5LJ5d

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
NGIPVKLLNEAQGHIVSLELTTGATYRGKLVESEDSMNVQLRDVIATEPQGAVTHMDQIFVRGSQIKFIVVPDLLKNAPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 14
structure length 82
sequence length 82
chains with identical sequence n
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
d PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5d00
4M75G 2DZ9A 2E64A 4XTUA 4M78C 4M77A 4F7UG 5LJ5h 3V8JA 4V2SA 2YLCA 4M7DF 2RB6A 3QO3A 3JB9I 1B34B 4HT9A 1H641 4M7DB 1WQ7A 1YCYA 4PJOD 2I2LA 1LJOA 1N9RA 3INZA 4J6XA 5GANj 3PGGA 1D3BB 4M75B 3V7CA 5GMKj 2JN0A 4F7UB 4N0AA 4F7UF 5GMKi 4NOYA 3JCMW 5LJ3g 4M7AC 3JCMg 2E1HA 4C8QC 3SWNB 5GANe 4NL2A 1I81A 2CGHA 3JCMP 4XU2A 5GAMh 4C92F 4M7DA 4XQ3A 1B34A 5GAOr 5GAMj 3RKXA 3V8LA 5GAN3 2DXTA 4C92E 2RD1A 4X9CA 4RCCA 5GAOq 2VXEA 1D3BA 4C92D 2EJFA 4M75A 5DY9A 3SB2A 4EMKC 4F7UA 5GAMe 3JCMb 1WPYA 4M77C 4X9DA 3V8KA 1TH7A 4JUVA 1Y96B 1M5Q1 1U1TA 3SWNA 4XU3A 5LJ3f 3JCMf 5GMKm 3HSBA 4C92A 2QTXA 4M7AG 4EMHA 2EJ9A 3EFRA 5LJ5j 5GAOl 4M78G 5GANd 4PJOC 1I4K1 3FJPA 4M7DE 2VXFA 2HNIA 2K57A 4M75F 3JCMc 3JCMJ 1X01A 5LJ5e 4M7DD 3JB9G 3AHUA 1Y96A 4M7AB 4M7AF 3JCMX 4XTXA 4XTZA 1HXDA 1I8FA 1BIBA 3EFSA 4M75E 4M78B 4F7UE 4M75D 3RERA 2DTOA 2RM4A 4C8QG 3RIRA 1KQ1A 5GAMd 4M7AE 2ZGWA 3HFOA 4HA8A 4J5YA 5GANf 3JB9F 1HK9A 3VU3C 2DJZA 2DTIA 3V7SA 5GAN8 4C92C 4C8QB 4EMGA 3FIFA 4MMLA 5GAN6 4M7AA 3M4GA 4M78A 5LJ5g 4M77G 5GAOp 1M8VA 5LJ5d 2EJGA 5GAOn 5GAMf 2RA2A 3RKWA 5GANg 2E10A 5I21A 4OP0A 4QVDA 4MMKA 4N0AC 4JRKA 5LJ3h 3HFNA 1JBMA 3JCMh 4XU0A 4EMKB 3JB9J 5GAN4 5GAN7 4M77B 2E65A 4PJOG 4JLIA 4C8QA 5CAIA 4HT8A 4M7DC 3JB9H 3QHSA 4XTWA 4A53A 3BFMA 4M78F 2DTHA 5GAMg 1BIAA 2DEQA 2YHTA 2FB7A 5LJ3e 5LJ5f 3JCMe 3JCMV 5GAOm 3GIBA 4DQ2A 4M7AD 4M75C 4RCBA 3QUIA 4M78E 4JRIA 3L1AA 4WF2A 4PJOF 4XTYA 4M78D 1WQWA 2DZCA 4PJOB 4EMKA 3SWNC 3JCMQ 3QSUA 2VC8A 4PJOE 2FYKA 3FB9A 3BY7A 4C8QF 3JB9D 4Y91A 5GANh 5GAN5 4C92G 5GMKh 2DXUA 4C8QE 4PNOA 3RESA 4C8QD 4QVCA 1KQ2A 4XU1A 1JRIA 1LNXA 4PJOA 2DKGA 1MGQA 2DVEA 2Y90A 4J6WA 4J6YA 3RUXA 3V7RA 5LJ3d 3JCMd 1LOJA 4M77F 4C92B 5GMKe 5LJ3j 5GMKl 2YLBA 3RKYA 1U1SA 3L2ZA 4NL3A 1I5LA 5GAN2 4A54A 4M77E 1N9SA 2E41A 3BDUA 4M7DG 1WNLA 4M77D 2EWNA 2EAYA 4XTVA 3BW1A
chains in the Genus database with same CATH superfamily
1YCSB 1UGQB 3HKSA 1AWXA 2EYXA 3U23A 1QWEA 3UA6A 1LJOA 4D6WA 1MV3A 2KT1A 4IUQA 3H9NA 2J6OA 1YP5A 4J83A 4JJDA 3JCMg 2RI3A 2DXCA 1YJ9A 4Z89A 4DA4A 1KK7A 5FW9A 2DXTA 2MF2A 1WHHA 1M27C 1D0ZA 4F7UA 1M2OA 1U1TA 4XU3A 2AZSA 4EDUA 3VRYA 7AT1B 2CSQA 4IURA 2WSCE 4C0DC 3CMAA 4M7AF 4XTXA 2L5QA 4M75D 4WCIA 2JTFA 2LDMA 1M9SA 3PVQA 3V7SA 4Y92A 4LD6A 2HBPA 2E10A 1YIJT 3CCJA 1KC8R 2VB6A 3CC4A 1MUZA 1CKBA 1TUGB 2CUBA 2OI3A 2LCLA 1MMDA 1K73R 2DEQA 2YRDA 3JCMV 1QVGS 2DD4A 2MWPA 2JVVA 2Y4YA 2K3YA 2KNBB 1WA7A 2E5QA 2OTJA 1HJDA 2FRWA 3BY7A 2LQNA 5CVIA 4ZN1A 2RHZA 1BYMA 5FU6C 2CH4A 3L2VA 4J6YA 2ABLA 4LNPA 1MMAA 3H6ZA 1VQ9A 1JEGA 1GCQA 4A54A 2LNVA 1QVFS 2VASA 3EG3A 2CP7A 4A4KA 2KSSA 5D7UA 2E64A 1SRMA 4PJOD 3E9GA 2J06A 1H641 2HQXA 2HDAA 2KI7A 2D6FA 4BD3A 4C8QC 3I55Q 5DLOA 2VGNA 2CGHA 4X34A 2LJ1A 2ROTA 2X51A 5HCKA 1ZX6A 1K9MU 3DLMA 2J7IA 5HY6A 3SB2A 3CCLT 2DVJA 1TOVA 1M5Q1 1K9AA 4LE9A 4QQDA 2DIGA 1RAEB 3DB3A 3G4SA 1WHLA 2OTLT 1AWJA 1UFFA 4RMOA 3JCMJ 2CREA 3VS5A 1YJNQ 2JZ2A 2QYZA 3I56Q 1OV3A 4ELZC 1GFCA 1SG5A 3SDZA 3EGXB 4DBRA 4MMLA 4PLIA 1GBRA 1K8AC 2LJ3A 2ED0A 1M8VA 3G71A 3M0TA 3MKDA 5A0GA 1VA7A 4MMKA 1B3QA 3J7AF 1JB0E 1FX7A 5C6SA 2F2VA 3RBBB 1G5VA 2YHTA 3JCMe 3OMGA 4PJOF 1XQHA 5J26A 4A63B 2FYKA 1KHCA 4C8QF 3JB9D 1AZGB 3EG0A 3JSCA 2PVOB 2QAZA 4JZ3A 1UGPB 4E7ZA 3M57A 4QW2A 1E6GA 1ABOA 2ZPFB 4PJMA 3RKYA 1ZBJA 2QASA 3CXCA 1WNLA 1JJ2A 1VQ4A 1Y0MA 2EAYA 2HKNA 1M3BA 2KRNA 2JS2A 2CT4A 1QCNA 2VWFA 3QO3A 3MEAA 1N9RA 2RF0A 4FM4B 3V7CA 5GMKj 3JCMW 5GMKi 3OYCA 2K79A 4ZTFA 1MNEA 1AOJA 2WSEE 1I81A 1D1CA 4P5NA 3MEUA 3OW2S 2P84A 1MMNA 4C92E 1D3BA 1WDXA 4KUDK 4OMPA 1QVPA 1UECA 2RHUA 1RACB 2M02A 4PL6A 2BTTA 2KRSA 3EGUA 4M78G 2CUDA 2EGEA 2VXFA 4DEXA 4ZNXA 2KBTA 1VQNQ 1FMKA 5KYUA 3CC7Q 2R5MA 1BI3A 1U8RA 3JB9F 1M3AA 4PLLA 2FPEA 3EHQA 2LZ6B 3OS0A 1NZ9A 1TUDA 3NFCA 5GAOp 2ESWA 1V1CA 1S72A 5LJ3h 1N8RC 3P8BB 4BY6B 4DBFA 1YJWQ 4JLIA 4C8QA 2JMCA 2RNAA 2BE9B 4JRIA 3ZBDA 3CCRQ 2E4HA 4AFSC 1D09B 3ME9A 1H3ZA 2HQEA 2CZ0B 5L8RE 3A98A 1N6AA 1U5SA 3FLGA 4PNOA 2LNHB 4QVCA 1E6HA 1YITT 2EFIA 1IRXA 2QI2A 1VQLQ 2K2VA 3OS5A 4C92B 3MP1A 1UTIA 2C0IA 4M77D 2EPDA 1VQ7Q 3EG2A 2KT8A 1K4US 1TSFA 3CC2A 1NEGA 3UDCA 8AT1B 1OULA 1G3WA 1GCPA 2DD5A 2YLCA 4EIKA 1KD1C 1YCYA 3OYFA 4AFUC 1Q7YR 1VYTA 5LJ3g 3CD6T 4QQ6A 2FVUA 2QDLA 3WVEB 3M5AA 3RMSA 2BIVA 2ZAEA 3RKXA 1YHQA 3EG9B 4GLMA 2D8JA 2LCCA 1VQMQ 2RJFA 4B9WA 2B8AA 4PFZA 4OB0B 4Q5WA 3G6EQ 1WX6A 3HP9A 4D8DA 4IIMA 1WJQA 3RDVA 1K0XA 1C1AA 4B9XA 4M7AB 2QA4Q 4M75E 2KVQG 1K73U 1RI0A 4CC4B 2CYZB 3ZFJA 3OYKA 4J9DA 2QQRA 4LD9K 4ORZA 1UGSB 1XJWB 1BI2A 3OYDA 2XI9A 2RJCA 2LQWA 5GANg 1KC8C 3OYBA 1PSEA 2DFUA 2XDDA 4N0AC 1IHVA 3UWNA 2CZ1B 1KFZA 3JB9J 5EG2A 1VQ5A 4IUPA 2RQVA 1IGUA 1T0JA 1X6OA 3VS0A 1UHCA 3LWIA 1I07A 2GF7A 2KE9A 5J3BA 4DQ2A 2JM9A 3LH5A 2D0QB 4HKEA 5A0LA 5KYXB 1K9MR 3VUZA 1QKWA 3CCVA 2M0YA 4JRQA 2RJEA 2GQVA 1NE8A 1NM7A 3I9QA 3IQLA 2H8HA 1UG1A 4JDSA 5J39A 1JO8A 2O88A 2XU8A 4HVVA 1ZBXA 1YI2Q 3QZ5B 1R77A 1YJNT 1PSFA 2EQUA 1VQ8T 4CC3A 2VUBA 5FROA 4NL3A 2MAMA 4M7DG 5CIUA 1OQKA 3TREA 3CCQQ 1FYNA 1PG5B 4N4GA 3QWXX 1VQ6Q 2PZ1A 3LX7A 4RTWA 1G8XA 3JV3A 3INZA 2EQIA 2FL7A 3EFOB 3NHNA 4M75B 3CMEQ 1Q82U 1EIFA 2YUOA 5I2SA 1WHJA 4MDXA 5GAOr 1VOMA 5GAOq 3CXCS 1JJ2S 1CSKA 4ZTJA 5DY9A 4BY6C 3Q1JA 2FPFA 2KR3A 4B6MA 5HKCA 1AZEA 1YJ9Q 4EMHA 4ME7A 2QQ9A 2EJ9A 1RI9A 4N4HA 2DRKA 1Q95G 1M1KR 3SHWA 2FHDA 3ER0A 2R58A 1QQJA 3HL8A 2DTOA 2ATCB 3OYMA 2ECZA 2MPXC 1YNZA 1OPLA 4C92C 4L59A 4E7HA 3CMAQ 3M4GA 3RNJA 1KQSA 1WHKA 1Z9ZA 3VS4A 3EGXA 1WHGA 2HZYA 5IXBA 2HAXA 4AFQC 2ZPIB 1WIEA 3MJXA 2B86A 2AHJB 1YIJA 5LJ3e 1AD5A 2XK0A 2J6KA 3H41A 4PJOB 4O6JA 3M9QA 3OYIA 1VIEA 2JOYA 4M4ZA 2RPNA 4L5GA 3R6NA 2O2OA 2YT6A 4MZPA 3TQ7P 5FU7B 1DJ7B 1JRIA 4JJBA 1NPPA 3QWYA 1VQNT 3SFMA 3VYGA 2YSQA 2NWMA 2J6FA 3CC7T 1U1SA 1IGQA 2WACA 5KCOA 3PIPA 2O9VA 1JU5C 1D1AA 4XTVA 3BW1A 3CPWA 1K1ZA 4M7AC 3LGLA 2ZZDA 1BB9A 4LDVA 2K9GA 1ARKA 1B34B 1VQ9Q 1ABQA 2BZXA 3PGGA 4DEYA 3OQ5A 2NUTB 4N0AA 4NOYA 1YJWT 2RN8A 2F5KA 5GANe 3T9NA 1TUCA 4C92F 2E6NA 3J81E 3DLLA 2NYSA 4FYVB 4X9CA 1NJIC 3M53A 3VUBA 3CCRT 3UT1A 1TH7A 3MP6A 1Y96B 4FSSA 1T0HA 3QPHA 2QGFB 2E6ZA 3F70A 2OJ2A 1QVGP 1H92A 3EFRA 3OMCA 3OBWA 1M90C 2GQIA 3M4YA 2ENMA 2NUPB 1RAHB 1VQLT 1D0YA 3NTIA 3EFSA 2DE0X 2OTLA 5D6WA 1I5OB 2K5LA 4J5YA 1HSQA 5KE3A 2F69A 1QVFP 1IREB 2DO3A 2C0TA 4R56A 3OS1A 1YBYA 2DAQA 1VQKT 3HFNA 2LP5A 4QKUA 5CAIA 4WTOB 3LLRA 3GOXA 5CQYA 1OZ3A 2VKNA 3OB9A 4M75C 3GLXA 4XTYA 4M78D 2RH2A 3OYGA 2X3XD 2EQKA 3G6ET 3QBYA 2DXUA 4F16A 4OB2B 4XU1A 4ZGDB 1Q7YU 4CC2A 2DYBA 2CZ7B 4F14A 3JCMd 1NEBA 1MV0B 2ZCFB 4BUGA 4M77E 3QIIA 5CKFA 3A5ZB 1H8KA 2K7AA 2NUZA 3G7ZA 4F7UG 2QQAA 2RB6A 1TWBA 3UF4A 5GANj 3M59A 1T3LA 1M30A 1C6VX 2C06A 4OMMA 2OAUA 3M0UA 3X26B 3V8LA 2L3QA 2XDBA 4J7FA 4RCCA 2VXEA 2A36A 2L89A 2EJFA 3X28B 1WPYA 4LUEA 1UHFA 5FRNA 3CCUA 4F04B 4AG1C 3EG9A 1TXQA 4HCKA 2K5FA 4PJOC 2L0AA 1M4ZA 3FJPA 4Z8AA 3QYGB 3KXTA 2EW3A 4M75F 4PJLA 5LJ5e 1OPKA 1OX9A 4C0ZA 4J7IA 1I8FA 1BIBA 4RTYA 5FU7C 1KQ1A 2PQWA 3TEEA 4VUBA 5GANf 1VQPQ 1VQ6T 4ANJA 4M7AA 2A3LA 2D0NA 2D1XA 3URGA 2M0OA 2RK2A 4QVDA 2A37A 2RI2A 4EMKB 1OYXA 4M77B 3REAB 4F17A 2AK5A 4JZ4A 1Q82R 1PRLC 2LQ8A 2E70A 3VJPA 4C5EA 2G6FX 3GF5A 2CP0A 2GNCA 2WSFE 4BE0A 4OMLA 1K9MC 1RAGB 3OYEA 5D6XA 4JJCA 1GXIE 1WHMA 3OYHA 3OW2P 2DL4A 2COYA 1YJ9T 3O5ZA 1TTHB 1Q81C 1KQSS 2X4WA 1G3YA 3X24B 1BKBA 3C95A 5KYXA 1MGQA 2QEXQ 1XNIA 1PWTA 4KUIA 4A4FA 4BDYA 2X3WD 3C12A 1YITA 1H3HA 4GBQA 4CC7A 4GLKA 2FZGB 2K3BA 4J6XA 1AT1B 4FCYA 3MO8A 2CKKA 4AMCA 1M1KU 3CCSQ 2QTVA 4E7LA 3CCEA 4XU2A 5GAMh 4XQ3A 5CCAA 2D8HA 3LW5E 5GAN3 1IXDA 2PVDB 3EFOA 1VQOQ 3CD6A 4HVWA 4M75A 4RTXA 3CPWS 1QKXA 2LC4A 3FDRA 2MIOA 4KH1B 5GJWB 1NLOC 1YN8A 5LJ5j 1EZZB 5IT9E 3TSWA 1YHQQ 3H0HA 4M7DD 1N5ZA 3PFSA 1NLPC 2ZPEB 3QYHB 2YRVA 2H3EB 1V29B 2P0PA 2ED1A 4C0GA 1ZSZB 1K76A 1B7TA 2KRMA 3CPFA 3OBYA 2AZVA 4DBHA 3E19A 3UA7A 3THKA 1PD0A 5IAYA 3FEOA 3CCMQ 2E65A 1Q86C 4AT1B 5GAMg 4Y28E 5LJ5f 4IUTA 2DYIA 1QCFA 1EFNA 4C0FA 2DL7A 2CZ6B 3MEWA 3OSSC 4Z02A 2VV5A 2KMTA 1VQ5Q 2RHYA 3PTAA 2LMJA 4PJOA 3MCAB 1VYVA 2HMAA 1P92A 3P8HA 1ZHIA 3QKJA 5GMKl 3REBB 2P0QA 1N9SA 2E41A 3BDUA 1QP2A 1EX4A 1YJNA 1VQ8A 2RHXA 3GNFB 4LDWA 5AT1B 1G3TA 4M7DF 2GTOA 2DBMA 1KJWA 1IHWA 3OYJA 1G2BA 2E3HA 4RTTA 2YUQA 3GNGA 4RG8A 2QQSA 4FYYB 5CR2A 1B34A 1PM3A 2NUTA 4EMKC 4M77C 4X9DA 1JXOA 4KT0E 3V8KA 2RHIA 3WXMB 1HYOA 2LRQA 3JCMf 4IUVA 1SSFA 3PE0A 4LDYA 2DK3A 1G83A 2K57A 1HD3A 3AHUA 2FZKB 1Y96A 2K4YA 1FXXA 5CO7A 2X4JA 2GCXA 4C8QG 2I0NA 4HA8A 2RMOA 2NUPA 2DTIA 1ZUKA 4A4GA 5GJVB 3D7SB 3OSVA 2KXDA 1ACMB 5GAOn 3RKWA 1R0CB 3QZ9B 2GFUA 4XU0A 1I0CA 3HRUA 1ZA2B 1SF9A 4XTWA 4K11A 2MYSA 4QT7A 2P4RA 2V1QA 4M78E 4A4HA 1LCKA 2DZCA 2PUKB 1MMGA 3M55A 4JLGA 1UE9A 1OU8A 1UJYA 1ZQ1A 3CXCP 1JJ2P 2IPOB 2COZA 4MZTA 3MP8A 1S1NA 2KGTA 5EC7A 2M16A 2SRCA 1OU9A 4J6WA 2FZCB 3V7RA 4HXJA 1AVZC 5LJ3d 3I55T 4M77F 1K73C 2YLBA 4LDXA 1VQPT 1WZOA 3MPUB 4E47A 4TVRA 3X25B 4OB1B 4V2SA 3EG1A 1UGRB 1WQ7A 4RTUA 3EH2A 1QLYA 1YFNA 1ZSZC 4FIBA 1WYXA 1IB8A 1WXUA 3I56T 5FWCA 2MCNA 2A0FB 2RD1A 1YJWA 1R0BG 2PTKA 2KROA 5GAMe 3G1JA 2ZPBB 3EGDB 1OI1A 5KH6A 1X75C 4XAXB 1RLQC 3OYLA 2H3JA 1KIKA 3CCRA 5GANd 3TSZA 1BCOA 2QEXT 4X1VA 1QW1A 2LVMA 4M78B 4JPBW 4ZGJB 2BE7D 4J9GA 3C4SA 3LYIA 2LT1A 1RAIB 2DBKA 4J9IA 4EMGA 4EPCA 3FIFA 3AT1B 4MZMA 4E7JA 3LH0A 4E7KA 2DPPB 4JRKA 4FW1A 3QDRB 3CCST 3VS1A 2XIDA 3FC3A 1Q82C 3S3OA 2G3RA 3JB9H 3QHSA 4KGVB 2P4TA 4A4EA 1BIAA 1VQOT 1VQKA 3QUIA 4WF2A 1B07A 2YUNA 1D1BA 4EMKA 1UDLA 3NGPA 1X2QA 4ATOA 2DERA 2DRMA 5KCHA 5GMKh 1ZLMA 4LUDA 2IIMA 2QK0A 2W0ZA 5ECAA 1SHFA 4FSXA 4IUUA 1TS9A 4KBMB 4BI8B 3G6EA 3L2ZA 1I5LA 3LGFA 4RG2A 2EWNA 3L2WA 2R5AA 1IO6A 4ELYC 3CCJQ 4HVUA 4OB3B 3CC4Q 3V8JA 1MHNA 3JB9I 4Z88A 4F7UF 3CCMT 3SWNB 1QMCA 2OTJQ 3A8HB 5GAMj 2RQUA 2MWOA 4JUVA 1VQ5T 2DA9A 2EYQA 5D6YA 2QTXA 3OYNA 5HK3A 5GAOl 1C0MA 1FMWA 4M7DE 2EGCA 3VRZA 3RMQA 2O31A 1X01A 3S3MA 3BDLA 1QWFA 3CCUQ 5FRMA 3RIRA 4L6V5 1LPLA 2OX7A 3MHXA 4LXCA 5AYFA 2A28A 2L3RA 2VVKA 2CP6A 2F2WA 5GAN6 2GGRA 2XG8D 4FYWB 2YDLA 1M2VB 2E12A 2RQTA 5LJ5d 2PUOB 2DL5A 5GAMf 2BZ8A 1M90U 2K6DA 4OP0A 3HPWA 3OA6A 1VQ6A 1NYGA 3EH1A 3CCLA 1JBMA 2EQMA 2JUFA 1ZSZA 4JS5A 2DTHA 1PRMC 3PNWC 4RCBA 1VQ7T 3L1AA 2BUDA 2GBQA 4PJJA 3G4SQ 2LT4A 2Z0WA 2VC8A 1Y71A 4J9CA 3META 1W2BS 1KD1R 4YTLA 2PVGB 3N5BB 2DVEA 1YWPA 1M1FA 1UGVA 5LJ3j 3S6WA 2FEIA 3VS3A 2K3XA 2VGMA 2HKQB 2FO0A 2DEUA 1VQMT 3G71Q 2EKHA 4RUGA 2DZ9A 3ZL7C 4M78C 4M7DB 2X4YA 1FWZA 3HHTB 1YITQ 3PVLA 4XK8E 3ASKA 1RLPC 4D8KA 2QA4T 2HL3A 3SD4A 1X69A 4PFOA 2JXBA 1X43A 2EYZA 5IN1A 3EHRA 4IIOA 1M8MA 3JCMb 1W4SA 4AG2C 5LJ3f 3HSBA 4C92A 2R57A 3CCEQ 2GTJA 2IVWA 5KYWB 3C0CA 2HNIA 1Q7YC 2KYMA 3CD6Q 1KQSP 2HL5C 2K2MA 5CKEA 1VQ4Q 5KYYB 1HXDA 5I11A 3FRNA 2DIQA 2V26A 4C5GA 8ATCB 1SRLA 3PMIA 3HFOA 4FT4A 2DJZA 4BI3A 4OMFB 2L8DA 3NPFA 1IZ6A 3M0RA 5CQXA 1O9SA 1CKAA 2AT1B 1YI2T 2KAFA 5GAN7 1TG0A 2HSEB 5I2MA 4OGCA 1RL2A 1V76A 4M78F 3VS7A 2JNGA 1WXBA 5DLQE 3A8OB 2XKOC 3CCQT 3SWNC 5KYNA 2GFAA 2CS7A 1GRIA 2J05A 4C92G 1WLPB 5CKHA 3CPWP 5C0MA 4C8QD 2XDPA 3ZEHA 3CMET 2LX7A 2DKGA 1M1GA 2O4XB 5GMKe 2Y4XA 2EVRA 2XD0A 5FLXE 3L42A 2KEAA 1Y57A 2O01E 1PD1A 2JMAA 3M0QA 1GFDA 1E7OA 1S72Q 4KGXB 2RQWA 1K8AU 4QVZA 1Q81U 2MMPA 2JS0A 2YWWA 4KGZB 3RR6A 1T3SA 2DILA 1OZ2A 4NL2A 1BCMA 1X27A 1VQ8Q 1Y7XA 3MEVA 3PMTA 2DNUA 1U3OA 4PK4A 2BKDN 3TU4K 4E7IA 2DJQA 3CMAT 5GMKm 4II1A 4M7AG 5I22A 2MOXA 4J9EA 3NTKA 3CQTA 4RKUE 5A2QE 3EGDA 1YWOA 1BBZA 3QG1A 3CC2Q 2BZYA 5FWBA 3QJYA 4F7UE 3RERA 2EYWA 1R8OB 1SPKA 3C94A 3A1PA 4ZN3A 1OOTA 3CCJT 1FMVA 5GAN8 3CC4T 4M78A 4JJNK 1RUWA 2HCKA 2L3PA 4PFPA 1SSHA 1WJRA 2LQKA 1W1FA 1M1KC 2RK1A 2X35A 2CH4W 3CBPA 1U06A 4JS4A 1QCOA 4HT8A 4M7DC 2OTJT 4BE1A 2XMFA 1NBEB 2DF6A 3JAME 1PCXA 4FW2A 1VUBA 4O5VA 4Y91A 1SEMA 1VQ9T 2XICA 3RESA 3UPUA 2XHCA 2V8KA 2Y90A 1Q86U 1Z9QA 3A8GB 1LOJA 5LL6S 3CCUT 2K5IA 3P8DA 3M58A 2KXCA 3WVDB 1GL5A 3DB4A 4UC4A 2LX9A 3I55A 1NJIR 3QDFA 1ZSGA 1WFWA 1UUEA 2RQRA 2AKKA 4M75G 5CKBA 3FJ5A 1PHTA 1J3TA 4KRTA 4HT9A 4BACA 1VQPA 2CT3A 1M90R 4F7UB 1M3CA 1N8RU 2PNIA 3L2UA 3JCMP 4IKFA 3CCVQ 3PT9A 1KG1A 2QG9B 1X6GA 3DKMA 3G4ST 2DMOA 3TVTA 2SEMA 1RAFB 2V8IA 3I56A 4LN2A 3SWNA 4FT2A 5L23A 4DOVA 2EQJA 2KQWA 2M1HA 1I4K1 5IHNA 3JCMc 3L2QA 2EKOA 4BDZA 2FRYA 3CBMA 4KH0B 4CI0C 2RM4A 5GAMd 4M7AE 2M9UA 1AHJB 1PKSA 2ZGWA 2O9SA 2QEXA 3GPLA 3G71T 2FPDA 2QDYB 3O8VA 4FYXB 1KD1U 4ZGEB 2F5TX 2RA2A 2ROLA 4ESRA 5I21A 4C5HA 3KFVA 3QXEB 2HQHA 2V1RA 5GAN4 4PJOG 3HRTA 1NG2A 1RAAB 5IHKA 3HTRA 4A53A 1M2VA 6AT1B 3E9FA 4JRPA 3CCSA 3CEYA 1OEBA 1ZA1B 1WQWA 3LWHA 3M0PA 2P0KA 3QSUA 3VS2A 3M56A 5GANh 1VQOA 3CCET 1WGSA 5GAN5 1PNJA 1JQQA 4BB7A 1W2BA 3GBQA 4MDWA 4DBQA 1KQ2A 2IG0A 2KYBA 1VQKQ 1UEBA 1VQ4T 2RJDA 2M51A 2X4XA 1QP3A 3VV0A 2CSIA 2YUPA 3VKIA 3BE3A 3OS2A 4PJNA 4E7SA 3QJ6A 2L2PA 3R6OA 4XTUA 4E6RA 1KC8U 2DXBA 5HK0A 2KY9A 1YIJQ 1AEYA 1A0NB 5A0DA 1SHGA 3PIOA 1UJ0A 1NYFA 2RO0A 1OX8A 1W70A 1X6BA 2MI6A 4M7DA 2JT4A 5KE2A 4OMOA 4E2FB 3CCMA 2KDSA 1VQNA 1ZUYA 3CC7A 1D0XA 3M54A 4FU6A 3H0FA 1X2KA 4DOWA 3KUFA 5CKDA 2ZPGB 3JB9G 1RABB 3I35A 4N4IA 1Y07A 2LJ0A 3H0IA 3NTHA 4HCZA 3H8ZA 5KYWA 1QVGA 1HK9A 1VIFA 3VU3C 4GY5A 2JTEA 1S72T 1BU1A 2JTMA 4LDUA 1PC0A 5KYYA 4BI4A 5DM7R 2DM1A 1O75A 3GP8A 1KSWA 1K8AR 2EJGA 4BE2A 1Q81R 1XTDA 2QGGA 3KBGA 1BI1A 2CDTA 1AWOA 5CK9A 4R0KA 2E5KA 2CP2A 2NLUA 1BK2A 2A08A 3E2UA 4R55A 4HCCA 1WXTA 1TU0B 3BFMA 3GIBA 2FB7A 5GAOm 3L2RA 3SEMA 9ATCB 4OMQA 1QVFA 4OF1A 3CBOA 1N27A 1VQLA 2C0OA 3A8MB 4C0DB 3CCLQ 2EIFA 4NS5A 4PJOE 1G3SA 2QXFA 1GBQA 2LCSA 4KULA 2F2XA 1VQ7A 4C8QE 2AIRB 2OTLQ 1LNXA 2ZPHB 3CC2T 2D9TA 4AFZC 5GAN2 3VS6A 2MK5A 4J9FA 2V8JA 2JW4A 2JJ9A 2F1LA 2O4XA 2VYTA 4OMNA 5IH2A 2CP3A 5LJ5h 3A8LB 4M77A 3OY9A 5IXFA 5IHIA 2A7YA 1UB4A 2I2LA 3HRSA 1VQMA 3J80E 2HSPA 1D3BB 1I1JA 1MNDA 1YHQT 1F1BB 2JN0A 1XOVA 2E1HA 4OVAA 2CP5A 1LVKA 4C92D 3OYYA 5FU6B 2QA4A 4J9HA 1KHIA 2OAWA 2E3IA 2FG0A 1W6XA 3EAEA 4J9BA 5KYUB 3VYHB 2X9HA 1VYUA 2AKLA 2DL3A 4J8OA 3UATA 4RTZA 1W2BP 2HD0A 3JCMX 3I5SA 4XTZA 1Q86R 1GCQC 2EYYA 2PU9B 4QQGA 3S3NA 2YXYA 3NMZC 1WI7A 3JRZA 2YRCA 5M9OA 3X20B 2KK4A 4C8QB 2DLPA 1SKUB 5LJ5g 4M77G 3TCJA 1RADB 2EBPA 2LTOA 2RI5A 2QQBA 3ULRB 3JCMh 1K0SA 3E1SA 1BI0A 1N8RR 3I5RA 1JXMA 3CCVT 2DX1A 4M7AD 1YI2A 1NJIU 2COWA 2W10A 1NPRA 2L3SA 3JCMQ 2DETA 1WJSA 3FB9A 1AWWA 2HEQA 4FL6A 4C5IA 1PKTA 3CCQA 3OYAA 4CRIA 3RUXA 4HCBA 3M0SA 4OGEA 2EGAA 2DL8A 3OW2A 3CMEA 4PKCC 2HBWA 4RTVA 2JM8A 1ZUUA
chains in the Genus database with same CATH topology
1UGQB 3HKSA 4LDWA 3LX7A 1G3TA 1K8AU 4M7DF 4QVZA 1Q81U 2MMPA 1LJOA 3INZA 2FL7A 4D6WA 4M75B 4IUQA 3OYJA 4J83A 3GNGA 3JCMg 4RG8A 1Q82U 1EIFA 1OZ2A 2QQSA 2DXCA 2RI3A 4NL2A 1YJ9A 1Y7XA 5I2SA 5CR2A 1B34A 5GAOr 4MDXA 4DA4A 3MEVA 3PMTA 2DXTA 5GAOq 2MF2A 3CXCS 1JJ2S 2BKDN 4ZTJA 3TU4K 5DY9A 4EMKC 4F7UA 4M77C 4X9DA 3WXMB 4KT0E 3V8KA 2RHIA 4BY6C 3Q1JA 1U1TA 4E7IA 4XU3A 3CMAT 2LRQA 3JCMf 4IUVA 4II1A 4EDUA 5HKCA 5GMKm 1SSFA 4M7AG 4EMHA 4ME7A 2QQ9A 2EJ9A 4N4HA 4LDYA 2DK3A 3NTKA 4RKUE 4IURA 2WSCE 5A2QE 2K57A 4C0DC 3CMAA 3AHUA 2FHDA 3QG1A 1Y96A 4M7AF 2K4YA 4XTXA 3ER0A 1FXXA 2L5QA 2R58A 3QJYA 5CO7A 3HL8A 4M75D 4F7UE 3RERA 2DTOA 2GCXA 2X4JA 4C8QG 2JTFA 2LDMA 1R8OB 1M9SA 4HA8A 3C94A 4ZN3A 3OYMA 2DTIA 3V7SA 3CCJT 5GAN8 4C92C 3CC4T 4L59A 4A4GA 4E7HA 3M4GA 4M78A 3OSVA 4JJNK 4LD6A 2HBPA 5GAOn 1KQSA 3RKWA 2E10A 3QZ9B 1WJRA 2LQKA 2GFUA 1YIJT 3CCJA 2HAXA 3CC4A 1M1KC 2RK1A 2X35A 4XU0A 2ZPIB 3CBPA 4JS4A 3HRUA 4HT8A 4M7DC 2LCLA 4BE1A 2OTJT 4XTWA 2AHJB 1YIJA 2DEQA 5LJ3e 3JCMV 3JAME 2XK0A 4M78E 4A4HA 1QVGS 2DD4A 2MWPA 4PJOB 1VUBA 2DZCA 2JVVA 2K3YA 2PUKB 2Y4YA 2E5QA 3M55A 3M9QA 4JLGA 4O6JA 2OTJA 1ZQ1A 3OYIA 1VIEA 2JOYA 3BY7A 4O5VA 4Y91A 4L5GA 5CVIA 4ZN1A 2RHZA 4MZPA 4MZTA 5FU7B 1VQ9T 1DJ7B 2XICA 3MP8A 3RESA 1BYMA 5FU6C 1JRIA 2M16A 3UPUA 2XHCA 3L2VA 1NPPA 2V8KA 2Y90A 4J6WA 4J6YA 3V7RA 1Q86U 3SFMA 3A8GB 5LJ3d 3VYGA 3I55T 1VQNT 1LOJA 3H6ZA 5LL6S 4M77F 2K5IA 3CCUT 1VQ9A 1K73C 3P8DA 3M58A 2YLBA 3CC7T 1U1SA 2WACA 5KCOA 3PIPA 4A54A 3WVDB 2LNVA 3DB4A 1QVFS 4LDXA 4UC4A 2LX9A 1VQPT 3I55A 4A4KA 4E47A 2KSSA 4TVRA 4XTVA 3X25B 3BW1A 3CPWA 4M7AC 3LGLA 4M75G 4OB1B 5CKBA 2E64A 4V2SA 2ZZDA 4LDVA 4PJOD 3E9GA 1B34B 4HT9A 1H641 1UGRB 1WQ7A 4BACA 1VQPA 2HQXA 2D6FA 3PGGA 3OQ5A 4BD3A 4F7UB 4N0AA 4NOYA 1N8RU 1YJWT 4C8QC 3L2UA 2F5KA 4FIBA 5GANe 2VGNA 2CGHA 4X34A 3T9NA 5DLOA 3JCMP 4C92F 2E6NA 3I56T 4IKFA 3J81E 3DLLA 3PT9A 1KG1A 2RD1A 4X9CA 3DKMA 3DLMA 1NJIC 1YJWA 1K9MU 5HY6A 3M53A 3VUBA 3G4ST 3SB2A 3UT1A 3CCRT 5GAMe 3CCLT 2ZPBB 1TH7A 1OI1A 1Y96B 1M5Q1 2V8IA 3MP6A 3SWNA 3I56A 4QQDA 5KH6A 3QPHA 2E6ZA 3F70A 1X75C 4XAXB 4FT2A 2DIGA 2H3JA 3OYLA 3EFRA 3DB3A 3OMCA 3OBWA 4DOVA 2EQJA 2KQWA 5GANd 3G4SA 3CCRA 2OTLT 2M1HA 1I4K1 3M4YA 1M90C 2QEXT 4RMOA 3JCMJ 3JCMc 1QW1A 1VQLT 3L2QA 2LVMA 2EKOA 3NTIA 4BDZA 2JZ2A 3EFSA 4M78B 3CBMA 4CI0C 4ELZC 2RM4A 4ZGJB 5GAMd 2OTLA 4M7AE 2M9UA 1AHJB 2ZGWA 3C4SA 5D6WA 2QEXA 3GPLA 2K5LA 3SDZA 4J5YA 3LYIA 5KE3A 3G71T 2LT1A 2QDYB 3O8VA 4EMGA 4EPCA 2F69A 3FIFA 4MMLA 1IREB 4PLIA 1K8AC 2DO3A 4R56A 1M8VA 4MZMA 1KD1U 4ZGEB 3OS1A 1YBYA 2F5TX 3G71A 2RA2A 4E7JA 3LH0A 4E7KA 2DPPB 5I21A 5A0GA 2DAQA 4MMKA 3QXEB 4JRKA 4C5HA 3QDRB 3CCST 1VQKT 3HFNA 3J7AF 2XIDA 5GAN4 3FC3A 4PJOG 3HRTA 3S3OA 5CAIA 1Q82C 1JB0E 1FX7A 2G3RA 3LLRA 5C6SA 3QHSA 3JB9H 4A53A 2P4TA 4A4EA 3GOXA 3E9FA 4JRPA 1G5VA 1BIAA 5CQYA 2YHTA 3JCMe 1OZ3A 3CCSA 1VQOT 1VQKA 3OB9A 3CEYA 4M75C 3OMGA 3QUIA 3GLXA 4PJOF 4WF2A 1XQHA 4XTYA 4M78D 1WQWA 5J26A 3LWHA 2RH2A 2P0KA 4EMKA 3QSUA 3OYGA 2FYKA 1KHCA 4C8QF 4ATOA 2EQKA 3M56A 3JB9D 5GANh 3QBYA 3G6ET 1VQOA 3CCET 1WGSA 5GAN5 5KCHA 5GMKh 2DXUA 4BB7A 1W2BA 3JSCA 4MDWA 1KQ2A 2PVOB 4OB2B 4XU1A 4ZGDB 2IG0A 1Q7YU 1UEBA 1UGPB 2CZ7B 1VQ4T 4FSXA 3JCMd 2RJDA 4IUUA 4KBMB 4BI8B 3G6EA 2X4XA 1QP3A 3M57A 4QW2A 3VV0A 2ZPFB 2ZCFB 4BUGA 3RKYA 3L2ZA 3VKIA 1I5LA 4M77E 3LGFA 3OS2A 3CXCA 1WNLA 3QIIA 4RG2A 1JJ2A 2EWNA 3L2WA 1VQ4A 2EAYA 2R5AA 3QJ6A 5CKFA 3A5ZB 4ELYC 3G7ZA 4OB3B 3R6OA 4XTUA 2QQAA 4F7UG 3V8JA 1MHNA 2RB6A 3MEAA 3QO3A 3JB9I 1N9RA 1KC8U 2DXBA 5HK0A 5GANj 2KY9A 4FM4B 3M59A 3V7CA 5GMKj 4F7UF 5A0DA 3JCMW 5GMKi 3PIOA 3OYCA 3CCMT 2C06A 3SWNB 4ZTFA 2RO0A 2WSEE 1I81A 2OAUA 4P5NA 2MI6A 4M7DA 3A8HB 5KE2A 3X26B 3MEUA 5GAMj 3V8LA 3OW2S 2XDBA 4C92E 4J7FA 4RCCA 2VXEA 1D3BA 2L89A 3CCMA 2EJFA 2KDSA 1VQNA 4KUDK 2MWOA 3X28B 1QVPA 1WPYA 2RHUA 5FRNA 3CCUA 4JUVA 1VQ5T 3CC7A 2EYQA 5D6YA 4PL6A 2QTXA 3OYNA 5HK3A 3M54A 5GAOl 4FU6A 4M78G 2K5FA 4PJOC 1M4ZA 3FJPA 4M7DE 2VXFA 3QYGB 3KXTA 4M75F 3RMQA 3S3MA 1X01A 4DOWA 3KUFA 5CKDA 5LJ5e 2ZPGB 3JB9G 4C0ZA 3BDLA 4N4IA 4J7IA 1I8FA 1BIBA 1Y07A 5FRMA 5FU7C 3RIRA 1KQ1A 4L6V5 2R5MA 3NTHA 1BI3A 2PQWA 4HCZA 3TEEA 3H8ZA 3MHXA 4VUBA 5GANf 1U8RA 3JB9F 1QVGA 1HK9A 1VIFA 4PLLA 4GY5A 5AYFA 3VU3C 2L3RA 1VQ6T 1S72T 3OS0A 5GAN6 4M7AA 2JTMA 2XG8D 4LDUA 1NZ9A 4BI4A 2A3LA 5DM7R 1O75A 3GP8A 2E12A 3NFCA 3URGA 5GAOp 5LJ5d 2PUOB 2EJGA 2M0OA 4BE2A 5GAMf 1M90U 3HPWA 1XTDA 2RK2A 3KBGA 4OP0A 4QVDA 1BI1A 3OA6A 1S72A 3CCLA 1VQ6A 5CK9A 5LJ3h 1JBMA 2RI2A 4EMKB 1N8RC 2EQMA 3P8BB 1OYXA 4M77B 4BY6B 4JLIA 2JUFA 2NLUA 4C8QA 4R55A 4HCCA 2LQ8A 2E70A 3VJPA 3BFMA 4C5EA 2DTHA 3GF5A 4JS5A 2WSFE 3GIBA 2FB7A 5GAOm 4BE0A 3L2RA 1QVFA 3PNWC 1K9MC 4RCBA 1VQ7T 3OYEA 4OF1A 3CBOA 1N27A 3L1AA 2BUDA 4JRIA 5D6XA 3ZBDA 1VQLA 1GXIE 3OYHA 2LT4A 3A8MB 4C0DB 2EIFA 2VC8A 4NS5A 4PJOE 1Y71A 1G3SA 3ME9A 2QXFA 1YJ9T 1H3ZA 2HQEA 2CZ0B 4KULA 5L8RE 1VQ7A 1N6AA 3META 1W2BS 1Q81C 1KQSS 4C8QE 3FLGA 4PNOA 2X4WA 4YTLA 4QVCA 1YITT 1G3YA 2PVGB 2EFIA 1LNXA 3X24B 1BKBA 2QI2A 3C95A 1MGQA 3N5BB 2DVEA 2ZPHB 3CC2T 1XNIA 4KUIA 1M1FA 4A4FA 2K2VA 4BDYA 3OS5A 4C92B 5LJ3j 3C12A 2D9TA 3S6WA 3MP1A 1YITA 5GAN2 2K3XA 2VGMA 4M77D 2V8JA 3CC2A 1VQMT 4GLKA 2VYTA 2O4XA 3UDCA 1G3WA 2DZ9A 3A8LB 4M78C 4M77A 5LJ5h 2DD5A 2YLCA 3OY9A 4M7DB 1KD1C 1YCYA 2A7YA 1UB4A 2I2LA 2X4YA 1FWZA 3HRSA 4J6XA 1VQMA 3HHTB 3J80E 1D3BB 1YHQT 3MO8A 2CKKA 2JN0A 3ASKA 4XK8E 3OYFA 1M1KU 1XOVA 5LJ3g 3CD6T 2E1HA 4E7LA 4QQ6A 2FVUA 2QA4T 3CCEA 3WVEB 4XU2A 3SD4A 5GAMh 4XQ3A 3M5AA 5CCAA 3RMSA 2BIVA 1YHQA 3LW5E 3RKXA 5GAN3 4OVAA 5IN1A 2PVDB 3CD6A 4C92D 3OYYA 2LCCA 4M75A 2RJFA 5FU6B 4B9WA 3JCMb 2QA4A 3CPWS 1W4SA 2B8AA 2LC4A 3FDRA 5LJ3f 1KHIA 3HSBA 4C92A 3EAEA 2R57A 4OB0B 4Q5WA 5LJ5j 5IT9E 3HP9A 3VYHB 2IVWA 1WJQA 2HNIA 1Q7YC 4M7DD 4J8OA 4B9XA 3PFSA 5CKEA 4M7AB 2HD0A 3JCMX 2ZPEB 4XTZA 1HXDA 4M75E 3QYHB 2KVQG 1K73U 1RI0A 2PU9B 2DIQA 3FRNA 4QQGA 4C5GA 3S3NA 2CYZB 3ZFJA 3OYKA 2YRVA 1V29B 3PMIA 2QQRA 3HFOA 2P0PA 3JRZA 4LD9K 4FT4A 4C0GA 1UGSB 2DJZA 4BI3A 5M9OA 1BI2A 3X20B 2KK4A 4C8QB 3OYDA 4OMFB 2L8DA 5LJ5g 4M77G 2XI9A 3CPFA 1IZ6A 3OBYA 2RJCA 3TCJA 5CQXA 1O9SA 5GANg 3OYBA 1KC8C 3E19A 2LTOA 1PSEA 2XDDA 2RI5A 4N0AC 2QQBA 5IAYA 3UWNA 3JCMh 2CZ1B 1YI2T 3E1SA 3FEOA 5EG2A 1BI0A 2KAFA 3JB9J 1VQ5A 5GAN7 2E65A 1Q86C 4IUPA 5I2MA 4OGCA 1RL2A 1X6OA 3CCVT 5GAMg 4M78F 3LWIA 4Y28E 2GF7A 5LJ5f 5J3BA 2JNGA 4IUTA 4DQ2A 4M7AD 1YI2A 2D0QB 4HKEA 5A0LA 1NJIU 4C0FA 2CZ6B 5DLQE 3A8OB 3VUZA 1NPRA 2XKOC 3MEWA 3CCQT 3JCMQ 3OSSC 3SWNC 3CCVA 1WJSA 4JRQA 2RJEA 4Z02A 3FB9A 2GFAA 2VV5A 2KMTA 2CS7A 2GQVA 2RHYA 1NE8A 4FL6A 3PTAA 4C92G 4C5IA 4JDSA 5CKHA 5J39A 5C0MA 4C8QD 3CCQA 3OYAA 2XDPA 3ZEHA 4PJOA 2XU8A 4CRIA 3CMET 1ZBXA 2DKGA 1M1GA 3MCAB 3RUXA 2O4XB 4HCBA 3QZ5B 1YJNT 1P92A 1PSFA 2EQUA 3P8HA 1ZHIA 3QKJA 5GMKe 2Y4XA 1VQ8T 5GMKl 2VUBA 5FROA 2XD0A 4OGEA 2P0QA 4NL3A 5FLXE 3OW2A 2MAMA 1N9SA 2E41A 3CMEA 3BDUA 3L42A 4PKCC 1QP2A 4M7DG 5CIUA 2O01E 1YJNA 3TREA 1VQ8A 2RHXA 3GNFB 4N4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M75 G;  2DZ9 A;  2E64 A;  4XTU A;  4M78 C;  4M77 A;  4F7U G;  5LJ5 h;  3V8J A;  4V2S A;  2YLC A;  4M7D F;  2RB6 A;  3QO3 A;  3JB9 I;  1B34 B;  4HT9 A;  1H64 1;  4M7D B;  1WQ7 A;  1YCY A;  4PJO D;  2I2L A;  1LJO A;  1N9R A;  3INZ A;  4J6X A;  5GAN j;  3PGG A;  1D3B B;  4M75 B;  3V7C A;  5GMK j;  2JN0 A;  4F7U B;  4N0A A;  4F7U F;  5GMK i;  4NOY A;  3JCM W;  5LJ3 g;  4M7A C;  3JCM g;  2E1H A;  4C8Q C;  3SWN B;  5GAN e;  4NL2 A;  1I81 A;  2CGH A;  3JCM P;  4XU2 A;  5GAM h;  4C92 F;  4M7D A;  4XQ3 A;  1B34 A;  5GAO r;  5GAM j;  3RKX A;  3V8L A;  5GAN 3;  2DXT A;  4C92 E;  2RD1 A;  4X9C A;  4RCC A;  5GAO q;  2VXE A;  1D3B A;  4C92 D;  2EJF A;  4M75 A;  5DY9 A;  3SB2 A;  4EMK C;  4F7U A;  5GAM e;  3JCM b;  1WPY A;  4M77 C;  4X9D A;  3V8K A;  1TH7 A;  4JUV A;  1Y96 B;  1M5Q 1;  1U1T A;  3SWN A;  4XU3 A;  5LJ3 f;  3JCM f;  5GMK m;  3HSB A;  4C92 A;  2QTX A;  4M7A G;  4EMH A;  2EJ9 A;  3EFR A;  5LJ5 j;  5GAO l;  4M78 G;  5GAN d;  4PJO C;  1I4K 1;  3FJP A;  4M7D E;  2VXF A;  2HNI A;  2K57 A;  4M75 F;  3JCM c;  3JCM J;  1X01 A;  5LJ5 e;  4M7D D;  3JB9 G;  3AHU A;  1Y96 A;  4M7A B;  4M7A F;  3JCM X;  4XTX A;  4XTZ A;  1HXD A;  1I8F A;  1BIB A;  3EFS A;  4M75 E;  4M78 B;  4F7U E;  4M75 D;  3RER A;  2DTO A;  2RM4 A;  4C8Q G;  3RIR A;  1KQ1 A;  5GAM d;  4M7A E;  2ZGW A;  3HFO A;  4HA8 A;  4J5Y A;  5GAN f;  3JB9 F;  1HK9 A;  3VU3 C;  2DJZ A;  2DTI A;  3V7S A;  5GAN 8;  4C92 C;  4C8Q B;  4EMG A;  3FIF A;  4MML A;  5GAN 6;  4M7A A;  3M4G A;  4M78 A;  5LJ5 g;  4M77 G;  5GAO p;  1M8V A;  5LJ5 d;  2EJG A;  5GAO n;  5GAM f;  2RA2 A;  3RKW A;  5GAN g;  2E10 A;  5I21 A;  4OP0 A;  4QVD A;  4MMK A;  4N0A C;  4JRK A;  5LJ3 h;  3HFN A;  1JBM A;  3JCM h;  4XU0 A;  4EMK B;  3JB9 J;  5GAN 4;  5GAN 7;  4M77 B;  2E65 A;  4PJO G;  4JLI A;  4C8Q A;  5CAI A;  4HT8 A;  4M7D C;  3JB9 H;  3QHS A;  4XTW A;  4A53 A;  3BFM A;  4M78 F;  2DTH A;  5GAM g;  1BIA A;  2DEQ A;  2YHT A;  2FB7 A;  5LJ3 e;  5LJ5 f;  3JCM e;  3JCM V;  5GAO m;  3GIB A;  4DQ2 A;  4M7A D;  4M75 C;  4RCB A;  3QUI A;  4M78 E;  4JRI A;  3L1A A;  4WF2 A;  4PJO F;  4XTY A;  4M78 D;  1WQW A;  2DZC A;  4PJO B;  4EMK A;  3SWN C;  3JCM Q;  3QSU A;  2VC8 A;  4PJO E;  2FYK A;  3FB9 A;  3BY7 A;  4C8Q F;  3JB9 D;  4Y91 A;  5GAN h;  5GAN 5;  4C92 G;  5GMK h;  2DXU A;  4C8Q E;  4PNO A;  3RES A;  4C8Q D;  4QVC A;  1KQ2 A;  4XU1 A;  1JRI A;  1LNX A;  4PJO A;  2DKG A;  1MGQ A;  2DVE A;  2Y90 A;  4J6W A;  4J6Y A;  3RUX A;  3V7R A;  5LJ3 d;  3JCM d;  1LOJ A;  4M77 F;  4C92 B;  5GMK e;  5LJ3 j;  5GMK l;  2YLB A;  3RKY A;  1U1S A;  3L2Z A;  4NL3 A;  1I5L A;  5GAN 2;  4A54 A;  4M77 E;  1N9S A;  2E41 A;  3BDU A;  4M7D G;  1WNL A;  4M77 D;  2EWN A;  2EAY A;  4XTV A;  3BW1 A; 
#chains in the Genus database with same CATH topology
 1YCS B;  1UGQ B;  3HKS A;  1AWX A;  2EYX A;  3U23 A;  1QWE A;  3UA6 A;  1LJO A;  4D6W A;  1MV3 A;  2KT1 A;  4IUQ A;  3H9N A;  2J6O A;  1YP5 A;  4J83 A;  4JJD A;  3JCM g;  2RI3 A;  2DXC A;  1YJ9 A;  4Z89 A;  4DA4 A;  1KK7 A;  5FW9 A;  2DXT A;  2MF2 A;  1WHH A;  1M27 C;  1D0Z A;  4F7U A;  1M2O A;  1U1T A;  4XU3 A;  2AZS A;  4EDU A;  3VRY A;  7AT1 B;  2CSQ A;  4IUR A;  2WSC E;  4C0D C;  3CMA A;  4M7A F;  4XTX A;  2L5Q A;  4M75 D;  4WCI A;  2JTF A;  2LDM A;  1M9S A;  3PVQ A;  3V7S A;  4Y92 A;  4LD6 A;  2HBP A;  2E10 A;  1YIJ T;  3CCJ A;  1KC8 R;  2VB6 A;  3CC4 A;  1MUZ A;  1CKB A;  1TUG B;  2CUB A;  2OI3 A;  2LCL A;  1MMD A;  1K73 R;  2DEQ A;  2YRD A;  3JCM V;  1QVG S;  2DD4 A;  2MWP A;  2JVV A;  2Y4Y A;  2K3Y A;  2KNB B;  1WA7 A;  2E5Q A;  2OTJ A;  1HJD A;  2FRW A;  3BY7 A;  2LQN A;  5CVI A;  4ZN1 A;  2RHZ A;  1BYM A;  5FU6 C;  2CH4 A;  3L2V A;  4J6Y A;  2ABL A;  4LNP A;  1MMA A;  3H6Z A;  1VQ9 A;  1JEG A;  1GCQ A;  4A54 A;  2LNV A;  1QVF S;  2VAS A;  3EG3 A;  2CP7 A;  4A4K A;  2KSS A;  5D7U A;  2E64 A;  1SRM A;  4PJO D;  3E9G A;  2J06 A;  1H64 1;  2HQX A;  2HDA A;  2KI7 A;  2D6F A;  4BD3 A;  4C8Q C;  3I55 Q;  5DLO A;  2VGN A;  2CGH A;  4X34 A;  2LJ1 A;  2ROT A;  2X51 A;  5HCK A;  1ZX6 A;  1K9M U;  3DLM A;  2J7I A;  5HY6 A;  3SB2 A;  3CCL T;  2DVJ A;  1TOV A;  1M5Q 1;  1K9A A;  4LE9 A;  4QQD A;  2DIG A;  1RAE B;  3DB3 A;  3G4S A;  1WHL A;  2OTL T;  1AWJ A;  1UFF A;  4RMO A;  3JCM J;  2CRE A;  3VS5 A;  1YJN Q;  2JZ2 A;  2QYZ A;  3I56 Q;  1OV3 A;  4ELZ C;  1GFC A;  1SG5 A;  3SDZ A;  3EGX B;  4DBR A;  4MML A;  4PLI A;  1GBR A;  1K8A C;  2LJ3 A;  2ED0 A;  1M8V A;  3G71 A;  3M0T A;  3MKD A;  5A0G A;  1VA7 A;  4MMK A;  1B3Q A;  3J7A F;  1JB0 E;  1FX7 A;  5C6S A;  2F2V A;  3RBB B;  1G5V A;  2YHT A;  3JCM e;  3OMG A;  4PJO F;  1XQH A;  5J26 A;  4A63 B;  2FYK A;  1KHC A;  4C8Q F;  3JB9 D;  1AZG B;  3EG0 A;  3JSC A;  2PVO B;  2QAZ A;  4JZ3 A;  1UGP B;  4E7Z A;  3M57 A;  4QW2 A;  1E6G A;  1ABO A;  2ZPF B;  4PJM A;  3RKY A;  1ZBJ A;  2QAS A;  3CXC A;  1WNL A;  1JJ2 A;  1VQ4 A;  1Y0M A;  2EAY A;  2HKN A;  1M3B A;  2KRN A;  2JS2 A;  2CT4 A;  1QCN A;  2VWF A;  3QO3 A;  3MEA A;  1N9R A;  2RF0 A;  4FM4 B;  3V7C A;  5GMK j;  3JCM W;  5GMK i;  3OYC A;  2K79 A;  4ZTF A;  1MNE A;  1AOJ A;  2WSE E;  1I81 A;  1D1C A;  4P5N A;  3MEU A;  3OW2 S;  2P84 A;  1MMN A;  4C92 E;  1D3B A;  1WDX A;  4KUD K;  4OMP A;  1QVP A;  1UEC A;  2RHU A;  1RAC B;  2M02 A;  4PL6 A;  2BTT A;  2KRS A;  3EGU A;  4M78 G;  2CUD A;  2EGE A;  2VXF A;  4DEX A;  4ZNX A;  2KBT A;  1VQN Q;  1FMK A;  5KYU A;  3CC7 Q;  2R5M A;  1BI3 A;  1U8R A;  3JB9 F;  1M3A A;  4PLL A;  2FPE A;  3EHQ A;  2LZ6 B;  3OS0 A;  1NZ9 A;  1TUD A;  3NFC A;  5GAO p;  2ESW A;  1V1C A;  1S72 A;  5LJ3 h;  1N8R C;  3P8B B;  4BY6 B;  4DBF A;  1YJW Q;  4JLI A;  4C8Q A;  2JMC A;  2RNA A;  2BE9 B;  4JRI A;  3ZBD A;  3CCR Q;  2E4H A;  4AFS C;  1D09 B;  3ME9 A;  1H3Z A;  2HQE A;  2CZ0 B;  5L8R E;  3A98 A;  1N6A A;  1U5S A;  3FLG A;  4PNO A;  2LNH B;  4QVC A;  1E6H A;  1YIT T;  2EFI A;  1IRX A;  2QI2 A;  1VQL Q;  2K2V A;  3OS5 A;  4C92 B;  3MP1 A;  1UTI A;  2C0I A;  4M77 D;  2EPD A;  1VQ7 Q;  3EG2 A;  2KT8 A;  1K4U S;  1TSF A;  3CC2 A;  1NEG A;  3UDC A;  8AT1 B;  1OUL A;  1G3W A;  1GCP A;  2DD5 A;  2YLC A;  4EIK A;  1KD1 C;  1YCY A;  3OYF A;  4AFU C;  1Q7Y R;  1VYT A;  5LJ3 g;  3CD6 T;  4QQ6 A;  2FVU A;  2QDL A;  3WVE B;  3M5A A;  3RMS A;  2BIV A;  2ZAE A;  3RKX A;  1YHQ A;  3EG9 B;  4GLM A;  2D8J A;  2LCC A;  1VQM Q;  2RJF A;  4B9W A;  2B8A A;  4PFZ A;  4OB0 B;  4Q5W A;  3G6E Q;  1WX6 A;  3HP9 A;  4D8D A;  4IIM A;  1WJQ A;  3RDV A;  1K0X A;  1C1A A;  4B9X A;  4M7A B;  2QA4 Q;  4M75 E;  2KVQ G;  1K73 U;  1RI0 A;  4CC4 B;  2CYZ B;  3ZFJ A;  3OYK A;  4J9D A;  2QQR A;  4LD9 K;  4ORZ A;  1UGS B;  1XJW B;  1BI2 A;  3OYD A;  2XI9 A;  2RJC A;  2LQW A;  5GAN g;  1KC8 C;  3OYB A;  1PSE A;  2DFU A;  2XDD A;  4N0A C;  1IHV A;  3UWN A;  2CZ1 B;  1KFZ A;  3JB9 J;  5EG2 A;  1VQ5 A;  4IUP A;  2RQV A;  1IGU A;  1T0J A;  1X6O A;  3VS0 A;  1UHC A;  3LWI A;  1I07 A;  2GF7 A;  2KE9 A;  5J3B A;  4DQ2 A;  2JM9 A;  3LH5 A;  2D0Q B;  4HKE A;  5A0L A;  5KYX B;  1K9M R;  3VUZ A;  1QKW A;  3CCV A;  2M0Y A;  4JRQ A;  2RJE A;  2GQV A;  1NE8 A;  1NM7 A;  3I9Q A;  3IQL A;  2H8H A;  1UG1 A;  4JDS A;  5J39 A;  1JO8 A;  2O88 A;  2XU8 A;  4HVV A;  1ZBX A;  1YI2 Q;  3QZ5 B;  1R77 A;  1YJN T;  1PSF A;  2EQU A;  1VQ8 T;  4CC3 A;  2VUB A;  5FRO A;  4NL3 A;  2MAM A;  4M7D G;  5CIU A;  1OQK A;  3TRE A;  3CCQ Q;  1FYN A;  1PG5 B;  4N4G A;  3QWX X;  1VQ6 Q;  2PZ1 A;  3LX7 A;  4RTW A;  1G8X A;  3JV3 A;  3INZ A;  2EQI A;  2FL7 A;  3EFO B;  3NHN A;  4M75 B;  3CME Q;  1Q82 U;  1EIF A;  2YUO A;  5I2S A;  1WHJ A;  4MDX A;  5GAO r;  1VOM A;  5GAO q;  3CXC S;  1JJ2 S;  1CSK A;  4ZTJ A;  5DY9 A;  4BY6 C;  3Q1J A;  2FPF A;  2KR3 A;  4B6M A;  5HKC A;  1AZE A;  1YJ9 Q;  4EMH A;  4ME7 A;  2QQ9 A;  2EJ9 A;  1RI9 A;  4N4H A;  2DRK A;  1Q95 G;  1M1K R;  3SHW A;  2FHD A;  3ER0 A;  2R58 A;  1QQJ A;  3HL8 A;  2DTO A;  2ATC B;  3OYM A;  2ECZ A;  2MPX C;  1YNZ A;  1OPL A;  4C92 C;  4L59 A;  4E7H A;  3CMA Q;  3M4G A;  3RNJ A;  1KQS A;  1WHK A;  1Z9Z A;  3VS4 A;  3EGX A;  1WHG A;  2HZY A;  5IXB A;  2HAX A;  4AFQ C;  2ZPI B;  1WIE A;  3MJX A;  2B86 A;  2AHJ B;  1YIJ A;  5LJ3 e;  1AD5 A;  2XK0 A;  2J6K A;  3H41 A;  4PJO B;  4O6J A;  3M9Q A;  3OYI A;  1VIE A;  2JOY A;  4M4Z A;  2RPN A;  4L5G A;  3R6N A;  2O2O A;  2YT6 A;  4MZP A;  3TQ7 P;  5FU7 B;  1DJ7 B;  1JRI A;  4JJB A;  1NPP A;  3QWY A;  1VQN T;  3SFM A;  3VYG A;  2YSQ A;  2NWM A;  2J6F A;  3CC7 T;  1U1S A;  1IGQ A;  2WAC A;  5KCO A;  3PIP A;  2O9V A;  1JU5 C;  1D1A A;  4XTV A;  3BW1 A;  3CPW A;  1K1Z A;  4M7A C;  3LGL A;  2ZZD A;  1BB9 A;  4LDV A;  2K9G A;  1ARK A;  1B34 B;  1VQ9 Q;  1ABQ A;  2BZX A;  3PGG A;  4DEY A;  3OQ5 A;  2NUT B;  4N0A A;  4NOY A;  1YJW T;  2RN8 A;  2F5K A;  5GAN e;  3T9N A;  1TUC A;  4C92 F;  2E6N A;  3J81 E;  3DLL A;  2NYS A;  4FYV B;  4X9C A;  1NJI C;  3M53 A;  3VUB A;  3CCR T;  3UT1 A;  1TH7 A;  3MP6 A;  1Y96 B;  4FSS A;  1T0H A;  3QPH A;  2QGF B;  2E6Z A;  3F70 A;  2OJ2 A;  1QVG P;  1H92 A;  3EFR A;  3OMC A;  3OBW A;  1M90 C;  2GQI A;  3M4Y A;  2ENM A;  2NUP B;  1RAH B;  1VQL T;  1D0Y A;  3NTI A;  3EFS A;  2DE0 X;  2OTL A;  5D6W A;  1I5O B;  2K5L A;  4J5Y A;  1HSQ A;  5KE3 A;  2F69 A;  1QVF P;  1IRE B;  2DO3 A;  2C0T A;  4R56 A;  3OS1 A;  1YBY A;  2DAQ A;  1VQK T;  3HFN A;  2LP5 A;  4QKU A;  5CAI A;  4WTO B;  3LLR A;  3GOX A;  5CQY A;  1OZ3 A;  2VKN A;  3OB9 A;  4M75 C;  3GLX A;  4XTY A;  4M78 D;  2RH2 A;  3OYG A;  2X3X D;  2EQK A;  3G6E T;  3QBY A;  2DXU A;  4F16 A;  4OB2 B;  4XU1 A;  4ZGD B;  1Q7Y U;  4CC2 A;  2DYB A;  2CZ7 B;  4F14 A;  3JCM d;  1NEB A;  1MV0 B;  2ZCF B;  4BUG A;  4M77 E;  3QII A;  5CKF A;  3A5Z B;  1H8K A;  2K7A A;  2NUZ A;  3G7Z A;  4F7U G;  2QQA A;  2RB6 A;  1TWB A;  3UF4 A;  5GAN j;  3M59 A;  1T3L A;  1M30 A;  1C6V X;  2C06 A;  4OMM A;  2OAU A;  3M0U A;  3X26 B;  3V8L A;  2L3Q A;  2XDB A;  4J7F A;  4RCC A;  2VXE A;  2A36 A;  2L89 A;  2EJF A;  3X28 B;  1WPY A;  4LUE A;  1UHF A;  5FRN A;  3CCU A;  4F04 B;  4AG1 C;  3EG9 A;  1TXQ A;  4HCK A;  2K5F A;  4PJO C;  2L0A A;  1M4Z A;  3FJP A;  4Z8A A;  3QYG B;  3KXT A;  2EW3 A;  4M75 F;  4PJL A;  5LJ5 e;  1OPK A;  1OX9 A;  4C0Z A;  4J7I A;  1I8F A;  1BIB A;  4RTY A;  5FU7 C;  1KQ1 A;  2PQW A;  3TEE A;  4VUB A;  5GAN f;  1VQP Q;  1VQ6 T;  4ANJ A;  4M7A A;  2A3L A;  2D0N A;  2D1X A;  3URG A;  2M0O A;  2RK2 A;  4QVD A;  2A37 A;  2RI2 A;  4EMK B;  1OYX A;  4M77 B;  3REA B;  4F17 A;  2AK5 A;  4JZ4 A;  1Q82 R;  1PRL C;  2LQ8 A;  2E70 A;  3VJP A;  4C5E A;  2G6F X;  3GF5 A;  2CP0 A;  2GNC A;  2WSF E;  4BE0 A;  4OML A;  1K9M C;  1RAG B;  3OYE A;  5D6X A;  4JJC A;  1GXI E;  1WHM A;  3OYH A;  3OW2 P;  2DL4 A;  2COY A;  1YJ9 T;  3O5Z A;  1TTH B;  1Q81 C;  1KQS S;  2X4W A;  1G3Y A;  3X24 B;  1BKB A;  3C95 A;  5KYX A;  1MGQ A;  2QEX Q;  1XNI A;  1PWT A;  4KUI A;  4A4F A;  4BDY A;  2X3W D;  3C12 A;  1YIT A;  1H3H A;  4GBQ A;  4CC7 A;  4GLK A;  2FZG B;  2K3B A;  4J6X A;  1AT1 B;  4FCY A;  3MO8 A;  2CKK A;  4AMC A;  1M1K U;  3CCS Q;  2QTV A;  4E7L A;  3CCE A;  4XU2 A;  5GAM h;  4XQ3 A;  5CCA A;  2D8H A;  3LW5 E;  5GAN 3;  1IXD A;  2PVD B;  3EFO A;  1VQO Q;  3CD6 A;  4HVW A;  4M75 A;  4RTX A;  3CPW S;  1QKX A;  2LC4 A;  3FDR A;  2MIO A;  4KH1 B;  5GJW B;  1NLO C;  1YN8 A;  5LJ5 j;  1EZZ B;  5IT9 E;  3TSW A;  1YHQ Q;  3H0H A;  4M7D D;  1N5Z A;  3PFS A;  1NLP C;  2ZPE B;  3QYH B;  2YRV A;  2H3E B;  1V29 B;  2P0P A;  2ED1 A;  4C0G A;  1ZSZ B;  1K76 A;  1B7T A;  2KRM A;  3CPF A;  3OBY A;  2AZV A;  4DBH A;  3E19 A;  3UA7 A;  3THK A;  1PD0 A;  5IAY A;  3FEO A;  3CCM Q;  2E65 A;  1Q86 C;  4AT1 B;  5GAM g;  4Y28 E;  5LJ5 f;  4IUT A;  2DYI A;  1QCF A;  1EFN A;  4C0F A;  2DL7 A;  2CZ6 B;  3MEW A;  3OSS C;  4Z02 A;  2VV5 A;  2KMT A;  1VQ5 Q;  2RHY A;  3PTA A;  2LMJ A;  4PJO A;  3MCA B;  1VYV A;  2HMA A;  1P92 A;  3P8H A;  1ZHI A;  3QKJ A;  5GMK l;  3REB B;  2P0Q A;  1N9S A;  2E41 A;  3BDU A;  1QP2 A;  1EX4 A;  1YJN A;  1VQ8 A;  2RHX A;  3GNF B;  4LDW A;  5AT1 B;  1G3T A;  4M7D F;  2GTO A;  2DBM A;  1KJW A;  1IHW A;  3OYJ A;  1G2B A;  2E3H A;  4RTT A;  2YUQ A;  3GNG A;  4RG8 A;  2QQS A;  4FYY B;  5CR2 A;  1B34 A;  1PM3 A;  2NUT A;  4EMK C;  4M77 C;  4X9D A;  1JXO A;  4KT0 E;  3V8K A;  2RHI A;  3WXM B;  1HYO A;  2LRQ A;  3JCM f;  4IUV A;  1SSF A;  3PE0 A;  4LDY A;  2DK3 A;  1G83 A;  2K57 A;  1HD3 A;  3AHU A;  2FZK B;  1Y96 A;  2K4Y A;  1FXX A;  5CO7 A;  2X4J A;  2GCX A;  4C8Q G;  2I0N A;  4HA8 A;  2RMO A;  2NUP A;  2DTI A;  1ZUK A;  4A4G A;  5GJV B;  3D7S B;  3OSV A;  2KXD A;  1ACM B;  5GAO n;  3RKW A;  1R0C B;  3QZ9 B;  2GFU A;  4XU0 A;  1I0C A;  3HRU A;  1ZA2 B;  1SF9 A;  4XTW A;  4K11 A;  2MYS A;  4QT7 A;  2P4R A;  2V1Q A;  4M78 E;  4A4H A;  1LCK A;  2DZC A;  2PUK B;  1MMG A;  3M55 A;  4JLG A;  1UE9 A;  1OU8 A;  1UJY A;  1ZQ1 A;  3CXC P;  1JJ2 P;  2IPO B;  2COZ A;  4MZT A;  3MP8 A;  1S1N A;  2KGT A;  5EC7 A;  2M16 A;  2SRC A;  1OU9 A;  4J6W A;  2FZC B;  3V7R A;  4HXJ A;  1AVZ C;  5LJ3 d;  3I55 T;  4M77 F;  1K73 C;  2YLB A;  4LDX A;  1VQP T;  1WZO A;  3MPU B;  4E47 A;  4TVR A;  3X25 B;  4OB1 B;  4V2S A;  3EG1 A;  1UGR B;  1WQ7 A;  4RTU A;  3EH2 A;  1QLY A;  1YFN A;  1ZSZ C;  4FIB A;  1WYX A;  1IB8 A;  1WXU A;  3I56 T;  5FWC A;  2MCN A;  2A0F B;  2RD1 A;  1YJW A;  1R0B G;  2PTK A;  2KRO A;  5GAM e;  3G1J A;  2ZPB B;  3EGD B;  1OI1 A;  5KH6 A;  1X75 C;  4XAX B;  1RLQ C;  3OYL A;  2H3J A;  1KIK A;  3CCR A;  5GAN d;  3TSZ A;  1BCO A;  2QEX T;  4X1V A;  1QW1 A;  2LVM A;  4M78 B;  4JPB W;  4ZGJ B;  2BE7 D;  4J9G A;  3C4S A;  3LYI A;  2LT1 A;  1RAI B;  2DBK A;  4J9I A;  4EMG A;  4EPC A;  3FIF A;  3AT1 B;  4MZM A;  4E7J A;  3LH0 A;  4E7K A;  2DPP B;  4JRK A;  4FW1 A;  3QDR B;  3CCS T;  3VS1 A;  2XID A;  3FC3 A;  1Q82 C;  3S3O A;  2G3R A;  3JB9 H;  3QHS A;  4KGV B;  2P4T A;  4A4E A;  1BIA A;  1VQO T;  1VQK A;  3QUI A;  4WF2 A;  1B07 A;  2YUN A;  1D1B A;  4EMK A;  1UDL A;  3NGP A;  1X2Q A;  4ATO A;  2DER A;  2DRM A;  5KCH A;  5GMK h;  1ZLM A;  4LUD A;  2IIM A;  2QK0 A;  2W0Z A;  5ECA A;  1SHF A;  4FSX A;  4IUU A;  1TS9 A;  4KBM B;  4BI8 B;  3G6E A;  3L2Z A;  1I5L A;  3LGF A;  4RG2 A;  2EWN A;  3L2W A;  2R5A A;  1IO6 A;  4ELY C;  3CCJ Q;  4HVU A;  4OB3 B;  3CC4 Q;  3V8J A;  1MHN A;  3JB9 I;  4Z88 A;  4F7U F;  3CCM T;  3SWN B;  1QMC A;  2OTJ Q;  3A8H B;  5GAM j;  2RQU A;  2MWO A;  4JUV A;  1VQ5 T;  2DA9 A;  2EYQ A;  5D6Y A;  2QTX A;  3OYN A;  5HK3 A;  5GAO l;  1C0M A;  1FMW A;  4M7D E;  2EGC A;  3VRZ A;  3RMQ A;  2O31 A;  1X01 A;  3S3M A;  3BDL A;  1QWF A;  3CCU Q;  5FRM A;  3RIR A;  4L6V 5;  1LPL A;  2OX7 A;  3MHX A;  4LXC A;  5AYF A;  2A28 A;  2L3R A;  2VVK A;  2CP6 A;  2F2W A;  5GAN 6;  2GGR A;  2XG8 D;  4FYW B;  2YDL A;  1M2V B;  2E12 A;  2RQT A;  5LJ5 d;  2PUO B;  2DL5 A;  5GAM f;  2BZ8 A;  1M90 U;  2K6D A;  4OP0 A;  3HPW A;  3OA6 A;  1VQ6 A;  1NYG A;  3EH1 A;  3CCL A;  1JBM A;  2EQM A;  2JUF A;  1ZSZ A;  4JS5 A;  2DTH A;  1PRM C;  3PNW C;  4RCB A;  1VQ7 T;  3L1A A;  2BUD A;  2GBQ A;  4PJJ A;  3G4S Q;  2LT4 A;  2Z0W A;  2VC8 A;  1Y71 A;  4J9C A;  3MET A;  1W2B S;  1KD1 R;  4YTL A;  2PVG B;  3N5B B;  2DVE A;  1YWP A;  1M1F A;  1UGV A;  5LJ3 j;  3S6W A;  2FEI A;  3VS3 A;  2K3X A;  2VGM A;  2HKQ B;  2FO0 A;  2DEU A;  1VQM T;  3G71 Q;  2EKH A;  4RUG A;  2DZ9 A;  3ZL7 C;  4M78 C;  4M7D B;  2X4Y A;  1FWZ A;  3HHT B;  1YIT Q;  3PVL A;  4XK8 E;  3ASK A;  1RLP C;  4D8K A;  2QA4 T;  2HL3 A;  3SD4 A;  1X69 A;  4PFO A;  2JXB A;  1X43 A;  2EYZ A;  5IN1 A;  3EHR A;  4IIO A;  1M8M A;  3JCM b;  1W4S A;  4AG2 C;  5LJ3 f;  3HSB A;  4C92 A;  2R57 A;  3CCE Q;  2GTJ A;  2IVW A;  5KYW B;  3C0C A;  2HNI A;  1Q7Y C;  2KYM A;  3CD6 Q;  1KQS P;  2HL5 C;  2K2M A;  5CKE A;  1VQ4 Q;  5KYY B;  1HXD A;  5I11 A;  3FRN A;  2DIQ A;  2V26 A;  4C5G A;  8ATC B;  1SRL A;  3PMI A;  3HFO A;  4FT4 A;  2DJZ A;  4BI3 A;  4OMF B;  2L8D A;  3NPF A;  1IZ6 A;  3M0R A;  5CQX A;  1O9S A;  1CKA A;  2AT1 B;  1YI2 T;  2KAF A;  5GAN 7;  1TG0 A;  2HSE B;  5I2M A;  4OGC A;  1RL2 A;  1V76 A;  4M78 F;  3VS7 A;  2JNG A;  1WXB A;  5DLQ E;  3A8O B;  2XKO C;  3CCQ T;  3SWN C;  5KYN A;  2GFA A;  2CS7 A;  1GRI A;  2J05 A;  4C92 G;  1WLP B;  5CKH A;  3CPW P;  5C0M A;  4C8Q D;  2XDP A;  3ZEH A;  3CME T;  2LX7 A;  2DKG A;  1M1G A;  2O4X B;  5GMK e;  2Y4X A;  2EVR A;  2XD0 A;  5FLX E;  3L42 A;  2KEA A;  1Y57 A;  2O01 E;  1PD1 A;  2JMA A;  3M0Q A;  1GFD A;  1E7O A;  1S72 Q;  4KGX B;  2RQW A;  1K8A U;  4QVZ A;  1Q81 U;  2MMP A;  2JS0 A;  2YWW A;  4KGZ B;  3RR6 A;  1T3S A;  2DIL A;  1OZ2 A;  4NL2 A;  1BCM A;  1X27 A;  1VQ8 Q;  1Y7X A;  3MEV A;  3PMT A;  2DNU A;  1U3O A;  4PK4 A;  2BKD N;  3TU4 K;  4E7I A;  2DJQ A;  3CMA T;  5GMK m;  4II1 A;  4M7A G;  5I22 A;  2MOX A;  4J9E A;  3NTK A;  3CQT A;  4RKU E;  5A2Q E;  3EGD A;  1YWO A;  1BBZ A;  3QG1 A;  3CC2 Q;  2BZY A;  5FWB A;  3QJY A;  4F7U E;  3RER A;  2EYW A;  1R8O B;  1SPK A;  3C94 A;  3A1P A;  4ZN3 A;  1OOT A;  3CCJ T;  1FMV A;  5GAN 8;  3CC4 T;  4M78 A;  4JJN K;  1RUW A;  2HCK A;  2L3P A;  4PFP A;  1SSH A;  1WJR A;  2LQK A;  1W1F A;  1M1K C;  2RK1 A;  2X35 A;  2CH4 W;  3CBP A;  1U06 A;  4JS4 A;  1QCO A;  4HT8 A;  4M7D C;  2OTJ T;  4BE1 A;  2XMF A;  1NBE B;  2DF6 A;  3JAM E;  1PCX A;  4FW2 A;  1VUB A;  4O5V A;  4Y91 A;  1SEM A;  1VQ9 T;  2XIC A;  3RES A;  3UPU A;  2XHC A;  2V8K A;  2Y90 A;  1Q86 U;  1Z9Q A;  3A8G B;  1LOJ A;  5LL6 S;  3CCU T;  2K5I A;  3P8D A;  3M58 A;  2KXC A;  3WVD B;  1GL5 A;  3DB4 A;  4UC4 A;  2LX9 A;  3I55 A;  1NJI R;  3QDF A;  1ZSG A;  1WFW A;  1UUE A;  2RQR A;  2AKK A;  4M75 G;  5CKB A;  3FJ5 A;  1PHT A;  1J3T A;  4KRT A;  4HT9 A;  4BAC A;  1VQP A;  2CT3 A;  1M90 R;  4F7U B;  1M3C A;  1N8R U;  2PNI A;  3L2U A;  3JCM P;  4IKF A;  3CCV Q;  3PT9 A;  1KG1 A;  2QG9 B;  1X6G A;  3DKM A;  3G4S T;  2DMO A;  3TVT A;  2SEM A;  1RAF B;  2V8I A;  3I56 A;  4LN2 A;  3SWN A;  4FT2 A;  5L23 A;  4DOV A;  2EQJ A;  2KQW A;  2M1H A;  1I4K 1;  5IHN A;  3JCM c;  3L2Q A;  2EKO A;  4BDZ A;  2FRY A;  3CBM A;  4KH0 B;  4CI0 C;  2RM4 A;  5GAM d;  4M7A E;  2M9U A;  1AHJ B;  1PKS A;  2ZGW A;  2O9S A;  2QEX A;  3GPL A;  3G71 T;  2FPD A;  2QDY B;  3O8V A;  4FYX B;  1KD1 U;  4ZGE B;  2F5T X;  2RA2 A;  2ROL A;  4ESR A;  5I21 A;  4C5H A;  3KFV A;  3QXE B;  2HQH A;  2V1R A;  5GAN 4;  4PJO G;  3HRT A;  1NG2 A;  1RAA B;  5IHK A;  3HTR A;  4A53 A;  1M2V A;  6AT1 B;  3E9F A;  4JRP A;  3CCS A;  3CEY A;  1OEB A;  1ZA1 B;  1WQW A;  3LWH A;  3M0P A;  2P0K A;  3QSU A;  3VS2 A;  3M56 A;  5GAN h;  1VQO A;  3CCE T;  1WGS A;  5GAN 5;  1PNJ A;  1JQQ A;  4BB7 A;  1W2B A;  3GBQ A;  4MDW A;  4DBQ A;  1KQ2 A;  2IG0 A;  2KYB A;  1VQK Q;  1UEB A;  1VQ4 T;  2RJD A;  2M51 A;  2X4X A;  1QP3 A;  3VV0 A;  2CSI A;  2YUP A;  3VKI A;  3BE3 A;  3OS2 A;  4PJN A;  4E7S A;  3QJ6 A;  2L2P A;  3R6O A;  4XTU A;  4E6R A;  1KC8 U;  2DXB A;  5HK0 A;  2KY9 A;  1YIJ Q;  1AEY A;  1A0N B;  5A0D A;  1SHG A;  3PIO A;  1UJ0 A;  1NYF A;  2RO0 A;  1OX8 A;  1W70 A;  1X6B A;  2MI6 A;  4M7D A;  2JT4 A;  5KE2 A;  4OMO A;  4E2F B;  3CCM A;  2KDS A;  1VQN A;  1ZUY A;  3CC7 A;  1D0X A;  3M54 A;  4FU6 A;  3H0F A;  1X2K A;  4DOW A;  3KUF A;  5CKD A;  2ZPG B;  3JB9 G;  1RAB B;  3I35 A;  4N4I A;  1Y07 A;  2LJ0 A;  3H0I A;  3NTH A;  4HCZ A;  3H8Z A;  5KYW A;  1QVG A;  1HK9 A;  1VIF A;  3VU3 C;  4GY5 A;  2JTE A;  1S72 T;  1BU1 A;  2JTM A;  4LDU A;  1PC0 A;  5KYY A;  4BI4 A;  5DM7 R;  2DM1 A;  1O75 A;  3GP8 A;  1KSW A;  1K8A R;  2EJG A;  4BE2 A;  1Q81 R;  1XTD A;  2QGG A;  3KBG A;  1BI1 A;  2CDT A;  1AWO A;  5CK9 A;  4R0K A;  2E5K A;  2CP2 A;  2NLU A;  1BK2 A;  2A08 A;  3E2U A;  4R55 A;  4HCC A;  1WXT A;  1TU0 B;  3BFM A;  3GIB A;  2FB7 A;  5GAO m;  3L2R A;  3SEM A;  9ATC B;  4OMQ A;  1QVF A;  4OF1 A;  3CBO A;  1N27 A;  1VQL A;  2C0O A;  3A8M B;  4C0D B;  3CCL Q;  2EIF A;  4NS5 A;  4PJO E;  1G3S A;  2QXF A;  1GBQ A;  2LCS A;  4KUL A;  2F2X A;  1VQ7 A;  4C8Q E;  2AIR B;  2OTL Q;  1LNX A;  2ZPH B;  3CC2 T;  2D9T A;  4AFZ C;  5GAN 2;  3VS6 A;  2MK5 A;  4J9F A;  2V8J A;  2JW4 A;  2JJ9 A;  2F1L A;  2O4X A;  2VYT A;  4OMN A;  5IH2 A;  2CP3 A;  5LJ5 h;  3A8L B;  4M77 A;  3OY9 A;  5IXF A;  5IHI A;  2A7Y A;  1UB4 A;  2I2L A;  3HRS A;  1VQM A;  3J80 E;  2HSP A;  1D3B B;  1I1J A;  1MND A;  1YHQ T;  1F1B B;  2JN0 A;  1XOV A;  2E1H A;  4OVA A;  2CP5 A;  1LVK A;  4C92 D;  3OYY A;  5FU6 B;  2QA4 A;  4J9H A;  1KHI A;  2OAW A;  2E3I A;  2FG0 A;  1W6X A;  3EAE A;  4J9B A;  5KYU B;  3VYH B;  2X9H A;  1VYU A;  2AKL A;  2DL3 A;  4J8O A;  3UAT A;  4RTZ A;  1W2B P;  2HD0 A;  3JCM X;  3I5S A;  4XTZ A;  1Q86 R;  1GCQ C;  2EYY A;  2PU9 B;  4QQG A;  3S3N A;  2YXY A;  3NMZ C;  1WI7 A;  3JRZ A;  2YRC A;  5M9O A;  3X20 B;  2KK4 A;  4C8Q B;  2DLP A;  1SKU B;  5LJ5 g;  4M77 G;  3TCJ A;  1RAD B;  2EBP A;  2LTO A;  2RI5 A;  2QQB A;  3ULR B;  3JCM h;  1K0S A;  3E1S A;  1BI0 A;  1N8R R;  3I5R A;  1JXM A;  3CCV T;  2DX1 A;  4M7A D;  1YI2 A;  1NJI U;  2COW A;  2W10 A;  1NPR A;  2L3S A;  3JCM Q;  2DET A;  1WJS A;  3FB9 A;  1AWW A;  2HEQ A;  4FL6 A;  4C5I A;  1PKT A;  3CCQ A;  3OYA A;  4CRI A;  3RUX A;  4HCB A;  3M0S A;  4OGE A;  2EGA A;  2DL8 A;  3OW2 A;  3CME A;  4PKC C;  2HBW A;  4RTV A;  2JM8 A;  1ZUU A; 
#chains in the Genus database with same CATH homology
 1UGQ B;  3HKS A;  4LDW A;  3LX7 A;  1G3T A;  1K8A U;  4M7D F;  4QVZ A;  1Q81 U;  2MMP A;  1LJO A;  3INZ A;  2FL7 A;  4D6W A;  4M75 B;  4IUQ A;  3OYJ A;  4J83 A;  3GNG A;  3JCM g;  4RG8 A;  1Q82 U;  1EIF A;  1OZ2 A;  2QQS A;  2DXC A;  2RI3 A;  4NL2 A;  1YJ9 A;  1Y7X A;  5I2S A;  5CR2 A;  1B34 A;  5GAO r;  4MDX A;  4DA4 A;  3MEV A;  3PMT A;  2DXT A;  5GAO q;  2MF2 A;  3CXC S;  1JJ2 S;  2BKD N;  4ZTJ A;  3TU4 K;  5DY9 A;  4EMK C;  4F7U A;  4M77 C;  4X9D A;  3WXM B;  4KT0 E;  3V8K A;  2RHI A;  4BY6 C;  3Q1J A;  1U1T A;  4E7I A;  4XU3 A;  3CMA T;  2LRQ A;  3JCM f;  4IUV A;  4II1 A;  4EDU A;  5HKC A;  5GMK m;  1SSF A;  4M7A G;  4EMH A;  4ME7 A;  2QQ9 A;  2EJ9 A;  4N4H A;  4LDY A;  2DK3 A;  3NTK A;  4RKU E;  4IUR A;  2WSC E;  5A2Q E;  2K57 A;  4C0D C;  3CMA A;  3AHU A;  2FHD A;  3QG1 A;  1Y96 A;  4M7A F;  2K4Y A;  4XTX A;  3ER0 A;  1FXX A;  2L5Q A;  2R58 A;  3QJY A;  5CO7 A;  3HL8 A;  4M75 D;  4F7U E;  3RER A;  2DTO A;  2GCX A;  2X4J A;  4C8Q G;  2JTF A;  2LDM A;  1R8O B;  1M9S A;  4HA8 A;  3C94 A;  4ZN3 A;  3OYM A;  2DTI A;  3V7S A;  3CCJ T;  5GAN 8;  4C92 C;  3CC4 T;  4L59 A;  4A4G A;  4E7H A;  3M4G A;  4M78 A;  3OSV A;  4JJN K;  4LD6 A;  2HBP A;  5GAO n;  1KQS A;  3RKW A;  2E10 A;  3QZ9 B;  1WJR A;  2LQK A;  2GFU A;  1YIJ T;  3CCJ A;  2HAX A;  3CC4 A;  1M1K C;  2RK1 A;  2X35 A;  4XU0 A;  2ZPI B;  3CBP A;  4JS4 A;  3HRU A;  4HT8 A;  4M7D C;  2LCL A;  4BE1 A;  2OTJ T;  4XTW A;  2AHJ B;  1YIJ A;  2DEQ A;  5LJ3 e;  3JCM V;  3JAM E;  2XK0 A;  4M78 E;  4A4H A;  1QVG S;  2DD4 A;  2MWP A;  4PJO B;  1VUB A;  2DZC A;  2JVV A;  2K3Y A;  2PUK B;  2Y4Y A;  2E5Q A;  3M55 A;  3M9Q A;  4JLG A;  4O6J A;  2OTJ A;  1ZQ1 A;  3OYI A;  1VIE A;  2JOY A;  3BY7 A;  4O5V A;  4Y91 A;  4L5G A;  5CVI A;  4ZN1 A;  2RHZ A;  4MZP A;  4MZT A;  5FU7 B;  1VQ9 T;  1DJ7 B;  2XIC A;  3MP8 A;  3RES A;  1BYM A;  5FU6 C;  1JRI A;  2M16 A;  3UPU A;  2XHC A;  3L2V A;  1NPP A;  2V8K A;  2Y90 A;  4J6W A;  4J6Y A;  3V7R A;  1Q86 U;  3SFM A;  3A8G B;  5LJ3 d;  3VYG A;  3I55 T;  1VQN T;  1LOJ A;  3H6Z A;  5LL6 S;  4M77 F;  2K5I A;  3CCU T;  1VQ9 A;  1K73 C;  3P8D A;  3M58 A;  2YLB A;  3CC7 T;  1U1S A;  2WAC A;  5KCO A;  3PIP A;  4A54 A;  3WVD B;  2LNV A;  3DB4 A;  1QVF S;  4LDX A;  4UC4 A;  2LX9 A;  1VQP T;  3I55 A;  4A4K A;  4E47 A;  2KSS A;  4TVR A;  4XTV A;  3X25 B;  3BW1 A;  3CPW A;  4M7A C;  3LGL A;  4M75 G;  4OB1 B;  5CKB A;  2E64 A;  4V2S A;  2ZZD A;  4LDV A;  4PJO D;  3E9G A;  1B34 B;  4HT9 A;  1H64 1;  1UGR B;  1WQ7 A;  4BAC A;  1VQP A;  2HQX A;  2D6F A;  3PGG A;  3OQ5 A;  4BD3 A;  4F7U B;  4N0A A;  4NOY A;  1N8R U;  1YJW T;  4C8Q C;  3L2U A;  2F5K A;  4FIB A;  5GAN e;  2VGN A;  2CGH A;  4X34 A;  3T9N A;  5DLO A;  3JCM P;  4C92 F;  2E6N A;  3I56 T;  4IKF A;  3J81 E;  3DLL A;  3PT9 A;  1KG1 A;  2RD1 A;  4X9C A;  3DKM A;  3DLM A;  1NJI C;  1YJW A;  1K9M U;  5HY6 A;  3M53 A;  3VUB A;  3G4S T;  3SB2 A;  3UT1 A;  3CCR T;  5GAM e;  3CCL T;  2ZPB B;  1TH7 A;  1OI1 A;  1Y96 B;  1M5Q 1;  2V8I A;  3MP6 A;  3SWN A;  3I56 A;  4QQD A;  5KH6 A;  3QPH A;  2E6Z A;  3F70 A;  1X75 C;  4XAX B;  4FT2 A;  2DIG A;  2H3J A;  3OYL A;  3EFR A;  3DB3 A;  3OMC A;  3OBW A;  4DOV A;  2EQJ A;  2KQW A;  5GAN d;  3G4S A;  3CCR A;  2OTL T;  2M1H A;  1I4K 1;  3M4Y A;  1M90 C;  2QEX T;  4RMO A;  3JCM J;  3JCM c;  1QW1 A;  1VQL T;  3L2Q A;  2LVM A;  2EKO A;  3NTI A;  4BDZ A;  2JZ2 A;  3EFS A;  4M78 B;  3CBM A;  4CI0 C;  4ELZ C;  2RM4 A;  4ZGJ B;  5GAM d;  2OTL A;  4M7A E;  2M9U A;  1AHJ B;  2ZGW A;  3C4S A;  5D6W A;  2QEX A;  3GPL A;  2K5L A;  3SDZ A;  4J5Y A;  3LYI A;  5KE3 A;  3G71 T;  2LT1 A;  2QDY B;  3O8V A;  4EMG A;  4EPC A;  2F69 A;  3FIF A;  4MML A;  1IRE B;  4PLI A;  1K8A C;  2DO3 A;  4R56 A;  1M8V A;  4MZM A;  1KD1 U;  4ZGE B;  3OS1 A;  1YBY A;  2F5T X;  3G71 A;  2RA2 A;  4E7J A;  3LH0 A;  4E7K A;  2DPP B;  5I21 A;  5A0G A;  2DAQ A;  4MMK A;  3QXE B;  4JRK A;  4C5H A;  3QDR B;  3CCS T;  1VQK T;  3HFN A;  3J7A F;  2XID A;  5GAN 4;  3FC3 A;  4PJO G;  3HRT A;  3S3O A;  5CAI A;  1Q82 C;  1JB0 E;  1FX7 A;  2G3R A;  3LLR A;  5C6S A;  3QHS A;  3JB9 H;  4A53 A;  2P4T A;  4A4E A;  3GOX A;  3E9F A;  4JRP A;  1G5V A;  1BIA A;  5CQY A;  2YHT A;  3JCM e;  1OZ3 A;  3CCS A;  1VQO T;  1VQK A;  3OB9 A;  3CEY A;  4M75 C;  3OMG A;  3QUI A;  3GLX A;  4PJO F;  4WF2 A;  1XQH A;  4XTY A;  4M78 D;  1WQW A;  5J26 A;  3LWH A;  2RH2 A;  2P0K A;  4EMK A;  3QSU A;  3OYG A;  2FYK A;  1KHC A;  4C8Q F;  4ATO A;  2EQK A;  3M56 A;  3JB9 D;  5GAN h;  3QBY A;  3G6E T;  1VQO A;  3CCE T;  1WGS A;  5GAN 5;  5KCH A;  5GMK h;  2DXU A;  4BB7 A;  1W2B A;  3JSC A;  4MDW A;  1KQ2 A;  2PVO B;  4OB2 B;  4XU1 A;  4ZGD B;  2IG0 A;  1Q7Y U;  1UEB A;  1UGP B;  2CZ7 B;  1VQ4 T;  4FSX A;  3JCM d;  2RJD A;  4IUU A;  4KBM B;  4BI8 B;  3G6E A;  2X4X A;  1QP3 A;  3M57 A;  4QW2 A;  3VV0 A;  2ZPF B;  2ZCF B;  4BUG A;  3RKY A;  3L2Z A;  3VKI A;  1I5L A;  4M77 E;  3LGF A;  3OS2 A;  3CXC A;  1WNL A;  3QII A;  4RG2 A;  1JJ2 A;  2EWN A;  3L2W A;  1VQ4 A;  2EAY A;  2R5A A;  3QJ6 A;  5CKF A;  3A5Z B;  4ELY C;  3G7Z A;  4OB3 B;  3R6O A;  4XTU A;  2QQA A;  4F7U G;  3V8J A;  1MHN A;  2RB6 A;  3MEA A;  3QO3 A;  3JB9 I;  1N9R A;  1KC8 U;  2DXB A;  5HK0 A;  5GAN j;  2KY9 A;  4FM4 B;  3M59 A;  3V7C A;  5GMK j;  4F7U F;  5A0D A;  3JCM W;  5GMK i;  3PIO A;  3OYC A;  3CCM T;  2C06 A;  3SWN B;  4ZTF A;  2RO0 A;  2WSE E;  1I81 A;  2OAU A;  4P5N A;  2MI6 A;  4M7D A;  3A8H B;  5KE2 A;  3X26 B;  3MEU A;  5GAM j;  3V8L A;  3OW2 S;  2XDB A;  4C92 E;  4J7F A;  4RCC A;  2VXE A;  1D3B A;  2L89 A;  3CCM A;  2EJF A;  2KDS A;  1VQN A;  4KUD K;  2MWO A;  3X28 B;  1QVP A;  1WPY A;  2RHU A;  5FRN A;  3CCU A;  4JUV A;  1VQ5 T;  3CC7 A;  2EYQ A;  5D6Y A;  4PL6 A;  2QTX A;  3OYN A;  5HK3 A;  3M54 A;  5GAO l;  4FU6 A;  4M78 G;  2K5F A;  4PJO C;  1M4Z A;  3FJP A;  4M7D E;  2VXF A;  3QYG B;  3KXT A;  4M75 F;  3RMQ A;  3S3M A;  1X01 A;  4DOW A;  3KUF A;  5CKD A;  5LJ5 e;  2ZPG B;  3JB9 G;  4C0Z A;  3BDL A;  4N4I A;  4J7I A;  1I8F A;  1BIB A;  1Y07 A;  5FRM A;  5FU7 C;  3RIR A;  1KQ1 A;  4L6V 5;  2R5M A;  3NTH A;  1BI3 A;  2PQW A;  4HCZ A;  3TEE A;  3H8Z A;  3MHX A;  4VUB A;  5GAN f;  1U8R A;  3JB9 F;  1QVG A;  1HK9 A;  1VIF A;  4PLL A;  4GY5 A;  5AYF A;  3VU3 C;  2L3R A;  1VQ6 T;  1S72 T;  3OS0 A;  5GAN 6;  4M7A A;  2JTM A;  2XG8 D;  4LDU A;  1NZ9 A;  4BI4 A;  2A3L A;  5DM7 R;  1O75 A;  3GP8 A;  2E12 A;  3NFC A;  3URG A;  5GAO p;  5LJ5 d;  2PUO B;  2EJG A;  2M0O A;  4BE2 A;  5GAM f;  1M90 U;  3HPW A;  1XTD A;  2RK2 A;  3KBG A;  4OP0 A;  4QVD A;  1BI1 A;  3OA6 A;  1S72 A;  3CCL A;  1VQ6 A;  5CK9 A;  5LJ3 h;  1JBM A;  2RI2 A;  4EMK B;  1N8R C;  2EQM A;  3P8B B;  1OYX A;  4M77 B;  4BY6 B;  4JLI A;  2JUF A;  2NLU A;  4C8Q A;  4R55 A;  4HCC A;  2LQ8 A;  2E70 A;  3VJP A;  3BFM A;  4C5E A;  2DTH A;  3GF5 A;  4JS5 A;  2WSF E;  3GIB A;  2FB7 A;  5GAO m;  4BE0 A;  3L2R A;  1QVF A;  3PNW C;  1K9M C;  4RCB A;  1VQ7 T;  3OYE A;  4OF1 A;  3CBO A;  1N27 A;  3L1A A;  2BUD A;  4JRI A;  5D6X A;  3ZBD A;  1VQL A;  1GXI E;  3OYH A;  2LT4 A;  3A8M B;  4C0D B;  2EIF A;  2VC8 A;  4NS5 A;  4PJO E;  1Y71 A;  1G3S A;  3ME9 A;  2QXF A;  1YJ9 T;  1H3Z A;  2HQE A;  2CZ0 B;  4KUL A;  5L8R E;  1VQ7 A;  1N6A A;  3MET A;  1W2B S;  1Q81 C;  1KQS S;  4C8Q E;  3FLG A;  4PNO A;  2X4W A;  4YTL A;  4QVC A;  1YIT T;  1G3Y A;  2PVG B;  2EFI A;  1LNX A;  3X24 B;  1BKB A;  2QI2 A;  3C95 A;  1MGQ A;  3N5B B;  2DVE A;  2ZPH B;  3CC2 T;  1XNI A;  4KUI A;  1M1F A;  4A4F A;  2K2V A;  4BDY A;  3OS5 A;  4C92 B;  5LJ3 j;  3C12 A;  2D9T A;  3S6W A;  3MP1 A;  1YIT A;  5GAN 2;  2K3X A;  2VGM A;  4M77 D;  2V8J A;  3CC2 A;  1VQM T;  4GLK A;  2VYT A;  2O4X A;  3UDC A;  1G3W A;  2DZ9 A;  3A8L B;  4M78 C;  4M77 A;  5LJ5 h;  2DD5 A;  2YLC A;  3OY9 A;  4M7D B;  1KD1 C;  1YCY A;  2A7Y A;  1UB4 A;  2I2L A;  2X4Y A;  1FWZ A;  3HRS A;  4J6X A;  1VQM A;  3HHT B;  3J80 E;  1D3B B;  1YHQ T;  3MO8 A;  2CKK A;  2JN0 A;  3ASK A;  4XK8 E;  3OYF A;  1M1K U;  1XOV A;  5LJ3 g;  3CD6 T;  2E1H A;  4E7L A;  4QQ6 A;  2FVU A;  2QA4 T;  3CCE A;  3WVE B;  4XU2 A;  3SD4 A;  5GAM h;  4XQ3 A;  3M5A A;  5CCA A;  3RMS A;  2BIV A;  1YHQ A;  3LW5 E;  3RKX A;  5GAN 3;  4OVA A;  5IN1 A;  2PVD B;  3CD6 A;  4C92 D;  3OYY A;  2LCC A;  4M75 A;  2RJF A;  5FU6 B;  4B9W A;  3JCM b;  2QA4 A;  3CPW S;  1W4S A;  2B8A A;  2LC4 A;  3FDR A;  5LJ3 f;  1KHI A;  3HSB A;  4C92 A;  3EAE A;  2R57 A;  4OB0 B;  4Q5W A;  5LJ5 j;  5IT9 E;  3HP9 A;  3VYH B;  2IVW A;  1WJQ A;  2HNI A;  1Q7Y C;  4M7D D;  4J8O A;  4B9X A;  3PFS A;  5CKE A;  4M7A B;  2HD0 A;  3JCM X;  2ZPE B;  4XTZ A;  1HXD A;  4M75 E;  3QYH B;  2KVQ G;  1K73 U;  1RI0 A;  2PU9 B;  2DIQ A;  3FRN A;  4QQG A;  4C5G A;  3S3N A;  2CYZ B;  3ZFJ A;  3OYK A;  2YRV A;  1V29 B;  3PMI A;  2QQR A;  3HFO A;  2P0P A;  3JRZ A;  4LD9 K;  4FT4 A;  4C0G A;  1UGS B;  2DJZ A;  4BI3 A;  5M9O A;  1BI2 A;  3X20 B;  2KK4 A;  4C8Q B;  3OYD A;  4OMF B;  2L8D A;  5LJ5 g;  4M77 G;  2XI9 A;  3CPF A;  1IZ6 A;  3OBY A;  2RJC A;  3TCJ A;  5CQX A;  1O9S A;  5GAN g;  3OYB A;  1KC8 C;  3E19 A;  2LTO A;  1PSE A;  2XDD A;  2RI5 A;  4N0A C;  2QQB A;  5IAY A;  3UWN A;  3JCM h;  2CZ1 B;  1YI2 T;  3E1S A;  3FEO A;  5EG2 A;  1BI0 A;  2KAF A;  3JB9 J;  1VQ5 A;  5GAN 7;  2E65 A;  1Q86 C;  4IUP A;  5I2M A;  4OGC A;  1RL2 A;  1X6O A;  3CCV T;  5GAM g;  4M78 F;  3LWI A;  4Y28 E;  2GF7 A;  5LJ5 f;  5J3B A;  2JNG A;  4IUT A;  4DQ2 A;  4M7A D;  1YI2 A;  2D0Q B;  4HKE A;  5A0L A;  1NJI U;  4C0F A;  2CZ6 B;  5DLQ E;  3A8O B;  3VUZ A;  1NPR A;  2XKO C;  3MEW A;  3CCQ T;  3JCM Q;  3OSS C;  3SWN C;  3CCV A;  1WJS A;  4JRQ A;  2RJE A;  4Z02 A;  3FB9 A;  2GFA A;  2VV5 A;  2KMT A;  2CS7 A;  2GQV A;  2RHY A;  1NE8 A;  4FL6 A;  3PTA A;  4C92 G;  4C5I A;  4JDS A;  5CKH A;  5J39 A;  5C0M A;  4C8Q D;  3CCQ A;  3OYA A;  2XDP A;  3ZEH A;  4PJO A;  2XU8 A;  4CRI A;  3CME T;  1ZBX A;  2DKG A;  1M1G A;  3MCA B;  3RUX A;  2O4X B;  4HCB A;  3QZ5 B;  1YJN T;  1P92 A;  1PSF A;  2EQU A;  3P8H A;  1ZHI A;  3QKJ A;  5GMK e;  2Y4X A;  1VQ8 T;  5GMK l;  2VUB A;  5FRO A;  2XD0 A;  4OGE A;  2P0Q A;  4NL3 A;  5FLX E;  3OW2 A;  2MAM A;  1N9S A;  2E41 A;  3CME A;  3BDU A;  3L42 A;  4PKC C;  1QP2 A;  4M7D G;  5CIU A;  2O01 E;  1YJN A;  3TRE A;  1VQ8 A;  2RHX A;  3GNF B;  4N4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...