAM g;  2F2W A;  2EGE A;  2F2X A;  3SDZ A;  3MJX A;  1G2B A;  4JRP A;  4EMH A;  4WTO B;  4FIB A;  1YI2 Q;  4M75 G;  4DQ2 A;  2CT4 A;  4M7D E;  3V8L A;  1VQN A;  3JCM h;  1HJD A;  1D0Y A;  3EH2 A;  2HEQ A;  1GBQ A;  3JCM V;  2LP5 A;  4C92 F;  2A3L A;  3A8H B;  4KUL A;  1UEC A;  1AWW A;  1PNJ A;  1D0Z A;  5GMK l;  3HKS A;  2D9T A;  1K0S A;  2MWO A;  1KD1 R;  3QBY A;  2DPP B;  3CCU T;  2KRO A;  1KC8 R;  1BKB A;  3PIO A;  4NL2 A;  1AVZ C;  1VQL Q;  4V2S A;  2OTJ Q;  4PJJ A;  2QAS A;  2LX9 A;  2VAS A;  3OB9 A;  1VQ9 T;  2CUB A;  2LX7 A;  2RHI A;  1I5O B;  4DEY A;  2K5I A;  1MHN A;  1RAF B;  1PKS A;  1IB8 A;  4GY5 A;  2EQJ A;  3ME9 A;  5HY6 A;  1QVF P;  2RQT A;  5GJW B;  3S6W A;  4IUQ A;  1WDX A;  1NJI U;  1EIF A;  3FJP A;  3VS6 A;  1VQ4 T;  3ZL7 C;  2E41 A;  2KBT A;  1N27 A;  5CKH A;  3VS3 A;  4FYW B;  2LNV A;  2QGF B;  1H3H A;  2NLU A;  3JCM b;  2NWM A;  1W2B S;  1C6V X;  1SKU B;  2DJZ A;  3VS7 A;  4F7U E;  5KYN A;  3GBQ A;  2H8H A;  2YUQ A;  3LX7 A;  2DLP A;  3CPF A;  3OSV A;  1OX9 A;  4IIM A;  3CCQ T;  2K79 A;  5GAN 5;  2KXD A;  1VQ8 T;  1UGQ B;  1V29 B;  1Q7Y U;  2LMJ A;  2BE9 B;  4RTU A;  3O5Z A;  2V1Q A;  2BZY A;  3CCR T;  2DAQ A;  1SHG A;  5LL6 S;  3EG9 A;  2JVV A;  3QKJ A;  4UC4 A;  2YLB A;  3HFO A;  2EQM A;  1V1C A;  3CME T;  3NHN A;  4MML A;  3TVT A;  1X69 A;  4M7A D;  4MDX A;  2GBQ A;  4LDY A;  3QYH B;  3QO3 A;  1I5L A;  1H64 1;  2JUF A;  4AFS C;  5I11 A;  3A1P A;  2DZC A;  4C0D B;  2P0P A;  3L1A A;  1PWT A;  2DRK A;  3QXE B;  1VYT A;  1N9R A;  2L3R A;  9ATC B;  3P8D A;  4F04 B;  1WNL A;  3X24 B;  3LWI A;  2DZ9 A;  2K5L A;  2HNI A;  5FU7 C;  3M4G A;  1M30 A;  4C0Z A;  1T0J A;  4PJO D;  3VRZ A;  1YIT T;  4BDY A;  5KCO A;  3FEO A;  2Y4Y A;  1WJQ A;  2DM1 A;  2HKN A;  2RMO A;  3QHS A;  2L3P A;  2M51 A;  2E5K A;  1TOV A;  3CC7 T;  2GNC A;  4WCI A;  2E70 A;  1OEB A;  4XU0 A;  4OF1 A;  4BI4 A;  2RJD A;  3OMG A;  4M75 D;  1BB9 A;  3TSZ A;  1WHJ A;  3V7R A;  2W10 A;  5GAN h;  2HSP A;  1Q82 C;  2KDS A;  4J9G A;  4KGX B;  3FIF A;  4J7F A;  2P4R A;  1MV3 A;  2GFU A;  2LQW A;  1ZBX A;  3EFR A;  2C0I A;  3IQL A;  5GAM e;  2DER A;  1WGS A;  1FWZ A;  2I2L A;  3A8L B;  2JMA A;  1MNE A;  3RMS A;  1M2V B;  3HTR A;  4D8D A;  3OBW A;  2YWW A;  3M58 A;  1M90 U;  4A63 B;  1W2B P;  3T9N A;  1M9S A;  1BIB A;  1U06 A;  5CAI A;  2DYB A;  2VVK A;  2PUK B;  4F7U G;  2RB6 A;  5DLO A;  5LJ5 j;  3G6E A;  1ZX6 A;  1N8R C;  1GXI E;  5GAO p;  2RPN A;  3CCM Q;  2E1H A;  2ZPE B;  2E65 A;  3L2V A;  4E6R A;  3EFS A;  3F70 A;  1OPK A;  3FJ5 A;  1VQN T;  3JB9 H;  4RG2 A;  4NOY A;  2DXB A;  2ZPB B;  2OAU A;  2NUT A;  1E6H A;  2DBM A;  1VQO A;  4RMO A;  4J9I A;  2DIL A;  1KHI A;  4J9H A;  2EYW A;  3CCU A;  3M55 A;  4PLL A;  5CIU A;  2IG0 A;  4IUU A;  4XU3 A;  2OAW A;  3M56 A;  4J83 A;  3A8O B;  2XD0 A;  3BW1 A;  4MMK A;  2A37 A;  2MIO A;  1OOT A;  1VQN Q;  1K9A A;  2ESW A;  2LQK A;  1ZLM A;  2KEA A;  5CR2 A;  2GCX A;  2D1X A;  1B07 A;  2CT3 A;  3H0H A;  1UHF A;  1GRI A;  4KH0 B;  3DKM A;  3Q1J A;  1VQO T;  5KYX A;  1YJN Q;  3MEA A;  3NTK A;  1QVG S;  1OZ3 A;  1VQL T;  3QWX X;  5J26 A;  2G6F X;  3CCL A;  2K4Y A;  5CQY A;  4DBR A;  1UGR B;  3N5B B;  5GJV B;  1UGS B;  2XHC A;  5FRM A;  4C92 G;  1FX7 A;  2LT1 A;  2J06 A;  3H41 A;  2K7A A;  3JCM X;  4PJO B;  1OV3 A;  3HRT A;  4C8Q E;  2LCC A;  1WZO A;  2ZGW A;  3LGF A;  5D6W A;  5A0G A;  1I1J A;  4JUV A;  3MET A;  3EAE A;  3FB9 A;  2MOX A;  2K3Y A;  2KSS A;  2EYY A;  3EHQ A;  3VJP A;  1M3A A;  3CME Q;  1SSF A;  2YDL A;  1PRM C;  2KRN A;  2LRQ A;  2JM9 A;  1VUB A;  2O88 A;  3BDL A;  1IHV A;  1N5Z A;  1S1N A;  3GOX A;  4OB0 B;  3KFV A;  4ZTJ A;  1BI2 A;  3E19 A;  2EKO A;  1HYO A;  4M7A A;  3A98 A;  3G6E Q;  4GBQ A;  4J9D A;  4M75 C;  1MMA A;  2NUZ A;  2E10 A;  3X20 B;  4BI8 B;  3QJY A;  2ROL A;  4E7K A;  2LVM A;  3X26 B;  1NM7 A;  4F7U F;  3CCQ A;  4M78 C;  3D7S B;  2SRC A;  4ZGD B;  2ABL A;  4NL3 A;  1VQ9 A;  3NGP A;  2FB7 A;  1W6X A;  3GLX A;  4JJB A;  1AWX A;  1U1T A;  2H3E B;  2K5F A;  1IGU A;  3OYE A;  2J6O A;  1AT1 B;  8ATC B;  1QVF A;  1OX8 A;  3TCJ A;  2M1H A;  5LJ3 d;  3CCS Q;  1RAI B;  4Z8A A;  3I56 T;  3CC2 A;  2F5K A;  2DIQ A;  2L8D A;  4M75 B;  3CEY A;  4KH1 B;  2J05 A;  2YRD A;  2PNI A;  2CZ6 B;  4RKU E;  5GMK m;  1VQP Q;  1UDL A;  5GAN e;  1Y07 A;  2EJ9 A;  5IHK A;  2RHU A;  4C5G A;  3G1J A;  2CZ1 B;  2Y90 A;  4PFZ A;  1E6G A;  4B9X A;  3BY7 A;  4IUP A;  1ZSG A;  2YLC A;  3S3N A;  1YIT A;  1VQK T;  4J9C A;  2IPO B;  4JPB W;  1K8A U;  3I55 T;  4IKF A;  5FWC A;  4N0A C;  2MK5 A;  2ZPH B;  1AZG B;  2RJF A;  1D1B A;  2PTK A;  2MWP A;  1YNZ A;  2P0Q A;  2AIR B;  1CKB A;  3SWN B;  4WF2 A;  4FYV B;  3HSB A;  1M2V A;  2QK0 A;  5IT9 E;  3VUB A;  1K0X A;  3TQ7 P;  3CD6 Q;  1W70 A;  1HD3 A;  3RDV A;  4QVZ A;  2F69 A;  2P84 A;  2ATC B;  3I56 A;  3CMA A;  4XTV A;  4EMG A;  2V8K A;  1VYV A;  3EHR A;  4QT7 A;  1IRX A;  2BIV A;  2HQX A;  3RKX A;  5GAO m;  1YJW A;  3SWN C;  3SB2 A;  4XTZ A;  5LJ3 j;  3SHW A;  4FU6 A;  1JJ2 A;  2PZ1 A;  1I81 A;  5CVI A;  3H8Z A;  3UA6 A;  1EZZ B;  1WHM A;  3RMQ A;  2DFU A;  5GAN 6;  1D1C A;  2L3S A;  2CP2 A;  1R8O B;  1QLY A;  3EGX A;  3CCM A;  2CDT A;  2WSF E;  1KQS A;  1Q86 C;  4Y92 A;  3C0C A;  2QI2 A;  3G7Z A;  1M3C A;  1TU0 B;  4XTW A;  2K9G A;  4K11 A;  2KT1 A;  1WXU A;  3LWH A;  3J81 E;  1M1F A;  3C4S A;  3OYK A;  1HK9 A;  3QII A;  4KUD K;  4LE9 A;  4YTL A;  2IIM A;  4C0D C;  3UPU A;  1X2Q A;  4M75 F;  3UAT A;  2FZC B;  4M78 D;  1KJW A;  1D3B A;  1SSH A;  5FLX E;  4IIO A;  4EMK C;  3CCV A;  2ENM A;  2KQW A;  3TRE A;  4C92 D;  3PMI A;  1LVK A;  2QQR A;  2O31 A;  4LDW A;  1IRE B;  2E4H A;  2CGH A;  1NEB A;  4HVU A;  4M7A E;  3LH5 A;  3EFO A;  1WJS A;  2FZG B;  4ZN3 A;  2QEX A;  2QDL A;  1UE9 A;  4A4H A;  4FSX A;  5GMK j;  4E7L A;  3UWN A;  1VIF A;  3VKI A;  1YIJ T;  2QTV A;  6AT1 B;  1S72 T;  2L3Q A;  4R0K A;  1F1B B;  3CCE T;  5GMK h;  4BE2 A;  1XJW B;  2DXC A;  4ELY C;  4OVA A;  5A2Q E;  1M2O A;  2FPE A;  4C5E A;  1SEM A;  1KQS P;  4JLG A;  3ZEH A;  3OY9 A;  3I55 A;  1ACM B;  1KQS S;  2I0N A;  2HSE B;  3BDU A;  1RAC B;  1VQK Q;  1OU8 A;  4ESR A;  3RBB B;  1R0C B;  4B9W A;  3M54 A;  2LZ6 B;  2DET A;  5GAN g;  3I5R A;  2ZPF B;  2EBP A;  3OYN A;  1NPP A;  3FDR A;  4MZM A;  2CP0 A;  4VUB A;  2EWN A;  4QQG A;  4FW2 A;  4RTX A;  1JXM A;  1ARK A;  5GAO n;  1VQ4 Q;  1U5S A;  2VUB A;  4L5G A;  4FL6 A;  4KRT A;  4AFU C;  2QGG A;  1UEB A;  2BZX A;  4JZ4 A;  2MCN A;  3GPL A;  2RQU A;  1NYG A;  4C92 A;  3CMA T;  1QWF A;  4FSS A;  3CBM A;  4QQ6 A;  3CCM T;  2M02 A;  4FCY A;  2RK2 A;  1NYF A;  4EMK A;  5D6X A;  1KIK A;  1GCP A;  1QVG A;  1VQ8 Q;  2V1R A;  5A0L A;  2YSQ A;  3CC7 A;  4LUD A;  1W1F A;  2YUP A;  2FRY A;  1PM3 A;  2DL8 A;  2SEM A;  4PJO G;  2BE7 D;  2OTJ A;  4A4E A;  1PCX A;  4J9E A;  2O4X B;  3REB B;  1YHQ Q;  1Y96 A;  4N4I A;  2PVG B;  4OMM A;  3CXC S;  1PG5 B;  1BYM A;  3ZBD A;  2V8I A;  3MO8 A;  4M77 G;  1VIE A;  2HDA A;  4HVV A;  2EFI A;  2W0Z A;  2OJ2 A;  3HRU A;  1V76 A;  2LJ1 A;  2L89 A;  1KC8 C;  4HT9 A;  5FU6 C;  2JN0 A;  1Q95 G;  3JCM f;  4XAX B;  3M0U A;  2DK3 A;  1WFW A;  2DRM A;  1JB0 E;  1TUC A;  2DD5 A;  3HPW A;  4J5Y A;  4LD9 K;  2VXF A;  3MKD A;  3RER A;  1QCN A;  4O5V A;  3JSC A;  3OYF A;  3G6E T;  1ZUY A;  5IHN A;  5KYX B;  4Y28 E;  2EYQ A;  2RO0 A;  3LYI A;  1AZE A;  4DBF A;  3EFO B;  3E9G A;  2YHT A;  3CCJ Q;  2HAX A;  2QQS A;  2FZK B;  1MUZ A;  4C92 C;  2DNU A;  2JTF A;  3NTH A;  2RI5 A;  1VQM Q;  2RN8 A;  4KUI A;  2CUD A;  3M0S A;  2M0O A;  2CP7 A;  3L2R A;  4BY6 B;  3SFM A;  2MPX C;  3JB9 D;  2C0T A;  4O6J A;  1GFC A;  2AK5 A;  2EQU A;  4II1 A;  1K8A R;  4M77 A;  1QVP A;  5GAN 7;  1QVF S;  2VGN A;  2XK0 A;  1Q82 R;  4C8Q D;  3OYB A;  2K2M A;  1U1S A;  5I22 A;  1GL5 A;  3OS2 A;  3CCJ T;  1RI9 A;  3LH0 A;  3OS0 A;  1S72 Q;  2AT1 B;  4J8O A;  4A53 A;  2QA4 A;  4M78 F;  2AZS A;  4EDU A;  3JCM e;  1VQ8 A;  2ED1 A;  1Q7Y R;  1I8F A;  3OBY A;  3H9N A;  4LUE A;  1EX4 A;  3VRY A;  2FL7 A;  1YP5 A;  1C0M A;  3A8M B;  1XQH A;  2KE9 A;  1K73 U;  3URG A;  1Z9Z A;  4JZ3 A;  3S3M A;  3GNF B;  2BTT A;  2GTJ A;  2XDP A;  2J7I A;  5GAM h;  4BE0 A;  3OYY A;  1IO6 A;  1N6A A;  2YUN A;  3MPU B;  3EGU A;  2O9V A;  2GTO A;  5GAN 3;  3PT9 A;  3EG0 A;  2DJQ A;  1WLP B;  2A36 A;  5D6Y A;  2EIF A;  1IGQ A;  2RH2 A;  4M77 E;  2JOY A;  3OS5 A;  4IUR A;  1FXX A;  1ZUK A;  1RAB B;  2COW A;  1AWJ A;  3OQ5 A;  3M57 A;  3CD6 T;  2X35 A;  2E3I A;  3MP8 A;  1LJO A;  4HCB A;  5I2M A;  2JT4 A;  3H0F A;  4XTU A;  3PTA A;  2HQH A;  5C6S A;  4ZTF A;  1LOJ A;  1OI1 A;  1KD1 C;  4EMK B;  1T0H A;  4QQD A;  3EGX B;  1BI0 A;  4LDX A;  4BB7 A;  2L0A A;  4ZN1 A;  2DE0 X;  1QQJ A;  1C1A A;  4KT0 E;  1ZSZ B;  5KYU B;  3CCJ A;  1R0B G;  1JJ2 S;  2O2O A;  1VQM A;  1RL2 A;  2CH4 A;  4C5H A;  1OUL A;  4MZT A;  2IVW A;  1W4S A;  1ZA1 B;  3CC7 Q;  3MCA B;  3O8V A;  5LJ3 e;  1B7T A;  4JRI A;  4AFZ C;  3SWN A;  2QQB A;  2QQ9 A;  1UUE A;  2K6D A;  4HCK A;  8AT1 B;  3CQT A;  5M9O A;  3M0P A;  4M7D A;  5FU7 B;  2EW3 A;  2GFA A;  4Z88 A;  5L8R E;  2E64 A;  2XI9 A;  3VS5 A;  2RM4 A;  3CC4 A;  1FMV A;  3I5S A;  2XDB A;  1TUG B;  4BUG A;  1DJ7 B;  2KRM A;  2E6Z A;  4PKC C;  1P92 A;  2CKK A;  1BCO A;  5CK9 A;  3JCM P;  5EC7 A;  1GCQ A;  3JB9 J;  1WPY A;  1NG2 A;  1RAH B;  4X1V A;  4PL6 A;  1HSQ A;  1VQK A;  3G71 Q;  4JLI A;  5GAM j;  1MND A;  5CCA A;  2COZ A;  3QSU A;  5J3B A;  1Q81 U;  4C8Q C;  1X27 A;  5KYY A;  1JU5 C;  2AZV A;  4JDS A;  4Q5W A;  1YBY A;  2HMA A;  3LLR A;  2EQK A;  3CC4 Q;  3CCE A;  2AKK A;  1OZ2 A;  2E6N A;  3I9Q A;  3HL8 A;  1M1K C;  1NPR A;  3QZ9 B;  2X4X A;  1X6G A;  3I56 Q;  1UGV A;  1G83 A;  2J6F A;  2XU8 A;  2RQV A;  2FVU A;  1BCM A;  1Y7X A;  5LJ3 h;  3JCM d;  2RA2 A;  1YJ9 A;  1X6B A;  4JS4 A;  3FRN A;  3H6Z A;  4M77 C;  1BI3 A;  3WVE B;  3CXC P;  3JCM g;  3R6O A;  3OW2 S;  1SRL A;  4PK4 A;  2YT6 A;  3VV0 A;  1Y57 A;  1YI2 T;  2NUT B;  3OYI A;  3EG1 A;  1R77 A;  4HVW A;  1E7O A;  5FU6 B;  1WHL A;  1M90 C;  2LNH B;  4HT8 A;  3HP9 A;  2MAM A;  4RCC A;  4LN2 A;  1TG0 A;  1WIE A;  2QG9 B;  4C8Q G;  1WXB A;  4M7A B;  1G3T A;  2RQR A;  1NLO C;  2DX1 A;  3P8B B; 
#chains in the Genus database with same CATH homology
 3CCS A;  3QKJ A;  4M7D F;  4UC4 A;  1ZHI A;  2R5M A;  1WJS A;  2YLB A;  2EQM A;  3HFO A;  3V8J A;  3VUZ A;  3CME T;  1VQ6 A;  1YCY A;  4ZN3 A;  4MML A;  3X25 B;  5HKC A;  5GMK i;  2QEX A;  4E7J A;  1Q86 U;  3AHU A;  4A4H A;  4FSX A;  5GMK j;  1NJI C;  4M7A D;  4MDX A;  4E7L A;  3UWN A;  1I4K 1;  4LDY A;  1TH7 A;  1VIF A;  3QYH B;  3QO3 A;  5GAO l;  4BY6 C;  1I5L A;  3HRS A;  3VKI A;  1H64 1;  2JUF A;  5FRO A;  2OTL A;  2DZC A;  4C0D B;  1YIJ T;  2P0P A;  1ZQ1 A;  2LQ8 A;  3BFM A;  3L1A A;  1S72 T;  4M7D C;  3QXE B;  3CCE T;  2FYK A;  2VXE A;  4Z02 A;  5GMK h;  1N9R A;  4BE2 A;  2L3R A;  2HQE A;  1KHC A;  2MF2 A;  2DXC A;  4ELY C;  3CXC A;  3P8D A;  4OVA A;  5A2Q E;  3OYL A;  4C5E A;  1VQM T;  1WNL A;  3QUI A;  3CCV T;  2RHZ A;  4JLG A;  3ZEH A;  3X24 B;  3OY9 A;  3LWI A;  3I55 A;  2DZ9 A;  2K5L A;  2HNI A;  5FU7 C;  3JRZ A;  3M4G A;  3M4Y A;  4C0Z A;  1KQS S;  4X9C A;  3A5Z B;  2HBP A;  2DTO A;  5GAN f;  4PJO D;  2JZ2 A;  1YIT T;  3GF5 A;  2XG8 D;  2R58 A;  2PQW A;  3BDU A;  5KCO A;  4BDY A;  3FEO A;  3OYH A;  2Y4Y A;  3DLL A;  1WJQ A;  4C8Q A;  5GAN j;  1G3W A;  3QHS A;  4B9W A;  3M54 A;  3X28 B;  3P8H A;  5GAN g;  5GAO r;  2ZPF B;  4DOW A;  3PIP A;  4E7I A;  3CC7 T;  3E1S A;  3LW5 E;  3OYN A;  1NPP A;  4OB3 B;  2E70 A;  4ME7 A;  1X75 C;  3ASK A;  3FDR A;  1Y71 A;  4MZM A;  4VUB A;  4XU0 A;  4A4K A;  2KVQ G;  3RKW A;  4OF1 A;  2EWN A;  4BI4 A;  2OTJ T;  5LJ5 f;  3GNG A;  2RJD A;  3OMG A;  1O75 A;  4QQG A;  2V8J A;  4M75 D;  3CC2 T;  5LJ3 g;  5GAO n;  1KG1 A;  2KAF A;  3PMT A;  4M7D B;  2VUB A;  4J6W A;  1BIA A;  4L5G A;  4FL6 A;  2XID A;  3RES A;  4PLI A;  5GAN 8;  1BI1 A;  1PSE A;  3V7S A;  4C8Q F;  1UEB A;  5DY9 A;  3V7R A;  3GPL A;  2BUD A;  5GAN h;  3GP8 A;  1Q81 C;  1QW1 A;  4C92 A;  3G4S A;  2PU9 B;  3CMA T;  1Q82 C;  2KDS A;  1VQ5 T;  5KH6 A;  3FIF A;  3CME A;  2DTI A;  4J7F A;  4JJN K;  3CBM A;  4QQ6 A;  3CCM T;  3OYA A;  2GFU A;  3CD6 A;  2JTM A;  2RK2 A;  2DKG A;  1ZBX A;  3EFR A;  4EMK A;  5D6X A;  3JB9 I;  2X4J A;  3OA6 A;  5GAM e;  3JB9 F;  1WGS A;  1FWZ A;  2I2L A;  2MMP A;  1U8R A;  1JBM A;  1QVG A;  3A8L B;  4N4H A;  3JCM c;  3RMS A;  2E5Q A;  4FT4 A;  5A0L A;  4PJO A;  3OBW A;  3MEU A;  4N0A A;  4LDV A;  3M58 A;  3CC7 A;  3DLM A;  1M90 U;  1G3S A;  3ER0 A;  3OMC A;  4OGC A;  1K73 C;  2ZZD A;  2VYT A;  4PJO G;  3T9N A;  2LC4 A;  2R57 A;  1M9S A;  1X6O A;  4A4E A;  1BIB A;  3MEW A;  2OTJ A;  5CAI A;  2O4X B;  4M75 E;  2PUK B;  1YJN T;  4F7U G;  2RB6 A;  3CBO A;  5DLO A;  5LJ5 j;  1Y96 A;  3G6E A;  4N4I A;  1N8R C;  4NS5 A;  1GXI E;  3OS1 A;  5GAO p;  2PVG B;  3CBP A;  4C5I A;  4F7U B;  5DM7 R;  3CXC S;  1Q7Y C;  1LNX A;  3RIR A;  2E1H A;  2ZPE B;  2E65 A;  4BAC A;  5CQX A;  4ATO A;  3L2V A;  4BDZ A;  1BYM A;  3ZBD A;  2V8I A;  3MO8 A;  3OSS C;  3EFS A;  3F70 A;  4M77 G;  1VIE A;  1VQN T;  4OB2 B;  4LDU A;  3INZ A;  3JB9 H;  3PNW C;  4RG2 A;  5CKE A;  2EFI A;  2LCL A;  2DXB A;  2ZPB B;  4NOY A;  4A54 A;  3L42 A;  2OAU A;  3HRU A;  4J6Y A;  3JAM E;  3MHX A;  1KC8 C;  2L89 A;  4M7A F;  2PVO B;  4PJO F;  1VQO A;  1YJ9 T;  2BKD N;  4HT9 A;  4RMO A;  5FU6 C;  2JN0 A;  4TVR A;  3JCM f;  4M77 D;  4XAX B;  1D3B B;  1KHI A;  3C12 A;  2DK3 A;  3ZFJ A;  2RJC A;  2K3X A;  5LJ5 h;  1JB0 E;  3CCU A;  1M4Z A;  3M55 A;  4PLL A;  5CIU A;  2DD5 A;  3HPW A;  4MDW A;  4RG8 A;  1VQ7 T;  4J5Y A;  3RKY A;  4LD9 K;  4C92 E;  4A4G A;  4E7H A;  2IG0 A;  4IUU A;  3OYC A;  4X34 A;  2F5T X;  2VXF A;  4OP0 A;  5DLQ E;  4O5V A;  4XU3 A;  2XDD A;  2RHY A;  3JSC A;  3OYF A;  3RER A;  3M5A A;  3M56 A;  4J83 A;  3A8O B;  4XU2 A;  3G6E T;  1KD1 U;  2XD0 A;  3BW1 A;  4MMK A;  2C06 A;  4X9D A;  4Y28 E;  5GAO q;  2EYQ A;  2WSE E;  5KE3 A;  2RO0 A;  5LJ5 d;  4R56 A;  1UGP B;  2DTH A;  1NZ9 A;  3LYI A;  2EAY A;  3NTI A;  2YRV A;  3C94 A;  3E9G A;  2YHT A;  5GAM f;  1M1G A;  2ZPI B;  2LQK A;  1NE8 A;  2QQS A;  2HAX A;  4C92 C;  5CR2 A;  3NTH A;  1M5Q 1;  2JTF A;  2GCX A;  2RI5 A;  4ZGE B;  5LJ5 g;  5C0M A;  4MZP A;  1O9S A;  4P5N A;  4KUI A;  1QP2 A;  4OGE A;  1VQL A;  3RUX A;  2M0O A;  3DKM A;  3L2R A;  4BY6 B;  2RI2 A;  3Q1J A;  3SFM A;  3JB9 D;  1VQO T;  4M7D E;  3MEA A;  2PVD B;  3NTK A;  1QVG S;  1OZ3 A;  3S3O A;  3QDR B;  4O6J A;  4R55 A;  5CKD A;  3OYG A;  1VQL T;  2EQU A;  4II1 A;  4XU1 A;  1H3Z A;  4D6W A;  4QVD A;  5J26 A;  4M77 A;  3CCL A;  1QVP A;  5GAN 7;  2K4Y A;  5CQY A;  3E9F A;  4JS5 A;  4ELZ C;  1UGR B;  3N5B B;  1QVF S;  2XK0 A;  2VGN A;  2VV5 A;  1UGS B;  2XHC A;  5FRM A;  4C8Q D;  4C92 G;  3OYB A;  1FX7 A;  2QA4 T;  1U1S A;  5A0D A;  1XOV A;  2LT1 A;  2CS7 A;  3OS2 A;  3JCM X;  4M78 E;  4PJO B;  3CCJ T;  3LH0 A;  1S72 A;  4DA4 A;  3OS0 A;  3NFC A;  2GQV A;  2OTL T;  4A53 A;  4J8O A;  2QA4 A;  3HRT A;  4M78 F;  1YJN A;  4C8Q E;  4EDU A;  2QTX A;  3JCM e;  1VQ8 A;  2LCC A;  3UT1 A;  4DOV A;  1I8F A;  2ZGW A;  3C95 A;  3LGF A;  3OBY A;  4IUV A;  3MP1 A;  5D6W A;  3OYM A;  3L2Q A;  4C8Q B;  5KCH A;  5A0G A;  4M7D G;  3HHT B;  4JUV A;  5I2S A;  2E12 A;  4BI3 A;  2FL7 A;  2LDM A;  2WSC E;  3MET A;  3QZ5 B;  2EJG A;  3EAE A;  3FB9 A;  1X01 A;  3A8M B;  2K3Y A;  2R5A A;  4N4G A;  1XQH A;  5AYF A;  2KSS A;  4F7U A;  5J39 A;  3TU4 K;  1VQP T;  1K73 U;  3URG A;  3VJP A;  3HFN A;  1SSF A;  1VQP A;  5GAN 2;  2LRQ A;  3S3M A;  1B34 B;  1VUB A;  2M16 A;  2QQA A;  3GNF B;  4HA8 A;  1VQ5 A;  3CCR A;  2XDP A;  3BDL A;  4L59 A;  5GAM h;  4BE0 A;  3OYY A;  4HKE A;  4FT2 A;  3GOX A;  4BD3 A;  4OB0 B;  4ZTJ A;  1N6A A;  1BI2 A;  5IN1 A;  3E19 A;  2QEX T;  2EKO A;  3M59 A;  3CC4 T;  3PFS A;  4M7A A;  4E47 A;  1K9M C;  4M75 C;  5GAN 3;  3V7C A;  3PT9 A;  2E10 A;  2RI3 A;  2MI6 A;  3X20 B;  4BI8 B;  3QJ6 A;  2B8A A;  2FHD A;  3QJY A;  4M77 B;  1UB4 A;  2JNG A;  4CRI A;  4JRQ A;  3JB9 G;  2K57 A;  1WQ7 A;  5D6Y A;  2EIF A;  4E7K A;  2LVM A;  3X26 B;  4Y91 A;  4F7U F;  5LJ3 f;  2RH2 A;  4LD6 A;  1YHQ A;  4M77 E;  3CCQ A;  2JOY A;  3OS5 A;  4IUR A;  4M78 C;  4ZGD B;  4NL3 A;  1FXX A;  3V8K A;  2O4X A;  3WVD B;  1YHQ T;  1M8V A;  3DB4 A;  1VQ9 A;  1N9S A;  1Y96 B;  2P4T A;  2FB7 A;  3GLX A;  3M9Q A;  3OQ5 A;  3QPH A;  3SD4 A;  1OYX A;  3M57 A;  3CD6 T;  2X35 A;  4M78 A;  1U1T A;  3A8G B;  1LJO A;  2K5F A;  3MP8 A;  5CKF A;  4J6X A;  3KXT A;  1YI2 A;  3OYE A;  4HCB A;  2CYZ B;  2QDY B;  5I2M A;  1M1K U;  3QYG B;  4XTU A;  4ZGJ B;  5HK0 A;  3PTA A;  1KQ1 A;  3PGG A;  5C6S A;  1XTD A;  4ZTF A;  1LOJ A;  1QVF A;  1QP3 A;  2HD0 A;  3VU3 C;  1OI1 A;  1KD1 C;  3TCJ A;  4EMK B;  1RI0 A;  4QW2 A;  2M1H A;  5HK3 A;  2CZ7 B;  5LJ3 d;  4QQD A;  1BI0 A;  3CPW S;  4LDX A;  4BB7 A;  4M7A C;  2LT4 A;  4L6V 5;  4XTX A;  2F5K A;  4A4F A;  4ZN1 A;  3I56 T;  1IZ6 A;  2DIQ A;  1KC8 U;  1K9M U;  3CC2 A;  2L8D A;  1AHJ B;  4KT0 E;  4M75 B;  3CEY A;  5GAN d;  3CCJ A;  4XQ3 A;  2RD1 A;  2CZ6 B;  4RKU E;  5GMK m;  4M7D D;  3VYH B;  1JJ2 S;  2AHJ B;  1VQM A;  1RL2 A;  2QXF A;  2DEQ A;  3M53 A;  4C5H A;  5GAN e;  2RHX A;  4M78 B;  2G3R A;  2L5Q A;  4MZT A;  1Y07 A;  2EJ9 A;  2IVW A;  1W4S A;  3JCM Q;  1N8R U;  4HCC A;  5GMK e;  3J7A F;  2RHU A;  4C5G A;  4JRK A;  2CZ1 B;  2EJF A;  2Y90 A;  4J7I A;  4KBM B;  4GLK A;  2CZ0 B;  4B9X A;  3BY7 A;  3MCA B;  4IUP A;  2YLC A;  4EPC A;  3UDC A;  3S3N A;  2VGM A;  3O8V A;  5LJ3 e;  5I21 A;  2PUO B;  4JRI A;  4CI0 C;  1WQW A;  1YIT A;  3SWN A;  3FLG A;  3CCS T;  2QQB A;  3OYJ A;  1VQK T;  2A7Y A;  2DVE A;  2QQ9 A;  2D6F A;  2LTO A;  1VQ4 A;  2H3J A;  4C0G A;  3MEV A;  1K8A U;  5M9O A;  3I55 T;  4IKF A;  3L2W A;  4N0A C;  2ZPH B;  4OB1 B;  4C92 B;  2XIC A;  3OW2 A;  5EG2 A;  1VQ6 T;  4XTY A;  2RJF A;  3L2U A;  4M7D A;  2ZCF B;  5FU7 B;  5KE2 A;  2GFA A;  2MWP A;  3MP6 A;  5L8R E;  2X4Y A;  2VC8 A;  4M78 G;  3JCM J;  2E64 A;  2XI9 A;  1JRI A;  2KK4 A;  2KMT A;  2P0Q A;  4FM4 B;  5CO7 A;  3SWN B;  4WF2 A;  2RM4 A;  1W2B A;  2KY9 A;  4HCZ A;  5IAY A;  1HXD A;  3CC4 A;  4PJO E;  5GAM g;  2XDB A;  3HSB A;  5IT9 E;  2P0K A;  3SDZ A;  1DJ7 B;  4BUG A;  4JRP A;  4EMH A;  2K2V A;  4FIB A;  4M75 G;  2E6Z A;  2DXT A;  4PKC C;  1P92 A;  1B34 A;  2CKK A;  3V8L A;  4DQ2 A;  3JCM h;  5CK9 A;  3FC3 A;  3JCM P;  1XNI A;  1VQN A;  3VUB A;  3LGL A;  5GAM d;  3G4S T;  2Y4X A;  3JB9 J;  2D0Q B;  4M75 A;  3JCM V;  1WPY A;  4C92 F;  2A3L A;  3A8H B;  4KUL A;  3WXM B;  3G71 A;  4PL6 A;  4QVZ A;  2F69 A;  1VQK A;  1KQ2 A;  4PJO C;  3GIB A;  4JLI A;  5GAM j;  5CCA A;  3I56 A;  2DD4 A;  5GMK l;  3HKS A;  3CMA A;  3QSU A;  5J3B A;  4XTV A;  1Q81 U;  4EMG A;  2D9T A;  2V8K A;  5FRN A;  3KBG A;  2MWO A;  4C8Q C;  3CPW A;  4OMF B;  2BIV A;  2HQX A;  4C0F A;  3RKX A;  2DO3 A;  2DPP B;  3QBY A;  4JDS A;  5GAO m;  3CCU T;  1YJW A;  4Q5W A;  2GF7 A;  3J80 E;  1YBY A;  3LLR A;  3CCE A;  2EQK A;  1G5V A;  1BKB A;  1YIJ A;  3PIO A;  3SWN C;  3SB2 A;  1OZ2 A;  2E6N A;  2M9U A;  2RJE A;  4NL2 A;  4XTZ A;  4PNO A;  5LJ3 j;  4FU6 A;  4BE1 A;  3HL8 A;  1JJ2 A;  4V2S A;  1I81 A;  1M1K C;  2LX9 A;  3OB9 A;  1VQ9 T;  1NPR A;  3QZ9 B;  2DXU A;  5CVI A;  2RHI A;  3H8Z A;  3TEE A;  2X4X A;  2XU8 A;  3RMQ A;  5GAN 6;  2K5I A;  1MHN A;  2FVU A;  4QVC A;  1Y7X A;  5LJ3 h;  1R8O B;  2EQJ A;  3ME9 A;  4GY5 A;  5HY6 A;  3CCM A;  4M7A G;  3JCM d;  3G71 T;  2RA2 A;  1YJ9 A;  2WSF E;  4RCB A;  3S6W A;  4IUQ A;  1KQS A;  4JS4 A;  1Q86 C;  3FRN A;  3H6Z A;  1NJI U;  1EIF A;  3FJP A;  3L2Z A;  4M77 C;  2QI2 A;  5CKB A;  1BI3 A;  3WVE B;  2O01 E;  3G7Z A;  3JCM W;  4XK8 E;  4XTW A;  1VQ7 A;  2ZPG B;  1VQ4 T;  1Q82 U;  3JCM g;  3R6O A;  3OW2 S;  2RK1 A;  2E41 A;  1PSF A;  3LWH A;  1N27 A;  1G3Y A;  3QG1 A;  5LJ5 e;  5CKH A;  3VV0 A;  3CCL T;  1YI2 T;  3J81 E;  1M1F A;  3C4S A;  2LNV A;  3VYG A;  3OYI A;  2NLU A;  3OYK A;  1HK9 A;  3QII A;  3JCM b;  4KUD K;  3OYD A;  1W2B S;  4YTL A;  5FU6 B;  1WJR A;  4C0D C;  4IUT A;  3UPU A;  4M75 F;  4F7U E;  2DJZ A;  2XKO C;  1M90 C;  4M77 F;  4HT8 A;  3LX7 A;  3OSV A;  3CPF A;  4M78 D;  3KUF A;  3HP9 A;  3CCQ T;  1K8A C;  5GAN 5;  1YJW T;  1D3B A;  2MAM A;  4RCC A;  5FLX E;  4EMK C;  3CCV A;  1VQ8 T;  2KQW A;  1UGQ B;  1V29 B;  3TRE A;  1MGQ A;  3PMI A;  4C92 D;  4C8Q G;  1Q7Y U;  1G3T A;  2QQR A;  4M7A B;  3CCR T;  2X4W A;  2DAQ A;  1IRE B;  4LDW A;  3DB3 A;  2DIG A;  5LL6 S;  2CGH A;  5GAN 4;  3P8B B;  2WAC A;  2JVV A;  4M7A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...