5LJ5d

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 14
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5d00
2QTXA 2YLCA 4M7DD 5GAN8 1WQ7A 4M78B 3FB9A 4X9DA 3HFNA 5GAOn 2EJGA 1D3BB 4J6WA 3JCMf 5GAN4 3JB9I 5GAMj 4M7AA 4N0AA 1WNLA 1H641 1KQ2A 4PJOA 3JCMe 3JCMc 1KQ1A 3GIBA 4C92E 4M77E 4F7UA 5GAMe 4F7UG 4XU3A 3BW1A 3M4GA 3EFSA 2DZCA 1X01A 4C8QG 4XU1A 4F7UE 3RKXA 5CAIA 4M75C 3RKYA 4M7DB 4PJOD 2RA2A 4JRKA 4M75B 2DXTA 2FYKA 4OP0A 2DZ9A 4M77D 1I81A 4NL2A 4M78A 3JCMg 5I21A 5GAOm 3RERA 1WQWA 1TH7A 3V8LA 4NOYA 4C92F 3JB9H 5GANg 4M7DA 4WF2A 2DEQA 4J6YA 4C92A 4A54A 5GMKl 5GANd 1BIBA 4A53A 1HXDA 3FIFA 4QVCA 3V8KA 4M7DE 1JRIA 4M7AE 1B34A 4F7UB 4RCBA 5LJ5j 5GANj 5LJ3j 1M8VA 4XTYA 4V2SA 4PJOB 4M75D 4JUVA 1U1TA 4PJOG 4C8QB 4M77G 1LOJA 4JLIA 3RKWA 2EAYA 4M77B 5GANe 4XU2A 4XTWA 4M78E 2EWNA 5LJ5d 1N9RA 5LJ3d 4M75G 4XTXA 3SWNB 4C8QC 1I4K1 4F7UF 5GMKe 4XTVA 4EMKB 1YCYA 5GAOp 5LJ3h 3QUIA 3RIRA 3QHSA 1Y96B 2DVEA 5LJ3g 3AHUA 5GAN5 5GMKi 4M7AF 2DXUA 5GAN3 4M77C 2FB7A 4N0AC 5GMKh 4HT8A 3JB9J 2K57A 2VC8A 2HNIA 4PJOC 4PNOA 2DKGA 4X9CA 3V7SA 2RD1A 4M7DC 1U1SA 4M7AC 5DY9A 4C8QD 3HFOA 4C92C 2CGHA 4MMKA 4XU0A 2E1HA 4EMKA 2VXEA 3BFMA 3BY7A 3JCMJ 3JB9G 4EMHA 1M5Q1 3SWNA 5GANh 5GAMg 3V7CA 2DTHA 5GAMf 5GAMh 4M75A 2E65A 4C8QE 4HT9A 4M7DF 1WPYA 4PJOF 2DTIA 3JCMh 3RUXA 4Y91A 3V7RA 1I5LA 4M75E 3PGGA 4C8QA 5GAN6 1LNXA 3JCMd 5GAN2 4M78F 1BIAA 1JBMA 2E41A 4XQ3A 4EMGA 3QSUA 4M7AG 5GAMd 1HK9A 4JRIA 4QVDA 4M78C 1LJOA 2E64A 5GANf 4XTZA 5GAOl 5LJ3f 3JCMX 4C92B 2RM4A 3BDUA 3RESA 3JCMW 3JB9D 4M7AB 4C92G 3EFRA 5LJ5e 5LJ3e 3L2ZA 4M78D 2EJ9A 4M77A 4MMLA 1D3BA 5GMKm 4J6XA 3JCMP 1N9SA 4DQ2A 3SB2A 2DTOA 4C8QF 5GAOq 2ZGWA 3QO3A 3V8JA 3FJPA 1B34B 2VXFA 3JCMb 4J5YA 3JCMQ 3JB9F 4PJOE 2JN0A 4HA8A 3L1AA 4M75F 4EMKC 5GMKj 5GAN7 2E10A 2RB6A 2I2LA 2YHTA 3SWNC 3JCMV 3HSBA 2Y90A 1I8FA 4M77F 3VU3C 4M7DG 2DJZA 2EJFA 3INZA 1Y96A 4RCCA 4XTUA 5LJ5g 5LJ5f 5LJ5h 5GAOr 1MGQA 4C92D 4NL3A 2YLBA 4M78G 4M7AD
chains in the Genus database with same CATH superfamily
2Y4XA 4B9XA 5GAOn 1ZBJA 1D3BB 4C0DB 4L59A 4PJLA 1ZA1B 1D0XA 3DB3A 4IKFA 1VQKA 2AKLA 3M0QA 1KQ1A 2P84A 2E3IA 2KYBA 4AMCA 3PIOA 1Q7YC 1Y0MA 2KXDA 2FPEA 2RQTA 2RK1A 4HCCA 1X01A 2H3JA 4DBHA 2LJ1A 3VYGA 2CP0A 2FYKA 3A1PA 5C6SA 2KT1A 1Q7YR 1AWXA 4DOWA 3OYIA 1FWZA 2HKQB 1VQMA 2GBQA 2FZGB 4OF1A 4F7UB 2CH4A 4XTYA 4ATOA 4PJOB 4V2SA 2A3LA 4KRTA 4C8QB 4WCIA 2RQVA 1WJRA 5IAYA 1QMCA 1VQOQ 3LWIA 2KAFA 2RQWA 4M78E 5LJ3d 2RI3A 1YFNA 1QW1A 1VYVA 1IO6A 1RI9A 1RUWA 3OS1A 2DVEA 1UHFA 3LYIA 3C12A 1PRLC 2FB7A 2KXCA 1YN8A 1ZSZA 4RTVA 1W1FA 2L3RA 1YJ9A 1Q86U 4Y92A 1XJWB 4PL6A 3C94A 1VQ5A 3I55A 1JQQA 5GAMf 2B86A 4M75A 2DL4A 3UATA 2BZXA 4A4KA 1OOTA 1LNXA 2J7IA 1YIJA 2MMPA 2LP5A 2MPXC 1ABOA 1BI2A 3VYHB 1XOVA 1S72A 4HCZA 3QDFA 1TXQA 1LVKA 3SB2A 2HZYA 2EQMA 4QW2A 2IG0A 2AZSA 2V26A 2X3WD 4KULA 3JCMV 2QEXQ 2QQAA 1EIFA 1Y7XA 3M57A 1NYFA 4M7AD 1WQ7A 4IURA 3HFNA 1T3LA 4VUBA 5GAMj 2YRDA 1V29B 1AZGB 1QWFA 1WJQA 1K73U 4O6JA 1PG5B 3BW1A 3EFSA 1NG2A 2ZPEB 4FYVB 4AT1B 4YTLA 5GJWB 4BI4A 1UJYA 1UG1A 4IUQA 2QEXA 2QYZA 4M75B 4BE0A 1Q86R 5L23A 5LL6S 4A4FA 4F04B 3OYDA 4PJMA 2MIOA 2DILA 1CKBA 1UGVA 5GANg 2OTLQ 1K0XA 4WF2A 4J9EA 3CCMA 2LDMA 3L2WA 3EG9B 1G3YA 1AWOA 2ENMA 5DM7R 2IVWA 4J9BA 5LJ3j 2G6FX 4GLKA 4E2FB 1ZBXA 2YUNA 5CKDA 1YIJQ 3H9NA 1E6HA 2HEQA 5LJ5d 1H8KA 2WSFE 1SF9A 2RJCA 5GAOp 4BDZA 3GPLA 3CD6Q 3OYGA 3VS6A 4PNOA 1RI0A 5CVIA 4C5HA 3HL8A 4KH1B 3VUZA 5KYYB 5GAMh 2GTOA 3OMCA 1WPYA 3C95A 2DRKA 3VS3A 1QVPA 2EQIA 2RJDA 4LD9K 2EPDA 1R0BG 4QVDA 3LH5A 5LJ3f 3RMQA 1M90R 4FW1A 4M78D 1DJ7B 3M5AA 5IXBA 5D6XA 3A8MB 1F1BB 1WIEA 3T9NA 1WXTA 3FJPA 2VXFA 1M2VA 2JN0A 3L1AA 4PFOA 3QKJA 3QG1A 2EFIA 2ESWA 1K9MC 1JEGA 4ESRA 5LJ5f 2WSEE 3PT9A 2LQNA 3I9QA 2CP3A 2E6NA 2MCNA 3R6NA 1SRLA 5CQYA 3CD6A 4E7KA 3TU4K 2GTJA 3EG9A 5C0MA 3RKXA 2EKOA 1Y07A 2YRVA 4JDSA 1JB0E 4PJNA 3S6WA 4RTZA 1H3ZA 1JJ2A 2BKDN 3EG2A 2DYIA 2KT8A 4Z8AA 1X2QA 2V8KA 3I56Q 5LJ5j 2EYYA 1BYMA 3L2UA 1U1TA 4XTWA 2QTVA 3CC7Q 1PNJA 1OEBA 1U5SA 2EIFA 3MO8A 4Z89A 4O5VA 1M30A 3KXTA 2R5MA 3I5RA 1UGPB 5GMKh 3CXCP 2RHUA 3G7ZA 1OI1A 1WX6A 1EZZB 2E1HA 3REBB 5IXFA 3BY7A 4DBFA 1UGRB 2M9UA 3V7CA 3UT1A 1QP2A 2FPDA 4RTWA 3D7SB 4M75E 2ZAEA 2K9GA 3FC3A 3QSUA 3LH0A 1VQPT 4M78C 2PTKA 3CCVT 4MDWA 4C92G 2D9TA 1PKSA 1GXIE 3CCVQ 2ZGWA 1B34B 4MZMA 1GL5A 4QKUA 4D6WA 4E7SA 5DLOA 1KK7A 2O4XA 3RMSA 1KHCA 3CCQQ 4RCCA 1X6GA 1LPLA 1YCSB 3I55Q 4IUPA 2BUDA 5FU7C 3QYGB 1W4SA 3JB9I 4QQ6A 1GBQA 2GFUA 1WNLA 3JCMe 1YJNT 3L42A 2J06A 2CT4A 1QCNA 2FVUA 3TSWA 1BKBA 2YUPA 1X75C 1VQPA 4JLGA 2KROA 4OB1B 3RR6A 2M02A 4CI0C 3CBMA 3P8HA 2CS7A 4NL2A 2QAZA 3RERA 2X9HA 4NOYA 1R77A 2A08A 2DEQA 1M3CA 4J9FA 2DK3A 1M1KU 4M7DE 3ER0A 3NPFA 3SFMA 2LQ8A 3M56A 3TREA 1FXXA 2CZ6B 4M75D 4JLIA 4IIOA 2LCCA 2DFUA 4F7UF 3RNJA 1D1CA 1M2OA 2MAMA 1Q81R 2OTJQ 2QGGA 1Y96B 1QP3A 2HDAA 2V1RA 2BTTA 2YDLA 1UDLA 3CC7T 4M7AC 1U1SA 5DY9A 3CC2Q 3M55A 2MWOA 3ULRB 3DKMA 3TSZA 1PCXA 1VQ4A 1ARKA 2DTHA 1YITQ 5CKFA 2DIGA 2RH2A 4ZTJA 1W2BP 1B07A 1HD3A 2K79A 5GAN6 2LJ0A 1QVGA 3VRYA 2MWPA 1HK9A 4KH0B 4LD6A 2VUBA 4FYWB 2COWA 4LE9A 4C92B 4IUVA 1X2KA 1GCQA 3EAEA 4M77A 4FT4A 4OMMA 1BU1A 3I5SA 4FL6A 2GFAA 4IIMA 2R58A 4RTYA 3A98A 3H8ZA 3QPHA 1SSHA 3CC4A 4M4ZA 5KCHA 3EGDB 2VWFA 1TOVA 4M7DG 3VRZA 3RBBB 4M78B 5I2MA 4KBMB 3VS5A 1UTIA 3QWYA 2EJGA 2EKHA 1ZSZC 1VQ5Q 1Q86C 4JJCA 3WVDB 5I11A 1B7TA 1WXUA 3OW2A 4FSSA 1RL2A 2LZ6B 1VA7A 3PE0A 2I0NA 2DZCA 3OS2A 2AKKA 4N4IA 4JRKA 1FX7A 5KYYA 2XU8A 4BI3A 3WXMB 1YJNQ 4M77D 5I21A 1VQ4Q 2VB6A 2AT1B 3V8LA 1UB4A 1SKUB 4FYXB 1VYTA 3OYKA 1BIBA 2D0NA 2F2WA 1G83A 2BE9B 2QG9B 2DF6A 5GJVB 3LGFA 3R6OA 3PMIA 5GANe 1TSFA 2AHJB 4XTXA 1VQ9A 3OS0A 2L3QA 3VS1A 4XTVA 4KT0E 2DVJA 3HRSA 3HP9A 3LX7A 2KBTA 3Q1JA 2DIQA 2HMAA 1PRMC 1Q7YU 4L6V5 5EC7A 3M0RA 3CCLA 2ROTA 3JRZA 4EMKA 2HQXA 2RHIA 1M5Q1 2RPNA 4C8QE 2GGRA 4CRIA 1NJIR 1N27A 2QEXT 4JS4A 4XAXB 3VS7A 3NGPA 2HCKA 3OQ5A 1ZUYA 1JJ2P 1VQ6A 2VASA 3VUBA 4XTZA 4ELZC 3CXCS 2EJ9A 1WYXA 4OB2B 1K73R 2EYZA 4EDUA 1X6OA 4N4GA 2DRMA 2DLPA 1M8MA 2W0ZA 3OY9A 5GAN7 3FEOA 3SWNC 2BZ8A 1PSEA 3NTHA 3THKA 1HSQA 4FSXA 4M78G 4LN2A 2MF2A 4GY5A 4J7IA 4OGCA 4X9DA 1N6AA 1OU9A 3MHXA 1YNZA 3H0IA 1H641 3LGLA 1RACB 1OZ2A 2DBMA 4EIKA 5KYWB 5KYWA 2D8JA 2V8IA 2CUDA 2ZPBB 3EHRA 3OYAA 5CO7A 1H92A 1Q82U 3U23A 1IZ6A 1M2VB 2CZ7B 3A8LB 2DZ9A 1PSFA 1WXBA 1WLPB 3J7AF 2YT6A 1VQ5T 1IREB 4OMFB 1IGUA 1SHFA 3UPUA 3A8GB 1RAGB 1HXDA 3FIFA 1K9AA 1N8RC 4RCBA 2YUOA 3OYCA 1X6BA 1QWEA 4XK8E 1S72Q 1X69A 3RKWA 1K0SA 4XU2A 2QI2A 2KGTA 1M1GA 3M0UA 2EGCA 1VQLQ 1BCOA 1YCYA 2H8HA 3AHUA 3QHSA 4OB0B 3OSVA 4QQDA 4HCBA 3OYMA 1UGQB 2EYWA 2XIDA 4X9CA 3V7SA 3SD4A 2RD1A 4X34A 2G3RA 1M1KC 1I07A 2VXEA 2J05A 3VS4A 1Q82C 3OYNA 4MDXA 1LCKA 2DL7A 1I5LA 5GAN2 2FPFA 1NPPA 2KYMA 1VQLT 3GNFB 2WSCE 2L2PA 5LJ5e 4ZNXA 3O5ZA 3JV3A 1VQKT 3NMZC 4KUIA 4MMLA 3M58A 2QQBA 1M1FA 3PVQA 3ZBDA 3V8JA 2EQKA 4QT7A 3MCAB 2JTFA 2E10A 1W2BS 3MKDA 2JM8A 1MNDA 2DBKA 3CBOA 2KDSA 3INZA 2OI3A 2EYQA 5CQXA 1ABQA 4C92D 2NLUA 2QTXA 2YLCA 5KYNA 1M27C 1E7OA 1Q95G 1CSKA 2RQUA 4N0AA 1VQ9T 3F70A 1MMAA 2X4XA 1AZEA 1W2BA 2XG8D 2RN8A 3EGXB 4PJOD 2D6FA 1YP5A 2FG0A 2QGFB 3QWXX 4C0ZA 4Q5WA 3JCMg 2OJ2A 4M78A 1J3TA 4IUUA 4Z88A 5EG2A 2CZ1B 2FL7A 5FU6C 2AIRB 4J8OA 2DMOA 4A4GA 1G3WA 4ZGJB 2Z0WA 1R0CB 1N8RR 4M77B 2MOXA 2EWNA 1VQOT 2K4YA 1X43A 4PLIA 4OMQA 4ZGEB 1YI2Q 3G4ST 2OTJT 3JB9J 2K57A 2HSEB 3KFVA 5FWBA 3X24B 2XD0A 1VQ8A 1Y71A 4PK4A 3UWNA 3QDRB 4EMHA 2XK0A 1NPRA 2KE9A 2J6OA 3VKIA 3V7RA 5A0LA 4C8QA 4E7IA 2XI9A 1Z9ZA 3JCMW 2FZKB 4M7AB 3L2ZA 1G3TA 1RLPC 4J6XA 2C0OA 4RTTA 2DTOA 2RF0A 3IQLA 4E7HA 4J5YA 4HVUA 1NLPC 2DM1A 3CEYA 4R0KA 5D6WA 2PQWA 1K73C 1U8RA 3CMAA 1UHCA 3CC7A 1MGQA 1JU5C 1JJ2S 2BZYA 3I56A 2JZ2A 1SPKA 2E70A 3O8VA 2BIVA 1ZHIA 4M7AA 2A28A 3QJ6A 4FYYB 4PJOA 2XMFA 2SRCA 1YJWT 3S3OA 4F14A 3HPWA 2K2VA 1WHHA 3M54A 1IRXA 2QQSA 2ROLA 4JZ4A 2P0QA 4M75C 4MZTA 2COZA 3EH2A 2RA2A 3TQ7P 4ZTFA 1VYUA 2QK0A 5KYXB 1GRIA 3JB9H 4C5EA 4M7DA 1OV3A 3HRTA 5FLXE 3M0TA 2VV5A 1O9SA 3J80E 3CCRA 1RAIB 4M77G 2EAYA 1YHQA 1N9RA 2PZ1A 2L3PA 5A0DA 3DB4A 3QUIA 2LMJA 1KHIA 4LDYA 2X4JA 2VC8A 2NUPB 3HKSA 1VQMQ 1ZUKA 1QVGP 1PD0A 1PC0A 2W10A 3M59A 2A37A 3HTRA 4M7DF 3JCMh 4CC7A 1MNEA 2NWMA 1YJNA 2DEUA 2LVMA 4AG2C 1WHKA 2E64A 4A4EA 1NM7A 4D8KA 4C5GA 4M7AG 3OW2P 5LJ3e 1M3AA 1OX8A 4II1A 4DQ2A 3QZ9B 4ELYC 3VS0A 3QO3A 3P8BB 2VKNA 3A5ZB 3JB9F 2LT1A 4EMKC 1R8OB 4JJDA 2GF7A 2I2LA 3J81E 1VQ9Q 2KK4A 1D1BA 3CCUQ 3PNWC 3NTIA 1NJIU 3CCVA 3MEWA 3MP8A 4RG8A 5L8RE 2F2VA 3ZEHA 1KC8R 2OTLT 1TU0B 1KQ2A 3CCMQ 2LNVA 2O31A 4ZN3A 1AOJA 2CREA 2K2MA 4F7UG 4E7LA 3EFOB 2RI2A 1WDXA 1BK2A 2O4XB 4C8QG 4OB3B 5HY6A 4JS5A 4BB7A 2OX7A 5IHIA 4J83A 1RABB 1UE9A 3GNGA 6AT1B 3FJ5A 1G5VA 5CKHA 1WHMA 2QA4T 5D6YA 1VOMA 1NEBA 1QKXA 1T0JA 3CCEQ 3E9FA 2DL5A 4QQGA 4L5GA 2P4TA 3MPUB 1FMVA 3OS5A 5LJ3h 4FT2A 2M1HA 2DJQA 5GAN3 3A8OB 4FU6A 1T0HA 1A0NB 3SHWA 3OW2S 1Y57A 3AT1B 2R57A 2JM9A 2LCLA 3M9QA 3JB9G 3EG0A 2F5TX 2YWWA 1VIEA 1WFWA 2JS0A 4RMOA 3PTAA 4M78F 1MMDA 3ME9A 1LJOA 4CC2A 3G4SQ 1YJ9Q 4FM4B 1VQ8T 1NLOC 4C0FA 2DXCA 3CCLQ 3CMET 3CC2T 1SEMA 1TG0A 1D09B 3EGXA 3G4SA 2EVRA 4M75F 5HK3A 2OTJA 2PU9B 3VU3C 3S3MA 5LJ5g 7AT1B 1AWWA 1VQOA 3H41A 5CK9A 5GAN8 2YRCA 4RUGA 2JOYA 4X1VA 2QDYB 3JCMf 1SSFA 2E5QA 1V76A 4M77E 3P8DA 4RTXA 5GAMe 4FCYA 5AT1B 1K8AU 1W6XA 3M4GA 2HAXA 4Z02A 4OMPA 3CMEQ 3ASKA 3OYFA 1RAAB 1VQNA 4J9CA 1YI2T 1D1AA 1YHQQ 3CCMT 5ECAA 2O9SA 4DA4A 1FMKA 4LXCA 1OQKA 3OMGA 4A53A 1OULA 4NS5A 4M7AE 2D1XA 2JMAA 4C5IA 1QVFS 2LX7A 4J9HA 4AG1C 2K3BA 1D0ZA 3REAB 1Q82R 3OYBA 4M75G 3VV0A 2DE0X 1I4K1 1C0MA 2PVDB 4K11A 2IIMA 3FRNA 5KCOA 4EPCA 1N8RU 1WHLA 3GP8A 1AD5A 5A2QE 2O01E 4HT8A 2VGNA 1NZ9A 2DKGA 1G3SA 2MI6A 4F16A 1VUBA 2JW4A 2FEIA 4KGVB 1JO8A 1VQLA 2IPOB 3SEMA 4JRPA 4A63B 2KMTA 2DERA 1Q81U 2ZPGB 2L8DA 2RMOA 1C6VX 2KVQG 3FDRA 2VYTA 5GANf 5GAOl 3JCMX 3BDUA 2XKOC 5IT9E 3JCMP 4WTOB 5I2SA 1FMWA 4C8QF 1QVGS 3WVEB 3I55T 2VVKA 2P4RA 3JCMQ 2JXBA 4LUDA 1EFNA 3CCSQ 1YWOA 1VQ7T 2CYZB 3NHNA 2CH4W 2DAQA 3C4SA 4M7DD 4P5NA 1JXOA 1M90U 4ORZA 1VQ8Q 1QVFA 5GAN4 1O75A 2ECZA 2OAWA 4QVZA 3VJPA 1QVFP 1YJWQ 1Z9QA 4HCKA 2J6KA 3BDLA 4LNPA 2KSSA 3OYEA 2PUOB 4OP0A 3HHTB 4BDYA 5GAOm 2V1QA 4JZ3A 1UJ0A 4A54A 1I5OB 2LQWA 4AFUC 2QQRA 2LJ3A 3V8KA 4QVCA 2XDDA 2RHXA 1K9MU 3E9GA 1PM3A 1LOJA 1UFFA 1C1AA 1NJIC 5GMKe 4EMKB 1S1NA 3EHQA 1VQMT 4LDVA 1ZSZB 3EG1A 1MHNA 2NUZA 1TTHB 3M4YA 4PJOC 4M7DC 4C8QD 3HFOA 2EYXA 4XU0A 4RTUA 4J9IA 1ACMB 2JTMA 2E4HA 2E5KA 3GF5A 4PJOF 1KD1C 1VQ6T 1KG1A 2PVOB 4J9GA 3PFSA 4EMGA 5GAMd 2QQ9A 5A0GA 2JMCA 1FYNA 2AK5A 3CCSA 2CKKA 4BACA 3ZL7C 2KI7A 1BB9A 2X3XD 3CCLT 2DPPB 3JSCA 1XQHA 2RK2A 1I8FA 2Y90A 2EJFA 4OGEA 4HKEA 4DBRA 4NL3A 5GMKl 3UF4A 5KYXA 2ZZDA 2SEMA 1AWJA 1RAFB 2M16A 2NUTB 2L5QA 5CKBA 1G2BA 1QKWA 4E7JA 2K5FA 1M9SA 2JT4A 2EQUA 1IB8A 2D8HA 4BUGA 3CCJQ 3DLLA 1G8XA 1YBYA 2NUTA 3CCUA 3RKYA 1XNIA 1GFDA 4OMLA 3UDCA 3CCEA 3C0CA 1PHTA 4UC4A 3CPWA 1TH7A 2F5KA 4C92F 4E6RA 3L2QA 2O2OA 4C92A 5FRMA 2O9VA 2DD5A 1K1ZA 2HQHA 1AVZC 3OB9A 4CC4B 1B34A 2CSIA 3DLMA 4HVWA 4JUVA 2K3XA 2FO0A 2WACA 5FWCA 1UGSB 1V1CA 3SWNB 4JRQA 5HKCA 4BI8B 1SG5A 2M51A 3LW5E 2PVGB 3GLXA 3CC4T 1W70A 5FU7B 4E7ZA 2HL5C 4PKCC 4PFPA 3M53A 2B8AA 1WI7A 1UEBA 3OBWA 2P0PA 3SWNA 1QCFA 1ZQ1A 4HT9A 1MMGA 4DEYA 1TUDA 1K76A 2K6DA 2DO3A 1SHGA 1HJDA 1WZOA 2FRWA 1BIAA 2E41A 1IHVA 4LDUA 2RJEA 4JJNK 5IN1A 1VQ4T 3TCJA 3HRUA 2FRYA 2XHCA 3JB9D 3MJXA 5M9OA 3BE3A 4BD3A 5J39A 1AEYA 3UA6A 5IH2A 1VQKQ 2JNGA 3LLRA 1KQSP 2YHTA 2Y4YA 1VQ7A 2E3HA 2CP6A 4BE1A 3FB9A 4J6WA 1VIFA 1I0CA 1YITT 4A4HA 3GIBA 3G71Q 1M4ZA 4XU3A 4PFZA 5CIUA 1ZA2B 4F7UE 4M7DB 2L3SA 3RDVA 1QCOA 2HQEA 1E6GA 1K8AR 4ANJA 5KE2A 3CMAQ 2HSPA 2RHYA 3S3NA 3URGA 2HBPA 3GOXA 3CQTA 2ABLA 2GCXA 2K3YA 5GANj 2FHDA 5CCAA 1N5ZA 3X28B 2LNHB 4R56A 1UECA 2HBWA 2E12A 1QLYA 5FROA 1B3QA 3CXCA 1BI3A 2JJ9A 4J9DA 5LJ3g 4GBQA 5GAN5 5GMKi 2DX1A 4M77C 2AZVA 2C0IA 1PKTA 3CCJT 2HNIA 2EBPA 4OMOA 1KSWA 1ZLMA 4MMKA 1M3BA 4TVRA 3BFMA 3X25B 1GCPA 5GANh 2QASA 2ED1A 2A36A 5CR2A 1BBZA 2KRSA 3L2RA 2F69A 2MK5A 1YI2A 1VQNT 1JBMA 4XQ3A 4R55A 1MMNA 1OX9A 2CT3A 2CSQA 3CPWS 5J3BA 4OVAA 5GMKm 2JTEA 4IUTA 3TVTA 2QA4Q 4PJOE 1VQ6Q 5LJ5h 2KEAA 5IHNA 5GAOr 1KIKA 3X20B 2C0TA 1SRMA 3CC2A 1RADB 5HK0A 3CMEA 3SDZA 3M0SA 1BI0A 2PUKB 1M90C 2DL8A 4AFSC 4C92E 2QDLA 3CCQT 2CP2A 4OMNA 1QQJA 1Q81C 5CAIA 4RG2A 2H3EB 1XTDA 3ZFJA 2COYA 2DXTA 2ZCFB 1D0YA 5J26A 2YXYA 1GFCA 2RNAA 1WJSA 1U06A 1KQSA 2LX9A 4DOVA 5GANd 1GCQC 3FLGA 3OA6A 1KJWA 2DD4A 2GQIA 1K8AC 3CD6T 3EG3A 3NTKA 1RAEB 4AFZC 2R5AA 3EGUA 5HCKA 3KBGA 2MYSA 5FRNA 2HD0A 1TWBA 4C0GA 1T3SA 3NFCA 3HSBA 3RIRA 2A0FB 1P92A 3CPWP 2EGAA 2GQVA 2QA4A 2ZPIB 3QXEB 1GBRA 4F17A 2DXBA 2E6ZA 2FZCB 3META 2LQKA 3E1SA 1PWTA 2ED0A 2HKNA 4ZGDB 1BCMA 3X26B 4D8DA 5GAMg 4BY6C 2LCSA 2CZ0B 3CCQA 4Y91A 3PGGA 1OZ3A 4B6MA 1WGSA 1WA7A 5I22A 1OU8A 2BE7D 1TUCA 2YUQA 3EFRA 1D3BA 2GNCA 1ZX6A 3E2UA 2OTLA 5GMKj 2LTOA 8AT1B 4PLLA 2L89A 4MZPA 3UA7A 1KD1U 2XICA 2JVVA 4HVVA 1OPKA 2X4YA 3JCMc 4CC3A 1IHWA 1OPLA 2JUFA 4XU1A 5D7UA 1KQSS 1AHJB 2KQWA 3A8HB 1H3HA 3CPFA 1EX4A 2L0AA 2CUBA 1I81A 1TUGB 3G1JA 3CCJA 2RQRA 3OSSC 1TS9A 1NYGA 4B9WA 3EGDA 4FW2A 1IXDA 1NEGA 3EH1A 2O88A 1NE8A 2KRNA 5KE3A 3MP6A 2YSQA 8ATCB 2A7YA 1AT1B 4C8QC 2NYSA 3PVLA 2DNUA 2KY9A 1YITA 2K5IA 1YHQT 2J6FA 3KUFA 1KFZA 4JPBW 2DL3A 4HXJA 3CCRT 1OYXA 1RLQC 5KH6A 2DXUA 2DETA 4C0DC 1NBEB 5KYUA 2RO0A 1WHJA 2X35A 4C92C 2EW3A 4BE2A 2CGHA 2KR3A 3H0FA 5FU6B 1S72T 2LC4A 3JCMJ 3OYLA 2KRMA 2F1LA 4DEXA 4RKUE 2ZPFB 3RUXA 1YIJT 1ZUUA 3JCMd 4JRIA 3OYJA 2DA9A 2C06A 1I1JA 1K4US 3MEAA 2RM4A 3RESA 3CCRQ 5IHKA 3OBYA 3QBYA 1YJWA 2QXFA 1YJ9T 3MEUA 3I56T 3JCMb 4HA8A 1VQ7Q 4FIBA 4M77F 1IGQA 2DJZA 3H6ZA 4ME7A 4AFQC 4XTUA 1VQPQ 1MUZA 3EFOA 1JXMA 3PMTA 3CMAT 2LT4A 1BI1A 2LRQA 2HL3A 2XDBA 4J7FA 1M1KR 1MV0B 2CP7A 4LDWA 4DBQA 4F7UA 3JAME 3PIPA 3M0PA 1KC8U 1X27A 4E47A 1HYOA 1WHGA 4LDXA 2EGEA 2X4WA 2M0OA 4Y28E 3OYHA 1WQWA 2XDPA 1YWPA 5AYFA 4BY6B 2F2XA 1U3OA 3QZ5B 4J6YA 2DYBA 3CCET 2M0YA 1JRIA 1M8VA 4N4HA 4PJOG 3OYYA 3N5BB 4ZN1A 2KNBB 2X51A 3G6EA 2OAUA 4JJBA 2V8JA 2CDTA 2EQJA 4M7AF 4KUDK 1ZSGA 2ZPHB 4N0AC 3VS2A 1UUEA 3QYHB 3G71T 3I35A 9ATCB 2VGMA 2D0QB 2CP5A 4GLMA 3CCUT 1K9MR 2ATCB 2JS2A 2E65A 2RHZA 3G6EQ 2DTIA 5KYUB 1KC8C 3MEVA 4LUEA 3CC4Q 2RJFA 2K7AA 1RAHB 1MV3A 2P0KA 3CCST 1VQNQ 4KGZB 1CKAA 3QJYA 3TEEA 1KD1R 4KGXB 5DLQE 3G71A 5CKEA 1N9SA 3MP1A 3L2VA 2RI5A 3QIIA 2K5LA 5GAOq 3H0HA 4PJJA 3LWHA 3E19A 2NUPA 1PD1A 3CBPA 2RB6A 3GBQA 5FW9A 1Y96A 3G6ET 2PNIA 2YLBA
chains in the Genus database with same CATH topology
4M78B 4BE1A 2Y4XA 4B9XA 3FB9A 5I2MA 4KBMB 3PNWC 3NTIA 5GAOn 3CCVA 2EJGA 1D3BB 1VIFA 3MEWA 3MP8A 4J6WA 4L59A 4RG8A 5L8RE 3ZEHA 4C0DB 1YITT 2OTLT 1Q86C 3DB3A 3WVDB 1VQKA 4IKFA 1KQ2A 3OW2A 1KQ1A 2LNVA 1RL2A 4A4HA 4ZN3A 3PIOA 1Q7YC 3GIBA 1M4ZA 4F7UG 4E7LA 4XU3A 2RI2A 2RK1A 2O4XB 4HCCA 2DZCA 3OS2A 1X01A 5CIUA 4C8QG 2H3JA 4OB3B 5HY6A 4F7UE 4JS5A 4M7DB 4N4IA 3VYGA 4BB7A 4JRKA 2FYKA 1FX7A 2XU8A 4BI3A 3WXMB 4M77D 5I21A 5C6SA 4J83A 2HQEA 5KE2A 3V8LA 1VQ6T 1UB4A 3GNGA 4DOWA 2RHYA 3OYIA 3S3NA 1FWZA 1VQMA 3OYKA 1BIBA 3URGA 2HBPA 1G5VA 5CKHA 3GOXA 4OF1A 2QA4T 2GCXA 4F7UB 5D6YA 2K3YA 5GANj 4XTYA 4V2SA 4ATOA 3LGFA 4PJOB 2A3LA 2FHDA 4C8QB 5CCAA 1WJRA 3E9FA 5IAYA 3X28B 3R6OA 3PMIA 4QQGA 3LWIA 4L5GA 2KAFA 5GANe 2AHJB 4M78E 5LJ3d 4R56A 2RI3A 2P4TA 4XTXA 1VQ9A 3OS0A 2E12A 5FROA 3CXCA 1BI3A 3OS5A 4XTVA 1QW1A 4KT0E 3HRSA 3HP9A 5LJ3h 3OS1A 3LX7A 2DVEA 3LYIA 3Q1JA 2M1HA 4FT2A 5GMKi 5LJ3g 5GAN3 5GAN5 3C12A 4M77C 2FB7A 3A8OB 4FU6A 2DIQA 1Q7YU 3CCJT 4L6V5 2HNIA 3OW2S 2L3RA 1YJ9A 2R57A 3CCLA 1Q86U 4MMKA 4TVRA 2LCLA 3JRZA 2HQXA 3M9QA 4PL6A 2RHIA 3BFMA 3X25B 4EMKA 3JB9G 1M5Q1 3C94A 2F5TX 5GANh 3I55A 1VQ5A 5GAMf 1VIEA 4M75A 4C8QE 5CR2A 4CRIA 4RMOA 1N27A 4A4KA 3L2RA 2F69A 3PTAA 2QEXT 1YI2A 1LNXA 1VQNT 4JS4A 4M78F 1JBMA 4XAXB 4XQ3A 1YIJA 2MMPA 1VQ6A 3OQ5A 4R55A 3VUBA 3ME9A 1BI2A 1LJOA 3VYHB 4XTZA 3CPWS 5J3BA 4ELZC 1XOVA 3CXCS 1S72A 4FM4B 2EJ9A 4OB2B 1VQ8T 4OVAA 5GMKm 4HCZA 2DXCA 4C0FA 4IUTA 3SB2A 1X6OA 4EDUA 4N4GA 3CMET 3CC2T 2EQMA 4QW2A 3OY9A 4PJOE 2OTJA 3G4SA 4M75F 5GAN7 2IG0A 3FEOA 5HK3A 2PU9B 3SWNC 4KULA 3JCMV 3VU3C 3S3MA 5LJ5g 1PSEA 2QQAA 5LJ5h 5GAOr 1EIFA 1Y7XA 3NTHA 1VQOA 5CK9A 3M57A 4FSXA 4M78G 4M7AD 2MF2A 1WQ7A 4GY5A 4IURA 4J7IA 3X20B 5GAN8 2JOYA 4OGCA 3HFNA 4X9DA 1N6AA 4VUBA 3CC2A 2QDYB 5HK0A 3CMEA 3JCMf 1SSFA 2E5QA 3MHXA 5GAMj 3SDZA 1BI0A 1H641 1V29B 2PUKB 3LGLA 1M90C 1OZ2A 4C92E 4M77E 3P8DA 5GAMe 1WJQA 1K73U 4O6JA 3BW1A 3CCQT 1K8AU 3M4GA 3EFSA 2ZPEB 4Z02A 2HAXA 2V8IA 4YTLA 2ZPBB 1Q81C 3OYAA 3ASKA 5CAIA 3OYFA 5CO7A 4BI4A 4RG2A 1Q82U 1IZ6A 1VQNA 4IUQA 1XTDA 2CZ7B 3A8LB 4M75B 3ZFJA 2DXTA 2QEXA 4BE0A 1YI2T 5LL6S 2ZCFB 2DZ9A 5J26A 4A4FA 3CCMT 1PSFA 3J7AF 3OYDA 1KQSA 1VQ5T 1WJSA 1IREB 4OMFB 3UPUA 5GANg 2LX9A 4WF2A 3A8GB 4DOVA 4DA4A 3CCMA 5GANd 2LDMA 3FLGA 3OA6A 2DD4A 3OMGA 1HXDA 4A53A 3L2WA 4NS5A 3FIFA 1K8AC 3CD6T 1G3YA 1N8RC 4M7AE 3NTKA 5DM7R 2IVWA 4RCBA 3OYCA 5LJ3j 2R5AA 4C5IA 4GLKA 1QVFS 1ZBXA 4XK8E 1NJIU 5CKDA 3RKWA 4XU2A 3KBGA 2QI2A 5LJ5d 3OYBA 5FRNA 4M75G 2HD0A 3VV0A 1M1GA 1I4K1 2WSFE 2PVDB 4C0GA 3NFCA 1YCYA 2RJCA 5GAOp 3HSBA 3AHUA 3RIRA 3QHSA 4OB0B 3OSVA 1P92A 3FRNA 4QQDA 5KCOA 3GPLA 4BDZA 4EPCA 3OYMA 4HCBA 1UGQB 3GP8A 1N8RU 2GQVA 5A2QE 2O01E 2XIDA 4HT8A 3OYGA 2VGNA 1NZ9A 2QA4A 2ZPIB 3QXEB 4PNOA 2DKGA 4X9CA 3SD4A 1G3SA 2RD1A 3V7SA 2DXBA 2MI6A 2E6ZA 3META 1RI0A 2G3RA 2LQKA 4X34A 1M1KC 5CVIA 1VUBA 3E1SA 4C5HA 2VXEA 3HL8A 3X26B 4ZGDB 5GAMg 3VUZA 1Q82C 5GAMh 3OYNA 1VQLA 4MDXA 4BY6C 3OMCA 2CZ0B 3CCQA 1WPYA 3C95A 4JRPA 4Y91A 2KMTA 1I5LA 3PGGA 1QVPA 1OZ3A 2RJDA 2ZPGB 1Q81U 5GAN2 2L8DA 1WGSA 4LD9K 2KVQG 1NPPA 3FDRA 4QVDA 1VQLT 2VYTA 5GANf 3GNFB 5GAOl 5LJ3f 3RMQA 3JCMX 2WSCE 3BDUA 5LJ5e 2XKOC 3EFRA 5IT9E 4M78D 1VQKT 4MMLA 1D3BA 4KUIA 1DJ7B 3M5AA 3JCMP 3M58A 5D6XA 3A8MB 5I2SA 2QQBA 2OTLA 1M1FA 3ZBDA 4C8QF 1QVGS 3WVEB 3I55T 3V8JA 3T9NA 3FJPA 2EQKA 2VXFA 3JCMQ 2JN0A 3L1AA 3MCAB 2JTFA 3QKJA 5GMKj 3QG1A 2E10A 2LTOA 1W2BS 2EFIA 1K9MC 1VQ7T 3CBOA 2KDSA 3INZA 5LJ5f 2CYZB 2EYQA 2WSEE 5CQXA 2DAQA 3C4SA 3PT9A 4PLLA 4C92D 2L89A 2NLUA 4MZPA 1KD1U 2QTXA 2YLCA 4M7DD 4P5NA 2E6NA 2XICA 2JVVA 1M90U 5CQYA 1QVFA 5GAN4 4N0AA 1O75A 2X4YA 1VQ9T 4QVZA 3F70A 3JCMc 3VJPA 3CD6A 2X4XA 4E7KA 3TU4K 1W2BA 2JUFA 3BDLA 4XU1A 5C0MA 1KQSS 2XG8D 3RKXA 1AHJB 2EKOA 2KQWA 2KSSA 3A8HB 1Y07A 3OYEA 2PUOB 4PJOD 3CPFA 2YRVA 2D6FA 4JDSA 4OP0A 4C0ZA 4Q5WA 1I81A 1JB0E 3HHTB 4M78A 3JCMg 3S6WA 5GAOm 4BDYA 3CCJA 4IUUA 1H3ZA 3OSSC 1JJ2A 4B9WA 2BKDN 4A54A 5EG2A 2CZ1B 2FL7A 2QQRA 4QVCA 3V8KA 5FU6C 2XDDA 1NE8A 2RHXA 2V8KA 4J8OA 4A4GA 5LJ5j 1K9MU 3E9GA 1G3WA 5KE3A 3L2UA 1BYMA 4ZGJB 1U1TA 3MP6A 1LOJA 4M77B 4XTWA 2EWNA 2A7YA 1VQOT 2K4YA 4C8QC 1NJIC 4PLIA 5GMKe 2KY9A 3MO8A 2EIFA 2K5IA 4EMKB 3KUFA 4ZGEB 1YHQT 1YITA 4O5VA 3KXTA 2R5MA 3CCRT 1OYXA 5KH6A 1VQMT 2DXUA 4LDVA 3G4ST 2OTJT 4C0DC 1MHNA 1UGPB 5GMKh 3JB9J 3M4YA 2K57A 2RO0A 4PJOC 4M7DC 2RHUA 3G7ZA 4C8QD 1OI1A 3HFOA 2X35A 3X24B 4C92C 1VQ8A 4BE2A 2CGHA 1Y71A 4XU0A 2XD0A 5FU6B 2E1HA 3UWNA 2JTMA 1S72T 2LC4A 3BY7A 3QDRB 4EMHA 3JCMJ 1UGRB 2M9UA 3V7CA 3OYLA 3UT1A 1QP2A 1NPRA 2XK0A 4RKUE 2ZPFB 3GF5A 4PJOF 3VKIA 3RUXA 3V7RA 1YIJT 5A0LA 4M75E 4C8QA 1KD1C 2PVOB 3JCMd 3PFSA 3FC3A 3QSUA 3LH0A 4EMGA 1VQPT 5GAMd 4JRIA 3OYJA 2QQ9A 5A0GA 4M78C 3CCSA 4E7IA 2C06A 2CKKA 2XI9A 3CCVT 4BACA 4MDWA 3MEAA 2RM4A 3RESA 3JCMW 4M7AB 3OBYA 3QBYA 4C92G 1YJWA 3L2ZA 1G3TA 2QXFA 4J6XA 3CCLT 1YJ9T 2D9TA 1GXIE 3MEUA 2DTOA 2ZGWA 2DPPB 3I56T 4E7HA 1B34B 3JSCA 4MZMA 4J5YA 3JCMb 4HA8A 3CEYA 5D6WA 4D6WA 1XQHA 2PQWA 1K73C 1U8RA 5DLOA 3CMAA 4FIBA 2RK2A 1I8FA 2O4XA 2Y90A 4M77F 1KHCA 2DJZA 2EJFA 3H6ZA 4ME7A 4RCCA 4XTUA 3RMSA 4OGEA 3PMTA 4HKEA 3CMAT 1MGQA 2LT4A 4NL3A 5GMKl 1BI1A 1JJ2S 2LRQA 2ZZDA 3I56A 2JZ2A 4IUPA 2BUDA 2E70A 5FU7C 3QYGB 2XDBA 3O8VA 1W4SA 2BIVA 1ZHIA 4J7FA 3JB9I 2M16A 4M7AA 2L5QA 2GFUA 3QJ6A 1WNLA 4QQ6A 5CKBA 4PJOA 4LDWA 3JCMe 1YJNT 4E7JA 2K5FA 1YJWT 1M9SA 3S3OA 4F7UA 2EQUA 3L42A 3JAME 3HPWA 4BUGA 2K2VA 3M54A 2QQSA 3PIPA 3DLLA 1KC8U 2FVUA 1BKBA 4E47A 1YBYA 1X75C 2P0QA 1VQPA 4JLGA 4M75C 4MZTA 3CCUA 3RKYA 1XNIA 4LDXA 4OB1B 2RA2A 2X4WA 3UDCA 2M0OA 4CI0C 3CBMA 3P8HA 2CS7A 4Y28E 4NL2A 4UC4A 3OYHA 3CCEA 4ZTFA 3RERA 1WQWA 2XDPA 3CPWA 1TH7A 3JB9H 2F5KA 4NOYA 4C5EA 4C92F 5AYFA 4M7DA 4BY6B 3L2QA 3QZ5B 2DEQA 3HRTA 4J6YA 4C92A 3CCET 5FRMA 2DD5A 2DK3A 1M1KU 5FLXE 4M7DE 1JRIA 3OB9A 3ER0A 1B34A 2VV5A 3SFMA 3DLMA 2LQ8A 3M56A 3TREA 1FXXA 1M8VA 2CZ6B 4N4HA 1O9SA 3J80E 4M75D 4JUVA 3OYYA 2K3XA 4PJOG 3CCRA 4M77G 4JLIA 2WACA 3N5BB 2EAYA 4ZN1A 1YHQA 1N9RA 2LCCA 4JRQA 1UGSB 3SWNB 4F7UF 5HKCA 3G6EA 2OAUA 4BI8B 5A0DA 3CC7A 2V8JA 3LW5E 2MAMA 2EQJA 3DB4A 2PVGB 3QUIA 1Y96B 3GLXA 4M7AF 3CC4T 4KUDK 5FU7B 1QP3A 2ZPHB 4N0AC 1KHIA 4LDYA 2X4JA 2VC8A 3HKSA 3QYHB 3CC7T 4M7AC 1U1SA 5DY9A 3G71T 4PKCC 2VGMA 2D0QB 2MWOA 3M55A 3M53A 2B8AA 3DKMA 3CCUT 1UEBA 3M59A 3OBWA 2P0PA 3SWNA 1VQ4A 1ZQ1A 2DTHA 5CKFA 2E65A 2DIGA 2RHZA 2RH2A 4ZTJA 4HT9A 4M7DF 3JCMh 2DTIA 2DO3A 5GAN6 1KC8C 1QVGA 3MEVA 1YJNA 1BIAA 2E41A 2MWPA 2LVMA 2RJFA 4LDUA 1HK9A 4LD6A 2P0KA 2RJEA 3CCST 4JJNK 2E64A 4A4EA 2VUBA 1KG1A 3QJYA 5IN1A 1VQ4T 3TEEA 3TCJA 4C5GA 3HRUA 4IUVA 2XHCA 4C92B 3JB9D 4M7AG 5LJ3e 5M9OA 3EAEA 4M77A 5DLQE 4BD3A 5J39A 4FT4A 3G71A 1N9SA 5CKEA 3MP1A 4II1A 2RI5A 3QIIA 3QZ9B 4FL6A 4DQ2A 4ELYC 3L2VA 2K5LA 5GAOq 2GFAA 3QO3A 3P8BB 2R58A 3A5ZB 3LWHA 3E19A 3QPHA 2LT1A 3H8ZA 4EMKC 2JNGA 3CC4A 3LLRA 3JB9F 3CBPA 1R8OB 2RB6A 5KCHA 2GF7A 2I2LA 2YHTA 3J81E 2Y4YA 4M7DG 1Y96A 1VQ7A 3G6ET 2KK4A 2YLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTX A;  2YLC A;  4M7D D;  5GAN 8;  1WQ7 A;  4M78 B;  3FB9 A;  4X9D A;  3HFN A;  5GAO n;  2EJG A;  1D3B B;  4J6W A;  3JCM f;  5GAN 4;  3JB9 I;  5GAM j;  4M7A A;  4N0A A;  1WNL A;  1H64 1;  1KQ2 A;  4PJO A;  3JCM e;  3JCM c;  1KQ1 A;  3GIB A;  4C92 E;  4M77 E;  4F7U A;  5GAM e;  4F7U G;  4XU3 A;  3BW1 A;  3M4G A;  3EFS A;  2DZC A;  1X01 A;  4C8Q G;  4XU1 A;  4F7U E;  3RKX A;  5CAI A;  4M75 C;  3RKY A;  4M7D B;  4PJO D;  2RA2 A;  4JRK A;  4M75 B;  2DXT A;  2FYK A;  4OP0 A;  2DZ9 A;  4M77 D;  1I81 A;  4NL2 A;  4M78 A;  3JCM g;  5I21 A;  5GAO m;  3RER A;  1WQW A;  1TH7 A;  3V8L A;  4NOY A;  4C92 F;  3JB9 H;  5GAN g;  4M7D A;  4WF2 A;  2DEQ A;  4J6Y A;  4C92 A;  4A54 A;  5GMK l;  5GAN d;  1BIB A;  4A53 A;  1HXD A;  3FIF A;  4QVC A;  3V8K A;  4M7D E;  1JRI A;  4M7A E;  1B34 A;  4F7U B;  4RCB A;  5LJ5 j;  5GAN j;  5LJ3 j;  1M8V A;  4XTY A;  4V2S A;  4PJO B;  4M75 D;  4JUV A;  1U1T A;  4PJO G;  4C8Q B;  4M77 G;  1LOJ A;  4JLI A;  3RKW A;  2EAY A;  4M77 B;  5GAN e;  4XU2 A;  4XTW A;  4M78 E;  2EWN A;  5LJ5 d;  1N9R A;  5LJ3 d;  4M75 G;  4XTX A;  3SWN B;  4C8Q C;  1I4K 1;  4F7U F;  5GMK e;  4XTV A;  4EMK B;  1YCY A;  5GAO p;  5LJ3 h;  3QUI A;  3RIR A;  3QHS A;  1Y96 B;  2DVE A;  5LJ3 g;  3AHU A;  5GAN 5;  5GMK i;  4M7A F;  2DXU A;  5GAN 3;  4M77 C;  2FB7 A;  4N0A C;  5GMK h;  4HT8 A;  3JB9 J;  2K57 A;  2VC8 A;  2HNI A;  4PJO C;  4PNO A;  2DKG A;  4X9C A;  3V7S A;  2RD1 A;  4M7D C;  1U1S A;  4M7A C;  5DY9 A;  4C8Q D;  3HFO A;  4C92 C;  2CGH A;  4MMK A;  4XU0 A;  2E1H A;  4EMK A;  2VXE A;  3BFM A;  3BY7 A;  3JCM J;  3JB9 G;  4EMH A;  1M5Q 1;  3SWN A;  5GAN h;  5GAM g;  3V7C A;  2DTH A;  5GAM f;  5GAM h;  4M75 A;  2E65 A;  4C8Q E;  4HT9 A;  4M7D F;  1WPY A;  4PJO F;  2DTI A;  3JCM h;  3RUX A;  4Y91 A;  3V7R A;  1I5L A;  4M75 E;  3PGG A;  4C8Q A;  5GAN 6;  1LNX A;  3JCM d;  5GAN 2;  4M78 F;  1BIA A;  1JBM A;  2E41 A;  4XQ3 A;  4EMG A;  3QSU A;  4M7A G;  5GAM d;  1HK9 A;  4JRI A;  4QVD A;  4M78 C;  1LJO A;  2E64 A;  5GAN f;  4XTZ A;  5GAO l;  5LJ3 f;  3JCM X;  4C92 B;  2RM4 A;  3BDU A;  3RES A;  3JCM W;  3JB9 D;  4M7A B;  4C92 G;  3EFR A;  5LJ5 e;  5LJ3 e;  3L2Z A;  4M78 D;  2EJ9 A;  4M77 A;  4MML A;  1D3B A;  5GMK m;  4J6X A;  3JCM P;  1N9S A;  4DQ2 A;  3SB2 A;  2DTO A;  4C8Q F;  5GAO q;  2ZGW A;  3QO3 A;  3V8J A;  3FJP A;  1B34 B;  2VXF A;  3JCM b;  4J5Y A;  3JCM Q;  3JB9 F;  4PJO E;  2JN0 A;  4HA8 A;  3L1A A;  4M75 F;  4EMK C;  5GMK j;  5GAN 7;  2E10 A;  2RB6 A;  2I2L A;  2YHT A;  3SWN C;  3JCM V;  3HSB A;  2Y90 A;  1I8F A;  4M77 F;  3VU3 C;  4M7D G;  2DJZ A;  2EJF A;  3INZ A;  1Y96 A;  4RCC A;  4XTU A;  5LJ5 g;  5LJ5 f;  5LJ5 h;  5GAO r;  1MGQ A;  4C92 D;  4NL3 A;  2YLB A;  4M78 G;  4M7A D; 
#chains in the Genus database with same CATH topology
 2Y4X A;  4B9X A;  5GAO n;  1ZBJ A;  1D3B B;  4C0D B;  4L59 A;  4PJL A;  1ZA1 B;  1D0X A;  3DB3 A;  4IKF A;  1VQK A;  2AKL A;  3M0Q A;  1KQ1 A;  2P84 A;  2E3I A;  2KYB A;  4AMC A;  3PIO A;  1Q7Y C;  1Y0M A;  2KXD A;  2FPE A;  2RQT A;  2RK1 A;  4HCC A;  1X01 A;  2H3J A;  4DBH A;  2LJ1 A;  3VYG A;  2CP0 A;  2FYK A;  3A1P A;  5C6S A;  2KT1 A;  1Q7Y R;  1AWX A;  4DOW A;  3OYI A;  1FWZ A;  2HKQ B;  1VQM A;  2GBQ A;  2FZG B;  4OF1 A;  4F7U B;  2CH4 A;  4XTY A;  4ATO A;  4PJO B;  4V2S A;  2A3L A;  4KRT A;  4C8Q B;  4WCI A;  2RQV A;  1WJR A;  5IAY A;  1QMC A;  1VQO Q;  3LWI A;  2KAF A;  2RQW A;  4M78 E;  5LJ3 d;  2RI3 A;  1YFN A;  1QW1 A;  1VYV A;  1IO6 A;  1RI9 A;  1RUW A;  3OS1 A;  2DVE A;  1UHF A;  3LYI A;  3C12 A;  1PRL C;  2FB7 A;  2KXC A;  1YN8 A;  1ZSZ A;  4RTV A;  1W1F A;  2L3R A;  1YJ9 A;  1Q86 U;  4Y92 A;  1XJW B;  4PL6 A;  3C94 A;  1VQ5 A;  3I55 A;  1JQQ A;  5GAM f;  2B86 A;  4M75 A;  2DL4 A;  3UAT A;  2BZX A;  4A4K A;  1OOT A;  1LNX A;  2J7I A;  1YIJ A;  2MMP A;  2LP5 A;  2MPX C;  1ABO A;  1BI2 A;  3VYH B;  1XOV A;  1S72 A;  4HCZ A;  3QDF A;  1TXQ A;  1LVK A;  3SB2 A;  2HZY A;  2EQM A;  4QW2 A;  2IG0 A;  2AZS A;  2V26 A;  2X3W D;  4KUL A;  3JCM V;  2QEX Q;  2QQA A;  1EIF A;  1Y7X A;  3M57 A;  1NYF A;  4M7A D;  1WQ7 A;  4IUR A;  3HFN A;  1T3L A;  4VUB A;  5GAM j;  2YRD A;  1V29 B;  1AZG B;  1QWF A;  1WJQ A;  1K73 U;  4O6J A;  1PG5 B;  3BW1 A;  3EFS A;  1NG2 A;  2ZPE B;  4FYV B;  4AT1 B;  4YTL A;  5GJW B;  4BI4 A;  1UJY A;  1UG1 A;  4IUQ A;  2QEX A;  2QYZ A;  4M75 B;  4BE0 A;  1Q86 R;  5L23 A;  5LL6 S;  4A4F A;  4F04 B;  3OYD A;  4PJM A;  2MIO A;  2DIL A;  1CKB A;  1UGV A;  5GAN g;  2OTL Q;  1K0X A;  4WF2 A;  4J9E A;  3CCM A;  2LDM A;  3L2W A;  3EG9 B;  1G3Y A;  1AWO A;  2ENM A;  5DM7 R;  2IVW A;  4J9B A;  5LJ3 j;  2G6F X;  4GLK A;  4E2F B;  1ZBX A;  2YUN A;  5CKD A;  1YIJ Q;  3H9N A;  1E6H A;  2HEQ A;  5LJ5 d;  1H8K A;  2WSF E;  1SF9 A;  2RJC A;  5GAO p;  4BDZ A;  3GPL A;  3CD6 Q;  3OYG A;  3VS6 A;  4PNO A;  1RI0 A;  5CVI A;  4C5H A;  3HL8 A;  4KH1 B;  3VUZ A;  5KYY B;  5GAM h;  2GTO A;  3OMC A;  1WPY A;  3C95 A;  2DRK A;  3VS3 A;  1QVP A;  2EQI A;  2RJD A;  4LD9 K;  2EPD A;  1R0B G;  4QVD A;  3LH5 A;  5LJ3 f;  3RMQ A;  1M90 R;  4FW1 A;  4M78 D;  1DJ7 B;  3M5A A;  5IXB A;  5D6X A;  3A8M B;  1F1B B;  1WIE A;  3T9N A;  1WXT A;  3FJP A;  2VXF A;  1M2V A;  2JN0 A;  3L1A A;  4PFO A;  3QKJ A;  3QG1 A;  2EFI A;  2ESW A;  1K9M C;  1JEG A;  4ESR A;  5LJ5 f;  2WSE E;  3PT9 A;  2LQN A;  3I9Q A;  2CP3 A;  2E6N A;  2MCN A;  3R6N A;  1SRL A;  5CQY A;  3CD6 A;  4E7K A;  3TU4 K;  2GTJ A;  3EG9 A;  5C0M A;  3RKX A;  2EKO A;  1Y07 A;  2YRV A;  4JDS A;  1JB0 E;  4PJN A;  3S6W A;  4RTZ A;  1H3Z A;  1JJ2 A;  2BKD N;  3EG2 A;  2DYI A;  2KT8 A;  4Z8A A;  1X2Q A;  2V8K A;  3I56 Q;  5LJ5 j;  2EYY A;  1BYM A;  3L2U A;  1U1T A;  4XTW A;  2QTV A;  3CC7 Q;  1PNJ A;  1OEB A;  1U5S A;  2EIF A;  3MO8 A;  4Z89 A;  4O5V A;  1M30 A;  3KXT A;  2R5M A;  3I5R A;  1UGP B;  5GMK h;  3CXC P;  2RHU A;  3G7Z A;  1OI1 A;  1WX6 A;  1EZZ B;  2E1H A;  3REB B;  5IXF A;  3BY7 A;  4DBF A;  1UGR B;  2M9U A;  3V7C A;  3UT1 A;  1QP2 A;  2FPD A;  4RTW A;  3D7S B;  4M75 E;  2ZAE A;  2K9G A;  3FC3 A;  3QSU A;  3LH0 A;  1VQP T;  4M78 C;  2PTK A;  3CCV T;  4MDW A;  4C92 G;  2D9T A;  1PKS A;  1GXI E;  3CCV Q;  2ZGW A;  1B34 B;  4MZM A;  1GL5 A;  4QKU A;  4D6W A;  4E7S A;  5DLO A;  1KK7 A;  2O4X A;  3RMS A;  1KHC A;  3CCQ Q;  4RCC A;  1X6G A;  1LPL A;  1YCS B;  3I55 Q;  4IUP A;  2BUD A;  5FU7 C;  3QYG B;  1W4S A;  3JB9 I;  4QQ6 A;  1GBQ A;  2GFU A;  1WNL A;  3JCM e;  1YJN T;  3L42 A;  2J06 A;  2CT4 A;  1QCN A;  2FVU A;  3TSW A;  1BKB A;  2YUP A;  1X75 C;  1VQP A;  4JLG A;  2KRO A;  4OB1 B;  3RR6 A;  2M02 A;  4CI0 C;  3CBM A;  3P8H A;  2CS7 A;  4NL2 A;  2QAZ A;  3RER A;  2X9H A;  4NOY A;  1R77 A;  2A08 A;  2DEQ A;  1M3C A;  4J9F A;  2DK3 A;  1M1K U;  4M7D E;  3ER0 A;  3NPF A;  3SFM A;  2LQ8 A;  3M56 A;  3TRE A;  1FXX A;  2CZ6 B;  4M75 D;  4JLI A;  4IIO A;  2LCC A;  2DFU A;  4F7U F;  3RNJ A;  1D1C A;  1M2O A;  2MAM A;  1Q81 R;  2OTJ Q;  2QGG A;  1Y96 B;  1QP3 A;  2HDA A;  2V1R A;  2BTT A;  2YDL A;  1UDL A;  3CC7 T;  4M7A C;  1U1S A;  5DY9 A;  3CC2 Q;  3M55 A;  2MWO A;  3ULR B;  3DKM A;  3TSZ A;  1PCX A;  1VQ4 A;  1ARK A;  2DTH A;  1YIT Q;  5CKF A;  2DIG A;  2RH2 A;  4ZTJ A;  1W2B P;  1B07 A;  1HD3 A;  2K79 A;  5GAN 6;  2LJ0 A;  1QVG A;  3VRY A;  2MWP A;  1HK9 A;  4KH0 B;  4LD6 A;  2VUB A;  4FYW B;  2COW A;  4LE9 A;  4C92 B;  4IUV A;  1X2K A;  1GCQ A;  3EAE A;  4M77 A;  4FT4 A;  4OMM A;  1BU1 A;  3I5S A;  4FL6 A;  2GFA A;  4IIM A;  2R58 A;  4RTY A;  3A98 A;  3H8Z A;  3QPH A;  1SSH A;  3CC4 A;  4M4Z A;  5KCH A;  3EGD B;  2VWF A;  1TOV A;  4M7D G;  3VRZ A;  3RBB B;  4M78 B;  5I2M A;  4KBM B;  3VS5 A;  1UTI A;  3QWY A;  2EJG A;  2EKH A;  1ZSZ C;  1VQ5 Q;  1Q86 C;  4JJC A;  3WVD B;  5I11 A;  1B7T A;  1WXU A;  3OW2 A;  4FSS A;  1RL2 A;  2LZ6 B;  1VA7 A;  3PE0 A;  2I0N A;  2DZC A;  3OS2 A;  2AKK A;  4N4I A;  4JRK A;  1FX7 A;  5KYY A;  2XU8 A;  4BI3 A;  3WXM B;  1YJN Q;  4M77 D;  5I21 A;  1VQ4 Q;  2VB6 A;  2AT1 B;  3V8L A;  1UB4 A;  1SKU B;  4FYX B;  1VYT A;  3OYK A;  1BIB A;  2D0N A;  2F2W A;  1G83 A;  2BE9 B;  2QG9 B;  2DF6 A;  5GJV B;  3LGF A;  3R6O A;  3PMI A;  5GAN e;  1TSF A;  2AHJ B;  4XTX A;  1VQ9 A;  3OS0 A;  2L3Q A;  3VS1 A;  4XTV A;  4KT0 E;  2DVJ A;  3HRS A;  3HP9 A;  3LX7 A;  2KBT A;  3Q1J A;  2DIQ A;  2HMA A;  1PRM C;  1Q7Y U;  4L6V 5;  5EC7 A;  3M0R A;  3CCL A;  2ROT A;  3JRZ A;  4EMK A;  2HQX A;  2RHI A;  1M5Q 1;  2RPN A;  4C8Q E;  2GGR A;  4CRI A;  1NJI R;  1N27 A;  2QEX T;  4JS4 A;  4XAX B;  3VS7 A;  3NGP A;  2HCK A;  3OQ5 A;  1ZUY A;  1JJ2 P;  1VQ6 A;  2VAS A;  3VUB A;  4XTZ A;  4ELZ C;  3CXC S;  2EJ9 A;  1WYX A;  4OB2 B;  1K73 R;  2EYZ A;  4EDU A;  1X6O A;  4N4G A;  2DRM A;  2DLP A;  1M8M A;  2W0Z A;  3OY9 A;  5GAN 7;  3FEO A;  3SWN C;  2BZ8 A;  1PSE A;  3NTH A;  3THK A;  1HSQ A;  4FSX A;  4M78 G;  4LN2 A;  2MF2 A;  4GY5 A;  4J7I A;  4OGC A;  4X9D A;  1N6A A;  1OU9 A;  3MHX A;  1YNZ A;  3H0I A;  1H64 1;  3LGL A;  1RAC B;  1OZ2 A;  2DBM A;  4EIK A;  5KYW B;  5KYW A;  2D8J A;  2V8I A;  2CUD A;  2ZPB B;  3EHR A;  3OYA A;  5CO7 A;  1H92 A;  1Q82 U;  3U23 A;  1IZ6 A;  1M2V B;  2CZ7 B;  3A8L B;  2DZ9 A;  1PSF A;  1WXB A;  1WLP B;  3J7A F;  2YT6 A;  1VQ5 T;  1IRE B;  4OMF B;  1IGU A;  1SHF A;  3UPU A;  3A8G B;  1RAG B;  1HXD A;  3FIF A;  1K9A A;  1N8R C;  4RCB A;  2YUO A;  3OYC A;  1X6B A;  1QWE A;  4XK8 E;  1S72 Q;  1X69 A;  3RKW A;  1K0S A;  4XU2 A;  2QI2 A;  2KGT A;  1M1G A;  3M0U A;  2EGC A;  1VQL Q;  1BCO A;  1YCY A;  2H8H A;  3AHU A;  3QHS A;  4OB0 B;  3OSV A;  4QQD A;  4HCB A;  3OYM A;  1UGQ B;  2EYW A;  2XID A;  4X9C A;  3V7S A;  3SD4 A;  2RD1 A;  4X34 A;  2G3R A;  1M1K C;  1I07 A;  2VXE A;  2J05 A;  3VS4 A;  1Q82 C;  3OYN A;  4MDX A;  1LCK A;  2DL7 A;  1I5L A;  5GAN 2;  2FPF A;  1NPP A;  2KYM A;  1VQL T;  3GNF B;  2WSC E;  2L2P A;  5LJ5 e;  4ZNX A;  3O5Z A;  3JV3 A;  1VQK T;  3NMZ C;  4KUI A;  4MML A;  3M58 A;  2QQB A;  1M1F A;  3PVQ A;  3ZBD A;  3V8J A;  2EQK A;  4QT7 A;  3MCA B;  2JTF A;  2E10 A;  1W2B S;  3MKD A;  2JM8 A;  1MND A;  2DBK A;  3CBO A;  2KDS A;  3INZ A;  2OI3 A;  2EYQ A;  5CQX A;  1ABQ A;  4C92 D;  2NLU A;  2QTX A;  2YLC A;  5KYN A;  1M27 C;  1E7O A;  1Q95 G;  1CSK A;  2RQU A;  4N0A A;  1VQ9 T;  3F70 A;  1MMA A;  2X4X A;  1AZE A;  1W2B A;  2XG8 D;  2RN8 A;  3EGX B;  4PJO D;  2D6F A;  1YP5 A;  2FG0 A;  2QGF B;  3QWX X;  4C0Z A;  4Q5W A;  3JCM g;  2OJ2 A;  4M78 A;  1J3T A;  4IUU A;  4Z88 A;  5EG2 A;  2CZ1 B;  2FL7 A;  5FU6 C;  2AIR B;  4J8O A;  2DMO A;  4A4G A;  1G3W A;  4ZGJ B;  2Z0W A;  1R0C B;  1N8R R;  4M77 B;  2MOX A;  2EWN A;  1VQO T;  2K4Y A;  1X43 A;  4PLI A;  4OMQ A;  4ZGE B;  1YI2 Q;  3G4S T;  2OTJ T;  3JB9 J;  2K57 A;  2HSE B;  3KFV A;  5FWB A;  3X24 B;  2XD0 A;  1VQ8 A;  1Y71 A;  4PK4 A;  3UWN A;  3QDR B;  4EMH A;  2XK0 A;  1NPR A;  2KE9 A;  2J6O A;  3VKI A;  3V7R A;  5A0L A;  4C8Q A;  4E7I A;  2XI9 A;  1Z9Z A;  3JCM W;  2FZK B;  4M7A B;  3L2Z A;  1G3T A;  1RLP C;  4J6X A;  2C0O A;  4RTT A;  2DTO A;  2RF0 A;  3IQL A;  4E7H A;  4J5Y A;  4HVU A;  1NLP C;  2DM1 A;  3CEY A;  4R0K A;  5D6W A;  2PQW A;  1K73 C;  1U8R A;  3CMA A;  1UHC A;  3CC7 A;  1MGQ A;  1JU5 C;  1JJ2 S;  2BZY A;  3I56 A;  2JZ2 A;  1SPK A;  2E70 A;  3O8V A;  2BIV A;  1ZHI A;  4M7A A;  2A28 A;  3QJ6 A;  4FYY B;  4PJO A;  2XMF A;  2SRC A;  1YJW T;  3S3O A;  4F14 A;  3HPW A;  2K2V A;  1WHH A;  3M54 A;  1IRX A;  2QQS A;  2ROL A;  4JZ4 A;  2P0Q A;  4M75 C;  4MZT A;  2COZ A;  3EH2 A;  2RA2 A;  3TQ7 P;  4ZTF A;  1VYU A;  2QK0 A;  5KYX B;  1GRI A;  3JB9 H;  4C5E A;  4M7D A;  1OV3 A;  3HRT A;  5FLX E;  3M0T A;  2VV5 A;  1O9S A;  3J80 E;  3CCR A;  1RAI B;  4M77 G;  2EAY A;  1YHQ A;  1N9R A;  2PZ1 A;  2L3P A;  5A0D A;  3DB4 A;  3QUI A;  2LMJ A;  1KHI A;  4LDY A;  2X4J A;  2VC8 A;  2NUP B;  3HKS A;  1VQM Q;  1ZUK A;  1QVG P;  1PD0 A;  1PC0 A;  2W10 A;  3M59 A;  2A37 A;  3HTR A;  4M7D F;  3JCM h;  4CC7 A;  1MNE A;  2NWM A;  1YJN A;  2DEU A;  2LVM A;  4AG2 C;  1WHK A;  2E64 A;  4A4E A;  1NM7 A;  4D8K A;  4C5G A;  4M7A G;  3OW2 P;  5LJ3 e;  1M3A A;  1OX8 A;  4II1 A;  4DQ2 A;  3QZ9 B;  4ELY C;  3VS0 A;  3QO3 A;  3P8B B;  2VKN A;  3A5Z B;  3JB9 F;  2LT1 A;  4EMK C;  1R8O B;  4JJD A;  2GF7 A;  2I2L A;  3J81 E;  1VQ9 Q;  2KK4 A;  1D1B A;  3CCU Q;  3PNW C;  3NTI A;  1NJI U;  3CCV A;  3MEW A;  3MP8 A;  4RG8 A;  5L8R E;  2F2V A;  3ZEH A;  1KC8 R;  2OTL T;  1TU0 B;  1KQ2 A;  3CCM Q;  2LNV A;  2O31 A;  4ZN3 A;  1AOJ A;  2CRE A;  2K2M A;  4F7U G;  4E7L A;  3EFO B;  2RI2 A;  1WDX A;  1BK2 A;  2O4X B;  4C8Q G;  4OB3 B;  5HY6 A;  4JS5 A;  4BB7 A;  2OX7 A;  5IHI A;  4J83 A;  1RAB B;  1UE9 A;  3GNG A;  6AT1 B;  3FJ5 A;  1G5V A;  5CKH A;  1WHM A;  2QA4 T;  5D6Y A;  1VOM A;  1NEB A;  1QKX A;  1T0J A;  3CCE Q;  3E9F A;  2DL5 A;  4QQG A;  4L5G A;  2P4T A;  3MPU B;  1FMV A;  3OS5 A;  5LJ3 h;  4FT2 A;  2M1H A;  2DJQ A;  5GAN 3;  3A8O B;  4FU6 A;  1T0H A;  1A0N B;  3SHW A;  3OW2 S;  1Y57 A;  3AT1 B;  2R57 A;  2JM9 A;  2LCL A;  3M9Q A;  3JB9 G;  3EG0 A;  2F5T X;  2YWW A;  1VIE A;  1WFW A;  2JS0 A;  4RMO A;  3PTA A;  4M78 F;  1MMD A;  3ME9 A;  1LJO A;  4CC2 A;  3G4S Q;  1YJ9 Q;  4FM4 B;  1VQ8 T;  1NLO C;  4C0F A;  2DXC A;  3CCL Q;  3CME T;  3CC2 T;  1SEM A;  1TG0 A;  1D09 B;  3EGX A;  3G4S A;  2EVR A;  4M75 F;  5HK3 A;  2OTJ A;  2PU9 B;  3VU3 C;  3S3M A;  5LJ5 g;  7AT1 B;  1AWW A;  1VQO A;  3H41 A;  5CK9 A;  5GAN 8;  2YRC A;  4RUG A;  2JOY A;  4X1V A;  2QDY B;  3JCM f;  1SSF A;  2E5Q A;  1V76 A;  4M77 E;  3P8D A;  4RTX A;  5GAM e;  4FCY A;  5AT1 B;  1K8A U;  1W6X A;  3M4G A;  2HAX A;  4Z02 A;  4OMP A;  3CME Q;  3ASK A;  3OYF A;  1RAA B;  1VQN A;  4J9C A;  1YI2 T;  1D1A A;  1YHQ Q;  3CCM T;  5ECA A;  2O9S A;  4DA4 A;  1FMK A;  4LXC A;  1OQK A;  3OMG A;  4A53 A;  1OUL A;  4NS5 A;  4M7A E;  2D1X A;  2JMA A;  4C5I A;  1QVF S;  2LX7 A;  4J9H A;  4AG1 C;  2K3B A;  1D0Z A;  3REA B;  1Q82 R;  3OYB A;  4M75 G;  3VV0 A;  2DE0 X;  1I4K 1;  1C0M A;  2PVD B;  4K11 A;  2IIM A;  3FRN A;  5KCO A;  4EPC A;  1N8R U;  1WHL A;  3GP8 A;  1AD5 A;  5A2Q E;  2O01 E;  4HT8 A;  2VGN A;  1NZ9 A;  2DKG A;  1G3S A;  2MI6 A;  4F16 A;  1VUB A;  2JW4 A;  2FEI A;  4KGV B;  1JO8 A;  1VQL A;  2IPO B;  3SEM A;  4JRP A;  4A63 B;  2KMT A;  2DER A;  1Q81 U;  2ZPG B;  2L8D A;  2RMO A;  1C6V X;  2KVQ G;  3FDR A;  2VYT A;  5GAN f;  5GAO l;  3JCM X;  3BDU A;  2XKO C;  5IT9 E;  3JCM P;  4WTO B;  5I2S A;  1FMW A;  4C8Q F;  1QVG S;  3WVE B;  3I55 T;  2VVK A;  2P4R A;  3JCM Q;  2JXB A;  4LUD A;  1EFN A;  3CCS Q;  1YWO A;  1VQ7 T;  2CYZ B;  3NHN A;  2CH4 W;  2DAQ A;  3C4S A;  4M7D D;  4P5N A;  1JXO A;  1M90 U;  4ORZ A;  1VQ8 Q;  1QVF A;  5GAN 4;  1O75 A;  2ECZ A;  2OAW A;  4QVZ A;  3VJP A;  1QVF P;  1YJW Q;  1Z9Q A;  4HCK A;  2J6K A;  3BDL A;  4LNP A;  2KSS A;  3OYE A;  2PUO B;  4OP0 A;  3HHT B;  4BDY A;  5GAO m;  2V1Q A;  4JZ3 A;  1UJ0 A;  4A54 A;  1I5O B;  2LQW A;  4AFU C;  2QQR A;  2LJ3 A;  3V8K A;  4QVC A;  2XDD A;  2RHX A;  1K9M U;  3E9G A;  1PM3 A;  1LOJ A;  1UFF A;  1C1A A;  1NJI C;  5GMK e;  4EMK B;  1S1N A;  3EHQ A;  1VQM T;  4LDV A;  1ZSZ B;  3EG1 A;  1MHN A;  2NUZ A;  1TTH B;  3M4Y A;  4PJO C;  4M7D C;  4C8Q D;  3HFO A;  2EYX A;  4XU0 A;  4RTU A;  4J9I A;  1ACM B;  2JTM A;  2E4H A;  2E5K A;  3GF5 A;  4PJO F;  1KD1 C;  1VQ6 T;  1KG1 A;  2PVO B;  4J9G A;  3PFS A;  4EMG A;  5GAM d;  2QQ9 A;  5A0G A;  2JMC A;  1FYN A;  2AK5 A;  3CCS A;  2CKK A;  4BAC A;  3ZL7 C;  2KI7 A;  1BB9 A;  2X3X D;  3CCL T;  2DPP B;  3JSC A;  1XQH A;  2RK2 A;  1I8F A;  2Y90 A;  2EJF A;  4OGE A;  4HKE A;  4DBR A;  4NL3 A;  5GMK l;  3UF4 A;  5KYX A;  2ZZD A;  2SEM A;  1AWJ A;  1RAF B;  2M16 A;  2NUT B;  2L5Q A;  5CKB A;  1G2B A;  1QKW A;  4E7J A;  2K5F A;  1M9S A;  2JT4 A;  2EQU A;  1IB8 A;  2D8H A;  4BUG A;  3CCJ Q;  3DLL A;  1G8X A;  1YBY A;  2NUT A;  3CCU A;  3RKY A;  1XNI A;  1GFD A;  4OML A;  3UDC A;  3CCE A;  3C0C A;  1PHT A;  4UC4 A;  3CPW A;  1TH7 A;  2F5K A;  4C92 F;  4E6R A;  3L2Q A;  2O2O A;  4C92 A;  5FRM A;  2O9V A;  2DD5 A;  1K1Z A;  2HQH A;  1AVZ C;  3OB9 A;  4CC4 B;  1B34 A;  2CSI A;  3DLM A;  4HVW A;  4JUV A;  2K3X A;  2FO0 A;  2WAC A;  5FWC A;  1UGS B;  1V1C A;  3SWN B;  4JRQ A;  5HKC A;  4BI8 B;  1SG5 A;  2M51 A;  3LW5 E;  2PVG B;  3GLX A;  3CC4 T;  1W70 A;  5FU7 B;  4E7Z A;  2HL5 C;  4PKC C;  4PFP A;  3M53 A;  2B8A A;  1WI7 A;  1UEB A;  3OBW A;  2P0P A;  3SWN A;  1QCF A;  1ZQ1 A;  4HT9 A;  1MMG A;  4DEY A;  1TUD A;  1K76 A;  2K6D A;  2DO3 A;  1SHG A;  1HJD A;  1WZO A;  2FRW A;  1BIA A;  2E41 A;  1IHV A;  4LDU A;  2RJE A;  4JJN K;  5IN1 A;  1VQ4 T;  3TCJ A;  3HRU A;  2FRY A;  2XHC A;  3JB9 D;  3MJX A;  5M9O A;  3BE3 A;  4BD3 A;  5J39 A;  1AEY A;  3UA6 A;  5IH2 A;  1VQK Q;  2JNG A;  3LLR A;  1KQS P;  2YHT A;  2Y4Y A;  1VQ7 A;  2E3H A;  2CP6 A;  4BE1 A;  3FB9 A;  4J6W A;  1VIF A;  1I0C A;  1YIT T;  4A4H A;  3GIB A;  3G71 Q;  1M4Z A;  4XU3 A;  4PFZ A;  5CIU A;  1ZA2 B;  4F7U E;  4M7D B;  2L3S A;  3RDV A;  1QCO A;  2HQE A;  1E6G A;  1K8A R;  4ANJ A;  5KE2 A;  3CMA Q;  2HSP A;  2RHY A;  3S3N A;  3URG A;  2HBP A;  3GOX A;  3CQT A;  2ABL A;  2GCX A;  2K3Y A;  5GAN j;  2FHD A;  5CCA A;  1N5Z A;  3X28 B;  2LNH B;  4R56 A;  1UEC A;  2HBW A;  2E12 A;  1QLY A;  5FRO A;  1B3Q A;  3CXC A;  1BI3 A;  2JJ9 A;  4J9D A;  5LJ3 g;  4GBQ A;  5GAN 5;  5GMK i;  2DX1 A;  4M77 C;  2AZV A;  2C0I A;  1PKT A;  3CCJ T;  2HNI A;  2EBP A;  4OMO A;  1KSW A;  1ZLM A;  4MMK A;  1M3B A;  4TVR A;  3BFM A;  3X25 B;  1GCP A;  5GAN h;  2QAS A;  2ED1 A;  2A36 A;  5CR2 A;  1BBZ A;  2KRS A;  3L2R A;  2F69 A;  2MK5 A;  1YI2 A;  1VQN T;  1JBM A;  4XQ3 A;  4R55 A;  1MMN A;  1OX9 A;  2CT3 A;  2CSQ A;  3CPW S;  5J3B A;  4OVA A;  5GMK m;  2JTE A;  4IUT A;  3TVT A;  2QA4 Q;  4PJO E;  1VQ6 Q;  5LJ5 h;  2KEA A;  5IHN A;  5GAO r;  1KIK A;  3X20 B;  2C0T A;  1SRM A;  3CC2 A;  1RAD B;  5HK0 A;  3CME A;  3SDZ A;  3M0S A;  1BI0 A;  2PUK B;  1M90 C;  2DL8 A;  4AFS C;  4C92 E;  2QDL A;  3CCQ T;  2CP2 A;  4OMN A;  1QQJ A;  1Q81 C;  5CAI A;  4RG2 A;  2H3E B;  1XTD A;  3ZFJ A;  2COY A;  2DXT A;  2ZCF B;  1D0Y A;  5J26 A;  2YXY A;  1GFC A;  2RNA A;  1WJS A;  1U06 A;  1KQS A;  2LX9 A;  4DOV A;  5GAN d;  1GCQ C;  3FLG A;  3OA6 A;  1KJW A;  2DD4 A;  2GQI A;  1K8A C;  3CD6 T;  3EG3 A;  3NTK A;  1RAE B;  4AFZ C;  2R5A A;  3EGU A;  5HCK A;  3KBG A;  2MYS A;  5FRN A;  2HD0 A;  1TWB A;  4C0G A;  1T3S A;  3NFC A;  3HSB A;  3RIR A;  2A0F B;  1P92 A;  3CPW P;  2EGA A;  2GQV A;  2QA4 A;  2ZPI B;  3QXE B;  1GBR A;  4F17 A;  2DXB A;  2E6Z A;  2FZC B;  3MET A;  2LQK A;  3E1S A;  1PWT A;  2ED0 A;  2HKN A;  4ZGD B;  1BCM A;  3X26 B;  4D8D A;  5GAM g;  4BY6 C;  2LCS A;  2CZ0 B;  3CCQ A;  4Y91 A;  3PGG A;  1OZ3 A;  4B6M A;  1WGS A;  1WA7 A;  5I22 A;  1OU8 A;  2BE7 D;  1TUC A;  2YUQ A;  3EFR A;  1D3B A;  2GNC A;  1ZX6 A;  3E2U A;  2OTL A;  5GMK j;  2LTO A;  8AT1 B;  4PLL A;  2L89 A;  4MZP A;  3UA7 A;  1KD1 U;  2XIC A;  2JVV A;  4HVV A;  1OPK A;  2X4Y A;  3JCM c;  4CC3 A;  1IHW A;  1OPL A;  2JUF A;  4XU1 A;  5D7U A;  1KQS S;  1AHJ B;  2KQW A;  3A8H B;  1H3H A;  3CPF A;  1EX4 A;  2L0A A;  2CUB A;  1I81 A;  1TUG B;  3G1J A;  3CCJ A;  2RQR A;  3OSS C;  1TS9 A;  1NYG A;  4B9W A;  3EGD A;  4FW2 A;  1IXD A;  1NEG A;  3EH1 A;  2O88 A;  1NE8 A;  2KRN A;  5KE3 A;  3MP6 A;  2YSQ A;  8ATC B;  2A7Y A;  1AT1 B;  4C8Q C;  2NYS A;  3PVL A;  2DNU A;  2KY9 A;  1YIT A;  2K5I A;  1YHQ T;  2J6F A;  3KUF A;  1KFZ A;  4JPB W;  2DL3 A;  4HXJ A;  3CCR T;  1OYX A;  1RLQ C;  5KH6 A;  2DXU A;  2DET A;  4C0D C;  1NBE B;  5KYU A;  2RO0 A;  1WHJ A;  2X35 A;  4C92 C;  2EW3 A;  4BE2 A;  2CGH A;  2KR3 A;  3H0F A;  5FU6 B;  1S72 T;  2LC4 A;  3JCM J;  3OYL A;  2KRM A;  2F1L A;  4DEX A;  4RKU E;  2ZPF B;  3RUX A;  1YIJ T;  1ZUU A;  3JCM d;  4JRI A;  3OYJ A;  2DA9 A;  2C06 A;  1I1J A;  1K4U S;  3MEA A;  2RM4 A;  3RES A;  3CCR Q;  5IHK A;  3OBY A;  3QBY A;  1YJW A;  2QXF A;  1YJ9 T;  3MEU A;  3I56 T;  3JCM b;  4HA8 A;  1VQ7 Q;  4FIB A;  4M77 F;  1IGQ A;  2DJZ A;  3H6Z A;  4ME7 A;  4AFQ C;  4XTU A;  1VQP Q;  1MUZ A;  3EFO A;  1JXM A;  3PMT A;  3CMA T;  2LT4 A;  1BI1 A;  2LRQ A;  2HL3 A;  2XDB A;  4J7F A;  1M1K R;  1MV0 B;  2CP7 A;  4LDW A;  4DBQ A;  4F7U A;  3JAM E;  3PIP A;  3M0P A;  1KC8 U;  1X27 A;  4E47 A;  1HYO A;  1WHG A;  4LDX A;  2EGE A;  2X4W A;  2M0O A;  4Y28 E;  3OYH A;  1WQW A;  2XDP A;  1YWP A;  5AYF A;  4BY6 B;  2F2X A;  1U3O A;  3QZ5 B;  4J6Y A;  2DYB A;  3CCE T;  2M0Y A;  1JRI A;  1M8V A;  4N4H A;  4PJO G;  3OYY A;  3N5B B;  4ZN1 A;  2KNB B;  2X51 A;  3G6E A;  2OAU A;  4JJB A;  2V8J A;  2CDT A;  2EQJ A;  4M7A F;  4KUD K;  1ZSG A;  2ZPH B;  4N0A C;  3VS2 A;  1UUE A;  3QYH B;  3G71 T;  3I35 A;  9ATC B;  2VGM A;  2D0Q B;  2CP5 A;  4GLM A;  3CCU T;  1K9M R;  2ATC B;  2JS2 A;  2E65 A;  2RHZ A;  3G6E Q;  2DTI A;  5KYU B;  1KC8 C;  3MEV A;  4LUE A;  3CC4 Q;  2RJF A;  2K7A A;  1RAH B;  1MV3 A;  2P0K A;  3CCS T;  1VQN Q;  4KGZ B;  1CKA A;  3QJY A;  3TEE A;  1KD1 R;  4KGX B;  5DLQ E;  3G71 A;  5CKE A;  1N9S A;  3MP1 A;  3L2V A;  2RI5 A;  3QII A;  2K5L A;  5GAO q;  3H0H A;  4PJJ A;  3LWH A;  3E19 A;  2NUP A;  1PD1 A;  3CBP A;  2RB6 A;  3GBQ A;  5FW9 A;  1Y96 A;  3G6E T;  2PNI A;  2YLB A; 
#chains in the Genus database with same CATH homology
 4M78 B;  4BE1 A;  2Y4X A;  4B9X A;  3FB9 A;  5I2M A;  4KBM B;  3PNW C;  3NTI A;  5GAO n;  3CCV A;  2EJG A;  1D3B B;  1VIF A;  3MEW A;  3MP8 A;  4J6W A;  4L59 A;  4RG8 A;  5L8R E;  3ZEH A;  4C0D B;  1YIT T;  2OTL T;  1Q86 C;  3DB3 A;  3WVD B;  1VQK A;  4IKF A;  1KQ2 A;  3OW2 A;  1KQ1 A;  2LNV A;  1RL2 A;  4A4H A;  4ZN3 A;  3PIO A;  1Q7Y C;  3GIB A;  1M4Z A;  4F7U G;  4E7L A;  4XU3 A;  2RI2 A;  2RK1 A;  2O4X B;  4HCC A;  2DZC A;  3OS2 A;  1X01 A;  5CIU A;  4C8Q G;  2H3J A;  4OB3 B;  5HY6 A;  4F7U E;  4JS5 A;  4M7D B;  4N4I A;  3VYG A;  4BB7 A;  4JRK A;  2FYK A;  1FX7 A;  2XU8 A;  4BI3 A;  3WXM B;  4M77 D;  5I21 A;  5C6S A;  4J83 A;  2HQE A;  5KE2 A;  3V8L A;  1VQ6 T;  1UB4 A;  3GNG A;  4DOW A;  2RHY A;  3OYI A;  3S3N A;  1FWZ A;  1VQM A;  3OYK A;  1BIB A;  3URG A;  2HBP A;  1G5V A;  5CKH A;  3GOX A;  4OF1 A;  2QA4 T;  2GCX A;  4F7U B;  5D6Y A;  2K3Y A;  5GAN j;  4XTY A;  4V2S A;  4ATO A;  3LGF A;  4PJO B;  2A3L A;  2FHD A;  4C8Q B;  5CCA A;  1WJR A;  3E9F A;  5IAY A;  3X28 B;  3R6O A;  3PMI A;  4QQG A;  3LWI A;  4L5G A;  2KAF A;  5GAN e;  2AHJ B;  4M78 E;  5LJ3 d;  4R56 A;  2RI3 A;  2P4T A;  4XTX A;  1VQ9 A;  3OS0 A;  2E12 A;  5FRO A;  3CXC A;  1BI3 A;  3OS5 A;  4XTV A;  1QW1 A;  4KT0 E;  3HRS A;  3HP9 A;  5LJ3 h;  3OS1 A;  3LX7 A;  2DVE A;  3LYI A;  3Q1J A;  2M1H A;  4FT2 A;  5GMK i;  5LJ3 g;  5GAN 3;  5GAN 5;  3C12 A;  4M77 C;  2FB7 A;  3A8O B;  4FU6 A;  2DIQ A;  1Q7Y U;  3CCJ T;  4L6V 5;  2HNI A;  3OW2 S;  2L3R A;  1YJ9 A;  2R57 A;  3CCL A;  1Q86 U;  4MMK A;  4TVR A;  2LCL A;  3JRZ A;  2HQX A;  3M9Q A;  4PL6 A;  2RHI A;  3BFM A;  3X25 B;  4EMK A;  3JB9 G;  1M5Q 1;  3C94 A;  2F5T X;  5GAN h;  3I55 A;  1VQ5 A;  5GAM f;  1VIE A;  4M75 A;  4C8Q E;  5CR2 A;  4CRI A;  4RMO A;  1N27 A;  4A4K A;  3L2R A;  2F69 A;  3PTA A;  2QEX T;  1YI2 A;  1LNX A;  1VQN T;  4JS4 A;  4M78 F;  1JBM A;  4XAX B;  4XQ3 A;  1YIJ A;  2MMP A;  1VQ6 A;  3OQ5 A;  4R55 A;  3VUB A;  3ME9 A;  1BI2 A;  1LJO A;  3VYH B;  4XTZ A;  3CPW S;  5J3B A;  4ELZ C;  1XOV A;  3CXC S;  1S72 A;  4FM4 B;  2EJ9 A;  4OB2 B;  1VQ8 T;  4OVA A;  5GMK m;  4HCZ A;  2DXC A;  4C0F A;  4IUT A;  3SB2 A;  1X6O A;  4EDU A;  4N4G A;  3CME T;  3CC2 T;  2EQM A;  4QW2 A;  3OY9 A;  4PJO E;  2OTJ A;  3G4S A;  4M75 F;  5GAN 7;  2IG0 A;  3FEO A;  5HK3 A;  2PU9 B;  3SWN C;  4KUL A;  3JCM V;  3VU3 C;  3S3M A;  5LJ5 g;  1PSE A;  2QQA A;  5LJ5 h;  5GAO r;  1EIF A;  1Y7X A;  3NTH A;  1VQO A;  5CK9 A;  3M57 A;  4FSX A;  4M78 G;  4M7A D;  2MF2 A;  1WQ7 A;  4GY5 A;  4IUR A;  4J7I A;  3X20 B;  5GAN 8;  2JOY A;  4OGC A;  3HFN A;  4X9D A;  1N6A A;  4VUB A;  3CC2 A;  2QDY B;  5HK0 A;  3CME A;  3JCM f;  1SSF A;  2E5Q A;  3MHX A;  5GAM j;  3SDZ A;  1BI0 A;  1H64 1;  1V29 B;  2PUK B;  3LGL A;  1M90 C;  1OZ2 A;  4C92 E;  4M77 E;  3P8D A;  5GAM e;  1WJQ A;  1K73 U;  4O6J A;  3BW1 A;  3CCQ T;  1K8A U;  3M4G A;  3EFS A;  2ZPE B;  4Z02 A;  2HAX A;  2V8I A;  4YTL A;  2ZPB B;  1Q81 C;  3OYA A;  3ASK A;  5CAI A;  3OYF A;  5CO7 A;  4BI4 A;  4RG2 A;  1Q82 U;  1IZ6 A;  1VQN A;  4IUQ A;  1XTD A;  2CZ7 B;  3A8L B;  4M75 B;  3ZFJ A;  2DXT A;  2QEX A;  4BE0 A;  1YI2 T;  5LL6 S;  2ZCF B;  2DZ9 A;  5J26 A;  4A4F A;  3CCM T;  1PSF A;  3J7A F;  3OYD A;  1KQS A;  1VQ5 T;  1WJS A;  1IRE B;  4OMF B;  3UPU A;  5GAN g;  2LX9 A;  4WF2 A;  3A8G B;  4DOV A;  4DA4 A;  3CCM A;  5GAN d;  2LDM A;  3FLG A;  3OA6 A;  2DD4 A;  3OMG A;  1HXD A;  4A53 A;  3L2W A;  4NS5 A;  3FIF A;  1K8A C;  3CD6 T;  1G3Y A;  1N8R C;  4M7A E;  3NTK A;  5DM7 R;  2IVW A;  4RCB A;  3OYC A;  5LJ3 j;  2R5A A;  4C5I A;  4GLK A;  1QVF S;  1ZBX A;  4XK8 E;  1NJI U;  5CKD A;  3RKW A;  4XU2 A;  3KBG A;  2QI2 A;  5LJ5 d;  3OYB A;  5FRN A;  4M75 G;  2HD0 A;  3VV0 A;  1M1G A;  1I4K 1;  2WSF E;  2PVD B;  4C0G A;  3NFC A;  1YCY A;  2RJC A;  5GAO p;  3HSB A;  3AHU A;  3RIR A;  3QHS A;  4OB0 B;  3OSV A;  1P92 A;  3FRN A;  4QQD A;  5KCO A;  3GPL A;  4BDZ A;  4EPC A;  3OYM A;  4HCB A;  1UGQ B;  3GP8 A;  1N8R U;  2GQV A;  5A2Q E;  2O01 E;  2XID A;  4HT8 A;  3OYG A;  2VGN A;  1NZ9 A;  2QA4 A;  2ZPI B;  3QXE B;  4PNO A;  2DKG A;  4X9C A;  3SD4 A;  1G3S A;  2RD1 A;  3V7S A;  2DXB A;  2MI6 A;  2E6Z A;  3MET A;  1RI0 A;  2G3R A;  2LQK A;  4X34 A;  1M1K C;  5CVI A;  1VUB A;  3E1S A;  4C5H A;  2VXE A;  3HL8 A;  3X26 B;  4ZGD B;  5GAM g;  3VUZ A;  1Q82 C;  5GAM h;  3OYN A;  1VQL A;  4MDX A;  4BY6 C;  3OMC A;  2CZ0 B;  3CCQ A;  1WPY A;  3C95 A;  4JRP A;  4Y91 A;  2KMT A;  1I5L A;  3PGG A;  1QVP A;  1OZ3 A;  2RJD A;  2ZPG B;  1Q81 U;  5GAN 2;  2L8D A;  1WGS A;  4LD9 K;  2KVQ G;  1NPP A;  3FDR A;  4QVD A;  1VQL T;  2VYT A;  5GAN f;  3GNF B;  5GAO l;  5LJ3 f;  3RMQ A;  3JCM X;  2WSC E;  3BDU A;  5LJ5 e;  2XKO C;  3EFR A;  5IT9 E;  4M78 D;  1VQK T;  4MML A;  1D3B A;  4KUI A;  1DJ7 B;  3M5A A;  3JCM P;  3M58 A;  5D6X A;  3A8M B;  5I2S A;  2QQB A;  2OTL A;  1M1F A;  3ZBD A;  4C8Q F;  1QVG S;  3WVE B;  3I55 T;  3V8J A;  3T9N A;  3FJP A;  2EQK A;  2VXF A;  3JCM Q;  2JN0 A;  3L1A A;  3MCA B;  2JTF A;  3QKJ A;  5GMK j;  3QG1 A;  2E10 A;  2LTO A;  1W2B S;  2EFI A;  1K9M C;  1VQ7 T;  3CBO A;  2KDS A;  3INZ A;  5LJ5 f;  2CYZ B;  2EYQ A;  2WSE E;  5CQX A;  2DAQ A;  3C4S A;  3PT9 A;  4PLL A;  4C92 D;  2L89 A;  2NLU A;  4MZP A;  1KD1 U;  2QTX A;  2YLC A;  4M7D D;  4P5N A;  2E6N A;  2XIC A;  2JVV A;  1M90 U;  5CQY A;  1QVF A;  5GAN 4;  4N0A A;  1O75 A;  2X4Y A;  1VQ9 T;  4QVZ A;  3F70 A;  3JCM c;  3VJP A;  3CD6 A;  2X4X A;  4E7K A;  3TU4 K;  1W2B A;  2JUF A;  3BDL A;  4XU1 A;  5C0M A;  1KQS S;  2XG8 D;  3RKX A;  1AHJ B;  2EKO A;  2KQW A;  2KSS A;  3A8H B;  1Y07 A;  3OYE A;  2PUO B;  4PJO D;  3CPF A;  2YRV A;  2D6F A;  4JDS A;  4OP0 A;  4C0Z A;  4Q5W A;  1I81 A;  1JB0 E;  3HHT B;  4M78 A;  3JCM g;  3S6W A;  5GAO m;  4BDY A;  3CCJ A;  4IUU A;  1H3Z A;  3OSS C;  1JJ2 A;  4B9W A;  2BKD N;  4A54 A;  5EG2 A;  2CZ1 B;  2FL7 A;  2QQR A;  4QVC A;  3V8K A;  5FU6 C;  2XDD A;  1NE8 A;  2RHX A;  2V8K A;  4J8O A;  4A4G A;  5LJ5 j;  1K9M U;  3E9G A;  1G3W A;  5KE3 A;  3L2U A;  1BYM A;  4ZGJ B;  1U1T A;  3MP6 A;  1LOJ A;  4M77 B;  4XTW A;  2EWN A;  2A7Y A;  1VQO T;  2K4Y A;  4C8Q C;  1NJI C;  4PLI A;  5GMK e;  2KY9 A;  3MO8 A;  2EIF A;  2K5I A;  4EMK B;  3KUF A;  4ZGE B;  1YHQ T;  1YIT A;  4O5V A;  3KXT A;  2R5M A;  3CCR T;  1OYX A;  5KH6 A;  1VQM T;  2DXU A;  4LDV A;  3G4S T;  2OTJ T;  4C0D C;  1MHN A;  1UGP B;  5GMK h;  3JB9 J;  3M4Y A;  2K57 A;  2RO0 A;  4PJO C;  4M7D C;  2RHU A;  3G7Z A;  4C8Q D;  1OI1 A;  3HFO A;  2X35 A;  3X24 B;  4C92 C;  1VQ8 A;  4BE2 A;  2CGH A;  1Y71 A;  4XU0 A;  2XD0 A;  5FU6 B;  2E1H A;  3UWN A;  2JTM A;  1S72 T;  2LC4 A;  3BY7 A;  3QDR B;  4EMH A;  3JCM J;  1UGR B;  2M9U A;  3V7C A;  3OYL A;  3UT1 A;  1QP2 A;  1NPR A;  2XK0 A;  4RKU E;  2ZPF B;  3GF5 A;  4PJO F;  3VKI A;  3RUX A;  3V7R A;  1YIJ T;  5A0L A;  4M75 E;  4C8Q A;  1KD1 C;  2PVO B;  3JCM d;  3PFS A;  3FC3 A;  3QSU A;  3LH0 A;  4EMG A;  1VQP T;  5GAM d;  4JRI A;  3OYJ A;  2QQ9 A;  5A0G A;  4M78 C;  3CCS A;  4E7I A;  2C06 A;  2CKK A;  2XI9 A;  3CCV T;  4BAC A;  4MDW A;  3MEA A;  2RM4 A;  3RES A;  3JCM W;  4M7A B;  3OBY A;  3QBY A;  4C92 G;  1YJW A;  3L2Z A;  1G3T A;  2QXF A;  4J6X A;  3CCL T;  1YJ9 T;  2D9T A;  1GXI E;  3MEU A;  2DTO A;  2ZGW A;  2DPP B;  3I56 T;  4E7H A;  1B34 B;  3JSC A;  4MZM A;  4J5Y A;  3JCM b;  4HA8 A;  3CEY A;  5D6W A;  4D6W A;  1XQH A;  2PQW A;  1K73 C;  1U8R A;  5DLO A;  3CMA A;  4FIB A;  2RK2 A;  1I8F A;  2O4X A;  2Y90 A;  4M77 F;  1KHC A;  2DJZ A;  2EJF A;  3H6Z A;  4ME7 A;  4RCC A;  4XTU A;  3RMS A;  4OGE A;  3PMT A;  4HKE A;  3CMA T;  1MGQ A;  2LT4 A;  4NL3 A;  5GMK l;  1BI1 A;  1JJ2 S;  2LRQ A;  2ZZD A;  3I56 A;  2JZ2 A;  4IUP A;  2BUD A;  2E70 A;  5FU7 C;  3QYG B;  2XDB A;  3O8V A;  1W4S A;  2BIV A;  1ZHI A;  4J7F A;  3JB9 I;  2M16 A;  4M7A A;  2L5Q A;  2GFU A;  3QJ6 A;  1WNL A;  4QQ6 A;  5CKB A;  4PJO A;  4LDW A;  3JCM e;  1YJN T;  4E7J A;  2K5F A;  1YJW T;  1M9S A;  3S3O A;  4F7U A;  2EQU A;  3L42 A;  3JAM E;  3HPW A;  4BUG A;  2K2V A;  3M54 A;  2QQS A;  3PIP A;  3DLL A;  1KC8 U;  2FVU A;  1BKB A;  4E47 A;  1YBY A;  1X75 C;  2P0Q A;  1VQP A;  4JLG A;  4M75 C;  4MZT A;  3CCU A;  3RKY A;  1XNI A;  4LDX A;  4OB1 B;  2RA2 A;  2X4W A;  3UDC A;  2M0O A;  4CI0 C;  3CBM A;  3P8H A;  2CS7 A;  4Y28 E;  4NL2 A;  4UC4 A;  3OYH A;  3CCE A;  4ZTF A;  3RER A;  1WQW A;  2XDP A;  3CPW A;  1TH7 A;  3JB9 H;  2F5K A;  4NOY A;  4C5E A;  4C92 F;  5AYF A;  4M7D A;  4BY6 B;  3L2Q A;  3QZ5 B;  2DEQ A;  3HRT A;  4J6Y A;  4C92 A;  3CCE T;  5FRM A;  2DD5 A;  2DK3 A;  1M1K U;  5FLX E;  4M7D E;  1JRI A;  3OB9 A;  3ER0 A;  1B34 A;  2VV5 A;  3SFM A;  3DLM A;  2LQ8 A;  3M56 A;  3TRE A;  1FXX A;  1M8V A;  2CZ6 B;  4N4H A;  1O9S A;  3J80 E;  4M75 D;  4JUV A;  3OYY A;  2K3X A;  4PJO G;  3CCR A;  4M77 G;  4JLI A;  2WAC A;  3N5B B;  2EAY A;  4ZN1 A;  1YHQ A;  1N9R A;  2LCC A;  4JRQ A;  1UGS B;  3SWN B;  4F7U F;  5HKC A;  3G6E A;  2OAU A;  4BI8 B;  5A0D A;  3CC7 A;  2V8J A;  3LW5 E;  2MAM A;  2EQJ A;  3DB4 A;  2PVG B;  3QUI A;  1Y96 B;  3GLX A;  4M7A F;  3CC4 T;  4KUD K;  5FU7 B;  1QP3 A;  2ZPH B;  4N0A C;  1KHI A;  4LDY A;  2X4J A;  2VC8 A;  3HKS A;  3QYH B;  3CC7 T;  4M7A C;  1U1S A;  5DY9 A;  3G71 T;  4PKC C;  2VGM A;  2D0Q B;  2MWO A;  3M55 A;  3M53 A;  2B8A A;  3DKM A;  3CCU T;  1UEB A;  3M59 A;  3OBW A;  2P0P A;  3SWN A;  1VQ4 A;  1ZQ1 A;  2DTH A;  5CKF A;  2E65 A;  2DIG A;  2RHZ A;  2RH2 A;  4ZTJ A;  4HT9 A;  4M7D F;  3JCM h;  2DTI A;  2DO3 A;  5GAN 6;  1KC8 C;  1QVG A;  3MEV A;  1YJN A;  1BIA A;  2E41 A;  2MWP A;  2LVM A;  2RJF A;  4LDU A;  1HK9 A;  4LD6 A;  2P0K A;  2RJE A;  3CCS T;  4JJN K;  2E64 A;  4A4E A;  2VUB A;  1KG1 A;  3QJY A;  5IN1 A;  1VQ4 T;  3TEE A;  3TCJ A;  4C5G A;  3HRU A;  4IUV A;  2XHC A;  4C92 B;  3JB9 D;  4M7A G;  5LJ3 e;  5M9O A;  3EAE A;  4M77 A;  5DLQ E;  4BD3 A;  5J39 A;  4FT4 A;  3G71 A;  1N9S A;  5CKE A;  3MP1 A;  4II1 A;  2RI5 A;  3QII A;  3QZ9 B;  4FL6 A;  4DQ2 A;  4ELY C;  3L2V A;  2K5L A;  5GAO q;  2GFA A;  3QO3 A;  3P8B B;  2R58 A;  3A5Z B;  3LWH A;  3E19 A;  3QPH A;  2LT1 A;  3H8Z A;  4EMK C;  2JNG A;  3CC4 A;  3LLR A;  3JB9 F;  3CBP A;  1R8O B;  2RB6 A;  5KCH A;  2GF7 A;  2I2L A;  2YHT A;  3J81 E;  2Y4Y A;  4M7D G;  1Y96 A;  1VQ7 A;  3G6E T;  2KK4 A;  2YLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...