5LJ5e

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
83
structure length
75
Chain Sequence
b'MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVEIPVNSKGTPLGKILLKGDNITLITS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 9
structure length 75
sequence length 83
chains with identical sequence p
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5e00
3L1AA 3EFRA 4M78F 3RKYA 5GMKh 3QUIA 3JCMP 4V2SA 4M75E 4M7AD 1HK9A 2E10A 4XQ3A 4NL2A 1LNXA 4MMKA 5DY9A 2VXEA 5LJ5g 4PJOB 4MMLA 2YLCA 3JB9J 2CGHA 3BW1A 3V8LA 4PJOC 4NL3A 5GAOl 4M7DE 2DTIA 1I81A 5LJ3g 4XTUA 4C8QE 5GAMh 4F7UB 4M75F 3JB9F 4M77B 5LJ3d 2FB7A 4XTYA 4M77G 3HFOA 5LJ5j 1WQ7A 4C92E 3V7CA 1U1TA 4M77C 2E41A 2DTHA 3RUXA 3JCMg 5GMKj 4HT8A 5GANh 5GAOr 4Y91A 3HSBA 2YHTA 4J5YA 1N9RA 4M77D 4M7AB 2EAYA 3JCMd 4HA8A 2DXTA 4C8QF 1WPYA 1BIAA 5GAOp 4M7AC 3VU3C 3V8KA 4C92F 5GAN7 3FJPA 3AHUA 5LJ3f 1WNLA 5LJ5e 4J6WA 4A53A 4XTWA 3JCMb 2DEQA 5GMKe 3FIFA 3V7RA 5GAN2 4EMGA 1U1SA 4OP0A 3RIRA 4M78A 1X01A 5GAN6 5GAN8 4M78G 2YLBA 3JCMf 4M7AF 3JCMc 4PJOE 1I5LA 1N9SA 5GMKl 4RCCA 2ZGWA 1M8VA 3INZA 3BDUA 2DZCA 2VC8A 4M78D 1LJOA 3RKWA 4NOYA 4XU3A 5GAMd 3JCMV 2EWNA 3JB9H 4F7UE 2RM4A 4M77E 3JCMQ 1KQ2A 4A54A 4PJOF 2I2LA 2VXFA 5LJ3j 5GANd 4XTZA 4JRIA 3SB2A 4N0AA 4M7AE 5LJ5h 4M7DA 4F7UF 5GAOq 1Y96A 4M7DG 4XU1A 4M77F 1YCYA 4X9DA 2K57A 3QHSA 4XTXA 2E1HA 4X9CA 4C8QA 4EMKA 1TH7A 4XTVA 3V8JA 4C8QG 2HNIA 1M5Q1 4JLIA 4DQ2A 2DTOA 4M78B 2DKGA 1D3BA 2DVEA 2E64A 3SWNB 3SWNA 5LJ3e 4M7DD 2Y90A 1B34A 4M78C 5GANf 5GAOn 2QTXA 3SWNC 3EFSA 3JB9D 1JBMA 4C8QD 1JRIA 4J6XA 5GAMg 5GAN3 5GAOm 4HT9A 3RESA 2DXUA 2EJGA 5GAMf 3JCMe 3JB9I 1WQWA 2FYKA 2RB6A 5GMKm 1BIBA 3FB9A 5I21A 3RKXA 5GANg 3BFMA 5GAN5 3GIBA 4J6YA 3JCMJ 4M75B 4M75A 4RCBA 4M75G 3V7SA 3JB9G 4M75C 2EJFA 5GAMj 1HXDA 2DJZA 4QVCA 2RA2A 1H641 5CAIA 4M7DB 4N0AC 1Y96B 3JCMW 4PJOA 2DZ9A 4M75D 4XU2A 3BY7A 4PJOG 4EMHA 5GANj 4EMKB 2RD1A 4QVDA 4C8QB 5GMKi 5LJ5d 4JRKA 4M7DC 4JUVA 4EMKC 4C8QC 5LJ3h 4PNOA 4C92B 1D3BB 3HFNA 3M4GA 4C92A 2EJ9A 4XU0A 4C92G 4F7UA 4PJOD 1B34B 4C92C 4M77A 3L2ZA 4F7UG 5GAMe 1I4K1 4M78E 5GAN4 1I8FA 3RERA 1MGQA 3JCMh 2JN0A 4C92D 4M7DF 5GANe 1LOJA 3PGGA 4WF2A 3QO3A 5LJ5f 3QSUA 4M7AA 4M7AG 3JCMX 1KQ1A 2E65A
chains in the Genus database with same CATH superfamily
2CREA 3LGLA 2KT1A 2F5TX 1WJRA 2OTLT 1LNXA 1VQMT 3JB9J 4ELYC 3HRUA 3BW1A 2AZVA 3REBB 1I81A 1VQ5T 1BYMA 3L2RA 2V1RA 2R58A 2OAUA 1UGPB 3CCMQ 2JMCA 2LQWA 1VQ6A 4FW1A 3JCMd 1MMNA 4KT0E 3LGFA 3OYEA 1OX9A 3FJPA 1IRXA 2NLUA 1MNEA 5GMKe 1LPLA 2O01E 5GAN2 4EMGA 2CP0A 5GAN6 3RR6A 3EGXB 5D6YA 4RCCA 2ECZA 2X35A 4ZGDB 2VYTA 5CQYA 4E7KA 4OMQA 3CMAT 1WGSA 1M2VB 1NJIR 1E6GA 5GANd 2HSPA 3NHNA 5FU6C 3LWHA 2RI5A 1VQKA 4M7DA 2JS0A 2K57A 3QHSA 4BE1A 2DTOA 1NE8A 1WHJA 2E64A 3I9QA 5KYUA 1FWZA 2EBPA 3SWNC 3CD6T 2EPDA 2FRYA 5GAN3 4J6XA 1QVGS 5GAOm 1AVZC 4A4GA 3O8VA 3H41A 1U8RA 1RLQC 1E6HA 1H8KA 3QDFA 4M75A 3M5AA 2RMOA 4E7ZA 1RAFB 3EGDA 2K7AA 1RACB 4PLLA 3E9FA 1K4US 1BCOA 3X25B 3A5ZB 1UG1A 1MNDA 3M4GA 4F7UG 1VQ4A 4OB1B 5GAN4 2RJFA 4JDSA 4LDWA 4A4HA 1M1KR 2FVUA 1TTHB 2AK5A 3JCMX 2NUZA 4HVWA 4IUTA 1VQ9A 2H8HA 3RKYA 5AYFA 1M8MA 4MMKA 4BI8B 3A8OB 2YLCA 3VS3A 3V8LA 1KQSP 2XK0A 1PHTA 3PMTA 1YNZA 3UATA 2K3BA 2WSFE 3RNJA 5GAOr 3MCAB 5CKDA 2LJ1A 3QZ9B 2XDPA 1OZ3A 4DEXA 2YUOA 5I11A 3EH2A 1QVGA 1KD1C 3PT9A 3CCEQ 2CH4A 5IXFA 3CC4T 2L8DA 3CCQQ 2R5MA 2DM1A 1YITT 2HKQB 4FCYA 2ZGWA 2W10A 3NTIA 2RM4A 3TEEA 3AT1B 3RMQA 1ZSZB 2O4XA 3G7ZA 4ME7A 5CVIA 3CPWP 4B6MA 2CS7A 3JV3A 4EPCA 1O9SA 3CMET 1BCMA 4EMKA 4XTXA 1ZBJA 3G71Q 5GJWB 1J3TA 3EHQA 1QLYA 2QDYB 3KFVA 4HKEA 2RK2A 2X4WA 5AT1B 3GPLA 1AZGB 2HQEA 2V1QA 1PRLC 3U23A 4J7FA 1VQLA 4BUGA 2EJFA 2DJZA 2L3PA 5J3BA 5IN1A 1NJIC 3JB9D 2K5FA 4M7DC 3I56A 4Z02A 2YUNA 1PWTA 1D3BB 1W2BA 1O75A 2DLPA 4J9GA 4ZN1A 2L3RA 3TCJA 3RERA 1PD1A 2JN0A 1D0XA 1OEBA 1Y71A 2GTOA 1IREB 2X4YA 1W1FA 2RJEA 2MK5A 2O9SA 3OYAA 5DY9A 2LC4A 1NYGA 1C0MA 3DLMA 1YJ9T 4M7DE 3CXCP 3M55A 2M1HA 3VUZA 4E7HA 2FB7A 3CCSA 2E41A 4BD3A 5GMKj 1AEYA 2Y4XA 2COWA 1N9RA 3I5SA 4C8QF 1M1KC 2FL7A 1B3QA 4X34A 4DEYA 2JM8A 5CQXA 4XTWA 1G3WA 3LW5E 2O2OA 3CCQT 4ZTJA 1OX8A 1X01A 1QP2A 3JCMf 3OYKA 4L59A 2VUBA 2RHXA 4AFZC 1ZBXA 3RKWA 3DLLA 1KHCA 3M0TA 3M0QA 2NUTB 5KYYB 3JCMQ 4F16A 2I2LA 1BB9A 1Q82R 1FMVA 1KC8U 2D1XA 5CKBA 1M2OA 2ZZDA 3OQ5A 4M77F 4HVVA 3V8JA 2Z0WA 3P8DA 4N4IA 1MV3A 5KYNA 4M7DD 2OTJA 5GANf 1PSFA 2I0NA 3QZ5B 1PSEA 3HTRA 1Y57A 4HT9A 2DXUA 1U3OA 4J6YA 1OV3A 2HQHA 1QMCA 2PU9B 2CDTA 2DJQA 4VUBA 4AT1B 2MWOA 1YIJQ 4M75D 4XU2A 1KG1A 2ED1A 4EMKC 1G2BA 4C92A 4FM4B 2EJ9A 3EFOA 3L2UA 1QW1A 3VKIA 2E12A 3EGUA 1B7TA 3PGGA 2BZXA 2PVOB 4LE9A 3UPUA 3X28B 2BE9B 3GBQA 2KQWA 1Q81U 3CEYA 3UA6A 4V2SA 3OYNA 3C95A 4NL2A 1UJYA 2CGHA 1YI2Q 1K9MU 5IHNA 2MCNA 4Q5WA 2GGRA 3EH1A 1IGQA 1VQOA 4Y91A 2DA9A 2KBTA 3L2QA 1OQKA 3VU3C 2E3IA 1JJ2P 2DEQA 3FIFA 1M30A 2MMPA 5GAN8 2EGCA 2J6OA 4J9IA 4QT7A 1CKAA 1ACMB 3QG1A 4D6WA 3NFCA 1JO8A 2EGEA 2DVJA 2DYIA 4PFOA 1YJWA 1GXIE 2AKLA 1G3TA 4QQDA 4QW2A 1WFWA 1N8RC 1M1FA 1W4SA 1VQ8T 1NEBA 3E19A 1VQ6Q 1OPLA 4F7UF 1Y96A 1Q95G 1UUEA 3OYBA 3TU4K 4XTVA 1BI2A 2A36A 4M78B 1IB8A 2DKGA 2ESWA 4IURA 3E1SA 2IIMA 1JB0E 3LH5A 2ENMA 4DOWA 1AT1B 3H8ZA 3JB9I 2O9VA 1M1GA 3GNFB 3EG3A 4OMNA 3QWXX 2JNGA 4RCBA 1UHCA 1N5ZA 3P8BB 2PUOB 1VQ7A 2QQBA 4EMHA 2RHZA 2EYWA 2QQSA 2YRDA 1VQKQ 1QWFA 2EQUA 4C0GA 2BZYA 4HCBA 1WLPB 2QTVA 3JCMh 2RQTA 2GCXA 4ANJA 3EG9A 4II1A 2YDLA 3QSUA 1NYFA 2K2VA 4L6V5 1WXBA 2CZ7B 3F70A 2X51A 1IXDA 4LDYA 3OYFA 2EQJA 4OMMA 5L23A 3OYCA 1VQPA 3CBOA 4OB2B 4CC7A 4GLKA 1YI2T 5LJ3g 5L8RE 2K4YA 1G8XA 2E4HA 2X3XD 4Y92A 1U1TA 1KQSA 5GANh 2P84A 1VQ4Q 4J8OA 1BU1A 1JQQA 3V8KA 1BI3A 4RTZA 4C0DB 3ER0A 1ZA1B 3MP6A 3CC7A 2E3HA 1N6AA 3JCMb 4KUDK 1VQ9Q 1BK2A 4RTWA 3P8HA 1NPRA 2VC8A 4D8DA 2L89A 2QG9B 4AFUC 2EKHA 1W6XA 1NJIU 1VQ6T 3G1JA 4F04B 4QQ6A 1OU8A 1KK7A 2KAFA 3CXCS 4C8QA 1V1CA 2F2XA 1GFDA 2G6FX 3SWNA 3CPWA 3MEWA 2L5QA 1ZX6A 4AFQC 3LX7A 2BIVA 2X3WD 2NUPB 2YRCA 4LDUA 3L2WA 3JCMJ 2V26A 4M75B 4QVCA 2RA2A 1H641 1VA7A 2RF0A 2VKNA 4L5GA 2XD0A 2LCSA 4QVDA 3TSWA 1VQKT 3VS1A 2DL8A 1R0CB 4OB3B 4J9EA 3MP8A 1R8OB 4M77A 4HCCA 4BI4A 4HXJA 4C92D 2ZPHB 3ME9A 3FJ5A 5M9OA 4FIBA 3VS0A 3OS1A 4M7AA 2QEXA 1H92A 3A8LB 4EIKA 2DD4A 5HCKA 1X69A 1K8AU 3EG1A 2P0QA 4RG2A 1VQLQ 2RO0A 2ZPIB 2QASA 2EW3A 3VV0A 4D8KA 3H9NA 3I56Q 2P4TA 1OZ2A 4M77G 5KYXA 1WQ7A 3QJ6A 4KRTA 2FG0A 1UB4A 3VYGA 5I2SA 1VQ4T 3HSBA 3CXCA 3CCVQ 3CC2A 1KD1R 1UEBA 2BTTA 3FEOA 3A1PA 5J39A 2M0OA 2P4RA 4M78G 3VS7A 2DRMA 4J9HA 2RHYA 3VRZA 3M57A 2ABLA 2XHCA 2ZPBB 3OW2P 2DBMA 5FW9A 2RQRA 2KE9A 2WSEE 4JJNK 2ZPFB 4E47A 3CCSQ 3QYHB 3REAB 4OGEA 1BI1A 3SB2A 3ULRB 1M9SA 2ZPGB 3R6OA 2RI2A 4IUPA 4ZTFA 2J6FA 4OMFB 1PC0A 1CKBA 2HNIA 1ZHIA 3KUFA 3QIIA 3HL8A 2EYQA 2SEMA 2RNAA 1HD3A 1TG0A 4IKFA 1M90C 1KFZA 5CO7A 1WHLA 2RB6A 1Q86U 3SHWA 4RKUE 2DERA 1UGVA 3BFMA 2GNCA 2HAXA 3DB3A 1YCSB 1XQHA 2RQVA 2BUDA 4WCIA 5EC7A 1VIEA 1FMWA 1A0NB 1U5SA 1TWBA 4C8QC 1T3LA 4F7UA 2L3SA 5C6SA 4ZN3A 3OYLA 3OYJA 3M9QA 3I55T 5FU7B 2OTJQ 2EVRA 3LLRA 3QO3A 2FZKB 2MAMA 1VYTA 3OYYA 2A08A 4JS4A 4F14A 9ATCB 3TQ7P 1VQLT 4PJOB 1ZSGA 2JOYA 3VUBA 2LT4A 3PTAA 1X27A 4C8QE 4KGXB 3S3MA 3I56T 4BY6B 2A37A 4M77C 2Y4YA 3MEUA 3G4SQ 4HT8A 4CI0C 3MJXA 3CCVT 4M7AC 2QQ9A 1JXOA 5KCHA 5LJ5e 2RQWA 1LCKA 4KH0B 2JXBA 3CCLA 4KGVB 1I5LA 1OULA 1JJ2A 3OSVA 3INZA 5KYWB 3CCMT 4PK4A 4E7SA 4M77E 3VS4A 1YWPA 3CCST 2OTLA 3FLGA 1W2BS 1NBEB 4XTZA 1Q82U 3X26B 3OMGA 1VQOQ 4M7AE 1TSFA 1H3HA 4ZNXA 3UA7A 5GAOq 2PNIA 1BKBA 2V8JA 4KGZB 4XAXB 5GMKh 3OYIA 2CP7A 1K73C 5FROA 1ABQA 2DVEA 2B8AA 2DXCA 4C8QD 3VJPA 1TUCA 2JS2A 3OB9A 2FYKA 2LNVA 1AWXA 1ZA2B 2K3YA 1NLPC 4PL6A 1Q7YR 3PMIA 2KYMA 3HRSA 5CKFA 4PLIA 1YJWQ 1HXDA 1U06A 5CAIA 3CCRA 4E7JA 1F1BB 4PJMA 2DO3A 2JTEA 1GL5A 2XDBA 5IXBA 3FDRA 2CP6A 2OAWA 4PNOA 4C92B 1D1BA 5GAMe 1D0ZA 1SSFA 2KDSA 2OTJT 2AIRB 3X20B 4WF2A 2DBKA 2LJ3A 2X4JA 1I07A 2DIGA 4LNPA 4M7AD 4CC2A 5LJ5g 1SSHA 4Z88A 2HKNA 4OMPA 3EGXA 5GAOl 1VQ7Q 2M9UA 2LRQA 2XIDA 2YXYA 1X75C 2LTOA 2HSEB 5IHIA 3M0SA 3G4ST 5FRMA 1R77A 2ROTA 2K79A 1FYNA 1M2VA 2EAYA 1HYOA 5HK0A 1I1JA 2LP5A 2YT6A 4J6WA 2KSSA 5CK9A 1X6BA 2RHUA 1YJNA 1D09B 3RIRA 4ZGJB 1SRLA 3CCUA 1WHMA 2HDAA 1VQPQ 1NM7A 2CSIA 4R55A 2X9HA 1I5OB 2MPXC 1N8RR 4XU3A 2KXDA 4F7UE 1VUBA 4OF1A 4JJBA 1KQ2A 1FXXA 4FYVB 4ESRA 1YHQA 1UGRB 2DE0X 2PQWA 4JJCA 1AHJB 1YCYA 2RHIA 1DJ7B 1TH7A 3CCET 1YP5A 1YFNA 2C0OA 4DOVA 3CC7Q 1XNIA 2DILA 5GAMg 3OYGA 1WHHA 5DLOA 2VVKA 3FC3A 1QKWA 1UJ0A 4IUUA 5KE3A 3GIBA 3GLXA 3OY9A 3CC4A 4R56A 1YJWT 5FRNA 2RQUA 3C12A 1RABB 1YITA 2DZ9A 4PJOG 4FU6A 3SDZA 4JUVA 1FMKA 3G71T 2ED0A 2AKKA 1OYXA 3MO8A 3GP8A 2NYSA 1QKXA 4FW2A 3E2UA 3CPFA 3CMEA 5EG2A 3JRZA 4LDVA 4M78F 4PJJA 1NPPA 2HZYA 1Q7YC 1SF9A 4ORZA 2JMAA 3GOXA 1VQ7T 2KGTA 2CP3A 4MZTA 2LCCA 3VS2A 1SHFA 2QI2A 3JB9F 1WI7A 3D7SB 5LJ5j 3V7CA 1TU0B 1UECA 1ZSZA 1FX7A 1RAEB 5A0LA 1BIAA 1WPYA 1XTDA 3MPUB 4OMLA 2QEXQ 1T0JA 5I22A 3J81E 2DF6A 2W0ZA 1WYXA 3J80E 4J9BA 1VQPT 1T0HA 2KY9A 1PD0A 2YUPA 3SEMA 2MF2A 3JB9H 1HJDA 4TVRA 5FU6B 1M27C 1ZUYA 4EDUA 1YJ9A 5D6WA 2WSCE 1QWEA 3CC2Q 2VB6A 1GCQA 7AT1B 5LJ3e 1D3BA 2G3RA 2HCKA 1YWOA 4KH1B 3SWNB 4Z89A 2EGAA 2DMOA 3EFSA 1R0BG 2P0PA 1VIFA 3HRTA 1WHGA 3RKXA 3TSZA 2QK0A 4FL6A 2IVWA 2KYBA 4C5EA 5GAMj 4KUIA 1KQSS 2RD1A 5LJ5d 1VQNA 5KH6A 2YUQA 1B34B 2J05A 1M4ZA 1QCOA 1MGQA 1X2QA 4M7DF 2XDDA 1WXUA 4RG8A 1X6OA 4F17A 3JAME 3L1AA 2OX7A 2PUKB 2O88A 2RH2A 1YIJT 2EQIA 1UDLA 4NL3A 4O6JA 4MZMA 4M75F 1ZQ1A 3A8GB 1RI9A 2CZ1B 3JCMg 2NUTA 5KYYA 3A8HB 2AHJB 1SRMA 1JU5C 5HY6A 3CPWS 2JW4A 5GAN7 1KD1U 2GFUA 2EQKA 3QYGB 4B9XA 3H0HA 4XK8E 4FT2A 2KRSA 4RTYA 4BI3A 4PFPA 2CT3A 2XICA 2L3QA 1M8VA 2DL3A 1Z9ZA 2H3EB 5GAMd 4BE2A 2QDLA 2VASA 4Z8AA 4WTOB 3EG2A 1ZSZC 2DX1A 1WZOA 3NTKA 1RUWA 3VRYA 2K3XA 4X9DA 2QA4A 3CC2T 2BE7D 3MEVA 4C5HA 4IUVA 1M90R 4RMOA 4OB0B 5GAOn 2GBQA 5I2MA 5ECAA 4AG2C 3IQLA 2DXBA 3CCLQ 3M4YA 5I21A 1Q81R 4X1VA 4RTUA 1JXMA 1TUDA 2FZGB 3A98A 2OTLQ 4M7DB 1AWWA 2R5AA 1UE9A 4IIMA 1K9MR 4FYXB 4JRKA 1S72A 5KYUB 2QXFA 4XU0A 1GCQC 2JT4A 1VQ8A 4HCKA 5CCAA 3CCJA 2E5KA 2LQKA 2F2WA 2RK1A 2M16A 2A0FB 3C4SA 3M0PA 3EGDB 3S3OA 4QVZA 3OYMA 4BB7A 1G83A 1HK9A 2M51A 3UWNA 2LVMA 1MMGA 3CCRQ 4XTUA 2F2VA 2CKKA 2LJ0A 2DTHA 1WJQA 1MUZA 1M1KU 2D9TA 1NZ9A 1I0CA 5IH2A 2MIOA 2HQXA 1IZ6A 1M3AA 3A8MB 4ATOA 1M3BA 3Q1JA 4M78A 1HSQA 1EIFA 4PJLA 2DL4A 4E7LA 1W70A 2A28A 3WVDB 4LUDA 4GLMA 1AD5A 2HBWA 4N4GA 1G5VA 2LZ6B 3G6EA 4OGCA 4PJOF 5LJ3j 2GQIA 4LDXA 4N0AA 2GF7A 3MHXA 4C0FA 1KC8C 3I5RA 2JTMA 2VWFA 1K73R 3OBWA 4JLIA 1VQ9T 1YJNQ 2LNHB 3PFSA 2QTXA 2JUFA 2AT1B 2QQRA 3RBBB 3CCUQ 2EJGA 4M4ZA 1WQWA 1ZUUA 4MDXA 2DL5A 4IUQA 2DD5A 4OVAA 2CH4W 4R0KA 4FSXA 3V7SA 3JB9G 1V29B 4MDWA 2F1LA 2K5IA 1Q7YU 1RLPC 2FZCB 2O4XB 5LL6S 1IGUA 2FPEA 1BBZA 1YHQQ 3BY7A 4EMKB 2YSQA 2CUBA 2XU8A 4KBMB 1X43A 2DYBA 3MEAA 4PJNA 1Y7XA 3ZEHA 1G3YA 1QVPA 4FYYB 5GJVB 5FLXE 3OYDA 1T3SA 2J6KA 5LJ5f 2C0TA 2KT8A 3ZL7C 1JJ2S 2HEQA 4A63B 2ROLA 2PTKA 1Q81C 2FHDA 1GCPA 3CC4Q 4BDYA 2WACA 1G3SA 1WXTA 4GBQA 2H3JA 1D1CA 2LDMA 3TVTA 3CCRT 1YITQ 2KNBB 2RN8A 3OYHA 5LJ3d 4E6RA 1K9MC 3BE3A 1KHIA 2E70A 3N5BB 3RUXA 2CP5A 1C1AA 2JVVA 2QGGA 3EAEA 4C92F 1Z9QA 3CMEQ 4LD9K 1UGSB 1IHVA 1QCNA 4JRQA 2MWPA 2KI7A 3M0UA 2ATCB 3M54A 3SFMA 2YWWA 3DKMA 1SPKA 5GMKl 4QKUA 2J7IA 2MYSA 1CSKA 3VS5A 3S3NA 3H0IA 4FSSA 3OS5A 3ZBDA 1N8RU 2NUPA 2VGNA 3MP1A 2VXFA 2KRMA 3J7AF 1N27A 4M7DG 4XU1A 2CUDA 4C0ZA 2LX9A 3QWYA 5GAMf 5GAN5 3WXMB 3PE0A 4DQ2A 1M5Q1 2CSQA 1YJNT 4K11A 4M78C 3THKA 2IG0A 2RJCA 3L2VA 3C94A 3CCUT 3PIPA 3O5ZA 4JLGA 3LWIA 4P5NA 3NMZC 1VQMA 3M56A 4M75G 3M53A 1K8AR 1AOJA 2SRCA 2OJ2A 1VQ5A 3M0RA 4N0AC 1YHQT 1LVKA 5FWCA 1YJ9Q 2DL7A 5J26A 1TXQA 2PVGB 4M78E 5C0MA 3RDVA 3CQTA 3OS0A 5CKHA 3C0CA 1MMAA 1YBYA 2E65A 3HFNA 2D0QB 5A0GA 1Y0MA 1OI1A 3JCMP 3M59A 1WX6A 2NWMA 2VXEA 3URGA 2RPNA 1TUGB 1RAIB 2HD0A 5HK3A 1B07A 2EYYA 4Y28E 3CMAA 3EFOB 4ZGEB 1VQNQ 2M02A 1S1NA 3HP9A 5A2QE 2YHTA 4M77D 4J7IA 1K0SA 1MMDA 4C0DC 1X6GA 1OOTA 3CD6A 3V7RA 1K1ZA 3I55A 1ABOA 2QYZA 3EG0A 1V76A 2FPDA 1RAHB 1VOMA 2FPFA 1UHFA 1GRIA 1AWJA 1Q86R 4M78D 2DZCA 3NGPA 3RMSA 3UDCA 2K5LA 1KJWA 3QBYA 2CZ6B 4J9FA 2QGFB 4BE0A 4GY5A 5LJ5h 3QXEB 3EHRA 1XJWB 4X9CA 2C06A 1AZEA 2D6FA 1JBMA 3CCVA 1ZLMA 3S6WA 1QVFP 1BIBA 2QQAA 1NEGA 3FRNA 2D8JA 4N4HA 4RUGA 4M75C 4FT4A 3NPFA 2KROA 1VQOT 1XOVA 1Y96B 3OA6A 4PJOA 3UF4A 2LT1A 3CCMA 4B9WA 2EIFA 3JSCA 1K76A 3KBGA 2DNUA 3HHTB 2XI9A 3QPHA 2ZPEB 5DM7R 2QA4Q 1P92A 3QKJA 5A0DA 2RI3A 6AT1B 8AT1B 3PNWC 4LUEA 2LQ8A 2CP2A 3META 4PKCC 4M75E 1RAAB 3CBMA 1PCXA 1K8AC 2A3LA 1GBQA 3OW2S 1GFCA 5CIUA 4AFSC 4JPBW 2XMFA 3R6NA 5GAMh 3H0FA 2K2MA 4QQGA 4AG1C 5KYWA 4LXCA 1VQNT 1S72Q 1IO6A 2M0YA 1KIKA 3EG9B 2K6DA 2ZAEA 1VQ8Q 3VS6A 5GAOp 3CCJQ 1D1AA 2KEAA 5LJ3f 4FYWB 4ELZC 2HL5C 1U1SA 3SD4A 2FRWA 4J83A 2YLBA 4M7AF 1K0XA 2BZ8A 4UC4A 3BDUA 1LJOA 1WHKA 4DBRA 1H3ZA 4BACA 4JS5A 5DLQE 4OMOA 2V8KA 1QP3A 2IPOB 2LMJA 2LQNA 5D6XA 8ATCB 1EFNA 2P0KA 3G4SA 1IHWA 2Y90A 1M90U 2DK3A 2L0AA 1JRIA 2E6NA 2F5KA 4HVUA 3L42A 3JCMe 1SKUB 3OMCA 3T9NA 3M58A 3FB9A 1Q86C 4A4KA 2R57A 3OW2A 3LH0A 2JJ9A 3WVEB 5IAYA 3G6EQ 2XG8D 3JCMW 2KVQG 4C8QB 1K9AA 3LYIA 5FWBA 2CYZB 1M3CA 3CC7T 4C92G 4DBQA 2QA4T 3HKSA 5IT9E 2EYXA 3L2ZA 4RTXA 3X24B 5GANe 3BDLA 5FU7C 2HL3A 4RTVA 1QCFA 3ASKA 4DA4A 3CCEA 1BI0A 4J9CA 4CRIA 3CCQA 2DRKA 2E10A 1AWOA 4CC4B 3OBYA 2FO0A 4PJOC 3OSSC 1D0YA 2DTIA 4M77B 4XTYA 1S72T 1NLOC 1E7OA 3PVQA 3DB4A 2DEUA 4BY6C 1QVGP 4PFZA 4M7AB 5HKCA 2DXTA 4YTLA 4DBFA 3CCJT 2EKOA 1OPKA 2PZ1A 3GF5A 1WA7A 3G71A 1UGQB 3AHUA 2A7YA 3I35A 2KXCA 5CKEA 1ARKA 1Y07A 4OP0A 4JJDA 4PJOE 4LD6A 2F69A 1N9SA 2LCLA 2J06A 5KYXB 3JCMV 3HPWA 1C6VX 4A54A 1KC8R 5IHKA 2OI3A 2X4XA 3OS2A 3ZFJA 3CBPA 3PIOA 1Q82C 1PG5B 2E6ZA 2QEXT 1K73U 5CR2A 2EQMA 3E9GA 2YRVA 2GTJA 4KULA 1NG2A 2DAQA 2VGMA 2KMTA 1SG5A 2FEIA 4IIOA 1EX4A 1SEMA 1EZZB 5GANg 4HCZA 2COZA 2ZCFB 1TOVA 1W2BP 1OU9A 3G6ET 1PKTA 1SHGA 1UFFA 2RJDA 2CZ0B 4JRPA 1TS9A 1RI0A 5LJ3h 2JZ2A 4C5IA 4BDZA 2BKDN 4PJOD 4C92C 1I4K1 4A4FA 1QQJA 1LOJA 1RAGB 1UTIA 1KQ1A 3EFRA 2LX7A 2EYZA 3QUIA 3H6ZA 4XQ3A 2VV5A 1VQMQ 4MMLA 1KSWA 1PKSA 4J9DA 5D7UA 2MOXA 1VQ5Q 4F7UB 4O5VA 1QVFS 3HFOA 4C92E 4A4EA 2GFAA 2EFIA 4JZ3A 4NS5A 4J5YA 3KXTA 4HA8A 2GQVA 2QAZA 2JTFA 2E5QA 2DFUA 2D8HA 1WNLA 4A53A 2D0NA 4MZPA 4C5GA 3PVLA 3JCMc 4JZ4A 2DPPB 2MI6A 2V8IA 2XKOC 3TREA 1VYUA 2KR3A 4NOYA 2EWNA 3CMAQ 1YIJA 1X2KA 3QJYA 4JRIA 1PM3A 2HMAA 2KRNA 1WIEA 4AMCA 2COYA 2E1HA 1WJSA 4C8QG 4E2FB 2O31A 1B34A 3CD6Q 3I55Q 5KCOA 2KK4A 4RTTA 3RESA 5GMKm 2JM9A 3VYHB 1VYVA 1GBRA 1RADB 2DIQA 4E7IA 1WDXA 1JEGA 3UT1A 1QVFA 1YI2A 1YN8A 2L2PA 3QDRB 5GANj 3NTHA 5GMKi 1PNJA 2DETA 3MKDA 2CT4A 4DBHA 5KE2A 2AZSA 1MV0B 2C0IA 1I8FA 3GNGA 2HBPA 2K9GA 2PVDB 3CCLT 1MHNA 1RL2A 4CC3A 4LN2A 1PRMC 4M7AG 1ZUKA 2B86A
chains in the Genus database with same CATH topology
4LDVA 2CZ7B 4M78F 3F70A 1OI1A 4LDYA 3OYFA 3M59A 3LGLA 2EQJA 1NPPA 3JCMP 2F5TX 1WJRA 3OYCA 1LNXA 1VQMT 1VQPA 2VXEA 1Q7YC 3URGA 3CBOA 4OB2B 2OTLT 4L6V5 4GLKA 3GOXA 4ELYC 3HRUA 3BW1A 3JB9J 1VQ7T 2HD0A 5HK3A 1I81A 1YI2T 5LJ3g 5L8RE 1VQ5T 1BYMA 4MZTA 2K4YA 2LCCA 3L2RA 4Y28E 3CMAA 2QI2A 3JB9F 2R58A 2OAUA 4ZGEB 5LJ5j 1UGPB 3V7CA 1U1TA 3HP9A 5A2QE 1KQSA 5GANh 1VQ6A 2YHTA 1FX7A 4M77D 3JCMd 4KT0E 4J8OA 5A0LA 1BIAA 1WPYA 1XTDA 4J7IA 3LGFA 3OYEA 3V8KA 1BI3A 4C0DB 3ER0A 3FJPA 3MP6A 4C0DC 3CC7A 2NLUA 1N6AA 3JCMb 4KUDK 5GMKe 3CD6A 3V7RA 2O01E 5GAN2 4EMGA 3I55A 3J81E 5GAN6 3J80E 3P8HA 1NPRA 1VQPT 5D6YA 2KY9A 4RCCA 2X35A 4M78D 2DZCA 2VC8A 3RMSA 4ZGDB 2MF2A 2VYTA 2K5LA 3UDCA 5CQYA 4E7KA 3JB9H 2L89A 3QBYA 4TVRA 3CMAT 1WGSA 2CZ6B 5FU6B 3TU4K 5GANd 3LWHA 5FU6C 2RI5A 4BE0A 4GY5A 1NJIU 4EDUA 1YJ9A 5D6WA 2WSCE 1VQKA 1VQ6T 5LJ5h 3QXEB 4M7DA 4QQ6A 2KAFA 2K57A 3QHSA 3CXCS 4C8QA 4X9CA 2C06A 4BE1A 2DTOA 1NE8A 2E64A 1D3BA 2G3RA 3SWNB 5LJ3e 3SWNA 1FWZA 3SWNC 3EFSA 3CPWA 1JBMA 2P0PA 3CCVA 3MEWA 2D6FA 3CD6T 5GAN3 2L5QA 4J6XA 1QVGS 5GAOm 4A4GA 3O8VA 1VIFA 3LX7A 2BIVA 3S6WA 3HRTA 1U8RA 1BIBA 2QQAA 3FRNA 3RKXA 4LDUA 3L2WA 3JCMJ 4FL6A 4M75B 4M75A 4N4HA 2IVWA 3M5AA 4M75C 4C5EA 4FT4A 5GAMj 4QVCA 1VQOT 2RA2A 4PLLA 1H641 3E9FA 1XOVA 4KUIA 1Y96B 3OA6A 4PJOA 4L5GA 1KQSS 3X25B 2XD0A 2LT1A 2RD1A 3A5ZB 4QVDA 5LJ5d 1VQNA 3CCMA 1VQKT 4B9WA 2EIFA 3JSCA 3KBGA 3M4GA 4OB3B 5A0GA 3HHTB 3MP8A 2XI9A 1R8OB 2ZPEB 1B34B 3QPHA 4M77A 4F7UG 4OB1B 5KH6A 5DM7R 1P92A 3QKJA 1VQ4A 1M4ZA 5A0DA 4BI4A 5GAN4 4HCCA 2RJFA 2RI3A 4JDSA 4LDWA 1MGQA 4A4HA 4C92D 4M7DF 2ZPHB 2FVUA 3ME9A 5M9OA 3PNWC 2XDDA 4RG8A 4FIBA 3OS1A 4M7AA 2QEXA 2LQ8A 3JCMX 3A8LB 1X6OA 3JAME 2DD4A 3L1AA 4IUTA 1VQ9A 2PUKB 3META 4PKCC 3RKYA 5AYFA 4M75E 1K8AU 2RH2A 4MMKA 1YIJT 2P0QA 4RG2A 4BI8B 3CBMA 3A8OB 2YLCA 2A3LA 2RO0A 1K8AC 3V8LA 2ZPIB 3OW2S 2XK0A 4O6JA 4NL3A 5CIUA 3PMTA 4MZMA 3VV0A 5GAMh 4M75F 1ZQ1A 4QQGA 2P4TA 1OZ2A 2WSFE 4M77G 1WQ7A 3A8GB 3QJ6A 2CZ1B 1VQNT 3JCMg 1UB4A 3A8HB 3VYGA 5I2SA 2AHJB 3MCAB 5CKDA 5GAOr 1VQ4T 3CXCA 3HSBA 3QZ9B 5GAOp 3CC2A 2XDPA 1OZ3A 5HY6A 3CPWS 1UEBA 5GAN7 1KD1U 2GFUA 2EQKA 5LJ3f 3FEOA 3QYGB 5J39A 1QVGA 1KD1C 3PT9A 4B9XA 2M0OA 4ELZC 1U1SA 4XK8E 4FT2A 3SD4A 2L8DA 3CC4T 4M7AE 4J83A 2R5MA 4M78G 2YLBA 2RHYA 2D0QB 4M7AF 3M57A 4BI3A 2XHCA 2ZPBB 1YITT 2XICA 2ZGWA 1M8VA 4UC4A 3BDUA 1LJOA 5GAMd 2WSEE 1H3ZA 4BE2A 3NTIA 2RM4A 4JJNK 2ZPFB 3TEEA 4BACA 4E47A 4JS5A 3RMQA 5DLQE 3QYHB 2V8KA 3SB2A 4OGEA 1BI1A 1QP3A 2O4XA 3G7ZA 5D6XA 4ME7A 1M9SA 5CVIA 2ZPGB 3NTKA 2CS7A 2P0KA 3R6OA 1O9SA 2RI2A 2K2VA 2K3XA 4IUPA 4X9DA 4XTXA 4OMFB 4EMKA 2QA4A 4ZTFA 3CC2T 3MEVA 4C5HA 2HNIA 4IUVA 1ZHIA 3KUFA 3QIIA 3G4SA 4RMOA 3HL8A 2EYQA 4OB0B 2Y90A 1M90U 5GAOn 4IKFA 2DK3A 1JRIA 1M90C 5I2MA 2E6NA 2QDYB 2F5KA 5CO7A 4HKEA 3L42A 3JCMe 2DXBA 3M4YA 2RB6A 2RK2A 3OMCA 3T9NA 2X4WA 3M58A 1Q86U 3FB9A 5I21A 4RKUE 3GPLA 3BFMA 4A4KA 1Q86C 2HQEA 2R57A 2HAXA 3OW2A 4J7FA 1VQLA 4BUGA 3DB3A 3LH0A 3WVEB 5IAYA 2EJFA 2DJZA 1XQHA 4EPCA 5J3BA 2BUDA 4M7DB 5IN1A 2XG8D 2R5AA 3JCMW 1NJIC 1VIEA 2K5FA 3JB9D 4M7DC 2KVQG 3I56A 4Z02A 4C8QB 3LYIA 4JRKA 2CYZB 1S72A 4C8QC 1D3BB 1W2BA 2QXFA 3CC7T 4C92G 4XU0A 4F7UA 3OYLA 5C6SA 4ZN3A 3HKSA 3OYJA 3L2ZA 2QA4T 1O75A 5IT9E 3M9QA 1VQ8A 4ZN1A 3I55T 2L3RA 3TCJA 3RERA 5CCAA 3CCJA 2LQKA 2JN0A 5FU7B 3X24B 5GANe 3BDLA 1Y71A 3LLRA 3QO3A 1IREB 5FU7C 2MAMA 2RK1A 3OYBA 2X4YA 2M16A 3OYYA 3ASKA 4DA4A 2RJEA 4JS4A 3CCEA 1BI0A 3C4SA 4CRIA 3CCQA 3S3OA 4QVZA 3OYMA 4BB7A 1HK9A 2E10A 3OYAA 5DY9A 1VQLT 2LC4A 3UWNA 4PJOB 3OBYA 2LVMA 3DLMA 3OSSC 4PJOC 2JOYA 2DTIA 1YJ9T 3VUBA 4M7DE 2LT4A 4XTUA 3PTAA 3M55A 2M1HA 4C8QE 3VUZA 4M77B 3I56T 2FB7A 3CCSA 2CKKA 4XTYA 4E7HA 3S3MA 1S72T 4BY6B 4M77C 2E41A 2DTHA 2Y4YA 4BD3A 3DB4A 3MEUA 5GMKj 1WJQA 4BY6C 4CI0C 2Y4XA 4HT8A 1N9RA 3CCVT 2D9TA 4M7AB 1NZ9A 1M1KU 5HKCA 2DXTA 4YTLA 4C8QF 3CCJT 2EKOA 1M1KC 4M7AC 2FL7A 2QQ9A 2HQXA 3GF5A 5KCHA 4X34A 3G71A 1UGQB 5CQXA 2A7YA 5LJ5e 3AHUA 5CKEA 4XTWA 1IZ6A 1G3WA 3LW5E 3A8MB 4ATOA 4ZTJA 1Y07A 4OP0A 3CCQT 3Q1JA 4M78A 1X01A 1QP2A 1EIFA 3JCMf 3CCLA 3OYKA 4E7LA 4PJOE 1I5LA 4L59A 4LD6A 2F69A 2VUBA 1N9SA 3WVDB 1JJ2A 2LCLA 2RHXA 1ZBXA 3OSVA 3INZA 3RKWA 4N4GA 3CCMT 3DLLA 1KHCA 3JCMV 1G5VA 3HPWA 4M77E 3JCMQ 3G6EA 4OGCA 4A54A 4PJOF 3CCST 2I2LA 2OTLA 5LJ3j 3FLGA 1W2BS 4XTZA 1KC8U 1Q82U 3X26B 2X4XA 3OMGA 4LDXA 3OS2A 5CKBA 4N0AA 2GF7A 3MHXA 3ZFJA 3CBPA 4C0FA 2ZZDA 3OQ5A 3PIOA 1Q82C 1KC8C 2JTMA 2E6ZA 5GAOq 4M77F 2QEXT 1BKBA 1K73U 2V8JA 4XAXB 5GMKh 5CR2A 2EQMA 3OYIA 3E9GA 3OBWA 3V8JA 4JLIA 2YRVA 1VQ9T 5FROA 1K73C 3P8DA 2DVEA 4N4IA 4M7DD 2OTJA 4KULA 3PFSA 5GANf 2B8AA 2QTXA 2JUFA 1PSFA 2DAQA 2VGMA 2DXCA 2KMTA 1PSEA 3QZ5B 4C8QD 2QQRA 3VJPA 4HT9A 2DXUA 2EJGA 3OB9A 1WQWA 2FYKA 2LNVA 4MDXA 5GANg 4HCZA 4J6YA 2K3YA 2DD5A 2ZCFB 4IUQA 4OVAA 4PL6A 4FSXA 3PMIA 3V7SA 3HRSA 3JB9G 2PU9B 5CKFA 1V29B 4MDWA 4PLIA 1Q7YU 2K5IA 1HXDA 4VUBA 2O4XB 3G6ET 5LL6S 5CAIA 2RJDA 3CCRA 4E7JA 2MWOA 2CZ0B 4M75D 4XU2A 4JRPA 3BY7A 2DO3A 4EMKB 1KG1A 2XDBA 1RI0A 3FDRA 4EMKC 2XU8A 5LJ3h 4PNOA 4C92B 4C92A 2JZ2A 4FM4B 4KBMB 2EJ9A 4C5IA 4BDZA 2BKDN 3MEAA 5GAMe 4C92C 3L2UA 1QW1A 4PJOD 1I4K1 3VKIA 4A4FA 1Y7XA 1SSFA 2E12A 3ZEHA 2KDSA 1G3YA 2OTJT 1QVPA 5FLXE 3X20B 3OYDA 1LOJA 3PGGA 4WF2A 5LJ5f 2PVOB 3UPUA 3X28B 1KQ1A 2KQWA 3EFRA 1Q81U 2X4JA 3CEYA 1JJ2S 2DIGA 3QUIA 3H6ZA 4V2SA 4M7AD 1Q81C 3OYNA 4XQ3A 2FHDA 3C95A 4NL2A 5LJ5g 2VV5A 4MMLA 4BDYA 2CGHA 1G3SA 2WACA 2H3JA 2LDMA 5GAOl 3CCRT 2M9UA 2LRQA 2XIDA 1K9MU 1X75C 2LTOA 4Q5WA 4F7UB 4O5VA 3OYHA 5LJ3d 1K9MC 1QVFS 3HFOA 1KHIA 4C92E 2E70A 3N5BB 4A4EA 3G4ST 2GFAA 3RUXA 5FRMA 2EFIA 1VQOA 4Y91A 4NS5A 4J5YA 3KXTA 2EAYA 2JVVA 4HA8A 2GQVA 3L2QA 3EAEA 3VU3C 2JTFA 4C92F 2E5QA 5HK0A 1WNLA 1YJNA 4J6WA 2KSSA 5CK9A 2RHUA 4LD9K 4A53A 1UGSB 2DEQA 3FIFA 2MMPA 3RIRA 4ZGJB 4JRQA 2MWPA 5GAN8 3CCUA 4MZPA 4C5GA 3M54A 3JCMc 3SFMA 3DKMA 5GMKl 2DPPB 2MI6A 2V8IA 3QG1A 4R55A 2XKOC 3TREA 3S3NA 4D6WA 3NFCA 4NOYA 4XU3A 2EWNA 4F7UE 1VUBA 3OS5A 4OF1A 3ZBDA 1YJWA 1N8RU 1GXIE 2VGNA 1G3TA 3MP1A 4QQDA 1FXXA 4QW2A 1YIJA 2VXFA 1KQ2A 1N8RC 1M1FA 1W4SA 1VQ8T 1YHQA 3QJYA 4JRIA 3E19A 1UGRB 3J7AF 1N27A 4F7UF 1Y96A 4M7DG 4XU1A 2PQWA 1AHJB 4C0ZA 1YCYA 2LX9A 5GAMf 2RHIA 2E1HA 5GAN5 1WJSA 3WXMB 1DJ7B 1TH7A 4XTVA 4C8QG 1BI2A 1M5Q1 4DQ2A 3CCET 4DOVA 4M78B 2DKGA 1YJNT 4IURA 3E1SA 1B34A 4M78C 1JB0E 1XNIA 2IG0A 2RJCA 5KCOA 4DOWA 5GAMg 3C94A 3L2VA 3CCUT 3OYGA 2KK4A 5DLOA 3RESA 3PIPA 3H8ZA 3JB9I 1M1GA 5GMKm 3GNFB 3FC3A 3VYHB 4IUUA 5KE3A 4JLGA 3LWIA 4P5NA 3GIBA 2JNGA 3GLXA 2DIQA 4RCBA 4E7IA 1VQMA 3M56A 4M75G 3M53A 3UT1A 3OY9A 3CC4A 4R56A 1YJWT 5FRNA 3P8BB 2PUOB 1VQ7A 3C12A 1QVFA 1YI2A 3CMET 1VQ5A 1YITA 4N0AC 1YHQT 2QQBA 2DZ9A 4PJOG 3QDRB 4EMHA 5GANj 4FU6A 2RHZA 3NTHA 5GMKi 3SDZA 2QQSA 4JUVA 5J26A 3G71T 2EQUA 3HFNA 4C0GA 5KE2A 4HCBA 2PVGB 4M78E 1I8FA 1OYXA 5C0MA 3GNGA 2HBPA 3MO8A 3GP8A 3JCMh 3OS0A 2GCXA 2PVDB 5CKHA 3CCLT 4II1A 1MHNA 3QSUA 1RL2A 3CPFA 3CMEA 4M7AG 5EG2A 1YBYA 3JRZA 2E65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  3EFR A;  4M78 F;  3RKY A;  5GMK h;  3QUI A;  3JCM P;  4V2S A;  4M75 E;  4M7A D;  1HK9 A;  2E10 A;  4XQ3 A;  4NL2 A;  1LNX A;  4MMK A;  5DY9 A;  2VXE A;  5LJ5 g;  4PJO B;  4MML A;  2YLC A;  3JB9 J;  2CGH A;  3BW1 A;  3V8L A;  4PJO C;  4NL3 A;  5GAO l;  4M7D E;  2DTI A;  1I81 A;  5LJ3 g;  4XTU A;  4C8Q E;  5GAM h;  4F7U B;  4M75 F;  3JB9 F;  4M77 B;  5LJ3 d;  2FB7 A;  4XTY A;  4M77 G;  3HFO A;  5LJ5 j;  1WQ7 A;  4C92 E;  3V7C A;  1U1T A;  4M77 C;  2E41 A;  2DTH A;  3RUX A;  3JCM g;  5GMK j;  4HT8 A;  5GAN h;  5GAO r;  4Y91 A;  3HSB A;  2YHT A;  4J5Y A;  1N9R A;  4M77 D;  4M7A B;  2EAY A;  3JCM d;  4HA8 A;  2DXT A;  4C8Q F;  1WPY A;  1BIA A;  5GAO p;  4M7A C;  3VU3 C;  3V8K A;  4C92 F;  5GAN 7;  3FJP A;  3AHU A;  5LJ3 f;  1WNL A;  5LJ5 e;  4J6W A;  4A53 A;  4XTW A;  3JCM b;  2DEQ A;  5GMK e;  3FIF A;  3V7R A;  5GAN 2;  4EMG A;  1U1S A;  4OP0 A;  3RIR A;  4M78 A;  1X01 A;  5GAN 6;  5GAN 8;  4M78 G;  2YLB A;  3JCM f;  4M7A F;  3JCM c;  4PJO E;  1I5L A;  1N9S A;  5GMK l;  4RCC A;  2ZGW A;  1M8V A;  3INZ A;  3BDU A;  2DZC A;  2VC8 A;  4M78 D;  1LJO A;  3RKW A;  4NOY A;  4XU3 A;  5GAM d;  3JCM V;  2EWN A;  3JB9 H;  4F7U E;  2RM4 A;  4M77 E;  3JCM Q;  1KQ2 A;  4A54 A;  4PJO F;  2I2L A;  2VXF A;  5LJ3 j;  5GAN d;  4XTZ A;  4JRI A;  3SB2 A;  4N0A A;  4M7A E;  5LJ5 h;  4M7D A;  4F7U F;  5GAO q;  1Y96 A;  4M7D G;  4XU1 A;  4M77 F;  1YCY A;  4X9D A;  2K57 A;  3QHS A;  4XTX A;  2E1H A;  4X9C A;  4C8Q A;  4EMK A;  1TH7 A;  4XTV A;  3V8J A;  4C8Q G;  2HNI A;  1M5Q 1;  4JLI A;  4DQ2 A;  2DTO A;  4M78 B;  2DKG A;  1D3B A;  2DVE A;  2E64 A;  3SWN B;  3SWN A;  5LJ3 e;  4M7D D;  2Y90 A;  1B34 A;  4M78 C;  5GAN f;  5GAO n;  2QTX A;  3SWN C;  3EFS A;  3JB9 D;  1JBM A;  4C8Q D;  1JRI A;  4J6X A;  5GAM g;  5GAN 3;  5GAO m;  4HT9 A;  3RES A;  2DXU A;  2EJG A;  5GAM f;  3JCM e;  3JB9 I;  1WQW A;  2FYK A;  2RB6 A;  5GMK m;  1BIB A;  3FB9 A;  5I21 A;  3RKX A;  5GAN g;  3BFM A;  5GAN 5;  3GIB A;  4J6Y A;  3JCM J;  4M75 B;  4M75 A;  4RCB A;  4M75 G;  3V7S A;  3JB9 G;  4M75 C;  2EJF A;  5GAM j;  1HXD A;  2DJZ A;  4QVC A;  2RA2 A;  1H64 1;  5CAI A;  4M7D B;  4N0A C;  1Y96 B;  3JCM W;  4PJO A;  2DZ9 A;  4M75 D;  4XU2 A;  3BY7 A;  4PJO G;  4EMH A;  5GAN j;  4EMK B;  2RD1 A;  4QVD A;  4C8Q B;  5GMK i;  5LJ5 d;  4JRK A;  4M7D C;  4JUV A;  4EMK C;  4C8Q C;  5LJ3 h;  4PNO A;  4C92 B;  1D3B B;  3HFN A;  3M4G A;  4C92 A;  2EJ9 A;  4XU0 A;  4C92 G;  4F7U A;  4PJO D;  1B34 B;  4C92 C;  4M77 A;  3L2Z A;  4F7U G;  5GAM e;  1I4K 1;  4M78 E;  5GAN 4;  1I8F A;  3RER A;  1MGQ A;  3JCM h;  2JN0 A;  4C92 D;  4M7D F;  5GAN e;  1LOJ A;  3PGG A;  4WF2 A;  3QO3 A;  5LJ5 f;  3QSU A;  4M7A A;  4M7A G;  3JCM X;  1KQ1 A;  2E65 A; 
#chains in the Genus database with same CATH topology
 2CRE A;  3LGL A;  2KT1 A;  2F5T X;  1WJR A;  2OTL T;  1LNX A;  1VQM T;  3JB9 J;  4ELY C;  3HRU A;  3BW1 A;  2AZV A;  3REB B;  1I81 A;  1VQ5 T;  1BYM A;  3L2R A;  2V1R A;  2R58 A;  2OAU A;  1UGP B;  3CCM Q;  2JMC A;  2LQW A;  1VQ6 A;  4FW1 A;  3JCM d;  1MMN A;  4KT0 E;  3LGF A;  3OYE A;  1OX9 A;  3FJP A;  1IRX A;  2NLU A;  1MNE A;  5GMK e;  1LPL A;  2O01 E;  5GAN 2;  4EMG A;  2CP0 A;  5GAN 6;  3RR6 A;  3EGX B;  5D6Y A;  4RCC A;  2ECZ A;  2X35 A;  4ZGD B;  2VYT A;  5CQY A;  4E7K A;  4OMQ A;  3CMA T;  1WGS A;  1M2V B;  1NJI R;  1E6G A;  5GAN d;  2HSP A;  3NHN A;  5FU6 C;  3LWH A;  2RI5 A;  1VQK A;  4M7D A;  2JS0 A;  2K57 A;  3QHS A;  4BE1 A;  2DTO A;  1NE8 A;  1WHJ A;  2E64 A;  3I9Q A;  5KYU A;  1FWZ A;  2EBP A;  3SWN C;  3CD6 T;  2EPD A;  2FRY A;  5GAN 3;  4J6X A;  1QVG S;  5GAO m;  1AVZ C;  4A4G A;  3O8V A;  3H41 A;  1U8R A;  1RLQ C;  1E6H A;  1H8K A;  3QDF A;  4M75 A;  3M5A A;  2RMO A;  4E7Z A;  1RAF B;  3EGD A;  2K7A A;  1RAC B;  4PLL A;  3E9F A;  1K4U S;  1BCO A;  3X25 B;  3A5Z B;  1UG1 A;  1MND A;  3M4G A;  4F7U G;  1VQ4 A;  4OB1 B;  5GAN 4;  2RJF A;  4JDS A;  4LDW A;  4A4H A;  1M1K R;  2FVU A;  1TTH B;  2AK5 A;  3JCM X;  2NUZ A;  4HVW A;  4IUT A;  1VQ9 A;  2H8H A;  3RKY A;  5AYF A;  1M8M A;  4MMK A;  4BI8 B;  3A8O B;  2YLC A;  3VS3 A;  3V8L A;  1KQS P;  2XK0 A;  1PHT A;  3PMT A;  1YNZ A;  3UAT A;  2K3B A;  2WSF E;  3RNJ A;  5GAO r;  3MCA B;  5CKD A;  2LJ1 A;  3QZ9 B;  2XDP A;  1OZ3 A;  4DEX A;  2YUO A;  5I11 A;  3EH2 A;  1QVG A;  1KD1 C;  3PT9 A;  3CCE Q;  2CH4 A;  5IXF A;  3CC4 T;  2L8D A;  3CCQ Q;  2R5M A;  2DM1 A;  1YIT T;  2HKQ B;  4FCY A;  2ZGW A;  2W10 A;  3NTI A;  2RM4 A;  3TEE A;  3AT1 B;  3RMQ A;  1ZSZ B;  2O4X A;  3G7Z A;  4ME7 A;  5CVI A;  3CPW P;  4B6M A;  2CS7 A;  3JV3 A;  4EPC A;  1O9S A;  3CME T;  1BCM A;  4EMK A;  4XTX A;  1ZBJ A;  3G71 Q;  5GJW B;  1J3T A;  3EHQ A;  1QLY A;  2QDY B;  3KFV A;  4HKE A;  2RK2 A;  2X4W A;  5AT1 B;  3GPL A;  1AZG B;  2HQE A;  2V1Q A;  1PRL C;  3U23 A;  4J7F A;  1VQL A;  4BUG A;  2EJF A;  2DJZ A;  2L3P A;  5J3B A;  5IN1 A;  1NJI C;  3JB9 D;  2K5F A;  4M7D C;  3I56 A;  4Z02 A;  2YUN A;  1PWT A;  1D3B B;  1W2B A;  1O75 A;  2DLP A;  4J9G A;  4ZN1 A;  2L3R A;  3TCJ A;  3RER A;  1PD1 A;  2JN0 A;  1D0X A;  1OEB A;  1Y71 A;  2GTO A;  1IRE B;  2X4Y A;  1W1F A;  2RJE A;  2MK5 A;  2O9S A;  3OYA A;  5DY9 A;  2LC4 A;  1NYG A;  1C0M A;  3DLM A;  1YJ9 T;  4M7D E;  3CXC P;  3M55 A;  2M1H A;  3VUZ A;  4E7H A;  2FB7 A;  3CCS A;  2E41 A;  4BD3 A;  5GMK j;  1AEY A;  2Y4X A;  2COW A;  1N9R A;  3I5S A;  4C8Q F;  1M1K C;  2FL7 A;  1B3Q A;  4X34 A;  4DEY A;  2JM8 A;  5CQX A;  4XTW A;  1G3W A;  3LW5 E;  2O2O A;  3CCQ T;  4ZTJ A;  1OX8 A;  1X01 A;  1QP2 A;  3JCM f;  3OYK A;  4L59 A;  2VUB A;  2RHX A;  4AFZ C;  1ZBX A;  3RKW A;  3DLL A;  1KHC A;  3M0T A;  3M0Q A;  2NUT B;  5KYY B;  3JCM Q;  4F16 A;  2I2L A;  1BB9 A;  1Q82 R;  1FMV A;  1KC8 U;  2D1X A;  5CKB A;  1M2O A;  2ZZD A;  3OQ5 A;  4M77 F;  4HVV A;  3V8J A;  2Z0W A;  3P8D A;  4N4I A;  1MV3 A;  5KYN A;  4M7D D;  2OTJ A;  5GAN f;  1PSF A;  2I0N A;  3QZ5 B;  1PSE A;  3HTR A;  1Y57 A;  4HT9 A;  2DXU A;  1U3O A;  4J6Y A;  1OV3 A;  2HQH A;  1QMC A;  2PU9 B;  2CDT A;  2DJQ A;  4VUB A;  4AT1 B;  2MWO A;  1YIJ Q;  4M75 D;  4XU2 A;  1KG1 A;  2ED1 A;  4EMK C;  1G2B A;  4C92 A;  4FM4 B;  2EJ9 A;  3EFO A;  3L2U A;  1QW1 A;  3VKI A;  2E12 A;  3EGU A;  1B7T A;  3PGG A;  2BZX A;  2PVO B;  4LE9 A;  3UPU A;  3X28 B;  2BE9 B;  3GBQ A;  2KQW A;  1Q81 U;  3CEY A;  3UA6 A;  4V2S A;  3OYN A;  3C95 A;  4NL2 A;  1UJY A;  2CGH A;  1YI2 Q;  1K9M U;  5IHN A;  2MCN A;  4Q5W A;  2GGR A;  3EH1 A;  1IGQ A;  1VQO A;  4Y91 A;  2DA9 A;  2KBT A;  3L2Q A;  1OQK A;  3VU3 C;  2E3I A;  1JJ2 P;  2DEQ A;  3FIF A;  1M30 A;  2MMP A;  5GAN 8;  2EGC A;  2J6O A;  4J9I A;  4QT7 A;  1CKA A;  1ACM B;  3QG1 A;  4D6W A;  3NFC A;  1JO8 A;  2EGE A;  2DVJ A;  2DYI A;  4PFO A;  1YJW A;  1GXI E;  2AKL A;  1G3T A;  4QQD A;  4QW2 A;  1WFW A;  1N8R C;  1M1F A;  1W4S A;  1VQ8 T;  1NEB A;  3E19 A;  1VQ6 Q;  1OPL A;  4F7U F;  1Y96 A;  1Q95 G;  1UUE A;  3OYB A;  3TU4 K;  4XTV A;  1BI2 A;  2A36 A;  4M78 B;  1IB8 A;  2DKG A;  2ESW A;  4IUR A;  3E1S A;  2IIM A;  1JB0 E;  3LH5 A;  2ENM A;  4DOW A;  1AT1 B;  3H8Z A;  3JB9 I;  2O9V A;  1M1G A;  3GNF B;  3EG3 A;  4OMN A;  3QWX X;  2JNG A;  4RCB A;  1UHC A;  1N5Z A;  3P8B B;  2PUO B;  1VQ7 A;  2QQB A;  4EMH A;  2RHZ A;  2EYW A;  2QQS A;  2YRD A;  1VQK Q;  1QWF A;  2EQU A;  4C0G A;  2BZY A;  4HCB A;  1WLP B;  2QTV A;  3JCM h;  2RQT A;  2GCX A;  4ANJ A;  3EG9 A;  4II1 A;  2YDL A;  3QSU A;  1NYF A;  2K2V A;  4L6V 5;  1WXB A;  2CZ7 B;  3F70 A;  2X51 A;  1IXD A;  4LDY A;  3OYF A;  2EQJ A;  4OMM A;  5L23 A;  3OYC A;  1VQP A;  3CBO A;  4OB2 B;  4CC7 A;  4GLK A;  1YI2 T;  5LJ3 g;  5L8R E;  2K4Y A;  1G8X A;  2E4H A;  2X3X D;  4Y92 A;  1U1T A;  1KQS A;  5GAN h;  2P84 A;  1VQ4 Q;  4J8O A;  1BU1 A;  1JQQ A;  3V8K A;  1BI3 A;  4RTZ A;  4C0D B;  3ER0 A;  1ZA1 B;  3MP6 A;  3CC7 A;  2E3H A;  1N6A A;  3JCM b;  4KUD K;  1VQ9 Q;  1BK2 A;  4RTW A;  3P8H A;  1NPR A;  2VC8 A;  4D8D A;  2L89 A;  2QG9 B;  4AFU C;  2EKH A;  1W6X A;  1NJI U;  1VQ6 T;  3G1J A;  4F04 B;  4QQ6 A;  1OU8 A;  1KK7 A;  2KAF A;  3CXC S;  4C8Q A;  1V1C A;  2F2X A;  1GFD A;  2G6F X;  3SWN A;  3CPW A;  3MEW A;  2L5Q A;  1ZX6 A;  4AFQ C;  3LX7 A;  2BIV A;  2X3W D;  2NUP B;  2YRC A;  4LDU A;  3L2W A;  3JCM J;  2V26 A;  4M75 B;  4QVC A;  2RA2 A;  1H64 1;  1VA7 A;  2RF0 A;  2VKN A;  4L5G A;  2XD0 A;  2LCS A;  4QVD A;  3TSW A;  1VQK T;  3VS1 A;  2DL8 A;  1R0C B;  4OB3 B;  4J9E A;  3MP8 A;  1R8O B;  4M77 A;  4HCC A;  4BI4 A;  4HXJ A;  4C92 D;  2ZPH B;  3ME9 A;  3FJ5 A;  5M9O A;  4FIB A;  3VS0 A;  3OS1 A;  4M7A A;  2QEX A;  1H92 A;  3A8L B;  4EIK A;  2DD4 A;  5HCK A;  1X69 A;  1K8A U;  3EG1 A;  2P0Q A;  4RG2 A;  1VQL Q;  2RO0 A;  2ZPI B;  2QAS A;  2EW3 A;  3VV0 A;  4D8K A;  3H9N A;  3I56 Q;  2P4T A;  1OZ2 A;  4M77 G;  5KYX A;  1WQ7 A;  3QJ6 A;  4KRT A;  2FG0 A;  1UB4 A;  3VYG A;  5I2S A;  1VQ4 T;  3HSB A;  3CXC A;  3CCV Q;  3CC2 A;  1KD1 R;  1UEB A;  2BTT A;  3FEO A;  3A1P A;  5J39 A;  2M0O A;  2P4R A;  4M78 G;  3VS7 A;  2DRM A;  4J9H A;  2RHY A;  3VRZ A;  3M57 A;  2ABL A;  2XHC A;  2ZPB B;  3OW2 P;  2DBM A;  5FW9 A;  2RQR A;  2KE9 A;  2WSE E;  4JJN K;  2ZPF B;  4E47 A;  3CCS Q;  3QYH B;  3REA B;  4OGE A;  1BI1 A;  3SB2 A;  3ULR B;  1M9S A;  2ZPG B;  3R6O A;  2RI2 A;  4IUP A;  4ZTF A;  2J6F A;  4OMF B;  1PC0 A;  1CKB A;  2HNI A;  1ZHI A;  3KUF A;  3QII A;  3HL8 A;  2EYQ A;  2SEM A;  2RNA A;  1HD3 A;  1TG0 A;  4IKF A;  1M90 C;  1KFZ A;  5CO7 A;  1WHL A;  2RB6 A;  1Q86 U;  3SHW A;  4RKU E;  2DER A;  1UGV A;  3BFM A;  2GNC A;  2HAX A;  3DB3 A;  1YCS B;  1XQH A;  2RQV A;  2BUD A;  4WCI A;  5EC7 A;  1VIE A;  1FMW A;  1A0N B;  1U5S A;  1TWB A;  4C8Q C;  1T3L A;  4F7U A;  2L3S A;  5C6S A;  4ZN3 A;  3OYL A;  3OYJ A;  3M9Q A;  3I55 T;  5FU7 B;  2OTJ Q;  2EVR A;  3LLR A;  3QO3 A;  2FZK B;  2MAM A;  1VYT A;  3OYY A;  2A08 A;  4JS4 A;  4F14 A;  9ATC B;  3TQ7 P;  1VQL T;  4PJO B;  1ZSG A;  2JOY A;  3VUB A;  2LT4 A;  3PTA A;  1X27 A;  4C8Q E;  4KGX B;  3S3M A;  3I56 T;  4BY6 B;  2A37 A;  4M77 C;  2Y4Y A;  3MEU A;  3G4S Q;  4HT8 A;  4CI0 C;  3MJX A;  3CCV T;  4M7A C;  2QQ9 A;  1JXO A;  5KCH A;  5LJ5 e;  2RQW A;  1LCK A;  4KH0 B;  2JXB A;  3CCL A;  4KGV B;  1I5L A;  1OUL A;  1JJ2 A;  3OSV A;  3INZ A;  5KYW B;  3CCM T;  4PK4 A;  4E7S A;  4M77 E;  3VS4 A;  1YWP A;  3CCS T;  2OTL A;  3FLG A;  1W2B S;  1NBE B;  4XTZ A;  1Q82 U;  3X26 B;  3OMG A;  1VQO Q;  4M7A E;  1TSF A;  1H3H A;  4ZNX A;  3UA7 A;  5GAO q;  2PNI A;  1BKB A;  2V8J A;  4KGZ B;  4XAX B;  5GMK h;  3OYI A;  2CP7 A;  1K73 C;  5FRO A;  1ABQ A;  2DVE A;  2B8A A;  2DXC A;  4C8Q D;  3VJP A;  1TUC A;  2JS2 A;  3OB9 A;  2FYK A;  2LNV A;  1AWX A;  1ZA2 B;  2K3Y A;  1NLP C;  4PL6 A;  1Q7Y R;  3PMI A;  2KYM A;  3HRS A;  5CKF A;  4PLI A;  1YJW Q;  1HXD A;  1U06 A;  5CAI A;  3CCR A;  4E7J A;  1F1B B;  4PJM A;  2DO3 A;  2JTE A;  1GL5 A;  2XDB A;  5IXB A;  3FDR A;  2CP6 A;  2OAW A;  4PNO A;  4C92 B;  1D1B A;  5GAM e;  1D0Z A;  1SSF A;  2KDS A;  2OTJ T;  2AIR B;  3X20 B;  4WF2 A;  2DBK A;  2LJ3 A;  2X4J A;  1I07 A;  2DIG A;  4LNP A;  4M7A D;  4CC2 A;  5LJ5 g;  1SSH A;  4Z88 A;  2HKN A;  4OMP A;  3EGX A;  5GAO l;  1VQ7 Q;  2M9U A;  2LRQ A;  2XID A;  2YXY A;  1X75 C;  2LTO A;  2HSE B;  5IHI A;  3M0S A;  3G4S T;  5FRM A;  1R77 A;  2ROT A;  2K79 A;  1FYN A;  1M2V A;  2EAY A;  1HYO A;  5HK0 A;  1I1J A;  2LP5 A;  2YT6 A;  4J6W A;  2KSS A;  5CK9 A;  1X6B A;  2RHU A;  1YJN A;  1D09 B;  3RIR A;  4ZGJ B;  1SRL A;  3CCU A;  1WHM A;  2HDA A;  1VQP Q;  1NM7 A;  2CSI A;  4R55 A;  2X9H A;  1I5O B;  2MPX C;  1N8R R;  4XU3 A;  2KXD A;  4F7U E;  1VUB A;  4OF1 A;  4JJB A;  1KQ2 A;  1FXX A;  4FYV B;  4ESR A;  1YHQ A;  1UGR B;  2DE0 X;  2PQW A;  4JJC A;  1AHJ B;  1YCY A;  2RHI A;  1DJ7 B;  1TH7 A;  3CCE T;  1YP5 A;  1YFN A;  2C0O A;  4DOV A;  3CC7 Q;  1XNI A;  2DIL A;  5GAM g;  3OYG A;  1WHH A;  5DLO A;  2VVK A;  3FC3 A;  1QKW A;  1UJ0 A;  4IUU A;  5KE3 A;  3GIB A;  3GLX A;  3OY9 A;  3CC4 A;  4R56 A;  1YJW T;  5FRN A;  2RQU A;  3C12 A;  1RAB B;  1YIT A;  2DZ9 A;  4PJO G;  4FU6 A;  3SDZ A;  4JUV A;  1FMK A;  3G71 T;  2ED0 A;  2AKK A;  1OYX A;  3MO8 A;  3GP8 A;  2NYS A;  1QKX A;  4FW2 A;  3E2U A;  3CPF A;  3CME A;  5EG2 A;  3JRZ A;  4LDV A;  4M78 F;  4PJJ A;  1NPP A;  2HZY A;  1Q7Y C;  1SF9 A;  4ORZ A;  2JMA A;  3GOX A;  1VQ7 T;  2KGT A;  2CP3 A;  4MZT A;  2LCC A;  3VS2 A;  1SHF A;  2QI2 A;  3JB9 F;  1WI7 A;  3D7S B;  5LJ5 j;  3V7C A;  1TU0 B;  1UEC A;  1ZSZ A;  1FX7 A;  1RAE B;  5A0L A;  1BIA A;  1WPY A;  1XTD A;  3MPU B;  4OML A;  2QEX Q;  1T0J A;  5I22 A;  3J81 E;  2DF6 A;  2W0Z A;  1WYX A;  3J80 E;  4J9B A;  1VQP T;  1T0H A;  2KY9 A;  1PD0 A;  2YUP A;  3SEM A;  2MF2 A;  3JB9 H;  1HJD A;  4TVR A;  5FU6 B;  1M27 C;  1ZUY A;  4EDU A;  1YJ9 A;  5D6W A;  2WSC E;  1QWE A;  3CC2 Q;  2VB6 A;  1GCQ A;  7AT1 B;  5LJ3 e;  1D3B A;  2G3R A;  2HCK A;  1YWO A;  4KH1 B;  3SWN B;  4Z89 A;  2EGA A;  2DMO A;  3EFS A;  1R0B G;  2P0P A;  1VIF A;  3HRT A;  1WHG A;  3RKX A;  3TSZ A;  2QK0 A;  4FL6 A;  2IVW A;  2KYB A;  4C5E A;  5GAM j;  4KUI A;  1KQS S;  2RD1 A;  5LJ5 d;  1VQN A;  5KH6 A;  2YUQ A;  1B34 B;  2J05 A;  1M4Z A;  1QCO A;  1MGQ A;  1X2Q A;  4M7D F;  2XDD A;  1WXU A;  4RG8 A;  1X6O A;  4F17 A;  3JAM E;  3L1A A;  2OX7 A;  2PUK B;  2O88 A;  2RH2 A;  1YIJ T;  2EQI A;  1UDL A;  4NL3 A;  4O6J A;  4MZM A;  4M75 F;  1ZQ1 A;  3A8G B;  1RI9 A;  2CZ1 B;  3JCM g;  2NUT A;  5KYY A;  3A8H B;  2AHJ B;  1SRM A;  1JU5 C;  5HY6 A;  3CPW S;  2JW4 A;  5GAN 7;  1KD1 U;  2GFU A;  2EQK A;  3QYG B;  4B9X A;  3H0H A;  4XK8 E;  4FT2 A;  2KRS A;  4RTY A;  4BI3 A;  4PFP A;  2CT3 A;  2XIC A;  2L3Q A;  1M8V A;  2DL3 A;  1Z9Z A;  2H3E B;  5GAM d;  4BE2 A;  2QDL A;  2VAS A;  4Z8A A;  4WTO B;  3EG2 A;  1ZSZ C;  2DX1 A;  1WZO A;  3NTK A;  1RUW A;  3VRY A;  2K3X A;  4X9D A;  2QA4 A;  3CC2 T;  2BE7 D;  3MEV A;  4C5H A;  4IUV A;  1M90 R;  4RMO A;  4OB0 B;  5GAO n;  2GBQ A;  5I2M A;  5ECA A;  4AG2 C;  3IQL A;  2DXB A;  3CCL Q;  3M4Y A;  5I21 A;  1Q81 R;  4X1V A;  4RTU A;  1JXM A;  1TUD A;  2FZG B;  3A98 A;  2OTL Q;  4M7D B;  1AWW A;  2R5A A;  1UE9 A;  4IIM A;  1K9M R;  4FYX B;  4JRK A;  1S72 A;  5KYU B;  2QXF A;  4XU0 A;  1GCQ C;  2JT4 A;  1VQ8 A;  4HCK A;  5CCA A;  3CCJ A;  2E5K A;  2LQK A;  2F2W A;  2RK1 A;  2M16 A;  2A0F B;  3C4S A;  3M0P A;  3EGD B;  3S3O A;  4QVZ A;  3OYM A;  4BB7 A;  1G83 A;  1HK9 A;  2M51 A;  3UWN A;  2LVM A;  1MMG A;  3CCR Q;  4XTU A;  2F2V A;  2CKK A;  2LJ0 A;  2DTH A;  1WJQ A;  1MUZ A;  1M1K U;  2D9T A;  1NZ9 A;  1I0C A;  5IH2 A;  2MIO A;  2HQX A;  1IZ6 A;  1M3A A;  3A8M B;  4ATO A;  1M3B A;  3Q1J A;  4M78 A;  1HSQ A;  1EIF A;  4PJL A;  2DL4 A;  4E7L A;  1W70 A;  2A28 A;  3WVD B;  4LUD A;  4GLM A;  1AD5 A;  2HBW A;  4N4G A;  1G5V A;  2LZ6 B;  3G6E A;  4OGC A;  4PJO F;  5LJ3 j;  2GQI A;  4LDX A;  4N0A A;  2GF7 A;  3MHX A;  4C0F A;  1KC8 C;  3I5R A;  2JTM A;  2VWF A;  1K73 R;  3OBW A;  4JLI A;  1VQ9 T;  1YJN Q;  2LNH B;  3PFS A;  2QTX A;  2JUF A;  2AT1 B;  2QQR A;  3RBB B;  3CCU Q;  2EJG A;  4M4Z A;  1WQW A;  1ZUU A;  4MDX A;  2DL5 A;  4IUQ A;  2DD5 A;  4OVA A;  2CH4 W;  4R0K A;  4FSX A;  3V7S A;  3JB9 G;  1V29 B;  4MDW A;  2F1L A;  2K5I A;  1Q7Y U;  1RLP C;  2FZC B;  2O4X B;  5LL6 S;  1IGU A;  2FPE A;  1BBZ A;  1YHQ Q;  3BY7 A;  4EMK B;  2YSQ A;  2CUB A;  2XU8 A;  4KBM B;  1X43 A;  2DYB A;  3MEA A;  4PJN A;  1Y7X A;  3ZEH A;  1G3Y A;  1QVP A;  4FYY B;  5GJV B;  5FLX E;  3OYD A;  1T3S A;  2J6K A;  5LJ5 f;  2C0T A;  2KT8 A;  3ZL7 C;  1JJ2 S;  2HEQ A;  4A63 B;  2ROL A;  2PTK A;  1Q81 C;  2FHD A;  1GCP A;  3CC4 Q;  4BDY A;  2WAC A;  1G3S A;  1WXT A;  4GBQ A;  2H3J A;  1D1C A;  2LDM A;  3TVT A;  3CCR T;  1YIT Q;  2KNB B;  2RN8 A;  3OYH A;  5LJ3 d;  4E6R A;  1K9M C;  3BE3 A;  1KHI A;  2E70 A;  3N5B B;  3RUX A;  2CP5 A;  1C1A A;  2JVV A;  2QGG A;  3EAE A;  4C92 F;  1Z9Q A;  3CME Q;  4LD9 K;  1UGS B;  1IHV A;  1QCN A;  4JRQ A;  2MWP A;  2KI7 A;  3M0U A;  2ATC B;  3M54 A;  3SFM A;  2YWW A;  3DKM A;  1SPK A;  5GMK l;  4QKU A;  2J7I A;  2MYS A;  1CSK A;  3VS5 A;  3S3N A;  3H0I A;  4FSS A;  3OS5 A;  3ZBD A;  1N8R U;  2NUP A;  2VGN A;  3MP1 A;  2VXF A;  2KRM A;  3J7A F;  1N27 A;  4M7D G;  4XU1 A;  2CUD A;  4C0Z A;  2LX9 A;  3QWY A;  5GAM f;  5GAN 5;  3WXM B;  3PE0 A;  4DQ2 A;  1M5Q 1;  2CSQ A;  1YJN T;  4K11 A;  4M78 C;  3THK A;  2IG0 A;  2RJC A;  3L2V A;  3C94 A;  3CCU T;  3PIP A;  3O5Z A;  4JLG A;  3LWI A;  4P5N A;  3NMZ C;  1VQM A;  3M56 A;  4M75 G;  3M53 A;  1K8A R;  1AOJ A;  2SRC A;  2OJ2 A;  1VQ5 A;  3M0R A;  4N0A C;  1YHQ T;  1LVK A;  5FWC A;  1YJ9 Q;  2DL7 A;  5J26 A;  1TXQ A;  2PVG B;  4M78 E;  5C0M A;  3RDV A;  3CQT A;  3OS0 A;  5CKH A;  3C0C A;  1MMA A;  1YBY A;  2E65 A;  3HFN A;  2D0Q B;  5A0G A;  1Y0M A;  1OI1 A;  3JCM P;  3M59 A;  1WX6 A;  2NWM A;  2VXE A;  3URG A;  2RPN A;  1TUG B;  1RAI B;  2HD0 A;  5HK3 A;  1B07 A;  2EYY A;  4Y28 E;  3CMA A;  3EFO B;  4ZGE B;  1VQN Q;  2M02 A;  1S1N A;  3HP9 A;  5A2Q E;  2YHT A;  4M77 D;  4J7I A;  1K0S A;  1MMD A;  4C0D C;  1X6G A;  1OOT A;  3CD6 A;  3V7R A;  1K1Z A;  3I55 A;  1ABO A;  2QYZ A;  3EG0 A;  1V76 A;  2FPD A;  1RAH B;  1VOM A;  2FPF A;  1UHF A;  1GRI A;  1AWJ A;  1Q86 R;  4M78 D;  2DZC A;  3NGP A;  3RMS A;  3UDC A;  2K5L A;  1KJW A;  3QBY A;  2CZ6 B;  4J9F A;  2QGF B;  4BE0 A;  4GY5 A;  5LJ5 h;  3QXE B;  3EHR A;  1XJW B;  4X9C A;  2C06 A;  1AZE A;  2D6F A;  1JBM A;  3CCV A;  1ZLM A;  3S6W A;  1QVF P;  1BIB A;  2QQA A;  1NEG A;  3FRN A;  2D8J A;  4N4H A;  4RUG A;  4M75 C;  4FT4 A;  3NPF A;  2KRO A;  1VQO T;  1XOV A;  1Y96 B;  3OA6 A;  4PJO A;  3UF4 A;  2LT1 A;  3CCM A;  4B9W A;  2EIF A;  3JSC A;  1K76 A;  3KBG A;  2DNU A;  3HHT B;  2XI9 A;  3QPH A;  2ZPE B;  5DM7 R;  2QA4 Q;  1P92 A;  3QKJ A;  5A0D A;  2RI3 A;  6AT1 B;  8AT1 B;  3PNW C;  4LUE A;  2LQ8 A;  2CP2 A;  3MET A;  4PKC C;  4M75 E;  1RAA B;  3CBM A;  1PCX A;  1K8A C;  2A3L A;  1GBQ A;  3OW2 S;  1GFC A;  5CIU A;  4AFS C;  4JPB W;  2XMF A;  3R6N A;  5GAM h;  3H0F A;  2K2M A;  4QQG A;  4AG1 C;  5KYW A;  4LXC A;  1VQN T;  1S72 Q;  1IO6 A;  2M0Y A;  1KIK A;  3EG9 B;  2K6D A;  2ZAE A;  1VQ8 Q;  3VS6 A;  5GAO p;  3CCJ Q;  1D1A A;  2KEA A;  5LJ3 f;  4FYW B;  4ELZ C;  2HL5 C;  1U1S A;  3SD4 A;  2FRW A;  4J83 A;  2YLB A;  4M7A F;  1K0X A;  2BZ8 A;  4UC4 A;  3BDU A;  1LJO A;  1WHK A;  4DBR A;  1H3Z A;  4BAC A;  4JS5 A;  5DLQ E;  4OMO A;  2V8K A;  1QP3 A;  2IPO B;  2LMJ A;  2LQN A;  5D6X A;  8ATC B;  1EFN A;  2P0K A;  3G4S A;  1IHW A;  2Y90 A;  1M90 U;  2DK3 A;  2L0A A;  1JRI A;  2E6N A;  2F5K A;  4HVU A;  3L42 A;  3JCM e;  1SKU B;  3OMC A;  3T9N A;  3M58 A;  3FB9 A;  1Q86 C;  4A4K A;  2R57 A;  3OW2 A;  3LH0 A;  2JJ9 A;  3WVE B;  5IAY A;  3G6E Q;  2XG8 D;  3JCM W;  2KVQ G;  4C8Q B;  1K9A A;  3LYI A;  5FWB A;  2CYZ B;  1M3C A;  3CC7 T;  4C92 G;  4DBQ A;  2QA4 T;  3HKS A;  5IT9 E;  2EYX A;  3L2Z A;  4RTX A;  3X24 B;  5GAN e;  3BDL A;  5FU7 C;  2HL3 A;  4RTV A;  1QCF A;  3ASK A;  4DA4 A;  3CCE A;  1BI0 A;  4J9C A;  4CRI A;  3CCQ A;  2DRK A;  2E10 A;  1AWO A;  4CC4 B;  3OBY A;  2FO0 A;  4PJO C;  3OSS C;  1D0Y A;  2DTI A;  4M77 B;  4XTY A;  1S72 T;  1NLO C;  1E7O A;  3PVQ A;  3DB4 A;  2DEU A;  4BY6 C;  1QVG P;  4PFZ A;  4M7A B;  5HKC A;  2DXT A;  4YTL A;  4DBF A;  3CCJ T;  2EKO A;  1OPK A;  2PZ1 A;  3GF5 A;  1WA7 A;  3G71 A;  1UGQ B;  3AHU A;  2A7Y A;  3I35 A;  2KXC A;  5CKE A;  1ARK A;  1Y07 A;  4OP0 A;  4JJD A;  4PJO E;  4LD6 A;  2F69 A;  1N9S A;  2LCL A;  2J06 A;  5KYX B;  3JCM V;  3HPW A;  1C6V X;  4A54 A;  1KC8 R;  5IHK A;  2OI3 A;  2X4X A;  3OS2 A;  3ZFJ A;  3CBP A;  3PIO A;  1Q82 C;  1PG5 B;  2E6Z A;  2QEX T;  1K73 U;  5CR2 A;  2EQM A;  3E9G A;  2YRV A;  2GTJ A;  4KUL A;  1NG2 A;  2DAQ A;  2VGM A;  2KMT A;  1SG5 A;  2FEI A;  4IIO A;  1EX4 A;  1SEM A;  1EZZ B;  5GAN g;  4HCZ A;  2COZ A;  2ZCF B;  1TOV A;  1W2B P;  1OU9 A;  3G6E T;  1PKT A;  1SHG A;  1UFF A;  2RJD A;  2CZ0 B;  4JRP A;  1TS9 A;  1RI0 A;  5LJ3 h;  2JZ2 A;  4C5I A;  4BDZ A;  2BKD N;  4PJO D;  4C92 C;  1I4K 1;  4A4F A;  1QQJ A;  1LOJ A;  1RAG B;  1UTI A;  1KQ1 A;  3EFR A;  2LX7 A;  2EYZ A;  3QUI A;  3H6Z A;  4XQ3 A;  2VV5 A;  1VQM Q;  4MML A;  1KSW A;  1PKS A;  4J9D A;  5D7U A;  2MOX A;  1VQ5 Q;  4F7U B;  4O5V A;  1QVF S;  3HFO A;  4C92 E;  4A4E A;  2GFA A;  2EFI A;  4JZ3 A;  4NS5 A;  4J5Y A;  3KXT A;  4HA8 A;  2GQV A;  2QAZ A;  2JTF A;  2E5Q A;  2DFU A;  2D8H A;  1WNL A;  4A53 A;  2D0N A;  4MZP A;  4C5G A;  3PVL A;  3JCM c;  4JZ4 A;  2DPP B;  2MI6 A;  2V8I A;  2XKO C;  3TRE A;  1VYU A;  2KR3 A;  4NOY A;  2EWN A;  3CMA Q;  1YIJ A;  1X2K A;  3QJY A;  4JRI A;  1PM3 A;  2HMA A;  2KRN A;  1WIE A;  4AMC A;  2COY A;  2E1H A;  1WJS A;  4C8Q G;  4E2F B;  2O31 A;  1B34 A;  3CD6 Q;  3I55 Q;  5KCO A;  2KK4 A;  4RTT A;  3RES A;  5GMK m;  2JM9 A;  3VYH B;  1VYV A;  1GBR A;  1RAD B;  2DIQ A;  4E7I A;  1WDX A;  1JEG A;  3UT1 A;  1QVF A;  1YI2 A;  1YN8 A;  2L2P A;  3QDR B;  5GAN j;  3NTH A;  5GMK i;  1PNJ A;  2DET A;  3MKD A;  2CT4 A;  4DBH A;  5KE2 A;  2AZS A;  1MV0 B;  2C0I A;  1I8F A;  3GNG A;  2HBP A;  2K9G A;  2PVD B;  3CCL T;  1MHN A;  1RL2 A;  4CC3 A;  4LN2 A;  1PRM C;  4M7A G;  1ZUK A;  2B86 A; 
#chains in the Genus database with same CATH homology
 4LDV A;  2CZ7 B;  4M78 F;  3F70 A;  1OI1 A;  4LDY A;  3OYF A;  3M59 A;  3LGL A;  2EQJ A;  1NPP A;  3JCM P;  2F5T X;  1WJR A;  3OYC A;  1LNX A;  1VQM T;  1VQP A;  2VXE A;  1Q7Y C;  3URG A;  3CBO A;  4OB2 B;  2OTL T;  4L6V 5;  4GLK A;  3GOX A;  4ELY C;  3HRU A;  3BW1 A;  3JB9 J;  1VQ7 T;  2HD0 A;  5HK3 A;  1I81 A;  1YI2 T;  5LJ3 g;  5L8R E;  1VQ5 T;  1BYM A;  4MZT A;  2K4Y A;  2LCC A;  3L2R A;  4Y28 E;  3CMA A;  2QI2 A;  3JB9 F;  2R58 A;  2OAU A;  4ZGE B;  5LJ5 j;  1UGP B;  3V7C A;  1U1T A;  3HP9 A;  5A2Q E;  1KQS A;  5GAN h;  1VQ6 A;  2YHT A;  1FX7 A;  4M77 D;  3JCM d;  4KT0 E;  4J8O A;  5A0L A;  1BIA A;  1WPY A;  1XTD A;  4J7I A;  3LGF A;  3OYE A;  3V8K A;  1BI3 A;  4C0D B;  3ER0 A;  3FJP A;  3MP6 A;  4C0D C;  3CC7 A;  2NLU A;  1N6A A;  3JCM b;  4KUD K;  5GMK e;  3CD6 A;  3V7R A;  2O01 E;  5GAN 2;  4EMG A;  3I55 A;  3J81 E;  5GAN 6;  3J80 E;  3P8H A;  1NPR A;  1VQP T;  5D6Y A;  2KY9 A;  4RCC A;  2X35 A;  4M78 D;  2DZC A;  2VC8 A;  3RMS A;  4ZGD B;  2MF2 A;  2VYT A;  2K5L A;  3UDC A;  5CQY A;  4E7K A;  3JB9 H;  2L89 A;  3QBY A;  4TVR A;  3CMA T;  1WGS A;  2CZ6 B;  5FU6 B;  3TU4 K;  5GAN d;  3LWH A;  5FU6 C;  2RI5 A;  4BE0 A;  4GY5 A;  1NJI U;  4EDU A;  1YJ9 A;  5D6W A;  2WSC E;  1VQK A;  1VQ6 T;  5LJ5 h;  3QXE B;  4M7D A;  4QQ6 A;  2KAF A;  2K57 A;  3QHS A;  3CXC S;  4C8Q A;  4X9C A;  2C06 A;  4BE1 A;  2DTO A;  1NE8 A;  2E64 A;  1D3B A;  2G3R A;  3SWN B;  5LJ3 e;  3SWN A;  1FWZ A;  3SWN C;  3EFS A;  3CPW A;  1JBM A;  2P0P A;  3CCV A;  3MEW A;  2D6F A;  3CD6 T;  5GAN 3;  2L5Q A;  4J6X A;  1QVG S;  5GAO m;  4A4G A;  3O8V A;  1VIF A;  3LX7 A;  2BIV A;  3S6W A;  3HRT A;  1U8R A;  1BIB A;  2QQA A;  3FRN A;  3RKX A;  4LDU A;  3L2W A;  3JCM J;  4FL6 A;  4M75 B;  4M75 A;  4N4H A;  2IVW A;  3M5A A;  4M75 C;  4C5E A;  4FT4 A;  5GAM j;  4QVC A;  1VQO T;  2RA2 A;  4PLL A;  1H64 1;  3E9F A;  1XOV A;  4KUI A;  1Y96 B;  3OA6 A;  4PJO A;  4L5G A;  1KQS S;  3X25 B;  2XD0 A;  2LT1 A;  2RD1 A;  3A5Z B;  4QVD A;  5LJ5 d;  1VQN A;  3CCM A;  1VQK T;  4B9W A;  2EIF A;  3JSC A;  3KBG A;  3M4G A;  4OB3 B;  5A0G A;  3HHT B;  3MP8 A;  2XI9 A;  1R8O B;  2ZPE B;  1B34 B;  3QPH A;  4M77 A;  4F7U G;  4OB1 B;  5KH6 A;  5DM7 R;  1P92 A;  3QKJ A;  1VQ4 A;  1M4Z A;  5A0D A;  4BI4 A;  5GAN 4;  4HCC A;  2RJF A;  2RI3 A;  4JDS A;  4LDW A;  1MGQ A;  4A4H A;  4C92 D;  4M7D F;  2ZPH B;  2FVU A;  3ME9 A;  5M9O A;  3PNW C;  2XDD A;  4RG8 A;  4FIB A;  3OS1 A;  4M7A A;  2QEX A;  2LQ8 A;  3JCM X;  3A8L B;  1X6O A;  3JAM E;  2DD4 A;  3L1A A;  4IUT A;  1VQ9 A;  2PUK B;  3MET A;  4PKC C;  3RKY A;  5AYF A;  4M75 E;  1K8A U;  2RH2 A;  4MMK A;  1YIJ T;  2P0Q A;  4RG2 A;  4BI8 B;  3CBM A;  3A8O B;  2YLC A;  2A3L A;  2RO0 A;  1K8A C;  3V8L A;  2ZPI B;  3OW2 S;  2XK0 A;  4O6J A;  4NL3 A;  5CIU A;  3PMT A;  4MZM A;  3VV0 A;  5GAM h;  4M75 F;  1ZQ1 A;  4QQG A;  2P4T A;  1OZ2 A;  2WSF E;  4M77 G;  1WQ7 A;  3A8G B;  3QJ6 A;  2CZ1 B;  1VQN T;  3JCM g;  1UB4 A;  3A8H B;  3VYG A;  5I2S A;  2AHJ B;  3MCA B;  5CKD A;  5GAO r;  1VQ4 T;  3CXC A;  3HSB A;  3QZ9 B;  5GAO p;  3CC2 A;  2XDP A;  1OZ3 A;  5HY6 A;  3CPW S;  1UEB A;  5GAN 7;  1KD1 U;  2GFU A;  2EQK A;  5LJ3 f;  3FEO A;  3QYG B;  5J39 A;  1QVG A;  1KD1 C;  3PT9 A;  4B9X A;  2M0O A;  4ELZ C;  1U1S A;  4XK8 E;  4FT2 A;  3SD4 A;  2L8D A;  3CC4 T;  4M7A E;  4J83 A;  2R5M A;  4M78 G;  2YLB A;  2RHY A;  2D0Q B;  4M7A F;  3M57 A;  4BI3 A;  2XHC A;  2ZPB B;  1YIT T;  2XIC A;  2ZGW A;  1M8V A;  4UC4 A;  3BDU A;  1LJO A;  5GAM d;  2WSE E;  1H3Z A;  4BE2 A;  3NTI A;  2RM4 A;  4JJN K;  2ZPF B;  3TEE A;  4BAC A;  4E47 A;  4JS5 A;  3RMQ A;  5DLQ E;  3QYH B;  2V8K A;  3SB2 A;  4OGE A;  1BI1 A;  1QP3 A;  2O4X A;  3G7Z A;  5D6X A;  4ME7 A;  1M9S A;  5CVI A;  2ZPG B;  3NTK A;  2CS7 A;  2P0K A;  3R6O A;  1O9S A;  2RI2 A;  2K2V A;  2K3X A;  4IUP A;  4X9D A;  4XTX A;  4OMF B;  4EMK A;  2QA4 A;  4ZTF A;  3CC2 T;  3MEV A;  4C5H A;  2HNI A;  4IUV A;  1ZHI A;  3KUF A;  3QII A;  3G4S A;  4RMO A;  3HL8 A;  2EYQ A;  4OB0 B;  2Y90 A;  1M90 U;  5GAO n;  4IKF A;  2DK3 A;  1JRI A;  1M90 C;  5I2M A;  2E6N A;  2QDY B;  2F5K A;  5CO7 A;  4HKE A;  3L42 A;  3JCM e;  2DXB A;  3M4Y A;  2RB6 A;  2RK2 A;  3OMC A;  3T9N A;  2X4W A;  3M58 A;  1Q86 U;  3FB9 A;  5I21 A;  4RKU E;  3GPL A;  3BFM A;  4A4K A;  1Q86 C;  2HQE A;  2R57 A;  2HAX A;  3OW2 A;  4J7F A;  1VQL A;  4BUG A;  3DB3 A;  3LH0 A;  3WVE B;  5IAY A;  2EJF A;  2DJZ A;  1XQH A;  4EPC A;  5J3B A;  2BUD A;  4M7D B;  5IN1 A;  2XG8 D;  2R5A A;  3JCM W;  1NJI C;  1VIE A;  2K5F A;  3JB9 D;  4M7D C;  2KVQ G;  3I56 A;  4Z02 A;  4C8Q B;  3LYI A;  4JRK A;  2CYZ B;  1S72 A;  4C8Q C;  1D3B B;  1W2B A;  2QXF A;  3CC7 T;  4C92 G;  4XU0 A;  4F7U A;  3OYL A;  5C6S A;  4ZN3 A;  3HKS A;  3OYJ A;  3L2Z A;  2QA4 T;  1O75 A;  5IT9 E;  3M9Q A;  1VQ8 A;  4ZN1 A;  3I55 T;  2L3R A;  3TCJ A;  3RER A;  5CCA A;  3CCJ A;  2LQK A;  2JN0 A;  5FU7 B;  3X24 B;  5GAN e;  3BDL A;  1Y71 A;  3LLR A;  3QO3 A;  1IRE B;  5FU7 C;  2MAM A;  2RK1 A;  3OYB A;  2X4Y A;  2M16 A;  3OYY A;  3ASK A;  4DA4 A;  2RJE A;  4JS4 A;  3CCE A;  1BI0 A;  3C4S A;  4CRI A;  3CCQ A;  3S3O A;  4QVZ A;  3OYM A;  4BB7 A;  1HK9 A;  2E10 A;  3OYA A;  5DY9 A;  1VQL T;  2LC4 A;  3UWN A;  4PJO B;  3OBY A;  2LVM A;  3DLM A;  3OSS C;  4PJO C;  2JOY A;  2DTI A;  1YJ9 T;  3VUB A;  4M7D E;  2LT4 A;  4XTU A;  3PTA A;  3M55 A;  2M1H A;  4C8Q E;  3VUZ A;  4M77 B;  3I56 T;  2FB7 A;  3CCS A;  2CKK A;  4XTY A;  4E7H A;  3S3M A;  1S72 T;  4BY6 B;  4M77 C;  2E41 A;  2DTH A;  2Y4Y A;  4BD3 A;  3DB4 A;  3MEU A;  5GMK j;  1WJQ A;  4BY6 C;  4CI0 C;  2Y4X A;  4HT8 A;  1N9R A;  3CCV T;  2D9T A;  4M7A B;  1NZ9 A;  1M1K U;  5HKC A;  2DXT A;  4YTL A;  4C8Q F;  3CCJ T;  2EKO A;  1M1K C;  4M7A C;  2FL7 A;  2QQ9 A;  2HQX A;  3GF5 A;  5KCH A;  4X34 A;  3G71 A;  1UGQ B;  5CQX A;  2A7Y A;  5LJ5 e;  3AHU A;  5CKE A;  4XTW A;  1IZ6 A;  1G3W A;  3LW5 E;  3A8M B;  4ATO A;  4ZTJ A;  1Y07 A;  4OP0 A;  3CCQ T;  3Q1J A;  4M78 A;  1X01 A;  1QP2 A;  1EIF A;  3JCM f;  3CCL A;  3OYK A;  4E7L A;  4PJO E;  1I5L A;  4L59 A;  4LD6 A;  2F69 A;  2VUB A;  1N9S A;  3WVD B;  1JJ2 A;  2LCL A;  2RHX A;  1ZBX A;  3OSV A;  3INZ A;  3RKW A;  4N4G A;  3CCM T;  3DLL A;  1KHC A;  3JCM V;  1G5V A;  3HPW A;  4M77 E;  3JCM Q;  3G6E A;  4OGC A;  4A54 A;  4PJO F;  3CCS T;  2I2L A;  2OTL A;  5LJ3 j;  3FLG A;  1W2B S;  4XTZ A;  1KC8 U;  1Q82 U;  3X26 B;  2X4X A;  3OMG A;  4LDX A;  3OS2 A;  5CKB A;  4N0A A;  2GF7 A;  3MHX A;  3ZFJ A;  3CBP A;  4C0F A;  2ZZD A;  3OQ5 A;  3PIO A;  1Q82 C;  1KC8 C;  2JTM A;  2E6Z A;  5GAO q;  4M77 F;  2QEX T;  1BKB A;  1K73 U;  2V8J A;  4XAX B;  5GMK h;  5CR2 A;  2EQM A;  3OYI A;  3E9G A;  3OBW A;  3V8J A;  4JLI A;  2YRV A;  1VQ9 T;  5FRO A;  1K73 C;  3P8D A;  2DVE A;  4N4I A;  4M7D D;  2OTJ A;  4KUL A;  3PFS A;  5GAN f;  2B8A A;  2QTX A;  2JUF A;  1PSF A;  2DAQ A;  2VGM A;  2DXC A;  2KMT A;  1PSE A;  3QZ5 B;  4C8Q D;  2QQR A;  3VJP A;  4HT9 A;  2DXU A;  2EJG A;  3OB9 A;  1WQW A;  2FYK A;  2LNV A;  4MDX A;  5GAN g;  4HCZ A;  4J6Y A;  2K3Y A;  2DD5 A;  2ZCF B;  4IUQ A;  4OVA A;  4PL6 A;  4FSX A;  3PMI A;  3V7S A;  3HRS A;  3JB9 G;  2PU9 B;  5CKF A;  1V29 B;  4MDW A;  4PLI A;  1Q7Y U;  2K5I A;  1HXD A;  4VUB A;  2O4X B;  3G6E T;  5LL6 S;  5CAI A;  2RJD A;  3CCR A;  4E7J A;  2MWO A;  2CZ0 B;  4M75 D;  4XU2 A;  4JRP A;  3BY7 A;  2DO3 A;  4EMK B;  1KG1 A;  2XDB A;  1RI0 A;  3FDR A;  4EMK C;  2XU8 A;  5LJ3 h;  4PNO A;  4C92 B;  4C92 A;  2JZ2 A;  4FM4 B;  4KBM B;  2EJ9 A;  4C5I A;  4BDZ A;  2BKD N;  3MEA A;  5GAM e;  4C92 C;  3L2U A;  1QW1 A;  4PJO D;  1I4K 1;  3VKI A;  4A4F A;  1Y7X A;  1SSF A;  2E12 A;  3ZEH A;  2KDS A;  1G3Y A;  2OTJ T;  1QVP A;  5FLX E;  3X20 B;  3OYD A;  1LOJ A;  3PGG A;  4WF2 A;  5LJ5 f;  2PVO B;  3UPU A;  3X28 B;  1KQ1 A;  2KQW A;  3EFR A;  1Q81 U;  2X4J A;  3CEY A;  1JJ2 S;  2DIG A;  3QUI A;  3H6Z A;  4V2S A;  4M7A D;  1Q81 C;  3OYN A;  4XQ3 A;  2FHD A;  3C95 A;  4NL2 A;  5LJ5 g;  2VV5 A;  4MML A;  4BDY A;  2CGH A;  1G3S A;  2WAC A;  2H3J A;  2LDM A;  5GAO l;  3CCR T;  2M9U A;  2LRQ A;  2XID A;  1K9M U;  1X75 C;  2LTO A;  4Q5W A;  4F7U B;  4O5V A;  3OYH A;  5LJ3 d;  1K9M C;  1QVF S;  3HFO A;  1KHI A;  4C92 E;  2E70 A;  3N5B B;  4A4E A;  3G4S T;  2GFA A;  3RUX A;  5FRM A;  2EFI A;  1VQO A;  4Y91 A;  4NS5 A;  4J5Y A;  3KXT A;  2EAY A;  2JVV A;  4HA8 A;  2GQV A;  3L2Q A;  3EAE A;  3VU3 C;  2JTF A;  4C92 F;  2E5Q A;  5HK0 A;  1WNL A;  1YJN A;  4J6W A;  2KSS A;  5CK9 A;  2RHU A;  4LD9 K;  4A53 A;  1UGS B;  2DEQ A;  3FIF A;  2MMP A;  3RIR A;  4ZGJ B;  4JRQ A;  2MWP A;  5GAN 8;  3CCU A;  4MZP A;  4C5G A;  3M54 A;  3JCM c;  3SFM A;  3DKM A;  5GMK l;  2DPP B;  2MI6 A;  2V8I A;  3QG1 A;  4R55 A;  2XKO C;  3TRE A;  3S3N A;  4D6W A;  3NFC A;  4NOY A;  4XU3 A;  2EWN A;  4F7U E;  1VUB A;  3OS5 A;  4OF1 A;  3ZBD A;  1YJW A;  1N8R U;  1GXI E;  2VGN A;  1G3T A;  3MP1 A;  4QQD A;  1FXX A;  4QW2 A;  1YIJ A;  2VXF A;  1KQ2 A;  1N8R C;  1M1F A;  1W4S A;  1VQ8 T;  1YHQ A;  3QJY A;  4JRI A;  3E19 A;  1UGR B;  3J7A F;  1N27 A;  4F7U F;  1Y96 A;  4M7D G;  4XU1 A;  2PQW A;  1AHJ B;  4C0Z A;  1YCY A;  2LX9 A;  5GAM f;  2RHI A;  2E1H A;  5GAN 5;  1WJS A;  3WXM B;  1DJ7 B;  1TH7 A;  4XTV A;  4C8Q G;  1BI2 A;  1M5Q 1;  4DQ2 A;  3CCE T;  4DOV A;  4M78 B;  2DKG A;  1YJN T;  4IUR A;  3E1S A;  1B34 A;  4M78 C;  1JB0 E;  1XNI A;  2IG0 A;  2RJC A;  5KCO A;  4DOW A;  5GAM g;  3C94 A;  3L2V A;  3CCU T;  3OYG A;  2KK4 A;  5DLO A;  3RES A;  3PIP A;  3H8Z A;  3JB9 I;  1M1G A;  5GMK m;  3GNF B;  3FC3 A;  3VYH B;  4IUU A;  5KE3 A;  4JLG A;  3LWI A;  4P5N A;  3GIB A;  2JNG A;  3GLX A;  2DIQ A;  4RCB A;  4E7I A;  1VQM A;  3M56 A;  4M75 G;  3M53 A;  3UT1 A;  3OY9 A;  3CC4 A;  4R56 A;  1YJW T;  5FRN A;  3P8B B;  2PUO B;  1VQ7 A;  3C12 A;  1QVF A;  1YI2 A;  3CME T;  1VQ5 A;  1YIT A;  4N0A C;  1YHQ T;  2QQB A;  2DZ9 A;  4PJO G;  3QDR B;  4EMH A;  5GAN j;  4FU6 A;  2RHZ A;  3NTH A;  5GMK i;  3SDZ A;  2QQS A;  4JUV A;  5J26 A;  3G71 T;  2EQU A;  3HFN A;  4C0G A;  5KE2 A;  4HCB A;  2PVG B;  4M78 E;  1I8F A;  1OYX A;  5C0M A;  3GNG A;  2HBP A;  3MO8 A;  3GP8 A;  3JCM h;  3OS0 A;  2GCX A;  2PVD B;  5CKH A;  3CCL T;  4II1 A;  1MHN A;  3QSU A;  1RL2 A;  3CPF A;  3CME A;  4M7A G;  5EG2 A;  1YBY A;  3JRZ A;  2E65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...