5LJ5g

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 69
sequence length 75
chains with identical sequence r
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5g00
3JCMV 4M78E 4M7AB 5GANg 5GMKl 5GANf 3JCMf 3JCMW 1WNLA 5GAN7 4C92D 4C8QC 1HXDA 2Y90A 4M78A 2JN0A 2EWNA 5GMKm 2YHTA 2DTHA 2CGHA 3BDUA 1HK9A 3RKYA 4M7DA 4PJOB 1WQWA 2ZGWA 3PGGA 1I81A 4J6XA 4M75C 1Y96A 5GAOl 2RM4A 4NL2A 5GAMe 4M77D 5GMKi 4C8QE 5LJ3j 5GAOm 4M7AC 1LJOA 1KQ2A 3L1AA 4C8QA 3BY7A 2FYKA 2VC8A 4HA8A 1U1SA 3JCMP 4JUVA 2DTIA 4M75E 4M77E 2EJFA 1N9SA 4PJOC 4NOYA 1MGQA 4M78D 4F7UG 3L2ZA 4M75A 5LJ5h 3JB9D 1U1TA 3JB9H 4EMKB 4RCBA 3V7RA 1YCYA 3SWNB 4F7UB 5I21A 5LJ3e 1JRIA 2DKGA 4M7AA 2DJZA 3JCMg 5GAN5 4M7DE 1JBMA 2DXTA 1H641 2E10A 4C92G 4XTVA 4C8QD 4XTYA 4PJOA 5GAOr 4J6YA 4JLIA 5LJ5d 5GAMf 5GAMg 2DVEA 1BIBA 4C92B 3JB9I 1I8FA 3HFNA 1BIAA 4M75D 4EMKC 4M77G 3QHSA 3SB2A 4F7UF 3JB9J 4OP0A 4XTZA 3RIRA 2E41A 2E64A 1B34A 3AHUA 3JCMJ 3RKWA 3JB9F 2EAYA 3M4GA 4XU0A 5GMKh 2RB6A 1WPYA 5DY9A 2EJ9A 1D3BA 4M78G 3JCMb 2EJGA 4M7DD 4XQ3A 4M7AE 4C92F 5LJ3f 3VU3C 4EMKA 5LJ3g 4NL3A 3QUIA 3JB9G 3HSBA 4N0AC 4M78B 4XU1A 5GANh 4QVCA 5GAN4 3BFMA 3JCMh 1I4K1 4Y91A 4PJOE 2VXFA 1M8VA 1Y96B 2FB7A 4M77F 4XTXA 4EMGA 5LJ5j 5GAN3 4C8QG 5GAN8 2YLBA 4XTWA 5GAMh 3V8KA 3V7SA 4C92A 4A53A 1I5LA 3BW1A 4X9CA 3EFSA 1LNXA 5GANj 4C8QB 5GANd 3SWNC 4M75G 4XU2A 4N0AA 3JCMd 4XU3A 4M78F 2VXEA 3HFOA 2K57A 5GAOq 4M7DF 4M7AD 1X01A 2DZCA 4V2SA 4A54A 5LJ5f 4M75B 4M77B 4MMKA 3RESA 4JRKA 5GAMd 4HT8A 3RERA 2I2LA 5LJ5e 4WF2A 3FJPA 3QO3A 4F7UE 4C92C 4PJOD 1N9RA 4XTUA 4J6WA 3JCMQ 1KQ1A 4PJOG 5LJ3h 4M7DG 2DXUA 5GAOn 5GANe 3SWNA 4F7UA 2RD1A 4X9DA 4C8QF 3JCMe 3V8LA 3JCMX 4RCCA 4M7DB 2QTXA 3RKXA 5GAOp 1LOJA 4J5YA 3INZA 1M5Q1 4M77C 2E65A 3FB9A 4C92E 3EFRA 4EMHA 4M75F 5GMKj 4MMLA 3QSUA 3FIFA 1TH7A 5LJ3d 2E1HA 2DTOA 2RA2A 5CAIA 2YLCA 3V8JA 4M7AF 4PNOA 3GIBA 2HNIA 3RUXA 1B34B 4JRIA 4M78C 3V7CA 4M7DC 4PJOF 2DZ9A 4M77A 5LJ5g 4M7AG 1D3BB 5GMKe 5GAMj 4HT9A 5GAN6 4DQ2A 2DEQA 4QVDA 1WQ7A 5GAN2 3JCMc
chains in the Genus database with same CATH superfamily
3CPWS 2GQIA 5GANg 3CCRA 2DVJA 2BUDA 2YHTA 2QI2A 1NEGA 1WQWA 1YJWQ 3FEOA 5GAOl 4C8QE 2RNAA 3RMSA 2O01E 1TUCA 1WI7A 3EHRA 1JO8A 2OTLT 1WZOA 2C0OA 2FVUA 1WLPB 2FPDA 3RNJA 5FU7C 3J80E 1GL5A 4FYYB 4A4KA 3OW2A 4C92B 4HCCA 3I5RA 2X4JA 1RAHB 2EAYA 3QPHA 1AZEA 2HKNA 2KT8A 4FL6A 1K4US 2DE0X 3VS3A 3E9FA 4ZGJB 1OV3A 2XDDA 5CR2A 3QYGB 3GPLA 4KULA 4BD3A 1XJWB 5KYUB 1I5LA 2QEXT 1AZGB 1OI1A 4X9CA 3CQTA 1BK2A 4ZN1A 2ECZA 4A4FA 1E7OA 1YFNA 1X01A 1X6GA 2LJ1A 2LQNA 4MMKA 4PJMA 2V1QA 2YUPA 4HT8A 3FC3A 2KBTA 4WF2A 1M90C 2XMFA 5KE2A 3JV3A 3SDZA 1TUDA 2RD1A 3SFMA 3GBQA 3H0HA 3RKXA 4UC4A 4M77C 4NS5A 4OGCA 3EAEA 1M90R 3S3NA 1NLOC 1UB4A 1VQKA 3I9QA 1D0ZA 2K6DA 1B34B 4M77A 5KYWA 2RO0A 3M57A 2F2VA 3JCMV 1NYFA 2HKQB 2RJDA 1NEBA 1K76A 1YITQ 2KXDA 3EH1A 1D1AA 1VQ4A 1V76A 4IUQA 1KHIA 3EGXA 4M77D 3OYHA 2YRDA 1ZSGA 3LLRA 3TQ7P 3CPWP 1YHQA 3CCJT 4JUVA 3ZBDA 3L2ZA 5LJ5h 3RBBB 1RLPC 3CC7T 2V26A 1YJ9A 3G4SA 1H641 2OX7A 3CCSA 2IIMA 3DB3A 5HCKA 1UG1A 2CSQA 2PUOB 2H3JA 1I1JA 1YCSB 2COZA 2EYYA 3CC2T 5KYNA 1QMCA 3OYGA 2JZ2A 1PHTA 2OTJQ 1LCKA 4FYWB 4XQ3A 2KY9A 3HSBA 5GJVB 2LP5A 2DIGA 2VVKA 4FSSA 4JJNK 1VQNA 1VQ6T 3BFMA 1I4K1 1RAIB 2ATCB 2HAXA 3OYNA 5CO7A 2FB7A 2OTLA 1WHJA 4J9EA 4C92A 3BW1A 3MO8A 3I55A 1PWTA 3QJYA 1HJDA 3CCRQ 2ZPIB 1M3CA 3MCAB 3JAME 2AK5A 5LJ5e 1BI1A 3E19A 4PFZA 3J7AF 2SRCA 1VQ7T 4F7UA 4EIKA 4VUBA 3VS0A 4TVRA 3INZA 2VUBA 5KH6A 5FU6C 4EMHA 1N6AA 5CCAA 1VQ9A 4PL6A 2AHJB 2FRWA 3TREA 1CKAA 2P4TA 3M4YA 4BDYA 5FWBA 4M78E 3CCVT 1AVZC 2LJ0A 1QCNA 3E1SA 1B7TA 4JJDA 1JB0E 2D0NA 3QWYA 1V29B 3UPUA 1I81A 2NUPA 1BYMA 2K5FA 1FMWA 1RADB 1KQ2A 3L1AA 4M75E 1B07A 2O4XA 5I11A 3QWXX 1KG1A 1VQOA 1YCYA 3EFOA 5D6WA 2KYMA 4OGEA 3G6EQ 4C92G 2RHIA 1OU9A 1S1NA 4LD6A 2BE7D 3I5SA 3C94A 2CS7A 2DD5A 1BKBA 2JM9A 4O5VA 2RMOA 3ER0A 3OYYA 2PVDB 1PC0A 2EPDA 2EQKA 2CP7A 3QBYA 4XU1A 1VQKQ 4DOWA 4MDWA 2VXFA 1RACB 2CH4W 3OYEA 4AFSC 2GTOA 4ESRA 1RABB 1M2VB 3CCMT 2D0QB 1PG5B 2I0NA 2K57A 4DBQA 4M7AD 2CT3A 4A54A 1TG0A 1VQ4Q 3QDRB 3VS1A 1ABOA 3CC2A 1K9AA 2OAUA 1ARKA 5GANe 3VUBA 3EGUA 3EG3A 4AFQC 3BDLA 1LOJA 4OMQA 1YHQQ 1OEBA 4OMFB 3QSUA 2FO0A 1M9SA 3UA7A 4E2FB 2RH2A 4JRIA 1YJ9Q 3EGDB 1MNEA 5CK9A 4PJOF 3G4SQ 1W1FA 3IQLA 4CRIA 3CCSQ 2QQRA 3F70A 1YI2T 4DQ2A 1G8XA 4CC2A 1SRLA 1BB9A 1PNJA 2JN0A 2QGGA 2LZ6B 2HSPA 2D1XA 3O8VA 5GAOm 2O2OA 1SSFA 1GFDA 1FMVA 1OZ2A 1XNIA 2LMJA 2XIDA 3OB9A 3PE0A 2CREA 2JNGA 1VQNQ 4B9XA 4Z88A 3QYHB 3OYCA 3JB9D 4A4GA 2L0AA 4L6V5 4GY5A 3CCET 2KSSA 3I55Q 2J6FA 4AG1C 2YDLA 1JJ2A 4KUDK 4LDYA 1ZA1B 5D7UA 2V1RA 1JEGA 3A8LB 4ZNXA 2DAQA 1K1ZA 2RK2A 4XAXB 2QASA 1VOMA 2FPFA 2E41A 2E64A 2BE9B 3LGFA 2G3RA 2KT1A 1MMAA 4X1VA 1ZQ1A 3UA6A 1Q7YC 3ASKA 2GCXA 4N0AC 3THKA 1VQ9Q 4PJOE 2EQUA 3LYIA 2ROTA 1UTIA 2K2MA 2YLBA 1Q7YR 4JPBW 5A2QE 2FZGB 3OY9A 3M56A 4WTOB 2JUFA 4FU6A 2RQUA 4XU2A 3SWNC 4N0AA 2EFIA 1MHNA 1UFFA 2EYQA 2VWFA 3RESA 2A0FB 4OB0B 4OMMA 3H6ZA 1XTDA 1VYVA 5IHIA 3SWNA 3V8LA 1UGPB 1NJIU 4C0DC 1YBYA 4PLLA 1MV3A 4XK8E 2A7YA 2NUTA 3LWIA 1QWEA 4C5HA 2MCNA 1E6GA 1M2VA 1QVFP 2QDLA 1VQOQ 5HK0A 2VASA 4R0KA 1WHGA 1MUZA 2BKDN 1NG2A 1EIFA 3C95A 2ED1A 3M5AA 1BI2A 1SHGA 1VYUA 5KCOA 5GAN2 3JCMc 1G3YA 1VQPA 3X26B 1MNDA 3JCMf 1KC8U 2HDAA 4BY6B 2PVOB 2QQSA 4J83A 3BDUA 3G1JA 1ZSZB 2BZYA 5GMKi 3QJ6A 2QA4T 5HK3A 2DA9A 2VGNA 5IHKA 3TSWA 1X27A 1JXOA 3HTRA 3QXEB 3X20B 4EMKB 2O31A 2EKHA 4LN2A 1K8AC 3PNWC 5GAN5 2O88A 1UHCA 4XTYA 3OYIA 1UGRB 2XG8D 3PVLA 2M0YA 2WACA 1K9MC 1K8AR 2C0IA 3RKWA 3S3MA 2GFAA 3CC4A 2EJ9A 1D3BA 4M7DD 1AWXA 4PJJA 1K9MR 1R77A 1X2KA 1VIEA 4BB7A 4IIMA 2JMCA 4N4HA 4E7JA 3I35A 3REAB 1K73C 1K0SA 1IGUA 1WJQA 4HCKA 1Y96B 1Y0MA 3RR6A 1GRIA 3QDFA 4XTWA 1ZA2B 1OX8A 2KEAA 2GNCA 4DA4A 2M9UA 1SHFA 5GANd 4E7LA 3DKMA 1JQQA 2DYIA 4RG8A 2FZKB 5GAOq 1WJRA 4BI8B 1VQ5T 2MF2A 2AKLA 4DBHA 1Q81C 4C8QF 2P0QA 2J05A 4KGZB 3HRTA 4RCCA 2LQWA 3VYHB 1Z9QA 1G3WA 1YIJT 3CD6A 3LGLA 2LCSA 3UT1A 3ME9A 3REBB 3MEWA 1Q81R 1QVGA 4J9IA 4PNOA 4Q5WA 3MPUB 1W2BP 2L3QA 4BI3A 3D7SB 3QG1A 4ME7A 4A4HA 3KBGA 4JRQA 4FIBA 3JCMW 2KRSA 2M0OA 2FG0A 5FRMA 3A8HB 4MZTA 2HBPA 2GGRA 3NTIA 3QKJA 5LJ3j 1GBQA 2O9VA 3M0TA 2LVMA 3NMZC 2VV5A 1T0HA 5D6XA 1JJ2S 3VJPA 1Y07A 3I56T 3LH0A 1EZZB 2NUZA 1I0CA 4PFOA 5CKEA 2GFUA 4CC3A 2CZ1B 1K0XA 4PKCC 4EMKC 5DM7R 4OP0A 4XTZA 4HXJA 2RQWA 2PUKB 1M1FA 3TSZA 1YJNT 3NTHA 1M8MA 2RHZA 2L3SA 5KYYA 2EJGA 3T9NA 4EMKA 1M1GA 4A63B 3M0SA 3CCUT 1GBRA 2X4YA 1QCFA 3VS5A 1PCXA 5C0MA 4AFZC 4FSXA 2KK4A 4XTXA 1SSHA 3L2WA 1E6HA 2X9HA 2NLUA 1KHCA 2DBMA 4C8QB 4F17A 1UJ0A 1VQPQ 1ZUUA 2K5LA 2VXEA 1OPKA 4V2SA 1UDLA 1IZ6A 1TTHB 3FJPA 3QO3A 4F7UE 3JCMQ 4PJOG 3G71T 1YNZA 3OYJA 2RHUA 4X9DA 1MV0B 1PD1A 5GMKj 3FB9A 3ZFJA 1WX6A 2YRVA 4RTVA 2XK0A 3UATA 3V8JA 4M7AF 1QP3A 3C4SA 2YUNA 2CZ7B 5FRNA 4K11A 2RI3A 4QQ6A 2DEQA 2LRQA 1YWOA 2F69A 3P8DA 3CCQT 1RLQC 1VQ8Q 1VQLT 1VUBA 1WNLA 1CSKA 5LL6S 1QKWA 2CGHA 2COWA 3CC4Q 1O9SA 5HY6A 2EIFA 2ZZDA 1PM3A 4LUEA 2R5MA 3MHXA 1ACMB 4RTZA 2R57A 4EDUA 4LNPA 1VQMT 5EC7A 1WGSA 1ABQA 3QIIA 3CMET 2DFUA 2LCCA 1BIAA 5FLXE 3CCLT 3JB9F 1G83A 2PTKA 4E47A 4OF1A 4M7AE 1OZ3A 5LJ3f 3CD6Q 2KE9A 3PT9A 5KYXB 4L5GA 1SKUB 1WXBA 3PFSA 4AMCA 1ZUYA 3VUZA 3ZL7C 4M78F 1SG5A 3EG0A 1PKTA 2RF0A 1YN8A 2HCKA 1KQSA 4C92C 1OQKA 1N9RA 4J6WA 1KQ1A 1T3SA 1QVGS 2JMAA 1N8RU 4FM4B 2OAWA 3EG2A 4M75F 4C0GA 5LJ3d 2E1HA 2J6KA 3R6OA 2E3HA 3AT1B 2KVQG 2KQWA 3CMAT 3OYLA 2DZ9A 2EYWA 4HT9A 2COYA 5GAN6 4BE1A 5KE3A 4C92D 2EQIA 3CPFA 4J8OA 5KYUA 5HKCA 2HL5C 4E7KA 2FEIA 4KT0E 3OYAA 2JOYA 3JCMP 3PMTA 1QP2A 2QEXA 2KAFA 1MGQA 2ZPGB 2LT1A 1S72T 1X6BA 2FHDA 3QZ9B 5L23A 1RI0A 2O9SA 4J9FA 3L42A 5D6YA 3M9QA 2MOXA 4E7ZA 2RJEA 1MMNA 1BIBA 3URGA 2JXBA 1RI9A 1AT1B 1B34A 1OULA 1IRXA 5EG2A 3M4GA 3HL8A 2YUQA 4RG2A 3SD4A 1IO6A 5LJ3g 4M78B 5GANh 3OW2S 1VA7A 3OMCA 2RN8A 3FLGA 1M3AA 2JS2A 1QVPA 1ZLMA 4C8QG 3S3OA 3GP8A 3A8MB 2QG9B 4Z8AA 1GXIE 2CP0A 2JTMA 1M30A 3OSSC 2RHYA 1MMGA 1CKBA 2RJCA 4M7DF 4M75B 4E6RA 1TOVA 1WDXA 5CIUA 3VS2A 1D1CA 3OYBA 3MEVA 1OX9A 1C0MA 3CCJA 5GAOn 2VYTA 3JCMe 2CYZB 2FZCB 5GAOp 1M2OA 4DEYA 4B9WA 2NYSA 3CC7A 1YJWT 3H0IA 5I2MA 1YP5A 4RTUA 2AZVA 4JZ4A 4PLIA 5DLQE 4LDUA 2CZ6B 6AT1B 1QVGP 2X51A 1G3TA 1VIFA 4OMLA 1Q86U 2QQAA 2L3PA 3ULRB 5A0DA 1QKXA 1VQ6A 2KROA 2WSEE 3UWNA 2VC8A 1U1SA 1A0NB 1W4SA 2E6NA 1HYOA 1Y71A 3H41A 5IN1A 5DLOA 5CKHA 3M54A 4FW1A 2KI7A 2RQVA 2BZ8A 4M7DE 3SHWA 1UE9A 2E10A 5CKFA 3TVTA 2LCLA 3L2UA 2DVEA 3GOXA 4KGVB 2P84A 3VRYA 1VQ7A 3HFNA 2RK1A 3TU4K 1M1KU 3RIRA 4HCZA 2E6ZA 2MPXC 3KXTA 1WHHA 2OTLQ 3GF5A 4NL3A 2HQEA 1BCOA 1UGVA 1S72A 4KH0B 3PTAA 2DBKA 3A98A 3CCVA 4A53A 2KMTA 3C12A 2L5QA 5IXBA 3OW2P 5LJ5f 5M9OA 4J9GA 3LWHA 2ABLA 4FYVB 1NJIC 4HVWA 2AZSA 2DIQA 1YITT 2RQRA 3CPWA 5J3BA 4IUPA 2QEXQ 1NJIR 2YLCA 3OS5A 4ZGDB 3JSCA 7AT1B 1TXQA 2WSCE 3X24B 1FX7A 1IGQA 5KCHA 4A4EA 4QVDA 1WQ7A 3ZEHA 4J9CA 2KRNA 1D0YA 2JVVA 4QQGA 4PJOB 2CP6A 2GTJA 3X28B 2PQWA 1KC8R 2B86A 2YUOA 1LJOA 2EGEA 2K7AA 2XICA 2AIRB 3M0RA 2MK5A 4PJLA 3CBPA 1N9SA 3OMGA 2DF6A 2OTJT 3CCMA 1U1TA 2EGCA 1W70A 3MP6A 4RCBA 2DJZA 2GQVA 5IAYA 3CBOA 2F1LA 2R58A 2A37A 1WHLA 2QXFA 4JDSA 5FW9A 3UF4A 2DL5A 4QW2A 3SB2A 4RMOA 3CCJQ 3CCRT 3GNFB 3EGDA 1KFZA 3HRUA 4M78G 3PIOA 3CC7Q 3N5BB 1Y57A 5J39A 3Q1JA 3MEUA 5GAN4 2HSEB 1UGSB 1G3SA 1YI2A 1M8VA 4M77F 2VB6A 5GAN8 3TEEA 2JT4A 3VS7A 3RMQA 4M75G 4PFPA 3JCMd 4JRPA 3CC2Q 1WA7A 4FYXB 2JW4A 3VRZA 1AHJB 2LC4A 1KD1U 1BCMA 4IIOA 5LJ3h 2HD0A 1M3BA 1VQ6Q 4LDVA 2L89A 3HRSA 2X3WD 1M27C 2F2XA 3NTKA 3CXCA 2P4RA 3CCEA 4FW2A 4IURA 3J81E 4LDXA 5FU7B 2DO3A 3R6NA 3RUXA 2Z0WA 2CKKA 5CQXA 2CP2A 1WHKA 1X43A 3HP9A 2L2PA 3LX7A 2FRYA 5GAMj 3OBWA 1X75C 1H92A 3JB9H 1VQ7Q 4CC4B 1HSQA 4BE0A 2PNIA 3G6ET 1HXDA 4EPCA 4PJNA 2BTTA 2MAMA 3M53A 2HQHA 1UJYA 1G5VA 1Q82U 2E5KA 1AWOA 2IPOB 1K9MU 1JU5C 3FRNA 4M77E 4PJOC 2IG0A 1PSFA 1LVKA 3CCVQ 1RUWA 4ORZA 3RDVA 5I21A 5LJ3e 2LDMA 4Z02A 4P5NA 1U8RA 3JCMg 3PIPA 5ECAA 4KBMB 1VQKT 1K73U 2JS0A 4PJOA 4JS4A 4JLIA 1T0JA 5CKDA 1WIEA 1NM7A 4Y28E 4JJCA 4F7UF 5I2SA 2RPNA 4BY6C 4CI0C 5KYWB 1VQ4T 5GMKh 1ZSZC 2DL7A 2RB6A 3X25B 4C5IA 2QQ9A 3QUIA 1QW1A 3CBMA 4WCIA 4ZGEB 2F2WA 2LQ8A 1PSEA 4IUUA 1AWJA 2J7IA 4JLGA 2CSIA 1YHQT 4DEXA 4D8KA 1ZSZA 2M16A 2EKOA 3OS1A 2NWMA 5J26A 4BDZA 1YJ9T 4RUGA 2X35A 2QA4A 3G4ST 3CCST 2HEQA 1BBZA 4CC7A 4O6JA 1TUGB 1KIKA 2DRKA 2ENMA 4C92E 4MMLA 1TH7A 3S6WA 2DTOA 3CCMQ 2RA2A 4YTLA 2D9TA 5CAIA 4ZTFA 4R55A 3GIBA 4ZTJA 4ELYC 1RAFB 2RI5A 1VQNT 1NYGA 5GMKe 3GNGA 2E4HA 4C0ZA 5C6SA 3I55T 3JRZA 2K3XA 4KRTA 1Y96A 4KH1B 2RM4A 3DB4A 3NFCA 2K2VA 3BY7A 3C0CA 2P0KA 3OQ5A 1SPKA 1PKSA 4BE2A 3FDRA 1YI2Q 4F7UB 1U5SA 2K3YA 1JRIA 3MEAA 1JBMA 2LJ3A 1VQ9T 3NGPA 2X4WA 4D8DA 1R8OB 3VS6A 2X3XD 1C6VX 2V8KA 5GAMf 1VQ5A 2V8IA 3G6EA 1I8FA 1KK7A 1AWWA 4DBFA 1PD0A 4RTYA 3A8OB 3WVEB 2M02A 2D8JA 2MWOA 5FWCA 2L8DA 3L2QA 2Y4YA 1YIJA 2AKKA 5FU6B 1RAAB 2J06A 1TU0B 2EW3A 2GBQA 1YWPA 1BI0A 2DETA 2CUDA 3WVDB 3NHNA 5GJWB 3CCEQ 3KFVA 4OB3B 1QVFA 2EGAA 3M58A 2A3LA 1IXDA 2M51A 2NUPB 1X6OA 2ZCFB 4IUVA 3V7SA 1UGQB 4F14A 4AG2C 2YRCA 1VQOT 1JJ2P 4DOVA 1IHWA 2O4XB 3HPWA 5GAMd 2DX1A 2EQJA 3EFOB 4FT4A 4XTUA 3CXCS 4MZPA 1M90U 3EH2A 2DXUA 1RAEB 2DMOA 4J7FA 1N8RC 4RTXA 4AT1B 3I56A 4RKUE 2MWPA 3VKIA 1D09B 1UHFA 2C06A 4OB2B 2DD4A 1M4ZA 1N8RR 5FROA 1O75A 2XHCA 1QLYA 1TWBA 2RQTA 5CKBA 4M7AB 2EYZA 5GMKl 3WXMB 4BUGA 4C8QC 1YJNA 1NE8A 2EWNA 1FMKA 4IUTA 4HCBA 3EG9B 2L3RA 4J6XA 3L2RA 2EYXA 4HVUA 3CCUA 9ATCB 2DRMA 4AFUC 4N4IA 4C8QA 3OS2A 2JTEA 1H3ZA 2DTIA 2VKNA 1PRMC 1X69A 2DEUA 2J6OA 1OYXA 4C8QD 4J6YA 4JJBA 5GAMg 3G71A 2QA4Q 2CH4A 4M77G 4XU0A 4MZMA 3U23A 2LNHB 2VGMA 3H8ZA 3OS0A 4JS5A 2CDTA 2BZXA 1SEMA 2DNUA 2WSFE 2OJ2A 3CEYA 4II1A 3JCMh 1W2BA 5LJ5j 3CCQA 3NPFA 2DYBA 1VQLA 3HKSA 3EFSA 1W6XA 1OOTA 2E5QA 2AT1B 1KJWA 2DXCA 5IXFA 2IVWA 3OYFA 2E70A 4JRKA 3DLLA 1UECA 1D1BA 2G6FX 1ZHIA 2LX9A 4B6MA 1SF9A 2ESWA 3JCMX 2KDSA 4J5YA 1VQMA 2LT4A 1M5Q1 3META 5GAN7 4LD9K 2LNVA 3QZ5B 3LW5E 4LE9A 1AD5A 2YSQA 4Z89A 1WXUA 4JZ3A 4GBQA 5AYFA 1NPPA 2DLPA 8ATCB 2KXCA 3CXCP 4QQDA 8AT1B 3CMEA 5IHNA 2DPPB 3G7ZA 4ZN3A 2K79A 4GLMA 4ATOA 3CCLA 1VQ5Q 1Q86C 2MMPA 2ZPBB 2PU9B 1QQJA 3DLMA 2Y90A 1PRLC 5KYXA 4E7IA 4C5EA 1YIJQ 2CP3A 3H9NA 3E9GA 1Q86R 1B3QA 4LUDA 4M7AC 2XDBA 3EG1A 4D6WA 4HA8A 3M59A 2EJFA 3FJ5A 4NOYA 2DM1A 4F7UG 2DILA 2JTFA 3UDCA 3SWNB 4M7AA 2DKGA 1IREB 2A36A 3PVQA 4F04B 1BU1A 1WYXA 2EQMA 2K3BA 1GFCA 3EG9A 2NUTB 4L59A 4BACA 2QAZA 1Z9ZA 1VYTA 1M1KC 4MDXA 2GF7A 2QGFB 2E12A 1VQPT 1G2BA 3AHUA 4C0DB 1I5OB 2DERA 2YT6A 2FPEA 2QYZA 1R0BG 1QVFS 2W0ZA 3JCMb 1QCOA 2XDPA 1U3OA 1M1KR 3I56Q 3CMAA 2F5KA 4Y91A 2EBPA 4FCYA 1EX4A 2YXYA 1DJ7B 5GAN3 4OVAA 4RTWA 2MIOA 3A5ZB 1GCPA 1OPLA 2EVRA 5GANj 5I22A 1I07A 3A8GB 3E2UA 1R0CB 5IT9E 2DZCA 1YJNQ 3O5ZA 4ANJA 3OYKA 2I2LA 4LDWA 1VQ8T 2OI3A 3CCUQ 1C1AA 4M7DB 5CQYA 3CC4T 3FIFA 4C5GA 2D8HA 3P8BB 3A1PA 4M78C 1KQSS 4QVZA 1GCQC 3OYDA 1TS9A 1QWFA 2ED0A 4M7AG 1D3BB 4J7IA 2CZ0B 2PVGB 3G71Q 2C0TA 3VS4A 2ROLA 5A0LA 4C0FA 2K4YA 3MP8A 4M78A 2PZ1A 2QK0A 1WJSA 1GCQA 1HK9A 2ZGWA 3PGGA 4M75C 1WHMA 3GLXA 4NL2A 1IHVA 2K9GA 1ZX6A 2CT4A 2QDYB 2FYKA 2D6FA 4KGXB 2BIVA 2HZYA 4KUIA 4M78D 1SRMA 5A0GA 4M75A 1F1BB 1WXTA 3H0FA 3CCQQ 1ZBJA 3CD6T 1KC8C 1VQLQ 1UEBA 1V1CA 2JJ9A 4J9HA 4DBRA 2DK3A 4XTVA 5GAOr 5LJ5d 1NBEB 1H3HA 3JB9I 4IKFA 4M75D 2CP5A 3QHSA 3JB9J 2H8HA 1YJWA 2R5AA 3HHTB 3P8HA 5AT1B 1XQHA 3EHQA 5DY9A 1NPRA 1VQMQ 1W2BS 3JB9G 1AOJA 3MKDA 4RTTA 2HMAA 1Q7YU 2ZPFB 4QVCA 2V8JA 3M55A 1RAGB 2QQBA 2YWWA 3CMEQ 1P92A 4OMNA 5GAMh 1FXXA 3V8KA 4QT7A 4HVVA 4Y92A 1OU8A 1MMDA 1RL2A 1LNXA 4BI4A 4E7HA 3CCLQ 1U06A 4XU3A 3TCJA 2DL8A 2SEMA 2F5TX 1KD1C 1FYNA 3RERA 1UUEA 3OYMA 2XU8A 1KD1R 4OMOA 4PK4A 3M0UA 4M7DC 1N27A 2ZPEB 5LJ5g 2XKOC 5KYYB 2E3IA 2X4XA 3L2VA 2CUBA 2XI9A 5GANf 2ZAEA 2LQKA 5IH2A 5GMKm 4OMPA 3OBYA 2DTHA 2HBWA 3OSVA 3RKYA 5L8RE 3SEMA 4M7DA 1NZ9A 1KQSP 1VQ8A 2RI2A 2RHXA 1Q82C 5GAMe 1TSFA 2LX7A 2H3EB 2P0PA 4J9BA 2FL7A 5CVIA 3CMAQ 4LXCA 1XOVA 2MI6A 1Q82R 1Q95G 4R56A 4X34A 4QKUA 3V7RA 4GLKA 1ZBXA 2KR3A 3M0PA 1K8AU 2DXTA 4N4GA 2HL3A 2KRMA 1J3TA 2LTOA 1WFWA 1IB8A 1YITA 1KSWA 1K73R 3OA6A 1LPLA 3JCMJ 2HQXA 2KYBA 1WPYA 1S72Q 1X2QA 4C92F 3VU3C 2Y4XA 2XD0A 3VV0A 3VYGA 2A08A 3BE3A 2KGTA 4ELZC 2A28A 1N5ZA 2DL3A 2DXBA 4E7SA 1AEYA 4EMGA 2DL4A 2JM8A 3MJXA 2KNBB 2DJQA 3M0QA 1D0XA 1Y7XA 2K5IA 2M1HA 2RJFA 1EFNA 1JXMA 3HFOA 4FT2A 4M77B 4F16A 1T3LA 4PJOD 4M7DG 2MYSA 2W10A 3KUFA 2OTJA 1Q81U 4J9DA 2QTXA 2QTVA 4HKEA 2E65A 3PMIA 3EFRA 2B8AA 3EGXB 1BI3A 1H8KA 2HNIA 1FWZA 1NLPC 4M4ZA 3V7CA 3LH5A 3MP1A 2ZPHB 1HD3A 4OB1B 1ZUKA
chains in the Genus database with same CATH topology
1G3YA 5CKBA 3CPWS 1VQPA 4M7AB 5GANg 3X26B 5GMKl 3JCMf 3WXMB 3CCRA 1KC8U 5GAN7 4BUGA 4C8QC 1Q86U 1YJNA 4BY6B 1NE8A 2PVOB 2EWNA 2QQSA 2YHTA 2BUDA 3BDUA 4IUTA 2QI2A 4J83A 2QQAA 4HCBA 1WQWA 2L3RA 4J6XA 3L2RA 3FEOA 5A0DA 5GAOl 5GMKi 3QJ6A 2QA4T 4C8QE 3CCUA 3RMSA 1VQ6A 2WSEE 3UWNA 2O01E 5HK3A 4N4IA 4C8QA 3OS2A 2VC8A 1U1SA 2VGNA 1W4SA 1H3ZA 2DTIA 2E6NA 1Y71A 5DLOA 5IN1A 5CKHA 3QXEB 3X20B 4EMKB 3M54A 2OTLT 2FVUA 1K8AC 3PNWC 5FU7C 5GAN5 3J80E 4M7DE 1OYXA 2E10A 5CKFA 4C8QD 4XTYA 3OYIA 2LCLA 4J6YA 4A4KA 1UGRB 3L2UA 5GAMg 2XG8D 3G71A 2DVEA 3GOXA 3OW2A 4C92B 1VQ7A 3HFNA 2WACA 1K9MC 2RK1A 4M77G 3TU4K 4HCCA 1M1KU 3RIRA 2X4JA 4HCZA 2E6ZA 2EAYA 2GFAA 3RKWA 3S3MA 3QPHA 3CC4A 4XU0A 4MZMA 4FL6A 3KXTA 2EJ9A 1D3BA 4M7DD 2VGMA 3H8ZA 3OS0A 3E9FA 4JS5A 3GF5A 4ZGJB 4NL3A 1VIEA 2HQEA 2XDDA 4BB7A 5CR2A 2WSFE 3CEYA 4N4HA 4II1A 4E7JA 3QYGB 3JCMh 3GPLA 1K73C 1WJQA 1S72A 4KULA 4BD3A 1W2BA 1Y96B 5LJ5j 3CCQA 1I5LA 4XTWA 3PTAA 2QEXT 3CCVA 4A53A 1VQLA 3HKSA 1OI1A 4DA4A 2KMTA 4X9CA 1M8VA 2M9UA 3C12A 3EFSA 2L5QA 5GANd 4E7LA 3DKMA 2E5QA 4ZN1A 4A4FA 2DXCA 4RG8A 5GAOq 1X01A 2IVWA 5LJ5f 3OYFA 4MMKA 2E70A 4JRKA 5M9OA 3DLLA 4HT8A 3FC3A 1WJRA 3LWHA 4BI8B 4WF2A 1M90C 1ZHIA 5KE2A 1VQ5T 2MF2A 2LX9A 1NJIC 3SDZA 1Q81C 2DIQA 2P0QA 2RD1A 3SFMA 4C8QF 1YITT 3JCMX 3HRTA 4RCCA 2KDSA 3RKXA 3CPWA 4J5YA 4UC4A 2LT4A 1M5Q1 3META 1G3WA 4M77C 4IUPA 4NS5A 2LNVA 3QZ5B 3EAEA 3LW5E 4OGCA 5J3BA 1YIJT 3LGLA 3CD6A 3UT1A 3ME9A 2YLCA 3MEWA 3OS5A 1UB4A 4ZGDB 3JSCA 4PNOA 5AYFA 3S3NA 1QVGA 1VQKA 1NPPA 2WSCE 4Q5WA 1B34B 3X24B 4QQDA 3CMEA 1FX7A 4BI3A 4M77A 3QG1A 4ME7A 2DPPB 4A4HA 5KCHA 2RO0A 3G7ZA 4A4EA 4ZN3A 4QVDA 1WQ7A 3KBGA 3M57A 3ZEHA 3JCMV 4JRQA 1Q86C 2MMPA 2RJDA 2ZPBB 4FIBA 2PU9B 3JCMW 2JVVA 4QQGA 2M0OA 3DLMA 2Y90A 1VQ4A 5FRMA 4E7IA 4PJOB 4C5EA 3A8HB 4IUQA 4MZTA 1KHIA 2HBPA 5GAN2 3E9GA 3X28B 2PQWA 4M77D 3NTIA 3OYHA 3QKJA 5LJ3j 4M7AC 2XDBA 1LJOA 2XICA 3LLRA 4HA8A 4D6WA 3CBPA 1YHQA 3CCJT 3M59A 4JUVA 2EJFA 2LVMA 1N9SA 3OMGA 4NOYA 2OTJT 4F7UG 3ZBDA 3L2ZA 5LJ5h 3CCMA 2VV5A 1U1TA 5D6XA 2JTFA 1JJ2S 3CC7T 3MP6A 4RCBA 3UDCA 3VJPA 3SWNB 1Y07A 3I56T 4M7AA 3LH0A 2DKGA 1YJ9A 1IREB 2DJZA 2GQVA 3G4SA 1H641 3CCSA 2EQMA 5CKEA 5IAYA 2GFUA 3DB3A 3CBOA 2CZ1B 4L59A 4BACA 2R58A 4PKCC 2PUOB 2H3JA 2QXFA 4JDSA 4EMKC 5DM7R 1M1KC 4MDXA 4QW2A 2GF7A 3SB2A 4RMOA 4OP0A 2E12A 1VQPT 4XTZA 3AHUA 4C0DB 3CCRT 3GNFB 3CC2T 3OYGA 2PUKB 1M1FA 2JZ2A 1YJNT 1QVFS 3NTHA 2RHZA 3HRUA 3JCMb 4M78G 2EJGA 3PIOA 4XQ3A 2XDPA 3N5BB 3T9NA 2KY9A 4EMKA 3HSBA 1M1GA 5J39A 2DIGA 3CMAA 4JJNK 1VQNA 3Q1JA 3CCUT 3MEUA 5GAN4 2F5KA 3BFMA 4Y91A 1I4K1 2HAXA 2X4YA 1UGSB 1G3SA 5C0MA 3OYNA 5CO7A 1YI2A 4LD9K 2FB7A 1DJ7B 4FSXA 2KK4A 4M77F 4XTXA 2OTLA 5GAN3 4OVAA 5GAN8 3L2WA 3TEEA 4C92A 3A5ZB 3BW1A 3MO8A 3I55A 2NLUA 1KHCA 5GANj 3QJYA 3RMQA 4C8QB 4M75G 3JCMd 4JRPA 3A8GB 2K5LA 2VXEA 2ZPIB 5IT9E 2DZCA 4V2SA 3OYKA 3MCAB 3JAME 2I2LA 5LJ5e 1IZ6A 1AHJB 1BI1A 2LC4A 3FJPA 3QO3A 4LDWA 4F7UE 1KD1U 3E19A 3JCMQ 3J7AF 4PJOG 5LJ3h 2HD0A 3G71T 1VQ7T 1VQ8T 3OYJA 4F7UA 4LDVA 2L89A 2RHUA 3HRSA 4X9DA 4VUBA 4M7DB 5CQYA 4TVRA 3INZA 2VUBA 5KH6A 3FB9A 3NTKA 5FU6C 5GMKj 4EMHA 3CXCA 3ZFJA 1N6AA 3CCEA 3CC4T 3FIFA 2YRVA 4C5GA 2XK0A 5CCAA 4IURA 3J81E 4LDXA 3V8JA 1VQ9A 5FU7B 4M7AF 1QP3A 2DO3A 3C4SA 3P8BB 3RUXA 4PL6A 4M78C 2CKKA 2AHJB 4QVZA 5CQXA 1KQSS 3OYDA 2CZ7B 5FRNA 3HP9A 3LX7A 3TREA 4M7AG 1D3BB 5GAMj 2P4TA 3M4YA 3OBWA 1X75C 2RI3A 4J7IA 4QQ6A 4BDYA 2DEQA 3JB9H 2LRQA 2PVGB 2F69A 2CZ0B 3P8DA 3CCQT 4M78E 3CCVT 5A0LA 1VUBA 1WNLA 4C0FA 4BE0A 2K4YA 1VQLT 3G6ET 1HXDA 3MP8A 4M78A 3E1SA 5LL6S 4EPCA 1WJSA 1JB0E 2CGHA 2MAMA 1HK9A 3M53A 2ZGWA 3PGGA 1V29B 3UPUA 1I81A 4M75C 3GLXA 4NL2A 1BYMA 1O9SA 1G5VA 2K5FA 1Q82U 5HY6A 2EIFA 2ZZDA 1K9MU 1KQ2A 2R5MA 3L1AA 3MHXA 2QDYB 2FYKA 3FRNA 2D6FA 4M75E 4M77E 2BIVA 4PJOC 2IG0A 2O4XA 4KUIA 1PSFA 2R57A 4M78D 4EDUA 1VQ6T 5A0GA 4M75A 1KG1A 1VQMT 1VQOA 1YCYA 3CD6T 5D6WA 1KC8C 4OGEA 1UEBA 5I21A 5LJ3e 1U8RA 2LDMA 4Z02A 1WGSA 4P5NA 3JCMg 3PIPA 4KBMB 1VQKT 4C92G 2DK3A 2RHIA 4XTVA 1K73U 4PJOA 4JS4A 5GAOr 4JLIA 5LJ5d 3QIIA 3CMET 2LCCA 5CKDA 3JB9I 4LD6A 4IKFA 1BIAA 4M75D 5FLXE 4Y28E 3QHSA 4F7UF 3JB9J 3C94A 5I2SA 3CCLT 2CS7A 4BY6C 1YJWA 3JB9F 4CI0C 2DD5A 1BKBA 2R5AA 3HHTB 4O5VA 1VQ4T 3P8HA 5GMKh 1XQHA 3ER0A 2RB6A 3X25B 5DY9A 1NPRA 4C5IA 4E47A 4OF1A 1W2BS 1OZ3A 3OYYA 2QQ9A 4M7AE 5LJ3f 3JB9G 1VQMA 3PT9A 1QW1A 2PVDB 3CBMA 3QUIA 4ZGEB 2EQKA 1Q7YU 2ZPFB 3QBYA 4XU1A 4QVCA 2LQ8A 1PSEA 2V8JA 3M55A 4IUUA 4L5GA 4DOWA 4MDWA 2VXFA 4JLGA 2QQBA 1YHQT 1P92A 3OYEA 3PFSA 2M16A 5GAMh 1FXXA 3V8KA 2EKOA 3OS1A 1RL2A 4BI4A 1LNXA 2D0QB 3CCMT 4E7HA 3VUZA 4XU3A 5J26A 4M78F 4BDZA 2K57A 3TCJA 1YJ9T 4M7AD 4A54A 2X35A 2QA4A 2F5TX 3G4ST 1KD1C 3RERA 3QDRB 3CCST 1KQSA 4C92C 4O6JA 1N9RA 4J6WA 3CC2A 1KQ1A 2OAUA 5GANe 3OYMA 3VUBA 2XU8A 3BDLA 1QVGS 1LOJA 1N8RU 4FM4B 4C92E 4OMFB 4M75F 4MMLA 3QSUA 1M9SA 4C0GA 1TH7A 3S6WA 5LJ3d 2E1HA 2DTOA 2RA2A 4YTLA 2D9TA 3R6OA 5CAIA 4R55A 4ZTFA 4ATOA 3GIBA 2RH2A 4JRIA 4ZTJA 2KVQG 4ELYC 2KQWA 3CMAT 2RI5A 4M7DC 3OYLA 5CK9A 1VQNT 4PJOF 2DZ9A 1N27A 2ZPEB 4CRIA 2QQRA 2XKOC 3GNGA 5GMKe 5LJ5g 4HT9A 5GAN6 3F70A 1YI2T 4DQ2A 2X4XA 4C0ZA 3L2VA 4BE1A 2XI9A 5C6SA 5GANf 5KE3A 4C92D 3I55T 2LQKA 5GMKm 2JN0A 3CPFA 2DTHA 3OBYA 3OSVA 4J8OA 5L8RE 3RKYA 4M7DA 1NZ9A 2K3XA 3JRZA 1VQ8A 2RI2A 5KCOA 1Y96A 2RHXA 5HKCA 1Q82C 2RM4A 5GAMe 3O8VA 3DB4A 3NFCA 5GAOm 1SSFA 4E7KA 4KT0E 1OZ2A 3OYAA 2K2VA 2JOYA 1XNIA 2P0PA 3BY7A 2XIDA 2FL7A 5CVIA 3JCMP 3PMTA 3OB9A 2JNGA 1QP2A 4B9XA 2QEXA 2KAFA 1XOVA 2P0KA 1MGQA 2MI6A 3OQ5A 2ZPGB 4R56A 2LT1A 4BE2A 3FDRA 3QYHB 4X34A 3OYCA 3JB9D 1S72T 4A4GA 3V7RA 2FHDA 3QZ9B 4L6V5 4GY5A 4F7UB 2K3YA 1JRIA 3CCET 4GLKA 2KSSA 1RI0A 1ZBXA 3MEAA 3L42A 5D6YA 1JBMA 1K8AU 2DXTA 3M9QA 1VQ9T 2X4WA 1R8OB 4N4GA 1JJ2A 4KUDK 2V8KA 2RJEA 5GAMf 4LDYA 1VQ5A 1BIBA 2LTOA 2V8IA 3G6EA 1I8FA 3A8LB 1YITA 3URGA 3A8OB 2DAQA 2RK2A 3WVEB 3CCLA 2MWOA 3OA6A 4XAXB 2L8DA 2E41A 2E64A 1B34A 2Y4YA 3L2QA 3JCMJ 2HQXA 1YIJA 3LGFA 5FU6B 2G3RA 5EG2A 3M4GA 1WPYA 3HL8A 1BI0A 4RG2A 3SD4A 1ZQ1A 4C92F 3VU3C 2Y4XA 3WVDB 5LJ3g 1Q7YC 2XD0A 3ASKA 2GCXA 4N0AC 4M78B 3VV0A 5GANh 3OW2S 3VYGA 4OB3B 1QVFA 3M58A 4ELZC 4PJOE 3OMCA 3FLGA 2DXBA 2A3LA 2EQUA 3LYIA 1QVPA 4EMGA 2ZCFB 4C8QG 1X6OA 2YLBA 3GP8A 3S3OA 4IUVA 3V7SA 3A8MB 1UGQB 1GXIE 5A2QE 3OY9A 3M56A 2JUFA 4FU6A 2JTMA 1Y7XA 2K5IA 4N0AA 2M1HA 2RJFA 4XU2A 3SWNC 3OSSC 4DOVA 2EFIA 1VQOT 3HFOA 1MHNA 2RHYA 2EYQA 2RJCA 2O4XB 4M7DF 3HPWA 4FT2A 4M75B 4M77B 3RESA 4OB0B 5GAMd 2EQJA 3H6ZA 5CIUA 1XTDA 4PJOD 4FT4A 4XTUA 3OYBA 3MEVA 3CXCS 3CCJA 4MZPA 1M90U 3VYHB 4M7DG 2DXUA 5GAOn 3SWNA 2VYTA 3JCMe 3V8LA 1UGPB 2CYZB 3KUFA 1NJIU 2OTJA 4J7FA 1Q81U 1N8RC 2QTXA 5GAOp 4C0DC 1YBYA 4HKEA 4PLLA 2E65A 3PMIA 4B9WA 3EFRA 4XK8E 3CC7A 1YJWT 2B8AA 2A7YA 3LWIA 3I56A 4RKUE 2MWPA 4C5HA 3VKIA 5I2MA 1BI3A 2C06A 4OB2B 2DD4A 5HK0A 2HNIA 1M4ZA 5DLQE 4PLIA 1FWZA 5FROA 4LDUA 1O75A 3V7CA 2BKDN 3MP1A 1EIFA 2XHCA 3C95A 2ZPHB 2CZ6B 3M5AA 1BI2A 4OB1B 1G3TA 1VIFA 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCM V;  4M78 E;  4M7A B;  5GAN g;  5GMK l;  5GAN f;  3JCM f;  3JCM W;  1WNL A;  5GAN 7;  4C92 D;  4C8Q C;  1HXD A;  2Y90 A;  4M78 A;  2JN0 A;  2EWN A;  5GMK m;  2YHT A;  2DTH A;  2CGH A;  3BDU A;  1HK9 A;  3RKY A;  4M7D A;  4PJO B;  1WQW A;  2ZGW A;  3PGG A;  1I81 A;  4J6X A;  4M75 C;  1Y96 A;  5GAO l;  2RM4 A;  4NL2 A;  5GAM e;  4M77 D;  5GMK i;  4C8Q E;  5LJ3 j;  5GAO m;  4M7A C;  1LJO A;  1KQ2 A;  3L1A A;  4C8Q A;  3BY7 A;  2FYK A;  2VC8 A;  4HA8 A;  1U1S A;  3JCM P;  4JUV A;  2DTI A;  4M75 E;  4M77 E;  2EJF A;  1N9S A;  4PJO C;  4NOY A;  1MGQ A;  4M78 D;  4F7U G;  3L2Z A;  4M75 A;  5LJ5 h;  3JB9 D;  1U1T A;  3JB9 H;  4EMK B;  4RCB A;  3V7R A;  1YCY A;  3SWN B;  4F7U B;  5I21 A;  5LJ3 e;  1JRI A;  2DKG A;  4M7A A;  2DJZ A;  3JCM g;  5GAN 5;  4M7D E;  1JBM A;  2DXT A;  1H64 1;  2E10 A;  4C92 G;  4XTV A;  4C8Q D;  4XTY A;  4PJO A;  5GAO r;  4J6Y A;  4JLI A;  5LJ5 d;  5GAM f;  5GAM g;  2DVE A;  1BIB A;  4C92 B;  3JB9 I;  1I8F A;  3HFN A;  1BIA A;  4M75 D;  4EMK C;  4M77 G;  3QHS A;  3SB2 A;  4F7U F;  3JB9 J;  4OP0 A;  4XTZ A;  3RIR A;  2E41 A;  2E64 A;  1B34 A;  3AHU A;  3JCM J;  3RKW A;  3JB9 F;  2EAY A;  3M4G A;  4XU0 A;  5GMK h;  2RB6 A;  1WPY A;  5DY9 A;  2EJ9 A;  1D3B A;  4M78 G;  3JCM b;  2EJG A;  4M7D D;  4XQ3 A;  4M7A E;  4C92 F;  5LJ3 f;  3VU3 C;  4EMK A;  5LJ3 g;  4NL3 A;  3QUI A;  3JB9 G;  3HSB A;  4N0A C;  4M78 B;  4XU1 A;  5GAN h;  4QVC A;  5GAN 4;  3BFM A;  3JCM h;  1I4K 1;  4Y91 A;  4PJO E;  2VXF A;  1M8V A;  1Y96 B;  2FB7 A;  4M77 F;  4XTX A;  4EMG A;  5LJ5 j;  5GAN 3;  4C8Q G;  5GAN 8;  2YLB A;  4XTW A;  5GAM h;  3V8K A;  3V7S A;  4C92 A;  4A53 A;  1I5L A;  3BW1 A;  4X9C A;  3EFS A;  1LNX A;  5GAN j;  4C8Q B;  5GAN d;  3SWN C;  4M75 G;  4XU2 A;  4N0A A;  3JCM d;  4XU3 A;  4M78 F;  2VXE A;  3HFO A;  2K57 A;  5GAO q;  4M7D F;  4M7A D;  1X01 A;  2DZC A;  4V2S A;  4A54 A;  5LJ5 f;  4M75 B;  4M77 B;  4MMK A;  3RES A;  4JRK A;  5GAM d;  4HT8 A;  3RER A;  2I2L A;  5LJ5 e;  4WF2 A;  3FJP A;  3QO3 A;  4F7U E;  4C92 C;  4PJO D;  1N9R A;  4XTU A;  4J6W A;  3JCM Q;  1KQ1 A;  4PJO G;  5LJ3 h;  4M7D G;  2DXU A;  5GAO n;  5GAN e;  3SWN A;  4F7U A;  2RD1 A;  4X9D A;  4C8Q F;  3JCM e;  3V8L A;  3JCM X;  4RCC A;  4M7D B;  2QTX A;  3RKX A;  5GAO p;  1LOJ A;  4J5Y A;  3INZ A;  1M5Q 1;  4M77 C;  2E65 A;  3FB9 A;  4C92 E;  3EFR A;  4EMH A;  4M75 F;  5GMK j;  4MML A;  3QSU A;  3FIF A;  1TH7 A;  5LJ3 d;  2E1H A;  2DTO A;  2RA2 A;  5CAI A;  2YLC A;  3V8J A;  4M7A F;  4PNO A;  3GIB A;  2HNI A;  3RUX A;  1B34 B;  4JRI A;  4M78 C;  3V7C A;  4M7D C;  4PJO F;  2DZ9 A;  4M77 A;  5LJ5 g;  4M7A G;  1D3B B;  5GMK e;  5GAM j;  4HT9 A;  5GAN 6;  4DQ2 A;  2DEQ A;  4QVD A;  1WQ7 A;  5GAN 2;  3JCM c; 
#chains in the Genus database with same CATH topology
 3CPW S;  2GQI A;  5GAN g;  3CCR A;  2DVJ A;  2BUD A;  2YHT A;  2QI2 A;  1NEG A;  1WQW A;  1YJW Q;  3FEO A;  5GAO l;  4C8Q E;  2RNA A;  3RMS A;  2O01 E;  1TUC A;  1WI7 A;  3EHR A;  1JO8 A;  2OTL T;  1WZO A;  2C0O A;  2FVU A;  1WLP B;  2FPD A;  3RNJ A;  5FU7 C;  3J80 E;  1GL5 A;  4FYY B;  4A4K A;  3OW2 A;  4C92 B;  4HCC A;  3I5R A;  2X4J A;  1RAH B;  2EAY A;  3QPH A;  1AZE A;  2HKN A;  2KT8 A;  4FL6 A;  1K4U S;  2DE0 X;  3VS3 A;  3E9F A;  4ZGJ B;  1OV3 A;  2XDD A;  5CR2 A;  3QYG B;  3GPL A;  4KUL A;  4BD3 A;  1XJW B;  5KYU B;  1I5L A;  2QEX T;  1AZG B;  1OI1 A;  4X9C A;  3CQT A;  1BK2 A;  4ZN1 A;  2ECZ A;  4A4F A;  1E7O A;  1YFN A;  1X01 A;  1X6G A;  2LJ1 A;  2LQN A;  4MMK A;  4PJM A;  2V1Q A;  2YUP A;  4HT8 A;  3FC3 A;  2KBT A;  4WF2 A;  1M90 C;  2XMF A;  5KE2 A;  3JV3 A;  3SDZ A;  1TUD A;  2RD1 A;  3SFM A;  3GBQ A;  3H0H A;  3RKX A;  4UC4 A;  4M77 C;  4NS5 A;  4OGC A;  3EAE A;  1M90 R;  3S3N A;  1NLO C;  1UB4 A;  1VQK A;  3I9Q A;  1D0Z A;  2K6D A;  1B34 B;  4M77 A;  5KYW A;  2RO0 A;  3M57 A;  2F2V A;  3JCM V;  1NYF A;  2HKQ B;  2RJD A;  1NEB A;  1K76 A;  1YIT Q;  2KXD A;  3EH1 A;  1D1A A;  1VQ4 A;  1V76 A;  4IUQ A;  1KHI A;  3EGX A;  4M77 D;  3OYH A;  2YRD A;  1ZSG A;  3LLR A;  3TQ7 P;  3CPW P;  1YHQ A;  3CCJ T;  4JUV A;  3ZBD A;  3L2Z A;  5LJ5 h;  3RBB B;  1RLP C;  3CC7 T;  2V26 A;  1YJ9 A;  3G4S A;  1H64 1;  2OX7 A;  3CCS A;  2IIM A;  3DB3 A;  5HCK A;  1UG1 A;  2CSQ A;  2PUO B;  2H3J A;  1I1J A;  1YCS B;  2COZ A;  2EYY A;  3CC2 T;  5KYN A;  1QMC A;  3OYG A;  2JZ2 A;  1PHT A;  2OTJ Q;  1LCK A;  4FYW B;  4XQ3 A;  2KY9 A;  3HSB A;  5GJV B;  2LP5 A;  2DIG A;  2VVK A;  4FSS A;  4JJN K;  1VQN A;  1VQ6 T;  3BFM A;  1I4K 1;  1RAI B;  2ATC B;  2HAX A;  3OYN A;  5CO7 A;  2FB7 A;  2OTL A;  1WHJ A;  4J9E A;  4C92 A;  3BW1 A;  3MO8 A;  3I55 A;  1PWT A;  3QJY A;  1HJD A;  3CCR Q;  2ZPI B;  1M3C A;  3MCA B;  3JAM E;  2AK5 A;  5LJ5 e;  1BI1 A;  3E19 A;  4PFZ A;  3J7A F;  2SRC A;  1VQ7 T;  4F7U A;  4EIK A;  4VUB A;  3VS0 A;  4TVR A;  3INZ A;  2VUB A;  5KH6 A;  5FU6 C;  4EMH A;  1N6A A;  5CCA A;  1VQ9 A;  4PL6 A;  2AHJ B;  2FRW A;  3TRE A;  1CKA A;  2P4T A;  3M4Y A;  4BDY A;  5FWB A;  4M78 E;  3CCV T;  1AVZ C;  2LJ0 A;  1QCN A;  3E1S A;  1B7T A;  4JJD A;  1JB0 E;  2D0N A;  3QWY A;  1V29 B;  3UPU A;  1I81 A;  2NUP A;  1BYM A;  2K5F A;  1FMW A;  1RAD B;  1KQ2 A;  3L1A A;  4M75 E;  1B07 A;  2O4X A;  5I11 A;  3QWX X;  1KG1 A;  1VQO A;  1YCY A;  3EFO A;  5D6W A;  2KYM A;  4OGE A;  3G6E Q;  4C92 G;  2RHI A;  1OU9 A;  1S1N A;  4LD6 A;  2BE7 D;  3I5S A;  3C94 A;  2CS7 A;  2DD5 A;  1BKB A;  2JM9 A;  4O5V A;  2RMO A;  3ER0 A;  3OYY A;  2PVD B;  1PC0 A;  2EPD A;  2EQK A;  2CP7 A;  3QBY A;  4XU1 A;  1VQK Q;  4DOW A;  4MDW A;  2VXF A;  1RAC B;  2CH4 W;  3OYE A;  4AFS C;  2GTO A;  4ESR A;  1RAB B;  1M2V B;  3CCM T;  2D0Q B;  1PG5 B;  2I0N A;  2K57 A;  4DBQ A;  4M7A D;  2CT3 A;  4A54 A;  1TG0 A;  1VQ4 Q;  3QDR B;  3VS1 A;  1ABO A;  3CC2 A;  1K9A A;  2OAU A;  1ARK A;  5GAN e;  3VUB A;  3EGU A;  3EG3 A;  4AFQ C;  3BDL A;  1LOJ A;  4OMQ A;  1YHQ Q;  1OEB A;  4OMF B;  3QSU A;  2FO0 A;  1M9S A;  3UA7 A;  4E2F B;  2RH2 A;  4JRI A;  1YJ9 Q;  3EGD B;  1MNE A;  5CK9 A;  4PJO F;  3G4S Q;  1W1F A;  3IQL A;  4CRI A;  3CCS Q;  2QQR A;  3F70 A;  1YI2 T;  4DQ2 A;  1G8X A;  4CC2 A;  1SRL A;  1BB9 A;  1PNJ A;  2JN0 A;  2QGG A;  2LZ6 B;  2HSP A;  2D1X A;  3O8V A;  5GAO m;  2O2O A;  1SSF A;  1GFD A;  1FMV A;  1OZ2 A;  1XNI A;  2LMJ A;  2XID A;  3OB9 A;  3PE0 A;  2CRE A;  2JNG A;  1VQN Q;  4B9X A;  4Z88 A;  3QYH B;  3OYC A;  3JB9 D;  4A4G A;  2L0A A;  4L6V 5;  4GY5 A;  3CCE T;  2KSS A;  3I55 Q;  2J6F A;  4AG1 C;  2YDL A;  1JJ2 A;  4KUD K;  4LDY A;  1ZA1 B;  5D7U A;  2V1R A;  1JEG A;  3A8L B;  4ZNX A;  2DAQ A;  1K1Z A;  2RK2 A;  4XAX B;  2QAS A;  1VOM A;  2FPF A;  2E41 A;  2E64 A;  2BE9 B;  3LGF A;  2G3R A;  2KT1 A;  1MMA A;  4X1V A;  1ZQ1 A;  3UA6 A;  1Q7Y C;  3ASK A;  2GCX A;  4N0A C;  3THK A;  1VQ9 Q;  4PJO E;  2EQU A;  3LYI A;  2ROT A;  1UTI A;  2K2M A;  2YLB A;  1Q7Y R;  4JPB W;  5A2Q E;  2FZG B;  3OY9 A;  3M56 A;  4WTO B;  2JUF A;  4FU6 A;  2RQU A;  4XU2 A;  3SWN C;  4N0A A;  2EFI A;  1MHN A;  1UFF A;  2EYQ A;  2VWF A;  3RES A;  2A0F B;  4OB0 B;  4OMM A;  3H6Z A;  1XTD A;  1VYV A;  5IHI A;  3SWN A;  3V8L A;  1UGP B;  1NJI U;  4C0D C;  1YBY A;  4PLL A;  1MV3 A;  4XK8 E;  2A7Y A;  2NUT A;  3LWI A;  1QWE A;  4C5H A;  2MCN A;  1E6G A;  1M2V A;  1QVF P;  2QDL A;  1VQO Q;  5HK0 A;  2VAS A;  4R0K A;  1WHG A;  1MUZ A;  2BKD N;  1NG2 A;  1EIF A;  3C95 A;  2ED1 A;  3M5A A;  1BI2 A;  1SHG A;  1VYU A;  5KCO A;  5GAN 2;  3JCM c;  1G3Y A;  1VQP A;  3X26 B;  1MND A;  3JCM f;  1KC8 U;  2HDA A;  4BY6 B;  2PVO B;  2QQS A;  4J83 A;  3BDU A;  3G1J A;  1ZSZ B;  2BZY A;  5GMK i;  3QJ6 A;  2QA4 T;  5HK3 A;  2DA9 A;  2VGN A;  5IHK A;  3TSW A;  1X27 A;  1JXO A;  3HTR A;  3QXE B;  3X20 B;  4EMK B;  2O31 A;  2EKH A;  4LN2 A;  1K8A C;  3PNW C;  5GAN 5;  2O88 A;  1UHC A;  4XTY A;  3OYI A;  1UGR B;  2XG8 D;  3PVL A;  2M0Y A;  2WAC A;  1K9M C;  1K8A R;  2C0I A;  3RKW A;  3S3M A;  2GFA A;  3CC4 A;  2EJ9 A;  1D3B A;  4M7D D;  1AWX A;  4PJJ A;  1K9M R;  1R77 A;  1X2K A;  1VIE A;  4BB7 A;  4IIM A;  2JMC A;  4N4H A;  4E7J A;  3I35 A;  3REA B;  1K73 C;  1K0S A;  1IGU A;  1WJQ A;  4HCK A;  1Y96 B;  1Y0M A;  3RR6 A;  1GRI A;  3QDF A;  4XTW A;  1ZA2 B;  1OX8 A;  2KEA A;  2GNC A;  4DA4 A;  2M9U A;  1SHF A;  5GAN d;  4E7L A;  3DKM A;  1JQQ A;  2DYI A;  4RG8 A;  2FZK B;  5GAO q;  1WJR A;  4BI8 B;  1VQ5 T;  2MF2 A;  2AKL A;  4DBH A;  1Q81 C;  4C8Q F;  2P0Q A;  2J05 A;  4KGZ B;  3HRT A;  4RCC A;  2LQW A;  3VYH B;  1Z9Q A;  1G3W A;  1YIJ T;  3CD6 A;  3LGL A;  2LCS A;  3UT1 A;  3ME9 A;  3REB B;  3MEW A;  1Q81 R;  1QVG A;  4J9I A;  4PNO A;  4Q5W A;  3MPU B;  1W2B P;  2L3Q A;  4BI3 A;  3D7S B;  3QG1 A;  4ME7 A;  4A4H A;  3KBG A;  4JRQ A;  4FIB A;  3JCM W;  2KRS A;  2M0O A;  2FG0 A;  5FRM A;  3A8H B;  4MZT A;  2HBP A;  2GGR A;  3NTI A;  3QKJ A;  5LJ3 j;  1GBQ A;  2O9V A;  3M0T A;  2LVM A;  3NMZ C;  2VV5 A;  1T0H A;  5D6X A;  1JJ2 S;  3VJP A;  1Y07 A;  3I56 T;  3LH0 A;  1EZZ B;  2NUZ A;  1I0C A;  4PFO A;  5CKE A;  2GFU A;  4CC3 A;  2CZ1 B;  1K0X A;  4PKC C;  4EMK C;  5DM7 R;  4OP0 A;  4XTZ A;  4HXJ A;  2RQW A;  2PUK B;  1M1F A;  3TSZ A;  1YJN T;  3NTH A;  1M8M A;  2RHZ A;  2L3S A;  5KYY A;  2EJG A;  3T9N A;  4EMK A;  1M1G A;  4A63 B;  3M0S A;  3CCU T;  1GBR A;  2X4Y A;  1QCF A;  3VS5 A;  1PCX A;  5C0M A;  4AFZ C;  4FSX A;  2KK4 A;  4XTX A;  1SSH A;  3L2W A;  1E6H A;  2X9H A;  2NLU A;  1KHC A;  2DBM A;  4C8Q B;  4F17 A;  1UJ0 A;  1VQP Q;  1ZUU A;  2K5L A;  2VXE A;  1OPK A;  4V2S A;  1UDL A;  1IZ6 A;  1TTH B;  3FJP A;  3QO3 A;  4F7U E;  3JCM Q;  4PJO G;  3G71 T;  1YNZ A;  3OYJ A;  2RHU A;  4X9D A;  1MV0 B;  1PD1 A;  5GMK j;  3FB9 A;  3ZFJ A;  1WX6 A;  2YRV A;  4RTV A;  2XK0 A;  3UAT A;  3V8J A;  4M7A F;  1QP3 A;  3C4S A;  2YUN A;  2CZ7 B;  5FRN A;  4K11 A;  2RI3 A;  4QQ6 A;  2DEQ A;  2LRQ A;  1YWO A;  2F69 A;  3P8D A;  3CCQ T;  1RLQ C;  1VQ8 Q;  1VQL T;  1VUB A;  1WNL A;  1CSK A;  5LL6 S;  1QKW A;  2CGH A;  2COW A;  3CC4 Q;  1O9S A;  5HY6 A;  2EIF A;  2ZZD A;  1PM3 A;  4LUE A;  2R5M A;  3MHX A;  1ACM B;  4RTZ A;  2R57 A;  4EDU A;  4LNP A;  1VQM T;  5EC7 A;  1WGS A;  1ABQ A;  3QII A;  3CME T;  2DFU A;  2LCC A;  1BIA A;  5FLX E;  3CCL T;  3JB9 F;  1G83 A;  2PTK A;  4E47 A;  4OF1 A;  4M7A E;  1OZ3 A;  5LJ3 f;  3CD6 Q;  2KE9 A;  3PT9 A;  5KYX B;  4L5G A;  1SKU B;  1WXB A;  3PFS A;  4AMC A;  1ZUY A;  3VUZ A;  3ZL7 C;  4M78 F;  1SG5 A;  3EG0 A;  1PKT A;  2RF0 A;  1YN8 A;  2HCK A;  1KQS A;  4C92 C;  1OQK A;  1N9R A;  4J6W A;  1KQ1 A;  1T3S A;  1QVG S;  2JMA A;  1N8R U;  4FM4 B;  2OAW A;  3EG2 A;  4M75 F;  4C0G A;  5LJ3 d;  2E1H A;  2J6K A;  3R6O A;  2E3H A;  3AT1 B;  2KVQ G;  2KQW A;  3CMA T;  3OYL A;  2DZ9 A;  2EYW A;  4HT9 A;  2COY A;  5GAN 6;  4BE1 A;  5KE3 A;  4C92 D;  2EQI A;  3CPF A;  4J8O A;  5KYU A;  5HKC A;  2HL5 C;  4E7K A;  2FEI A;  4KT0 E;  3OYA A;  2JOY A;  3JCM P;  3PMT A;  1QP2 A;  2QEX A;  2KAF A;  1MGQ A;  2ZPG B;  2LT1 A;  1S72 T;  1X6B A;  2FHD A;  3QZ9 B;  5L23 A;  1RI0 A;  2O9S A;  4J9F A;  3L42 A;  5D6Y A;  3M9Q A;  2MOX A;  4E7Z A;  2RJE A;  1MMN A;  1BIB A;  3URG A;  2JXB A;  1RI9 A;  1AT1 B;  1B34 A;  1OUL A;  1IRX A;  5EG2 A;  3M4G A;  3HL8 A;  2YUQ A;  4RG2 A;  3SD4 A;  1IO6 A;  5LJ3 g;  4M78 B;  5GAN h;  3OW2 S;  1VA7 A;  3OMC A;  2RN8 A;  3FLG A;  1M3A A;  2JS2 A;  1QVP A;  1ZLM A;  4C8Q G;  3S3O A;  3GP8 A;  3A8M B;  2QG9 B;  4Z8A A;  1GXI E;  2CP0 A;  2JTM A;  1M30 A;  3OSS C;  2RHY A;  1MMG A;  1CKB A;  2RJC A;  4M7D F;  4M75 B;  4E6R A;  1TOV A;  1WDX A;  5CIU A;  3VS2 A;  1D1C A;  3OYB A;  3MEV A;  1OX9 A;  1C0M A;  3CCJ A;  5GAO n;  2VYT A;  3JCM e;  2CYZ B;  2FZC B;  5GAO p;  1M2O A;  4DEY A;  4B9W A;  2NYS A;  3CC7 A;  1YJW T;  3H0I A;  5I2M A;  1YP5 A;  4RTU A;  2AZV A;  4JZ4 A;  4PLI A;  5DLQ E;  4LDU A;  2CZ6 B;  6AT1 B;  1QVG P;  2X51 A;  1G3T A;  1VIF A;  4OML A;  1Q86 U;  2QQA A;  2L3P A;  3ULR B;  5A0D A;  1QKX A;  1VQ6 A;  2KRO A;  2WSE E;  3UWN A;  2VC8 A;  1U1S A;  1A0N B;  1W4S A;  2E6N A;  1HYO A;  1Y71 A;  3H41 A;  5IN1 A;  5DLO A;  5CKH A;  3M54 A;  4FW1 A;  2KI7 A;  2RQV A;  2BZ8 A;  4M7D E;  3SHW A;  1UE9 A;  2E10 A;  5CKF A;  3TVT A;  2LCL A;  3L2U A;  2DVE A;  3GOX A;  4KGV B;  2P84 A;  3VRY A;  1VQ7 A;  3HFN A;  2RK1 A;  3TU4 K;  1M1K U;  3RIR A;  4HCZ A;  2E6Z A;  2MPX C;  3KXT A;  1WHH A;  2OTL Q;  3GF5 A;  4NL3 A;  2HQE A;  1BCO A;  1UGV A;  1S72 A;  4KH0 B;  3PTA A;  2DBK A;  3A98 A;  3CCV A;  4A53 A;  2KMT A;  3C12 A;  2L5Q A;  5IXB A;  3OW2 P;  5LJ5 f;  5M9O A;  4J9G A;  3LWH A;  2ABL A;  4FYV B;  1NJI C;  4HVW A;  2AZS A;  2DIQ A;  1YIT T;  2RQR A;  3CPW A;  5J3B A;  4IUP A;  2QEX Q;  1NJI R;  2YLC A;  3OS5 A;  4ZGD B;  3JSC A;  7AT1 B;  1TXQ A;  2WSC E;  3X24 B;  1FX7 A;  1IGQ A;  5KCH A;  4A4E A;  4QVD A;  1WQ7 A;  3ZEH A;  4J9C A;  2KRN A;  1D0Y A;  2JVV A;  4QQG A;  4PJO B;  2CP6 A;  2GTJ A;  3X28 B;  2PQW A;  1KC8 R;  2B86 A;  2YUO A;  1LJO A;  2EGE A;  2K7A A;  2XIC A;  2AIR B;  3M0R A;  2MK5 A;  4PJL A;  3CBP A;  1N9S A;  3OMG A;  2DF6 A;  2OTJ T;  3CCM A;  1U1T A;  2EGC A;  1W70 A;  3MP6 A;  4RCB A;  2DJZ A;  2GQV A;  5IAY A;  3CBO A;  2F1L A;  2R58 A;  2A37 A;  1WHL A;  2QXF A;  4JDS A;  5FW9 A;  3UF4 A;  2DL5 A;  4QW2 A;  3SB2 A;  4RMO A;  3CCJ Q;  3CCR T;  3GNF B;  3EGD A;  1KFZ A;  3HRU A;  4M78 G;  3PIO A;  3CC7 Q;  3N5B B;  1Y57 A;  5J39 A;  3Q1J A;  3MEU A;  5GAN 4;  2HSE B;  1UGS B;  1G3S A;  1YI2 A;  1M8V A;  4M77 F;  2VB6 A;  5GAN 8;  3TEE A;  2JT4 A;  3VS7 A;  3RMQ A;  4M75 G;  4PFP A;  3JCM d;  4JRP A;  3CC2 Q;  1WA7 A;  4FYX B;  2JW4 A;  3VRZ A;  1AHJ B;  2LC4 A;  1KD1 U;  1BCM A;  4IIO A;  5LJ3 h;  2HD0 A;  1M3B A;  1VQ6 Q;  4LDV A;  2L89 A;  3HRS A;  2X3W D;  1M27 C;  2F2X A;  3NTK A;  3CXC A;  2P4R A;  3CCE A;  4FW2 A;  4IUR A;  3J81 E;  4LDX A;  5FU7 B;  2DO3 A;  3R6N A;  3RUX A;  2Z0W A;  2CKK A;  5CQX A;  2CP2 A;  1WHK A;  1X43 A;  3HP9 A;  2L2P A;  3LX7 A;  2FRY A;  5GAM j;  3OBW A;  1X75 C;  1H92 A;  3JB9 H;  1VQ7 Q;  4CC4 B;  1HSQ A;  4BE0 A;  2PNI A;  3G6E T;  1HXD A;  4EPC A;  4PJN A;  2BTT A;  2MAM A;  3M53 A;  2HQH A;  1UJY A;  1G5V A;  1Q82 U;  2E5K A;  1AWO A;  2IPO B;  1K9M U;  1JU5 C;  3FRN A;  4M77 E;  4PJO C;  2IG0 A;  1PSF A;  1LVK A;  3CCV Q;  1RUW A;  4ORZ A;  3RDV A;  5I21 A;  5LJ3 e;  2LDM A;  4Z02 A;  4P5N A;  1U8R A;  3JCM g;  3PIP A;  5ECA A;  4KBM B;  1VQK T;  1K73 U;  2JS0 A;  4PJO A;  4JS4 A;  4JLI A;  1T0J A;  5CKD A;  1WIE A;  1NM7 A;  4Y28 E;  4JJC A;  4F7U F;  5I2S A;  2RPN A;  4BY6 C;  4CI0 C;  5KYW B;  1VQ4 T;  5GMK h;  1ZSZ C;  2DL7 A;  2RB6 A;  3X25 B;  4C5I A;  2QQ9 A;  3QUI A;  1QW1 A;  3CBM A;  4WCI A;  4ZGE B;  2F2W A;  2LQ8 A;  1PSE A;  4IUU A;  1AWJ A;  2J7I A;  4JLG A;  2CSI A;  1YHQ T;  4DEX A;  4D8K A;  1ZSZ A;  2M16 A;  2EKO A;  3OS1 A;  2NWM A;  5J26 A;  4BDZ A;  1YJ9 T;  4RUG A;  2X35 A;  2QA4 A;  3G4S T;  3CCS T;  2HEQ A;  1BBZ A;  4CC7 A;  4O6J A;  1TUG B;  1KIK A;  2DRK A;  2ENM A;  4C92 E;  4MML A;  1TH7 A;  3S6W A;  2DTO A;  3CCM Q;  2RA2 A;  4YTL A;  2D9T A;  5CAI A;  4ZTF A;  4R55 A;  3GIB A;  4ZTJ A;  4ELY C;  1RAF B;  2RI5 A;  1VQN T;  1NYG A;  5GMK e;  3GNG A;  2E4H A;  4C0Z A;  5C6S A;  3I55 T;  3JRZ A;  2K3X A;  4KRT A;  1Y96 A;  4KH1 B;  2RM4 A;  3DB4 A;  3NFC A;  2K2V A;  3BY7 A;  3C0C A;  2P0K A;  3OQ5 A;  1SPK A;  1PKS A;  4BE2 A;  3FDR A;  1YI2 Q;  4F7U B;  1U5S A;  2K3Y A;  1JRI A;  3MEA A;  1JBM A;  2LJ3 A;  1VQ9 T;  3NGP A;  2X4W A;  4D8D A;  1R8O B;  3VS6 A;  2X3X D;  1C6V X;  2V8K A;  5GAM f;  1VQ5 A;  2V8I A;  3G6E A;  1I8F A;  1KK7 A;  1AWW A;  4DBF A;  1PD0 A;  4RTY A;  3A8O B;  3WVE B;  2M02 A;  2D8J A;  2MWO A;  5FWC A;  2L8D A;  3L2Q A;  2Y4Y A;  1YIJ A;  2AKK A;  5FU6 B;  1RAA B;  2J06 A;  1TU0 B;  2EW3 A;  2GBQ A;  1YWP A;  1BI0 A;  2DET A;  2CUD A;  3WVD B;  3NHN A;  5GJW B;  3CCE Q;  3KFV A;  4OB3 B;  1QVF A;  2EGA A;  3M58 A;  2A3L A;  1IXD A;  2M51 A;  2NUP B;  1X6O A;  2ZCF B;  4IUV A;  3V7S A;  1UGQ B;  4F14 A;  4AG2 C;  2YRC A;  1VQO T;  1JJ2 P;  4DOV A;  1IHW A;  2O4X B;  3HPW A;  5GAM d;  2DX1 A;  2EQJ A;  3EFO B;  4FT4 A;  4XTU A;  3CXC S;  4MZP A;  1M90 U;  3EH2 A;  2DXU A;  1RAE B;  2DMO A;  4J7F A;  1N8R C;  4RTX A;  4AT1 B;  3I56 A;  4RKU E;  2MWP A;  3VKI A;  1D09 B;  1UHF A;  2C06 A;  4OB2 B;  2DD4 A;  1M4Z A;  1N8R R;  5FRO A;  1O75 A;  2XHC A;  1QLY A;  1TWB A;  2RQT A;  5CKB A;  4M7A B;  2EYZ A;  5GMK l;  3WXM B;  4BUG A;  4C8Q C;  1YJN A;  1NE8 A;  2EWN A;  1FMK A;  4IUT A;  4HCB A;  3EG9 B;  2L3R A;  4J6X A;  3L2R A;  2EYX A;  4HVU A;  3CCU A;  9ATC B;  2DRM A;  4AFU C;  4N4I A;  4C8Q A;  3OS2 A;  2JTE A;  1H3Z A;  2DTI A;  2VKN A;  1PRM C;  1X69 A;  2DEU A;  2J6O A;  1OYX A;  4C8Q D;  4J6Y A;  4JJB A;  5GAM g;  3G71 A;  2QA4 Q;  2CH4 A;  4M77 G;  4XU0 A;  4MZM A;  3U23 A;  2LNH B;  2VGM A;  3H8Z A;  3OS0 A;  4JS5 A;  2CDT A;  2BZX A;  1SEM A;  2DNU A;  2WSF E;  2OJ2 A;  3CEY A;  4II1 A;  3JCM h;  1W2B A;  5LJ5 j;  3CCQ A;  3NPF A;  2DYB A;  1VQL A;  3HKS A;  3EFS A;  1W6X A;  1OOT A;  2E5Q A;  2AT1 B;  1KJW A;  2DXC A;  5IXF A;  2IVW A;  3OYF A;  2E70 A;  4JRK A;  3DLL A;  1UEC A;  1D1B A;  2G6F X;  1ZHI A;  2LX9 A;  4B6M A;  1SF9 A;  2ESW A;  3JCM X;  2KDS A;  4J5Y A;  1VQM A;  2LT4 A;  1M5Q 1;  3MET A;  5GAN 7;  4LD9 K;  2LNV A;  3QZ5 B;  3LW5 E;  4LE9 A;  1AD5 A;  2YSQ A;  4Z89 A;  1WXU A;  4JZ3 A;  4GBQ A;  5AYF A;  1NPP A;  2DLP A;  8ATC B;  2KXC A;  3CXC P;  4QQD A;  8AT1 B;  3CME A;  5IHN A;  2DPP B;  3G7Z A;  4ZN3 A;  2K79 A;  4GLM A;  4ATO A;  3CCL A;  1VQ5 Q;  1Q86 C;  2MMP A;  2ZPB B;  2PU9 B;  1QQJ A;  3DLM A;  2Y90 A;  1PRL C;  5KYX A;  4E7I A;  4C5E A;  1YIJ Q;  2CP3 A;  3H9N A;  3E9G A;  1Q86 R;  1B3Q A;  4LUD A;  4M7A C;  2XDB A;  3EG1 A;  4D6W A;  4HA8 A;  3M59 A;  2EJF A;  3FJ5 A;  4NOY A;  2DM1 A;  4F7U G;  2DIL A;  2JTF A;  3UDC A;  3SWN B;  4M7A A;  2DKG A;  1IRE B;  2A36 A;  3PVQ A;  4F04 B;  1BU1 A;  1WYX A;  2EQM A;  2K3B A;  1GFC A;  3EG9 A;  2NUT B;  4L59 A;  4BAC A;  2QAZ A;  1Z9Z A;  1VYT A;  1M1K C;  4MDX A;  2GF7 A;  2QGF B;  2E12 A;  1VQP T;  1G2B A;  3AHU A;  4C0D B;  1I5O B;  2DER A;  2YT6 A;  2FPE A;  2QYZ A;  1R0B G;  1QVF S;  2W0Z A;  3JCM b;  1QCO A;  2XDP A;  1U3O A;  1M1K R;  3I56 Q;  3CMA A;  2F5K A;  4Y91 A;  2EBP A;  4FCY A;  1EX4 A;  2YXY A;  1DJ7 B;  5GAN 3;  4OVA A;  4RTW A;  2MIO A;  3A5Z B;  1GCP A;  1OPL A;  2EVR A;  5GAN j;  5I22 A;  1I07 A;  3A8G B;  3E2U A;  1R0C B;  5IT9 E;  2DZC A;  1YJN Q;  3O5Z A;  4ANJ A;  3OYK A;  2I2L A;  4LDW A;  1VQ8 T;  2OI3 A;  3CCU Q;  1C1A A;  4M7D B;  5CQY A;  3CC4 T;  3FIF A;  4C5G A;  2D8H A;  3P8B B;  3A1P A;  4M78 C;  1KQS S;  4QVZ A;  1GCQ C;  3OYD A;  1TS9 A;  1QWF A;  2ED0 A;  4M7A G;  1D3B B;  4J7I A;  2CZ0 B;  2PVG B;  3G71 Q;  2C0T A;  3VS4 A;  2ROL A;  5A0L A;  4C0F A;  2K4Y A;  3MP8 A;  4M78 A;  2PZ1 A;  2QK0 A;  1WJS A;  1GCQ A;  1HK9 A;  2ZGW A;  3PGG A;  4M75 C;  1WHM A;  3GLX A;  4NL2 A;  1IHV A;  2K9G A;  1ZX6 A;  2CT4 A;  2QDY B;  2FYK A;  2D6F A;  4KGX B;  2BIV A;  2HZY A;  4KUI A;  4M78 D;  1SRM A;  5A0G A;  4M75 A;  1F1B B;  1WXT A;  3H0F A;  3CCQ Q;  1ZBJ A;  3CD6 T;  1KC8 C;  1VQL Q;  1UEB A;  1V1C A;  2JJ9 A;  4J9H A;  4DBR A;  2DK3 A;  4XTV A;  5GAO r;  5LJ5 d;  1NBE B;  1H3H A;  3JB9 I;  4IKF A;  4M75 D;  2CP5 A;  3QHS A;  3JB9 J;  2H8H A;  1YJW A;  2R5A A;  3HHT B;  3P8H A;  5AT1 B;  1XQH A;  3EHQ A;  5DY9 A;  1NPR A;  1VQM Q;  1W2B S;  3JB9 G;  1AOJ A;  3MKD A;  4RTT A;  2HMA A;  1Q7Y U;  2ZPF B;  4QVC A;  2V8J A;  3M55 A;  1RAG B;  2QQB A;  2YWW A;  3CME Q;  1P92 A;  4OMN A;  5GAM h;  1FXX A;  3V8K A;  4QT7 A;  4HVV A;  4Y92 A;  1OU8 A;  1MMD A;  1RL2 A;  1LNX A;  4BI4 A;  4E7H A;  3CCL Q;  1U06 A;  4XU3 A;  3TCJ A;  2DL8 A;  2SEM A;  2F5T X;  1KD1 C;  1FYN A;  3RER A;  1UUE A;  3OYM A;  2XU8 A;  1KD1 R;  4OMO A;  4PK4 A;  3M0U A;  4M7D C;  1N27 A;  2ZPE B;  5LJ5 g;  2XKO C;  5KYY B;  2E3I A;  2X4X A;  3L2V A;  2CUB A;  2XI9 A;  5GAN f;  2ZAE A;  2LQK A;  5IH2 A;  5GMK m;  4OMP A;  3OBY A;  2DTH A;  2HBW A;  3OSV A;  3RKY A;  5L8R E;  3SEM A;  4M7D A;  1NZ9 A;  1KQS P;  1VQ8 A;  2RI2 A;  2RHX A;  1Q82 C;  5GAM e;  1TSF A;  2LX7 A;  2H3E B;  2P0P A;  4J9B A;  2FL7 A;  5CVI A;  3CMA Q;  4LXC A;  1XOV A;  2MI6 A;  1Q82 R;  1Q95 G;  4R56 A;  4X34 A;  4QKU A;  3V7R A;  4GLK A;  1ZBX A;  2KR3 A;  3M0P A;  1K8A U;  2DXT A;  4N4G A;  2HL3 A;  2KRM A;  1J3T A;  2LTO A;  1WFW A;  1IB8 A;  1YIT A;  1KSW A;  1K73 R;  3OA6 A;  1LPL A;  3JCM J;  2HQX A;  2KYB A;  1WPY A;  1S72 Q;  1X2Q A;  4C92 F;  3VU3 C;  2Y4X A;  2XD0 A;  3VV0 A;  3VYG A;  2A08 A;  3BE3 A;  2KGT A;  4ELZ C;  2A28 A;  1N5Z A;  2DL3 A;  2DXB A;  4E7S A;  1AEY A;  4EMG A;  2DL4 A;  2JM8 A;  3MJX A;  2KNB B;  2DJQ A;  3M0Q A;  1D0X A;  1Y7X A;  2K5I A;  2M1H A;  2RJF A;  1EFN A;  1JXM A;  3HFO A;  4FT2 A;  4M77 B;  4F16 A;  1T3L A;  4PJO D;  4M7D G;  2MYS A;  2W10 A;  3KUF A;  2OTJ A;  1Q81 U;  4J9D A;  2QTX A;  2QTV A;  4HKE A;  2E65 A;  3PMI A;  3EFR A;  2B8A A;  3EGX B;  1BI3 A;  1H8K A;  2HNI A;  1FWZ A;  1NLP C;  4M4Z A;  3V7C A;  3LH5 A;  3MP1 A;  2ZPH B;  1HD3 A;  4OB1 B;  1ZUK A; 
#chains in the Genus database with same CATH homology
 1G3Y A;  5CKB A;  3CPW S;  1VQP A;  4M7A B;  5GAN g;  3X26 B;  5GMK l;  3JCM f;  3WXM B;  3CCR A;  1KC8 U;  5GAN 7;  4BUG A;  4C8Q C;  1Q86 U;  1YJN A;  4BY6 B;  1NE8 A;  2PVO B;  2EWN A;  2QQS A;  2YHT A;  2BUD A;  3BDU A;  4IUT A;  2QI2 A;  4J83 A;  2QQA A;  4HCB A;  1WQW A;  2L3R A;  4J6X A;  3L2R A;  3FEO A;  5A0D A;  5GAO l;  5GMK i;  3QJ6 A;  2QA4 T;  4C8Q E;  3CCU A;  3RMS A;  1VQ6 A;  2WSE E;  3UWN A;  2O01 E;  5HK3 A;  4N4I A;  4C8Q A;  3OS2 A;  2VC8 A;  1U1S A;  2VGN A;  1W4S A;  1H3Z A;  2DTI A;  2E6N A;  1Y71 A;  5DLO A;  5IN1 A;  5CKH A;  3QXE B;  3X20 B;  4EMK B;  3M54 A;  2OTL T;  2FVU A;  1K8A C;  3PNW C;  5FU7 C;  5GAN 5;  3J80 E;  4M7D E;  1OYX A;  2E10 A;  5CKF A;  4C8Q D;  4XTY A;  3OYI A;  2LCL A;  4J6Y A;  4A4K A;  1UGR B;  3L2U A;  5GAM g;  2XG8 D;  3G71 A;  2DVE A;  3GOX A;  3OW2 A;  4C92 B;  1VQ7 A;  3HFN A;  2WAC A;  1K9M C;  2RK1 A;  4M77 G;  3TU4 K;  4HCC A;  1M1K U;  3RIR A;  2X4J A;  4HCZ A;  2E6Z A;  2EAY A;  2GFA A;  3RKW A;  3S3M A;  3QPH A;  3CC4 A;  4XU0 A;  4MZM A;  4FL6 A;  3KXT A;  2EJ9 A;  1D3B A;  4M7D D;  2VGM A;  3H8Z A;  3OS0 A;  3E9F A;  4JS5 A;  3GF5 A;  4ZGJ B;  4NL3 A;  1VIE A;  2HQE A;  2XDD A;  4BB7 A;  5CR2 A;  2WSF E;  3CEY A;  4N4H A;  4II1 A;  4E7J A;  3QYG B;  3JCM h;  3GPL A;  1K73 C;  1WJQ A;  1S72 A;  4KUL A;  4BD3 A;  1W2B A;  1Y96 B;  5LJ5 j;  3CCQ A;  1I5L A;  4XTW A;  3PTA A;  2QEX T;  3CCV A;  4A53 A;  1VQL A;  3HKS A;  1OI1 A;  4DA4 A;  2KMT A;  4X9C A;  1M8V A;  2M9U A;  3C12 A;  3EFS A;  2L5Q A;  5GAN d;  4E7L A;  3DKM A;  2E5Q A;  4ZN1 A;  4A4F A;  2DXC A;  4RG8 A;  5GAO q;  1X01 A;  2IVW A;  5LJ5 f;  3OYF A;  4MMK A;  2E70 A;  4JRK A;  5M9O A;  3DLL A;  4HT8 A;  3FC3 A;  1WJR A;  3LWH A;  4BI8 B;  4WF2 A;  1M90 C;  1ZHI A;  5KE2 A;  1VQ5 T;  2MF2 A;  2LX9 A;  1NJI C;  3SDZ A;  1Q81 C;  2DIQ A;  2P0Q A;  2RD1 A;  3SFM A;  4C8Q F;  1YIT T;  3JCM X;  3HRT A;  4RCC A;  2KDS A;  3RKX A;  3CPW A;  4J5Y A;  4UC4 A;  2LT4 A;  1M5Q 1;  3MET A;  1G3W A;  4M77 C;  4IUP A;  4NS5 A;  2LNV A;  3QZ5 B;  3EAE A;  3LW5 E;  4OGC A;  5J3B A;  1YIJ T;  3LGL A;  3CD6 A;  3UT1 A;  3ME9 A;  2YLC A;  3MEW A;  3OS5 A;  1UB4 A;  4ZGD B;  3JSC A;  4PNO A;  5AYF A;  3S3N A;  1QVG A;  1VQK A;  1NPP A;  2WSC E;  4Q5W A;  1B34 B;  3X24 B;  4QQD A;  3CME A;  1FX7 A;  4BI3 A;  4M77 A;  3QG1 A;  4ME7 A;  2DPP B;  4A4H A;  5KCH A;  2RO0 A;  3G7Z A;  4A4E A;  4ZN3 A;  4QVD A;  1WQ7 A;  3KBG A;  3M57 A;  3ZEH A;  3JCM V;  4JRQ A;  1Q86 C;  2MMP A;  2RJD A;  2ZPB B;  4FIB A;  2PU9 B;  3JCM W;  2JVV A;  4QQG A;  2M0O A;  3DLM A;  2Y90 A;  1VQ4 A;  5FRM A;  4E7I A;  4PJO B;  4C5E A;  3A8H B;  4IUQ A;  4MZT A;  1KHI A;  2HBP A;  5GAN 2;  3E9G A;  3X28 B;  2PQW A;  4M77 D;  3NTI A;  3OYH A;  3QKJ A;  5LJ3 j;  4M7A C;  2XDB A;  1LJO A;  2XIC A;  3LLR A;  4HA8 A;  4D6W A;  3CBP A;  1YHQ A;  3CCJ T;  3M59 A;  4JUV A;  2EJF A;  2LVM A;  1N9S A;  3OMG A;  4NOY A;  2OTJ T;  4F7U G;  3ZBD A;  3L2Z A;  5LJ5 h;  3CCM A;  2VV5 A;  1U1T A;  5D6X A;  2JTF A;  1JJ2 S;  3CC7 T;  3MP6 A;  4RCB A;  3UDC A;  3VJP A;  3SWN B;  1Y07 A;  3I56 T;  4M7A A;  3LH0 A;  2DKG A;  1YJ9 A;  1IRE B;  2DJZ A;  2GQV A;  3G4S A;  1H64 1;  3CCS A;  2EQM A;  5CKE A;  5IAY A;  2GFU A;  3DB3 A;  3CBO A;  2CZ1 B;  4L59 A;  4BAC A;  2R58 A;  4PKC C;  2PUO B;  2H3J A;  2QXF A;  4JDS A;  4EMK C;  5DM7 R;  1M1K C;  4MDX A;  4QW2 A;  2GF7 A;  3SB2 A;  4RMO A;  4OP0 A;  2E12 A;  1VQP T;  4XTZ A;  3AHU A;  4C0D B;  3CCR T;  3GNF B;  3CC2 T;  3OYG A;  2PUK B;  1M1F A;  2JZ2 A;  1YJN T;  1QVF S;  3NTH A;  2RHZ A;  3HRU A;  3JCM b;  4M78 G;  2EJG A;  3PIO A;  4XQ3 A;  2XDP A;  3N5B B;  3T9N A;  2KY9 A;  4EMK A;  3HSB A;  1M1G A;  5J39 A;  2DIG A;  3CMA A;  4JJN K;  1VQN A;  3Q1J A;  3CCU T;  3MEU A;  5GAN 4;  2F5K A;  3BFM A;  4Y91 A;  1I4K 1;  2HAX A;  2X4Y A;  1UGS B;  1G3S A;  5C0M A;  3OYN A;  5CO7 A;  1YI2 A;  4LD9 K;  2FB7 A;  1DJ7 B;  4FSX A;  2KK4 A;  4M77 F;  4XTX A;  2OTL A;  5GAN 3;  4OVA A;  5GAN 8;  3L2W A;  3TEE A;  4C92 A;  3A5Z B;  3BW1 A;  3MO8 A;  3I55 A;  2NLU A;  1KHC A;  5GAN j;  3QJY A;  3RMQ A;  4C8Q B;  4M75 G;  3JCM d;  4JRP A;  3A8G B;  2K5L A;  2VXE A;  2ZPI B;  5IT9 E;  2DZC A;  4V2S A;  3OYK A;  3MCA B;  3JAM E;  2I2L A;  5LJ5 e;  1IZ6 A;  1AHJ B;  1BI1 A;  2LC4 A;  3FJP A;  3QO3 A;  4LDW A;  4F7U E;  1KD1 U;  3E19 A;  3JCM Q;  3J7A F;  4PJO G;  5LJ3 h;  2HD0 A;  3G71 T;  1VQ7 T;  1VQ8 T;  3OYJ A;  4F7U A;  4LDV A;  2L89 A;  2RHU A;  3HRS A;  4X9D A;  4VUB A;  4M7D B;  5CQY A;  4TVR A;  3INZ A;  2VUB A;  5KH6 A;  3FB9 A;  3NTK A;  5FU6 C;  5GMK j;  4EMH A;  3CXC A;  3ZFJ A;  1N6A A;  3CCE A;  3CC4 T;  3FIF A;  2YRV A;  4C5G A;  2XK0 A;  5CCA A;  4IUR A;  3J81 E;  4LDX A;  3V8J A;  1VQ9 A;  5FU7 B;  4M7A F;  1QP3 A;  2DO3 A;  3C4S A;  3P8B B;  3RUX A;  4PL6 A;  4M78 C;  2CKK A;  2AHJ B;  4QVZ A;  5CQX A;  1KQS S;  3OYD A;  2CZ7 B;  5FRN A;  3HP9 A;  3LX7 A;  3TRE A;  4M7A G;  1D3B B;  5GAM j;  2P4T A;  3M4Y A;  3OBW A;  1X75 C;  2RI3 A;  4J7I A;  4QQ6 A;  4BDY A;  2DEQ A;  3JB9 H;  2LRQ A;  2PVG B;  2F69 A;  2CZ0 B;  3P8D A;  3CCQ T;  4M78 E;  3CCV T;  5A0L A;  1VUB A;  1WNL A;  4C0F A;  4BE0 A;  2K4Y A;  1VQL T;  3G6E T;  1HXD A;  3MP8 A;  4M78 A;  3E1S A;  5LL6 S;  4EPC A;  1WJS A;  1JB0 E;  2CGH A;  2MAM A;  1HK9 A;  3M53 A;  2ZGW A;  3PGG A;  1V29 B;  3UPU A;  1I81 A;  4M75 C;  3GLX A;  4NL2 A;  1BYM A;  1O9S A;  1G5V A;  2K5F A;  1Q82 U;  5HY6 A;  2EIF A;  2ZZD A;  1K9M U;  1KQ2 A;  2R5M A;  3L1A A;  3MHX A;  2QDY B;  2FYK A;  3FRN A;  2D6F A;  4M75 E;  4M77 E;  2BIV A;  4PJO C;  2IG0 A;  2O4X A;  4KUI A;  1PSF A;  2R57 A;  4M78 D;  4EDU A;  1VQ6 T;  5A0G A;  4M75 A;  1KG1 A;  1VQM T;  1VQO A;  1YCY A;  3CD6 T;  5D6W A;  1KC8 C;  4OGE A;  1UEB A;  5I21 A;  5LJ3 e;  1U8R A;  2LDM A;  4Z02 A;  1WGS A;  4P5N A;  3JCM g;  3PIP A;  4KBM B;  1VQK T;  4C92 G;  2DK3 A;  2RHI A;  4XTV A;  1K73 U;  4PJO A;  4JS4 A;  5GAO r;  4JLI A;  5LJ5 d;  3QII A;  3CME T;  2LCC A;  5CKD A;  3JB9 I;  4LD6 A;  4IKF A;  1BIA A;  4M75 D;  5FLX E;  4Y28 E;  3QHS A;  4F7U F;  3JB9 J;  3C94 A;  5I2S A;  3CCL T;  2CS7 A;  4BY6 C;  1YJW A;  3JB9 F;  4CI0 C;  2DD5 A;  1BKB A;  2R5A A;  3HHT B;  4O5V A;  1VQ4 T;  3P8H A;  5GMK h;  1XQH A;  3ER0 A;  2RB6 A;  3X25 B;  5DY9 A;  1NPR A;  4C5I A;  4E47 A;  4OF1 A;  1W2B S;  1OZ3 A;  3OYY A;  2QQ9 A;  4M7A E;  5LJ3 f;  3JB9 G;  1VQM A;  3PT9 A;  1QW1 A;  2PVD B;  3CBM A;  3QUI A;  4ZGE B;  2EQK A;  1Q7Y U;  2ZPF B;  3QBY A;  4XU1 A;  4QVC A;  2LQ8 A;  1PSE A;  2V8J A;  3M55 A;  4IUU A;  4L5G A;  4DOW A;  4MDW A;  2VXF A;  4JLG A;  2QQB A;  1YHQ T;  1P92 A;  3OYE A;  3PFS A;  2M16 A;  5GAM h;  1FXX A;  3V8K A;  2EKO A;  3OS1 A;  1RL2 A;  4BI4 A;  1LNX A;  2D0Q B;  3CCM T;  4E7H A;  3VUZ A;  4XU3 A;  5J26 A;  4M78 F;  4BDZ A;  2K57 A;  3TCJ A;  1YJ9 T;  4M7A D;  4A54 A;  2X35 A;  2QA4 A;  2F5T X;  3G4S T;  1KD1 C;  3RER A;  3QDR B;  3CCS T;  1KQS A;  4C92 C;  4O6J A;  1N9R A;  4J6W A;  3CC2 A;  1KQ1 A;  2OAU A;  5GAN e;  3OYM A;  3VUB A;  2XU8 A;  3BDL A;  1QVG S;  1LOJ A;  1N8R U;  4FM4 B;  4C92 E;  4OMF B;  4M75 F;  4MML A;  3QSU A;  1M9S A;  4C0G A;  1TH7 A;  3S6W A;  5LJ3 d;  2E1H A;  2DTO A;  2RA2 A;  4YTL A;  2D9T A;  3R6O A;  5CAI A;  4R55 A;  4ZTF A;  4ATO A;  3GIB A;  2RH2 A;  4JRI A;  4ZTJ A;  2KVQ G;  4ELY C;  2KQW A;  3CMA T;  2RI5 A;  4M7D C;  3OYL A;  5CK9 A;  1VQN T;  4PJO F;  2DZ9 A;  1N27 A;  2ZPE B;  4CRI A;  2QQR A;  2XKO C;  3GNG A;  5GMK e;  5LJ5 g;  4HT9 A;  5GAN 6;  3F70 A;  1YI2 T;  4DQ2 A;  2X4X A;  4C0Z A;  3L2V A;  4BE1 A;  2XI9 A;  5C6S A;  5GAN f;  5KE3 A;  4C92 D;  3I55 T;  2LQK A;  5GMK m;  2JN0 A;  3CPF A;  2DTH A;  3OBY A;  3OSV A;  4J8O A;  5L8R E;  3RKY A;  4M7D A;  1NZ9 A;  2K3X A;  3JRZ A;  1VQ8 A;  2RI2 A;  5KCO A;  1Y96 A;  2RHX A;  5HKC A;  1Q82 C;  2RM4 A;  5GAM e;  3O8V A;  3DB4 A;  3NFC A;  5GAO m;  1SSF A;  4E7K A;  4KT0 E;  1OZ2 A;  3OYA A;  2K2V A;  2JOY A;  1XNI A;  2P0P A;  3BY7 A;  2XID A;  2FL7 A;  5CVI A;  3JCM P;  3PMT A;  3OB9 A;  2JNG A;  1QP2 A;  4B9X A;  2QEX A;  2KAF A;  1XOV A;  2P0K A;  1MGQ A;  2MI6 A;  3OQ5 A;  2ZPG B;  4R56 A;  2LT1 A;  4BE2 A;  3FDR A;  3QYH B;  4X34 A;  3OYC A;  3JB9 D;  1S72 T;  4A4G A;  3V7R A;  2FHD A;  3QZ9 B;  4L6V 5;  4GY5 A;  4F7U B;  2K3Y A;  1JRI A;  3CCE T;  4GLK A;  2KSS A;  1RI0 A;  1ZBX A;  3MEA A;  3L42 A;  5D6Y A;  1JBM A;  1K8A U;  2DXT A;  3M9Q A;  1VQ9 T;  2X4W A;  1R8O B;  4N4G A;  1JJ2 A;  4KUD K;  2V8K A;  2RJE A;  5GAM f;  4LDY A;  1VQ5 A;  1BIB A;  2LTO A;  2V8I A;  3G6E A;  1I8F A;  3A8L B;  1YIT A;  3URG A;  3A8O B;  2DAQ A;  2RK2 A;  3WVE B;  3CCL A;  2MWO A;  3OA6 A;  4XAX B;  2L8D A;  2E41 A;  2E64 A;  1B34 A;  2Y4Y A;  3L2Q A;  3JCM J;  2HQX A;  1YIJ A;  3LGF A;  5FU6 B;  2G3R A;  5EG2 A;  3M4G A;  1WPY A;  3HL8 A;  1BI0 A;  4RG2 A;  3SD4 A;  1ZQ1 A;  4C92 F;  3VU3 C;  2Y4X A;  3WVD B;  5LJ3 g;  1Q7Y C;  2XD0 A;  3ASK A;  2GCX A;  4N0A C;  4M78 B;  3VV0 A;  5GAN h;  3OW2 S;  3VYG A;  4OB3 B;  1QVF A;  3M58 A;  4ELZ C;  4PJO E;  3OMC A;  3FLG A;  2DXB A;  2A3L A;  2EQU A;  3LYI A;  1QVP A;  4EMG A;  2ZCF B;  4C8Q G;  1X6O A;  2YLB A;  3GP8 A;  3S3O A;  4IUV A;  3V7S A;  3A8M B;  1UGQ B;  1GXI E;  5A2Q E;  3OY9 A;  3M56 A;  2JUF A;  4FU6 A;  2JTM A;  1Y7X A;  2K5I A;  4N0A A;  2M1H A;  2RJF A;  4XU2 A;  3SWN C;  3OSS C;  4DOV A;  2EFI A;  1VQO T;  3HFO A;  1MHN A;  2RHY A;  2EYQ A;  2RJC A;  2O4X B;  4M7D F;  3HPW A;  4FT2 A;  4M75 B;  4M77 B;  3RES A;  4OB0 B;  5GAM d;  2EQJ A;  3H6Z A;  5CIU A;  1XTD A;  4PJO D;  4FT4 A;  4XTU A;  3OYB A;  3MEV A;  3CXC S;  3CCJ A;  4MZP A;  1M90 U;  3VYH B;  4M7D G;  2DXU A;  5GAO n;  3SWN A;  2VYT A;  3JCM e;  3V8L A;  1UGP B;  2CYZ B;  3KUF A;  1NJI U;  2OTJ A;  4J7F A;  1Q81 U;  1N8R C;  2QTX A;  5GAO p;  4C0D C;  1YBY A;  4HKE A;  4PLL A;  2E65 A;  3PMI A;  4B9W A;  3EFR A;  4XK8 E;  3CC7 A;  1YJW T;  2B8A A;  2A7Y A;  3LWI A;  3I56 A;  4RKU E;  2MWP A;  4C5H A;  3VKI A;  5I2M A;  1BI3 A;  2C06 A;  4OB2 B;  2DD4 A;  5HK0 A;  2HNI A;  1M4Z A;  5DLQ E;  4PLI A;  1FWZ A;  5FRO A;  4LDU A;  1O75 A;  3V7C A;  2BKD N;  3MP1 A;  1EIF A;  2XHC A;  3C95 A;  2ZPH B;  2CZ6 B;  3M5A A;  1BI2 A;  4OB1 B;  1G3T A;  1VIF A;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...