5LJ5g

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
75
structure length
69
Chain Sequence
b'VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQLGLQTVIRGNSIISLEALDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 8
structure length 69
sequence length 75
chains with identical sequence r
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5g00
2DXUA 5GMKe 2DJZA 4PNOA 3JCMf 2FB7A 4M78C 4PJOG 2DZCA 5LJ5d 5GANd 2DEQA 4M7AE 1KQ2A 4PJOD 5GAN6 4V2SA 3SB2A 5I21A 3BW1A 4M75G 4M77G 4X9CA 4QVCA 4M7AD 3V7RA 5LJ3f 5GMKl 3RKXA 4XU1A 3EFSA 4M78G 1U1TA 5GAMf 1M8VA 1B34A 5LJ3j 2CGHA 4C92B 3JB9D 4C8QE 2EAYA 1WNLA 2RM4A 5GAN7 4XTYA 4C8QD 4XTWA 4JLIA 5GAOn 1N9RA 3JB9F 4M7DB 2I2LA 4A54A 4C8QF 1M5Q1 5GMKh 2EJFA 2YLCA 2K57A 4J6XA 4C8QA 5LJ5e 5GANe 4PJOC 4M7AC 4NL2A 5GAOl 5GMKm 2DXTA 3L2ZA 5DY9A 3AHUA 4F7UF 4F7UA 4DQ2A 4M7AG 4MMLA 3FIFA 1Y96A 2E64A 2VXFA 3RKWA 4C8QC 3JCMg 2YHTA 1I4K1 4EMGA 4PJOB 2E1HA 3JB9G 4EMKB 5LJ3g 5GAN8 5GAN3 4M75B 3QO3A 1U1SA 4M77B 4C8QG 3HFOA 2EJ9A 5LJ5h 5GAMj 3JCMe 3EFRA 5GAMg 5GANh 1WQWA 4M78B 3JB9I 2JN0A 1KQ1A 2DKGA 4RCCA 3V7CA 4N0AA 4WF2A 2VC8A 2E65A 3SWNA 4F7UG 4F7UE 2DZ9A 5LJ3e 3JCMd 2QTXA 4XTXA 4XU2A 1YCYA 3BY7A 2DTOA 1HK9A 3RKYA 1D3BB 5LJ3d 2RB6A 4J5YA 3JCMJ 1JBMA 3QHSA 3FJPA 5GAMd 3RERA 2Y90A 3RESA 4N0AC 4J6YA 3SWNC 1BIAA 3HFNA 3QUIA 5LJ5f 4M77C 3JCMX 5GANf 3V8KA 4M7DE 3JCMh 4C92F 4XU0A 5GAOr 4M7DD 4C92A 1JRIA 4EMKA 4M75A 2EWNA 2RD1A 4M7AB 4HT9A 5GAN5 3GIBA 2E10A 3QSUA 3FB9A 1TH7A 4XTUA 2E41A 2YLBA 1LNXA 4M78A 5LJ3h 4Y91A 1LOJA 4M7DF 4X9DA 5GMKj 3RIRA 3V7SA 4M7DA 5GAN4 3BFMA 5GAOm 3JCMb 3HSBA 2RA2A 4JRIA 4JUVA 4C8QB 4XTZA 4NOYA 1I81A 1LJOA 1HXDA 3RUXA 3JCMQ 5GAMe 4XTVA 1I5LA 3INZA 2VXEA 3V8LA 1D3BA 3JB9J 4PJOE 3BDUA 4A53A 3M4GA 4C92E 3JCMc 4C92G 4M75E 5GAOq 4M77E 4M7DC 2FYKA 1X01A 4F7UB 4C92D 4HA8A 4J6WA 1Y96B 2DTIA 4M77D 3PGGA 4M75D 3VU3C 4M78E 3JCMV 4EMHA 4NL3A 4PJOF 4M78D 5CAIA 4M7AF 4M7DG 5GMKi 4PJOA 4QVDA 2HNIA 4M7AA 4M75F 4M77F 5LJ5j 4HT8A 5LJ5g 1B34B 1WQ7A 3L1AA 3JCMW 4M77A 5GANg 3JCMP 5GANj 2EJGA 2DVEA 4OP0A 3JB9H 4M78F 1N9SA 1WPYA 4XU3A 5GAOp 1BIBA 4XQ3A 1H641 5GAMh 1MGQA 5GAN2 3SWNB 1I8FA 2ZGWA 4JRKA 4MMKA 4C92C 4EMKC 4M75C 3V8JA 2DTHA 4RCBA
chains in the Genus database with same CATH superfamily
1VQOA 2CDTA 5GANd 1KQ2A 2L89A 1MMNA 2GTOA 2X4JA 3PMIA 3PVLA 2DMOA 5GMKl 4Z89A 2COZA 1KC8C 4C8QE 2SRCA 1VQOT 1IREB 2HSPA 2RJEA 4A54A 4ZN1A 1W1FA 1I0CA 2K57A 4C5GA 3EGDB 1BBZA 3PTAA 2FZGB 3I35A 1KHCA 3LWHA 3M0UA 5FWBA 2QEXT 5KYNA 3M0RA 2DXBA 2EFIA 3EFOA 8ATCB 2W10A 3QO3A 2D1XA 2DIGA 2ZCFB 4ORZA 5I2SA 1KD1U 1YJWA 1VQLQ 4HXJA 2DIQA 4WF2A 4F7UG 4XTXA 5J3BA 2DK3A 1QLYA 4D6WA 4C5EA 2VGNA 5KE2A 1EFNA 1GFDA 1OQKA 1QCNA 2HMAA 3L42A 2M1HA 4JJBA 3QUIA 1YJWT 4RTZA 1E6GA 2C0OA 3OYDA 2PVGB 3CPWA 1I07A 2RQRA 3L2UA 3E19A 1J3TA 1SRMA 5IAYA 4XTZA 4BE2A 2PZ1A 1XJWB 3A98A 3HKSA 1X01A 4J6WA 3CBOA 4MZPA 4M77D 4IUUA 2CZ1B 1W2BP 3M53A 1GXIE 2JOYA 1PKSA 4DEYA 3FLGA 1VQ5Q 4DA4A 2L3PA 2KI7A 1BIBA 2R5MA 3CXCA 4KH1B 4RUGA 2DTHA 1WA7A 2DLPA 5LJ5d 4ZGEB 1WIEA 2F5KA 4HCZA 1KC8U 1TUGB 2FHDA 1OZ2A 4RMOA 1TOVA 1KFZA 5GAMf 4JDSA 3JB9D 4XTYA 3REBB 5HCKA 3OSVA 2K5IA 3FRNA 4KUDK 2YLCA 5GANe 4E7IA 2E6ZA 3LH0A 1GBRA 3S3MA 2FVUA 1NLOC 3CC2Q 4RTTA 2CP7A 3I55Q 1I4K1 4DBHA 1YWPA 2RN8A 1WYXA 3H6ZA 5GAN3 3M0QA 2WSEE 4RKUE 3CMAA 2DRMA 4OMPA 4A4GA 3G4SA 2YUQA 1NJIC 3JCMd 3NPFA 3OYBA 2LQ8A 3KXTA 2NYSA 2V1RA 2RB6A 1YN8A 1KQSP 3CMAT 2LNHB 1SPKA 1Q81R 2Y90A 2LX7A 1AWXA 3G4ST 2CSIA 2EYXA 1WGSA 2K6DA 4OGCA 2E41A 5FWCA 1VQLA 2D0QB 3ZBDA 4KGZB 3DLLA 2FO0A 3MPUB 2QASA 1UFFA 1NM7A 2RHIA 4X1VA 2ZPIB 4PFPA 1QMCA 5DM7R 3VU3C 1VQLT 5IHKA 3LW5E 5CIUA 5GMKi 4QVDA 4HCKA 4M75F 2KROA 3WVDB 2QK0A 1R8OB 1BKBA 1M1KU 2JM9A 4BY6C 4XU3A 1W2BA 3TREA 2FEIA 2K4YA 2RJFA 3NTKA 1AZGB 3JRZA 3I5SA 2RH2A 1C1AA 4PNOA 4J9EA 1G8XA 2QGGA 3R6NA 1PRLC 3HHTB 4OMMA 1U1TA 2L0AA 1AD5A 3PIPA 2RM4A 1IGQA 3JAME 2JMCA 2LCCA 2I2LA 1VYUA 5IHNA 3REAB 1X2QA 3OYJA 1JB0E 1KHIA 5LJ5e 1VQ4Q 3OS2A 2QQBA 2P0KA 2JNGA 2PUOB 4M7AG 3FIFA 1YNZA 3ZFJA 2QA4Q 1UGVA 3OYFA 4GLMA 2HAXA 2O9SA 4FCYA 2YUOA 7AT1B 3JV3A 1UGRB 3GNGA 5GAMg 1D0YA 5FU7C 2KVQG 5GANh 1NJIU 1IB8A 1JU5C 1WHGA 1NJIR 3UT1A 4MDWA 3CPWS 4KRTA 2LDMA 2P4RA 4J9FA 2VWFA 1KQSA 4XTUA 1PCXA 3X26B 2DYBA 3HSBA 2FPEA 3M58A 3M0PA 3C12A 3RUXA 1HXDA 2KGTA 4LNPA 3INZA 1RAFB 3U23A 4MDXA 2LVMA 4PJNA 4Y92A 3CCSQ 4HA8A 2XHCA 2AHJB 1K73C 4M7DG 1SSFA 3CXCS 1RI9A 3WXMB 2KNBB 2E6NA 3QXEB 3MP6A 3LGLA 3N5BB 2YRCA 3SWNB 1JEGA 5A0LA 4E2FB 3H8ZA 2M0YA 4M7AE 1PSFA 1VQ8A 2XG8D 3BW1A 4X9CA 2EIFA 2KR3A 2P0PA 1D0XA 2L8DA 4M78G 2M9UA 2OJ2A 2MYSA 2EAYA 4XTWA 1VQMA 1HJDA 2IVWA 2WACA 3CCUQ 2FZCB 2H3JA 1YJ9A 3I9QA 3J80E 3H41A 5GAOl 3CC7Q 2LC4A 3AHUA 3TCJA 2W0ZA 1GL5A 1MNEA 4C0ZA 1MV0B 1OX8A 2BIVA 3RNJA 3G6EA 1V29B 4PJOB 1M4ZA 1PSEA 1YJ9T 5LJ5h 2FPFA 2OX7A 2PVOB 2JN0A 3QYHB 4LUDA 2O4XB 3H0HA 4N0AA 2CZ6B 4LXCA 3G6ET 1UTIA 1YCYA 2BE9B 1YI2Q 2AZVA 4F04B 1NEGA 4J5YA 2QA4A 2GFUA 2CP6A 3VS3A 2HD0A 4XK8E 1PM3A 4M7DE 3EG2A 1VQ4T 2YWWA 1HD3A 5CKBA 4E7JA 2RQUA 2EWNA 3P8DA 4ANJA 5GJWB 2O88A 2RHXA 4GLKA 2QA4T 1ZA2B 2XIDA 2LJ3A 2DL4A 4JUVA 4AG2C 1RI0A 1M1GA 1I5LA 4VUBA 3OYNA 1K73U 2OTLA 4M78E 3JCMV 1M3CA 2K3BA 1SSHA 4M7AA 3EGUA 1W2BS 1RAHB 1CKAA 1QW1A 2WSFE 2ZPBB 4O5VA 2ATCB 1YWOA 4XQ3A 2BE7D 4XAXB 1FWZA 3OBYA 4HVUA 4A4EA 4OMLA 2RJDA 4ATOA 4M77C 3CCSA 2DJZA 3META 3SHWA 3VS6A 2DAQA 1I5OB 1TSFA 2DL7A 2MAMA 2XDPA 5I21A 2EVRA 3F70A 3NMZC 1Y71A 3NGPA 3OS5A 1P92A 3M57A 5CKFA 4JLIA 3CCST 2A37A 3QKJA 2XD0A 2KY9A 1T3SA 2VV5A 2GFAA 2V8JA 1N8RC 1GRIA 1Q7YC 3ULRB 3VV0A 4FYYB 3FJ5A 3TU4K 1ZBXA 4JPBW 4PFOA 2YUNA 3FDRA 1Q82U 2CH4A 4Y28E 5AT1B 5LL6S 3CCUA 4AMCA 3X25B 2DKGA 4BE0A 2BKDN 3SWNA 3G7ZA 1TU0B 2MOXA 1BI2A 4CC3A 3JCMJ 1M2OA 2KYMA 3CCUT 1ABQA 1KQSS 5GAOr 8AT1B 2L3RA 3E9GA 4J7IA 4M78A 3OYKA 4X9DA 3VRYA 1MMAA 2EQUA 4BI3A 1ZUKA 4C8QB 1U8RA 1YI2A 1K9MU 5IXBA 4L6V5 5GAOq 3CCLQ 1X43A 2FG0A 3ER0A 2EYWA 4J9DA 1YHQA 2EQIA 2HQHA 3OA6A 5KYYA 4PJOA 1GCPA 2HKNA 4E7HA 2CZ0B 1YI2T 2VKNA 1WPYA 4KGVB 1M9SA 2DA9A 2O4XA 1YHQT 1I8FA 2PVDB 3VS1A 1M3AA 4IIOA 3RMSA 1VQNQ 2AZSA 1OZ3A 2M16A 3URGA 2EGEA 1G3TA 1B3QA 2DEQA 5CO7A 3RMQA 1PWTA 4M75G 4F14A 1VQPA 1OPLA 1B34A 1G2BA 1NLPC 4C92B 1SEMA 2FPDA 3P8HA 3OYEA 3CC4A 3OYCA 2ZZDA 3CCQQ 5D7UA 3LH5A 1N8RU 2RK1A 1QVPA 2ED0A 1Q95G 3KFVA 2ZPHB 1VQPT 4EIKA 1TUDA 2DXTA 3CC4T 2FRWA 1Q7YR 5L23A 1UGPB 2VXFA 3E1SA 3Q1JA 2MWOA 1JXOA 1GFCA 2KRNA 1IO6A 3CMAQ 1XNIA 3NTIA 3V7CA 4OVAA 1K76A 2EW3A 3G4SQ 2K7AA 3G71Q 3KUFA 4KBMB 5KCOA 4P5NA 1N27A 1LVKA 4TVRA 1T0JA 3CCRQ 5GAMd 5KH6A 4LD9K 1QVGP 2EGCA 3X24B 3QPHA 2JS0A 3HRSA 1BCOA 2YLBA 2EQKA 1YFNA 2JVVA 3RIRA 4QW2A 1BU1A 2DM1A 5GAN4 3OYLA 3EHQA 2B8AA 2DD5A 2IIMA 2DNUA 1BK2A 3LLRA 3JCMQ 4XTVA 4LD6A 4C92E 2KT8A 2DYIA 4M75E 4L5GA 2FYKA 4F7UB 1KD1R 1AOJA 2K2MA 4J7FA 4JRQA 1W6XA 2H3EB 3QBYA 4M77F 3JCMP 4FM4B 3X20B 5L8RE 3OSSC 1Q86U 1ZSZB 2XKOC 1MGQA 2M0OA 1BI1A 1SG5A 4QT7A 2K5LA 5ECAA 3UWNA 3V8JA 3CCLA 1E7OA 4L59A 3VUBA 3OY9A 4BACA 1QQJA 1X6GA 5GAN7 1WNLA 2J7IA 3CCLT 3OW2P 4PLLA 3JB9F 4O6JA 5GJVB 1M1KC 4C8QA 2KDSA 4J6XA 3TQ7P 1VQNA 2A7YA 1KJWA 3O5ZA 1QVFP 3OQ5A 2ESWA 4D8KA 1ZLMA 3CCJQ 2JM8A 5A0GA 2E64A 5A2QE 1XQHA 2YSQA 1RABB 2RNAA 2DILA 1VQNT 3CCQA 1K0XA 2RMOA 1KC8R 2EJ9A 1V76A 1MNDA 2K9GA 1FYNA 2VC8A 4F7UE 4HVWA 3VYHB 1IZ6A 4EPCA 1HK9A 3CCQT 1NE8A 1YIJQ 3RERA 5AYFA 3OB9A 3RESA 3SDZA 3HFNA 4LDWA 2J6FA 2DBMA 4GBQA 4C92A 4EMKA 4M75A 4RTXA 1AEYA 2J6OA 3VJPA 2EQMA 2VB6A 2AKKA 1QVGA 2F5TX 3BFMA 3G71A 2RA2A 2MK5A 1YJNA 4CC2A 2HSEB 2R58A 5GAMe 1R0BG 2V1QA 3CCRA 2CSQA 2EQJA 3AT1B 4E7LA 3TEEA 1VYVA 2E4HA 3G71T 3TSWA 5GANj 1UUEA 2KMTA 1EZZB 3CCRT 3CBMA 1UDLA 5FRNA 4IIMA 4MMKA 2C06A 1AT1B 2CUDA 2KQWA 3BDLA 3MJXA 2DZCA 2MF2A 1VQ8Q 5LJ3f 2EYZA 1OU9A 2BTTA 3CCEQ 2X3WD 1YP5A 4K11A 1D09B 4C8QD 5I22A 1Y07A 1KSWA 3QJYA 1ABOA 1VQMQ 1NYFA 3QYGB 2ROTA 3QWXX 3UF4A 1M1KR 2EBPA 3VS5A 5GMKm 3OW2A 2LT4A 1YJ9Q 2SEMA 2V8KA 4F7UA 2QDYB 4Z88A 4C0DB 2X4YA 5CQXA 3M0TA 2GQVA 3G6EQ 1W4SA 2QQ9A 1ZSZA 1WQWA 4J9IA 4BD3A 2J05A 5LJ3e 4HCBA 1WHMA 4BDZA 2FZKB 3CCJA 3OYAA 3PMTA 4JRPA 4N0AC 1BIAA 1K4US 3JCMX 2ZPEB 4OGEA 5HK0A 4M7AB 4HT9A 1WHJA 1UE9A 1TH7A 4JJCA 3VYGA 3CCJT 4RTWA 2RHUA 4OMNA 2A0FB 3CEYA 2MPXC 2CT4A 3M4GA 1YIJA 3JCMc 2ZPGB 1Y57A 4BI4A 2OTLQ 2QQAA 4FIBA 1QKWA 4OF1A 5LJ5j 2GGRA 3VKIA 2CKKA 2DBKA 1G5VA 1YIJT 2O01E 5GAMh 9ATCB 3QJ6A 1D1BA 1WJRA 1NEBA 4LDXA 1OULA 3NHNA 4DEXA 5KYXB 2KSSA 1Y0MA 4V2SA 2F2WA 3NFCA 3QG1A 4Z8AA 4ZGDB 4QVCA 1IHWA 4RTYA 4JZ3A 2D6FA 2RQTA 3CBPA 1H3HA 1OX9A 3P8BB 4AFUC 4WTOB 2CGHA 2JS2A 1TWBA 1ARKA 2P84A 2VGMA 2X3XD 2HL3A 4M7DB 1M90C 4FYVB 2RO0A 3CQTA 2LMJA 4CRIA 2BUDA 2E3IA 5KYUB 2COWA 1JQQA 1M2VB 3MEAA 1CKBA 3SEMA 2VVKA 2CH4W 1IRXA 3CCEA 3M56A 1XOVA 2JTEA 1MMDA 5LJ3g 1OOTA 4DOVA 4M78B 3OYHA 4GY5A 1VQ8T 1WXUA 3J7AF 4EDUA 3CCET 1SHFA 1NYGA 2BZ8A 4PFZA 1VQ7A 3L2QA 2GCXA 1VQMT 1Z9ZA 3SWNC 4N4HA 1K1ZA 3EGXB 1VQKQ 5KYYB 2JTMA 2RD1A 1PD0A 1QVGS 5CKDA 3GIBA 5LJ3h 3QZ9B 3UATA 4JJDA 1D1CA 1OU8A 4KGXB 1Q82C 2WSCE 1LJOA 2D8HA 2AIRB 1D3BA 3BDUA 4A53A 2JTFA 2LX9A 1X6BA 4KT0E 3I56Q 1IHVA 1YHQQ 4RG2A 2E3HA 3QWYA 2NUZA 1B34B 4RG8A 5FU6C 4LDUA 2DVEA 4QQ6A 1N9SA 1NZ9A 1OV3A 5EC7A 1H8KA 2X9HA 2XK0A 4QVZA 5HY6A 2RHZA 2QAZA 5GMKe 1U3OA 4M77G 1K9MC 3HPWA 1VQPQ 4ELZC 1M90U 1BB9A 3EAEA 3QZ5B 1SF9A 3GLXA 4NS5A 1K73R 1UG1A 5FRMA 1AZEA 3CC4Q 1LCKA 3OW2S 3PNWC 2OTLT 3C4SA 2HQEA 2YUPA 3PT9A 1IGUA 1A0NB 1JO8A 1QVFS 1OPKA 3MEVA 4A4KA 3ZL7C 2OAWA 3LWIA 2Z0WA 3M9QA 4B9WA 3JB9G 1PG5B 1UEBA 2KYBA 2MMPA 2YDLA 2D8JA 1K8AU 2DXCA 1QCOA 3CD6Q 4J83A 1VQ9Q 2CZ7B 5KYXA 1G3SA 2KRMA 4CC7A 3OS0A 3J81E 1PKTA 4J8OA 3L2WA 4AFSC 3ME9A 3OYIA 4ZTJA 2VYTA 2XU8A 2O2OA 1R0CB 2O31A 1VOMA 4ZNXA 4E7ZA 1YITQ 4M7DA 2X51A 1QWFA 4KULA 4WCIA 2DL5A 2HL5C 1QWEA 2LZ6B 2DE0X 4FYWB 1Q82R 5KYUA 1M2VA 1X75C 3LGFA 3OYYA 4IUPA 4M77E 4YTLA 1VQKA 1RAEB 4M7AF 1RAIB 4KH0B 2BZYA 3JSCA 1RUWA 5GAOp 1ACMB 5CR2A 1VQKT 2HDAA 2LRQA 4JRKA 3VS0A 1MHNA 3THKA 1ZUUA 1SHGA 2DXUA 4FT4A 2FB7A 3I56A 2QDLA 4M7AD 2MI6A 4BDYA 1QP3A 3EGXA 2AKLA 3RKXA 3EFSA 3GBQA 1K9MR 2CP2A 3A8OB 2HBPA 3VS4A 1WI7A 3S3NA 1MV3A 2XMFA 5J26A 4QKUA 4DBQA 1X2KA 3I56T 3PE0A 5GMKh 2FL7A 3FEOA 1Q86C 5DLQE 1M30A 3L2ZA 3UA7A 1UJ0A 4A4HA 2DEUA 3CCMA 1Z9QA 3RKWA 4C8QC 4JS4A 1VUBA 1UGQB 4EMKB 4M75B 4MZMA 4RTVA 4R0KA 4IUTA 5C0MA 1E6HA 4IUVA 3CCMT 3EG0A 2IPOB 3C0CA 1M1FA 2RJCA 4BI8B 5D6YA 1N8RR 2KXDA 2QTVA 3I5RA 4LUEA 1KK7A 2DX1A 3UA6A 1TUCA 4PJLA 2ROLA 3V8KA 1AHJB 1UJYA 4XU0A 4M7DD 1NG2A 2CUBA 3QSUA 1BI0A 1VYTA 1WJQA 1VA7A 2QYZA 3LX7A 2K79A 3MO8A 3EHRA 3CD6A 1VQ9A 3SFMA 2G6FX 1YJNQ 1FX7A 2VXEA 4FT2A 2VASA 1B07A 3CCVA 1FMWA 2YRDA 2QG9B 2JZ2A 4D8DA 4EMHA 3PGGA 2F2XA 4PJOF 4M78D 5EG2A 4PJJA 2HNIA 1WXTA 3CD6T 1VQ9T 3JCMW 4N4IA 4ZGJB 1YITA 2L3QA 2QEXA 3CCVT 5KYWB 2EYQA 2GNCA 4A63B 2RF0A 2COYA 4R55A 1F1BB 4PJOD 1YITT 3V7RA 1R77A 2NUPB 3OMCA 1M8VA 2OTJQ 2DRKA 3M5AA 4C0GA 2J06A 1VIEA 2L5QA 1JJ2P 2KEAA 1Q81C 2R5AA 5DY9A 1OYXA 1Q86R 2Y4XA 2MIOA 1ZUYA 4E6RA 2DPPB 2YHTA 3PIOA 4AG1C 2A08A 3ZEHA 5GAN8 5CK9A 2PU9B 1S1NA 3EFRA 2F2VA 1C6VX 2ECZA 2X4XA 3OS1A 4RCCA 3OYMA 2Y4YA 2XI9A 1HSQA 2E65A 2DO3A 1D1AA 2JJ9A 3VRZA 3A8GB 3GOXA 2QTXA 2X4WA 4XU2A 1QP2A 1ZSZC 5LJ3d 1QKXA 4MZTA 1WJSA 1JBMA 1PRMC 4CC4B 4J6YA 5GANf 4OMQA 2JMAA 1RLPC 1ZSGA 1AWOA 1OEBA 4B9XA 1WXBA 3M54A 3FB9A 4CI0C 3EG3A 1MMGA 3HRUA 3V7SA 1X27A 1T0HA 2DL3A 2OI3A 4PKCC 3JCMb 2LCLA 2HZYA 4FL6A 4DOWA 4NOYA 2CS7A 3V8LA 2LP5A 1GCQA 4BUGA 3GPLA 2I0NA 1Y96B 3H9NA 1KIKA 4HCCA 3A8LB 2DERA 1KG1A 2CT3A 2DJQA 3ASKA 4HVVA 4ELYC 4DBFA 5CAIA 4ESRA 2ED1A 3E2UA 1K9AA 1Y7XA 1YCSB 2AK5A 2GF7A 6AT1B 2KE9A 5CKEA 4PL6A 5HKCA 2CYZB 1H641 1WZOA 1C0MA 2YXYA 4PK4A 3GF5A 5GAN2 2ZGWA 2DETA 1YBYA 2PTKA 4JZ4A 1ZHIA 4C5IA 4PLIA 5GAN6 2D0NA 1BCMA 2DD4A 1G3YA 2RQWA 2KAFA 2V26A 2LT1A 1YJNT 1PD1A 3LYIA 2KBTA 3O8VA 3UPUA 1PC0A 3CPFA 1Q81U 4C8QF 1IXDA 1UHCA 3GNFB 3MP1A 1QCFA 2R57A 4BY6B 4DQ2A 5I11A 3NTHA 1JJ2A 2PUKB 2K5FA 4ZN3A 2OTJA 4FW1A 4LDVA 4EMGA 1UHFA 1WHHA 5IHIA 1TS9A 2LJ1A 2E5KA 5GAMj 4C5HA 1KQ1A 5KYWA 2B86A 4E7SA 3EGDA 2KT1A 1TTHB 2DZ9A 2E70A 3FC3A 2CREA 2OTJT 3MKDA 5HK3A 3BY7A 3X28B 4BB7A 2P0QA 2MCNA 1EX4A 1D3BB 5FLXE 3C94A 3FJPA 1VQ7Q 4A4FA 2GTJA 5LJ5f 2NUPA 1JXMA 3DB3A 4C0FA 1QVFA 4C92F 4AFZC 4KUIA 3TSZA 1EIFA 3A5ZB 2XDBA 2RI2A 3H0IA 1LNXA 1RL2A 1U06A 1AWWA 4FYXB 2EYYA 3PFSA 2KXCA 1I81A 2LQKA 2JW4A 2HQXA 4C92D 5FU7B 2EGAA 4M75D 1ZQ1A 4LE9A 4NL3A 1BYMA 2A3LA 2D9TA 1VQ5A 5GANg 4OB1B 3VS7A 2JUFA 1WHKA 4C0DC 2XDDA 2F69A 2EPDA 3D7SB 1O9SA 1VQ5T 1AWJA 2QQRA 3RDVA 3JCMf 2NUTB 4B6MA 2CP0A 5IT9E 4QQDA 5CCAA 5LJ3j 1WHLA 3CMEQ 2RK2A 2JXBA 1W70A 2EJFA 1H3ZA 4M7AC 1RADB 3CC2A 4DBRA 4JLGA 1G3WA 3I55A 3E9FA 4F7UF 2XICA 1Y96A 3VUZA 1XTDA 1VIFA 2DFUA 5D6WA 4E7KA 3EH1A 1VQ6Q 4J9CA 1CSKA 3HFOA 5I2MA 3M0SA 2QGFB 3CC2T 3JCMe 2LNVA 3I55T 2ABLA 3QDRB 2G3RA 2KK4A 1N6AA 4E47A 3C95A 1N5ZA 2LQWA 2M02A 2HKQB 1JRIA 2E10A 2F1LA 2L2PA 1LOJA 1I1JA 1T3LA 3MEWA 3UDCA 3DB4A 2RI5A 3JB9J 2OAUA 1K8AC 4M7DC 2GBQA 2HCKA 3IQLA 1ZA1B 1NPRA 1V1CA 2DTIA 5KCHA 4LDYA 3QDFA 4F17A 2RI3A 2IG0A 3GP8A 3MEUA 2O9VA 4R56A 1O75A 4OB0B 1WQ7A 5LJ5g 4UC4A 3G1JA 4OP0A 2QXFA 3OYGA 5M9OA 1VQ7T 5A0DA 2ENMA 1FMVA 4LN2A 1TG0A 3EG9B 1U5SA 5FU6B 4FU6A 4HKEA 4M78C 4PJOG 3SB2A 2DF6A 4FSXA 3S3OA 2A36A 2BZXA 2QI2A 5C6SA 4ZTFA 1K0SA 2C0TA 1VQ4A 2P4TA 1PHTA 3H0FA 4PJOC 5CQYA 1S72Q 1JJ2S 1RLQC 5CVIA 4AT1B 4MMLA 3EH2A 2E12A 3T9NA 2YT6A 3JCMg 1NPPA 2GQIA 5D6XA 3CCMQ 1WFWA 1G83A 2VUBA 3CMEA 1WX6A 2LQNA 1BI3A 4M77B 4J9BA 1M8MA 3JB9I 5IH2A 2CP5A 2ZPFB 4IURA 4J9HA 1M90R 1HYOA 4J9GA 4OMFB 2A28A 3CMET 1SKUB 3A1PA 2NUTA 1RACB 2L3SA 3QHSA 3JCMh 5IXFA 5CKHA 2EKOA 1VQ6A 2PQWA 2J6KA 2X35A 4Y91A 1RAAB 5GMKj 1WDXA 4X34A 2LCSA 4RTUA 4JRIA 1RAGB 3A8MB 4PJOE 1VQ6T 2RPNA 3M59A 1LPLA 1VQOQ 4OB3B 1ZX6A 3CCVQ 1K8AR 5J39A 2HEQA 2E5QA 4JS5A 3DLMA 5IN1A 4F16A 4QQGA 3L1AA 3EFOB 2EJGA 2AT1B 2M51A 4M4ZA 2QEXQ 4AFQC 2K2VA 3TVTA 4OMOA 2LTOA 4FW2A 4RCBA 4II1A 1DJ7B 4Z02A 3WVEB 2QQSA 1X69A 2LJ0A 4ME7A 3BE3A 5FROA 3MCAB 4XU1A 5DLOA 3MP8A 3L2RA 4Q5WA 1UECA 4OB2B 3EG1A 3QIIA 5GAOn 2K3YA 1N9RA 4IKFA 3RR6A 2ZAEA 5KE3A 1M5Q1 4IUQA 1YJWQ 3CC7A 3M4YA 3MHXA 4NL2A 3RBBB 4FSSA 2H8HA 3HTRA 4PJMA 1B7TA 2NWMA 2E1HA 3CC7T 5FW9A 4C8QG 1U1SA 2FRYA 2RHYA 3HP9A 2MWPA 1UB4A 2DVJA 2C0IA 3HL8A 2RQVA 2NLUA 1OI1A 1S72A 3EG9A 3A8HB 2V8IA 1KD1C 1FMKA 2CP3A 3HRTA 2DTOA 3RKYA 3CPWP 2DL8A 2K3XA 1GBQA 2YRVA 1PNJA 1ZBJA 3R6OA 1S72T 1H92A 5GAN5 3VS2A 4M7DF 1FXXA 1M3BA 2JT4A 5GAOm 1MUZA 1X6OA 3L2VA 2KRSA 1SRLA 1UGSB 4BE1A 1D0ZA 4C92G 3DKMA 2PNIA 1AVZC 2HBWA 3SD4A 1NBEB 4N4GA 3CXCP 4HT8A 4M77A 3JB9H 4M78F 1GCQC 1WLPB 1TXQA 1Q7YU 3KBGA 3OMGA 1M27C 4JJNK 2EKHA 3OBWA 3M55A 3S6WA 4C92C 4EMKC 4M75C 3PVQA
chains in the Genus database with same CATH topology
1YBYA 1VQOA 3CCSA 2DJZA 3META 1ZHIA 4C5IA 2KSSA 5GANd 2DAQA 4PLIA 2L89A 5GAN6 2MAMA 2XDPA 3NFCA 3QG1A 4ZGDB 4QVCA 2X4JA 5I21A 3PMIA 3F70A 2DD4A 5GMKl 2D6FA 1G3YA 3CBPA 1KC8C 3P8BB 2KAFA 1Y71A 2CGHA 2LT1A 4C8QE 1YJNT 3OS5A 1P92A 3LYIA 3M57A 3O8VA 5CKFA 1YHQA 2VGMA 1VQOT 4JLIA 1IREB 3CCST 3UPUA 3CPFA 3QKJA 4M7DB 2RJEA 1M90C 4A54A 4ZN1A 2XD0A 1Q81U 4C8QF 2KY9A 2VV5A 2GFAA 2K57A 4C5GA 2RO0A 2V8JA 4CRIA 1N8RC 3GNFB 3PTAA 1Q7YC 2BUDA 3MP1A 3VV0A 2R57A 3MEAA 4BY6B 4DQ2A 1KHCA 3NTHA 3LWHA 1JJ2A 2PUKB 2K5FA 4ZN3A 3CCEA 2QEXT 2OTJA 4LDVA 3M56A 4EMGA 3TU4K 1ZBXA 2DXBA 2EFIA 1XOVA 5LJ3g 3FDRA 3QO3A 1Q82U 4Y28E 5GAMj 2DIGA 5LL6S 4DOVA 3CCUA 2ZCFB 4M78B 4C5HA 3X25B 5I2SA 3OYHA 1YJWA 1KD1U 1KQ1A 2DKGA 4GY5A 2DIQA 4BE0A 1VQ8T 2BKDN 3J7AF 4WF2A 3SWNA 3G7ZA 4F7UG 4EDUA 2DZ9A 3CCET 2E70A 4XTXA 3FC3A 2OTJT 5J3BA 2DK3A 5HK3A 3BY7A 3X28B 4D6WA 4BB7A 2P0QA 1BI2A 4C5EA 1VQ7A 2VGNA 5KE2A 1D3BB 5FLXE 3L2QA 3JCMJ 3L42A 2M1HA 3C94A 2GCXA 3FJPA 4A4FA 1VQMT 3CCUT 3SWNC 5LJ5f 4N4HA 1KQSS 3QUIA 1YJWT 4C0FA 3DB3A 1QVFA 4C92F 5GAOr 4KUIA 3OYDA 2PVGB 2JTMA 3CPWA 2RD1A 1EIFA 3A5ZB 1QVGS 5CKDA 2XDBA 3GIBA 2L3RA 2RI2A 5LJ3h 3QZ9B 1LNXA 3E9GA 4J7IA 4M78A 3OYKA 1RL2A 4X9DA 3L2UA 3E19A 2EQUA 3PFSA 4BI3A 5IAYA 1Q82C 4C8QB 1U8RA 2WSCE 4XTZA 4BE2A 1I81A 1LJOA 1YI2A 1K9MU 1D3BA 2LQKA 3HKSA 3BDUA 4A53A 4L6V5 5GAOq 1X01A 2HQXA 3ER0A 2JTFA 5FU7B 4J6WA 4M75D 3CBOA 2LX9A 4KT0E 4M77D 1ZQ1A 4IUUA 4MZPA 4NL3A 2CZ1B 2A3LA 2D9TA 3M53A 3OA6A 1BYMA 4RG2A 1GXIE 1VQ5A 2JOYA 4PJOA 3FLGA 4E7HA 1B34B 2CZ0B 4RG8A 4C92D 5GANg 1YI2T 5FU6C 4LDUA 2DVEA 4OB1B 4DA4A 4QQ6A 1N9SA 1WPYA 1NZ9A 1M9SA 2JUFA 1BIBA 2R5MA 2O4XA 3CXCA 4C0DC 1YHQT 2XDDA 2F69A 1I8FA 2XK0A 4QVZA 2PVDB 3RMSA 5HY6A 1O9SA 2RHZA 2M16A 2DTHA 1OZ3A 3URGA 1VQ5T 5GMKe 2QQRA 3JCMf 5LJ5d 4ZGEB 2F5KA 4HCZA 1KC8U 1G3TA 2DEQA 5CO7A 3RMQA 4M75G 4M77G 2FHDA 5IT9E 1K9MC 1VQPA 1OZ2A 4RMOA 3HPWA 5GAMf 4QQDA 5CCAA 1B34A 5LJ3j 4JDSA 4C92B 4ELZC 3P8HA 3JB9D 1M90U 3EAEA 3OYEA 3CC4A 3OYCA 2ZZDA 3QZ5B 4XTYA 2RK2A 3GLXA 4NS5A 5FRMA 3OSVA 2K5IA 1N8RU 3FRNA 4KUDK 4LDXA 2RK1A 1QVPA 3OW2S 2EJFA 2YLCA 3PNWC 2OTLT 3C4SA 2HQEA 2ZPHB 3PT9A 1VQPT 1H3ZA 5GANe 4E7IA 2E6ZA 3LH0A 4M7AC 3S3MA 2FVUA 3CC2A 2DXTA 4JLGA 1G3WA 3I55A 1QVFS 3E9FA 4F7UF 3CC4T 2XICA 3MEVA 1UGPB 1Y96A 2VXFA 4A4KA 3E1SA 3Q1JA 3LWIA 3VUZA 2MWOA 1I4K1 1XTDA 1VIFA 3M9QA 4B9WA 3H6ZA 5D6WA 3JB9G 1UEBA 4E7KA 2MMPA 5GAN3 3HFOA 2WSEE 4RKUE 5I2MA 3CMAA 3CC2T 3JCMe 2LNVA 3I55T 4A4GA 3G4SA 1XNIA 3NTIA 3V7CA 4OVAA 1K8AU 3QDRB 2G3RA 2KK4A 3KUFA 4KBMB 5KCOA 4P5NA 1N6AA 4E47A 3JCMd 1NJIC 2DXCA 4V2SA 1N27A 3C95A 4J83A 3OYBA 2CZ7B 2LQ8A 3KXTA 1G3SA 4TVRA 2RB6A 3CMAT 3OS0A 5GAMd 3J81E 2Y90A 4J8OA 5KH6A 3L2WA 3G4ST 3ME9A 4LD9K 3OYIA 4ZTJA 1WGSA 1JRIA 3X24B 2VYTA 2XU8A 3QPHA 4OGCA 3HRSA 2E10A 2E41A 2YLBA 2EQKA 1VQLA 1LOJA 2D0QB 3ZBDA 2JVVA 3RIRA 4M7DA 4QW2A 3DLLA 5GAN4 3MEWA 3OYLA 3UDCA 4KULA 3DB4A 2B8AA 2DD5A 2RHIA 3LLRA 3JCMQ 2RI5A 4XTVA 2ZPIB 3JB9J 2OAUA 4LD6A 1X75C 4C92E 1K8AC 3LGFA 4M75E 3OYYA 4IUPA 4L5GA 2FYKA 4M77E 4F7UB 4M7DC 5DM7R 3VU3C 1NPRA 2DTIA 4YTLA 5KCHA 1VQKA 4LDYA 1VQLT 4J7FA 3LW5E 2RI3A 2IG0A 3GP8A 5CIUA 4JRQA 4M7AF 3QBYA 5GMKi 3MEUA 4QVDA 4M75F 3WVDB 4M77F 1O75A 4R56A 3JSCA 1R8OB 1WQ7A 1BKBA 4OB0B 5LJ5g 3JCMP 1M1KU 4FM4B 4UC4A 4OP0A 4BY6C 3X20B 5L8RE 5GAOp 3OSSC 4XU3A 1Q86U 2QXFA 1W2BA 2XKOC 3OYGA 5M9OA 1VQ7T 5A0DA 1MGQA 2M0OA 1BI1A 3TREA 5CR2A 2K4YA 1VQKT 2LRQA 4JRKA 2RJFA 2K5LA 1MHNA 3NTKA 3UWNA 3V8JA 3JRZA 2DXUA 2RH2A 5FU6B 4FU6A 4FT4A 4HKEA 4PNOA 2FB7A 4M78C 4PJOG 3CCLA 3I56A 3SB2A 4M7AD 3HHTB 4L59A 4FSXA 3S3OA 2MI6A 4BDYA 1QP3A 3RKXA 3VUBA 3OY9A 3EFSA 4BACA 1U1TA 2QI2A 3A8OB 3PIPA 2RM4A 1WNLA 2HBPA 5GAN7 5C6SA 4ZTFA 3S3NA 3JAME 2LCCA 3CCLT 4PLLA 5J26A 3JB9F 2I2LA 1VQ4A 2P4TA 3I56T 5GMKh 3OYJA 4O6JA 1JB0E 1KHIA 2KDSA 4J6XA 4C8QA 5LJ5e 1M1KC 2A7YA 2FL7A 1VQNA 4PJOC 3FEOA 3OS2A 1Q86C 2QQBA 5CQYA 3OQ5A 5DLQE 2P0KA 1JJ2S 3L2ZA 5CVIA 4A4HA 2JNGA 2PUOB 4M7AG 4MMLA 2E12A 3FIFA 2E64A 5A0GA 3CCMA 3ZFJA 3T9NA 5A2QE 3RKWA 4C8QC 3JCMg 1VUBA 1NPPA 1XQHA 5D6XA 3OYFA 4JS4A 2HAXA 1UGQB 2VUBA 1VQNT 3CMEA 3CCQA 1BI3A 4EMKB 4M75B 4M77B 1UGRB 3GNGA 4MZMA 2EJ9A 5GAMg 5FU7C 2KVQG 5GANh 1NJIU 3JB9I 4IUTA 5C0MA 4IUVA 2ZPFB 3CCMT 2VC8A 4F7UE 4IURA 3VYHB 1IZ6A 4OMFB 4EPCA 1M1FA 2RJCA 4BI8B 5D6YA 1HK9A 3CMET 3CCQT 3UT1A 4MDWA 1NE8A 3QHSA 3RERA 5AYFA 3OB9A 3RESA 3CPWS 3SDZA 3HFNA 4LDWA 3V8KA 3JCMh 1AHJB 2LDMA 4XU0A 5CKHA 4M7DD 2EKOA 4C92A 4EMKA 1VQ6A 2PQWA 4M75A 1KQSA 3QSUA 4XTUA 2X35A 1BI0A 4Y91A 3VJPA 2EQMA 3X26B 1WJQA 5GMKj 1QVGA 4X34A 2F5TX 3BFMA 3G71A 3HSBA 2RA2A 3LX7A 4JRIA 1YJNA 3MO8A 3CD6A 1VQ9A 3M58A 3A8MB 3SFMA 3C12A 3RUXA 1HXDA 2R58A 5GAMe 1FX7A 2VXEA 3INZA 4FT2A 1VQ6T 3M59A 4PJOE 3CCRA 3CCVA 4MDXA 2EQJA 2LVMA 4OB3B 4HA8A 2JZ2A 4EMHA 4E7LA 3PGGA 3TEEA 5J39A 2E5QA 4JS5A 2XHCA 4PJOF 3DLMA 4M78D 3G71T 5EG2A 2AHJB 1K73C 4M7DG 5IN1A 2HNIA 4QQGA 3CD6T 1VQ9T 3L1AA 3JCMW 5GANj 2EJGA 4N4IA 1SSFA 4ZGJB 3CXCS 1YITA 2KMTA 2QEXA 3CCRT 3WXMB 3CCVT 3CBMA 2E6NA 3QXEB 3MP6A 5FRNA 3LGLA 3N5BB 3SWNB 4MMKA 2K2VA 2C06A 2LTOA 2KQWA 2EYQA 3BDLA 4RCBA 4II1A 5A0LA 1DJ7B 4Z02A 3WVEB 2QQSA 3H8ZA 4R55A 4M7AE 1PSFA 2DZCA 2XG8D 4ME7A 1VQ8A 4PJOD 2MF2A 3BW1A 1YITT 4X9CA 2EIFA 5FROA 3V7RA 2P0PA 5LJ3f 3MCAB 4XU1A 2L8DA 3MP8A 3OMCA 2M9UA 4M78G 5DLOA 1M8VA 3L2RA 3M5AA 4Q5WA 2EAYA 4OB2B 4C8QD 4XTWA 1Y07A 4C0GA 3QIIA 1VQMA 3QJYA 1VIEA 5GAOn 2K3YA 1N9RA 2IVWA 4IKFA 2WACA 5KE3A 3QYGB 1M5Q1 2L5QA 4IUQA 2H3JA 3CC7A 3M4YA 1YJ9A 3MHXA 3J80E 4NL2A 5GAOl 5GMKm 2LC4A 2R5AA 5DY9A 2LT4A 3OW2A 1Q81C 3AHUA 3TCJA 1OYXA 2Y4XA 2V8KA 4C0ZA 4F7UA 2DPPB 2QDYB 2BIVA 2YHTA 3G6EA 1V29B 4C0DB 3PIOA 2X4YA 4PJOB 3ZEHA 1M4ZA 2E1HA 5CQXA 2GQVA 3CC7T 1PSEA 1YJ9T 5GAN8 5CK9A 4C8QG 1U1SA 2RHYA 1W4SA 2QQ9A 3HP9A 2MWPA 1UB4A 2PU9B 5LJ5h 2X4XA 3EFRA 3HL8A 1WQWA 2PVOB 2JN0A 3OS1A 2NLUA 3QYHB 4RCCA 4BD3A 3OYMA 2O4XB 2Y4YA 4N0AA 2XI9A 5LJ3e 2CZ6B 2E65A 1OI1A 2DO3A 4HCBA 1S72A 3A8GB 3GOXA 4BDZA 2QTXA 3A8HB 2V8IA 2X4WA 4XU2A 3G6ET 1YCYA 1KD1C 3HRTA 2DTOA 3CCJA 3RKYA 1QP2A 3OYAA 5LJ3d 3PMTA 4J5YA 2QA4A 2GFUA 1JBMA 1WJSA 4MZTA 4JRPA 2K3XA 2HD0A 4N0AC 4J6YA 1BIAA 4XK8E 5GANf 4M7DE 3JCMX 2YRVA 1VQ4T 4E7JA 5CKBA 2ZPEB 3R6OA 4OGEA 2EWNA 5HK0A 1S72T 4M7AB 4B9XA 4HT9A 3M54A 3P8DA 5GAN5 3FB9A 1TH7A 4CI0C 4M7DF 3VYGA 3CCJT 1FXXA 3HRUA 2RHXA 3V7SA 4GLKA 2RHUA 5GAOm 2QA4T 4PKCC 3JCMb 1KQ2A 2LCLA 2XIDA 4JUVA 4FL6A 1X6OA 3L2VA 1RI0A 4DOWA 1M1GA 4NOYA 3CEYA 1I5LA 2CS7A 4VUBA 1UGSB 3V8LA 4BE1A 3OYNA 3M4GA 1YIJA 3JCMc 4C92G 1K73U 2ZPGB 2OTLA 3DKMA 4BI4A 4BUGA 3GPLA 1Y96B 4HCCA 4M78E 3A8LB 3JCMV 1KG1A 2QQAA 4FIBA 3ASKA 3SD4A 4ELYC 5CAIA 4N4GA 4M7AA 4OF1A 5LJ5j 1W2BS 4HT8A 1Y7XA 2GF7A 4M77A 3JB9H 3VKIA 4M78F 1QW1A 2WSFE 2CKKA 4PL6A 2ZPBB 5CKEA 4O5VA 1Q7YU 1G5VA 3KBGA 1YIJT 2O01E 2CYZB 1H641 3OMGA 4XQ3A 5HKCA 5GAMh 4XAXB 1FWZA 3GF5A 3OBYA 5GAN2 4JJNK 2ZGWA 3OBWA 3QJ6A 4A4EA 3M55A 3S6WA 4C92C 2RJDA 4EMKC 1WJRA 4M75C 4ATOA 4M77C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXU A;  5GMK e;  2DJZ A;  4PNO A;  3JCM f;  2FB7 A;  4M78 C;  4PJO G;  2DZC A;  5LJ5 d;  5GAN d;  2DEQ A;  4M7A E;  1KQ2 A;  4PJO D;  5GAN 6;  4V2S A;  3SB2 A;  5I21 A;  3BW1 A;  4M75 G;  4M77 G;  4X9C A;  4QVC A;  4M7A D;  3V7R A;  5LJ3 f;  5GMK l;  3RKX A;  4XU1 A;  3EFS A;  4M78 G;  1U1T A;  5GAM f;  1M8V A;  1B34 A;  5LJ3 j;  2CGH A;  4C92 B;  3JB9 D;  4C8Q E;  2EAY A;  1WNL A;  2RM4 A;  5GAN 7;  4XTY A;  4C8Q D;  4XTW A;  4JLI A;  5GAO n;  1N9R A;  3JB9 F;  4M7D B;  2I2L A;  4A54 A;  4C8Q F;  1M5Q 1;  5GMK h;  2EJF A;  2YLC A;  2K57 A;  4J6X A;  4C8Q A;  5LJ5 e;  5GAN e;  4PJO C;  4M7A C;  4NL2 A;  5GAO l;  5GMK m;  2DXT A;  3L2Z A;  5DY9 A;  3AHU A;  4F7U F;  4F7U A;  4DQ2 A;  4M7A G;  4MML A;  3FIF A;  1Y96 A;  2E64 A;  2VXF A;  3RKW A;  4C8Q C;  3JCM g;  2YHT A;  1I4K 1;  4EMG A;  4PJO B;  2E1H A;  3JB9 G;  4EMK B;  5LJ3 g;  5GAN 8;  5GAN 3;  4M75 B;  3QO3 A;  1U1S A;  4M77 B;  4C8Q G;  3HFO A;  2EJ9 A;  5LJ5 h;  5GAM j;  3JCM e;  3EFR A;  5GAM g;  5GAN h;  1WQW A;  4M78 B;  3JB9 I;  2JN0 A;  1KQ1 A;  2DKG A;  4RCC A;  3V7C A;  4N0A A;  4WF2 A;  2VC8 A;  2E65 A;  3SWN A;  4F7U G;  4F7U E;  2DZ9 A;  5LJ3 e;  3JCM d;  2QTX A;  4XTX A;  4XU2 A;  1YCY A;  3BY7 A;  2DTO A;  1HK9 A;  3RKY A;  1D3B B;  5LJ3 d;  2RB6 A;  4J5Y A;  3JCM J;  1JBM A;  3QHS A;  3FJP A;  5GAM d;  3RER A;  2Y90 A;  3RES A;  4N0A C;  4J6Y A;  3SWN C;  1BIA A;  3HFN A;  3QUI A;  5LJ5 f;  4M77 C;  3JCM X;  5GAN f;  3V8K A;  4M7D E;  3JCM h;  4C92 F;  4XU0 A;  5GAO r;  4M7D D;  4C92 A;  1JRI A;  4EMK A;  4M75 A;  2EWN A;  2RD1 A;  4M7A B;  4HT9 A;  5GAN 5;  3GIB A;  2E10 A;  3QSU A;  3FB9 A;  1TH7 A;  4XTU A;  2E41 A;  2YLB A;  1LNX A;  4M78 A;  5LJ3 h;  4Y91 A;  1LOJ A;  4M7D F;  4X9D A;  5GMK j;  3RIR A;  3V7S A;  4M7D A;  5GAN 4;  3BFM A;  5GAO m;  3JCM b;  3HSB A;  2RA2 A;  4JRI A;  4JUV A;  4C8Q B;  4XTZ A;  4NOY A;  1I81 A;  1LJO A;  1HXD A;  3RUX A;  3JCM Q;  5GAM e;  4XTV A;  1I5L A;  3INZ A;  2VXE A;  3V8L A;  1D3B A;  3JB9 J;  4PJO E;  3BDU A;  4A53 A;  3M4G A;  4C92 E;  3JCM c;  4C92 G;  4M75 E;  5GAO q;  4M77 E;  4M7D C;  2FYK A;  1X01 A;  4F7U B;  4C92 D;  4HA8 A;  4J6W A;  1Y96 B;  2DTI A;  4M77 D;  3PGG A;  4M75 D;  3VU3 C;  4M78 E;  3JCM V;  4EMH A;  4NL3 A;  4PJO F;  4M78 D;  5CAI A;  4M7A F;  4M7D G;  5GMK i;  4PJO A;  4QVD A;  2HNI A;  4M7A A;  4M75 F;  4M77 F;  5LJ5 j;  4HT8 A;  5LJ5 g;  1B34 B;  1WQ7 A;  3L1A A;  3JCM W;  4M77 A;  5GAN g;  3JCM P;  5GAN j;  2EJG A;  2DVE A;  4OP0 A;  3JB9 H;  4M78 F;  1N9S A;  1WPY A;  4XU3 A;  5GAO p;  1BIB A;  4XQ3 A;  1H64 1;  5GAM h;  1MGQ A;  5GAN 2;  3SWN B;  1I8F A;  2ZGW A;  4JRK A;  4MMK A;  4C92 C;  4EMK C;  4M75 C;  3V8J A;  2DTH A;  4RCB A; 
#chains in the Genus database with same CATH topology
 1VQO A;  2CDT A;  5GAN d;  1KQ2 A;  2L89 A;  1MMN A;  2GTO A;  2X4J A;  3PMI A;  3PVL A;  2DMO A;  5GMK l;  4Z89 A;  2COZ A;  1KC8 C;  4C8Q E;  2SRC A;  1VQO T;  1IRE B;  2HSP A;  2RJE A;  4A54 A;  4ZN1 A;  1W1F A;  1I0C A;  2K57 A;  4C5G A;  3EGD B;  1BBZ A;  3PTA A;  2FZG B;  3I35 A;  1KHC A;  3LWH A;  3M0U A;  5FWB A;  2QEX T;  5KYN A;  3M0R A;  2DXB A;  2EFI A;  3EFO A;  8ATC B;  2W10 A;  3QO3 A;  2D1X A;  2DIG A;  2ZCF B;  4ORZ A;  5I2S A;  1KD1 U;  1YJW A;  1VQL Q;  4HXJ A;  2DIQ A;  4WF2 A;  4F7U G;  4XTX A;  5J3B A;  2DK3 A;  1QLY A;  4D6W A;  4C5E A;  2VGN A;  5KE2 A;  1EFN A;  1GFD A;  1OQK A;  1QCN A;  2HMA A;  3L42 A;  2M1H A;  4JJB A;  3QUI A;  1YJW T;  4RTZ A;  1E6G A;  2C0O A;  3OYD A;  2PVG B;  3CPW A;  1I07 A;  2RQR A;  3L2U A;  3E19 A;  1J3T A;  1SRM A;  5IAY A;  4XTZ A;  4BE2 A;  2PZ1 A;  1XJW B;  3A98 A;  3HKS A;  1X01 A;  4J6W A;  3CBO A;  4MZP A;  4M77 D;  4IUU A;  2CZ1 B;  1W2B P;  3M53 A;  1GXI E;  2JOY A;  1PKS A;  4DEY A;  3FLG A;  1VQ5 Q;  4DA4 A;  2L3P A;  2KI7 A;  1BIB A;  2R5M A;  3CXC A;  4KH1 B;  4RUG A;  2DTH A;  1WA7 A;  2DLP A;  5LJ5 d;  4ZGE B;  1WIE A;  2F5K A;  4HCZ A;  1KC8 U;  1TUG B;  2FHD A;  1OZ2 A;  4RMO A;  1TOV A;  1KFZ A;  5GAM f;  4JDS A;  3JB9 D;  4XTY A;  3REB B;  5HCK A;  3OSV A;  2K5I A;  3FRN A;  4KUD K;  2YLC A;  5GAN e;  4E7I A;  2E6Z A;  3LH0 A;  1GBR A;  3S3M A;  2FVU A;  1NLO C;  3CC2 Q;  4RTT A;  2CP7 A;  3I55 Q;  1I4K 1;  4DBH A;  1YWP A;  2RN8 A;  1WYX A;  3H6Z A;  5GAN 3;  3M0Q A;  2WSE E;  4RKU E;  3CMA A;  2DRM A;  4OMP A;  4A4G A;  3G4S A;  2YUQ A;  1NJI C;  3JCM d;  3NPF A;  3OYB A;  2LQ8 A;  3KXT A;  2NYS A;  2V1R A;  2RB6 A;  1YN8 A;  1KQS P;  3CMA T;  2LNH B;  1SPK A;  1Q81 R;  2Y90 A;  2LX7 A;  1AWX A;  3G4S T;  2CSI A;  2EYX A;  1WGS A;  2K6D A;  4OGC A;  2E41 A;  5FWC A;  1VQL A;  2D0Q B;  3ZBD A;  4KGZ B;  3DLL A;  2FO0 A;  3MPU B;  2QAS A;  1UFF A;  1NM7 A;  2RHI A;  4X1V A;  2ZPI B;  4PFP A;  1QMC A;  5DM7 R;  3VU3 C;  1VQL T;  5IHK A;  3LW5 E;  5CIU A;  5GMK i;  4QVD A;  4HCK A;  4M75 F;  2KRO A;  3WVD B;  2QK0 A;  1R8O B;  1BKB A;  1M1K U;  2JM9 A;  4BY6 C;  4XU3 A;  1W2B A;  3TRE A;  2FEI A;  2K4Y A;  2RJF A;  3NTK A;  1AZG B;  3JRZ A;  3I5S A;  2RH2 A;  1C1A A;  4PNO A;  4J9E A;  1G8X A;  2QGG A;  3R6N A;  1PRL C;  3HHT B;  4OMM A;  1U1T A;  2L0A A;  1AD5 A;  3PIP A;  2RM4 A;  1IGQ A;  3JAM E;  2JMC A;  2LCC A;  2I2L A;  1VYU A;  5IHN A;  3REA B;  1X2Q A;  3OYJ A;  1JB0 E;  1KHI A;  5LJ5 e;  1VQ4 Q;  3OS2 A;  2QQB A;  2P0K A;  2JNG A;  2PUO B;  4M7A G;  3FIF A;  1YNZ A;  3ZFJ A;  2QA4 Q;  1UGV A;  3OYF A;  4GLM A;  2HAX A;  2O9S A;  4FCY A;  2YUO A;  7AT1 B;  3JV3 A;  1UGR B;  3GNG A;  5GAM g;  1D0Y A;  5FU7 C;  2KVQ G;  5GAN h;  1NJI U;  1IB8 A;  1JU5 C;  1WHG A;  1NJI R;  3UT1 A;  4MDW A;  3CPW S;  4KRT A;  2LDM A;  2P4R A;  4J9F A;  2VWF A;  1KQS A;  4XTU A;  1PCX A;  3X26 B;  2DYB A;  3HSB A;  2FPE A;  3M58 A;  3M0P A;  3C12 A;  3RUX A;  1HXD A;  2KGT A;  4LNP A;  3INZ A;  1RAF B;  3U23 A;  4MDX A;  2LVM A;  4PJN A;  4Y92 A;  3CCS Q;  4HA8 A;  2XHC A;  2AHJ B;  1K73 C;  4M7D G;  1SSF A;  3CXC S;  1RI9 A;  3WXM B;  2KNB B;  2E6N A;  3QXE B;  3MP6 A;  3LGL A;  3N5B B;  2YRC A;  3SWN B;  1JEG A;  5A0L A;  4E2F B;  3H8Z A;  2M0Y A;  4M7A E;  1PSF A;  1VQ8 A;  2XG8 D;  3BW1 A;  4X9C A;  2EIF A;  2KR3 A;  2P0P A;  1D0X A;  2L8D A;  4M78 G;  2M9U A;  2OJ2 A;  2MYS A;  2EAY A;  4XTW A;  1VQM A;  1HJD A;  2IVW A;  2WAC A;  3CCU Q;  2FZC B;  2H3J A;  1YJ9 A;  3I9Q A;  3J80 E;  3H41 A;  5GAO l;  3CC7 Q;  2LC4 A;  3AHU A;  3TCJ A;  2W0Z A;  1GL5 A;  1MNE A;  4C0Z A;  1MV0 B;  1OX8 A;  2BIV A;  3RNJ A;  3G6E A;  1V29 B;  4PJO B;  1M4Z A;  1PSE A;  1YJ9 T;  5LJ5 h;  2FPF A;  2OX7 A;  2PVO B;  2JN0 A;  3QYH B;  4LUD A;  2O4X B;  3H0H A;  4N0A A;  2CZ6 B;  4LXC A;  3G6E T;  1UTI A;  1YCY A;  2BE9 B;  1YI2 Q;  2AZV A;  4F04 B;  1NEG A;  4J5Y A;  2QA4 A;  2GFU A;  2CP6 A;  3VS3 A;  2HD0 A;  4XK8 E;  1PM3 A;  4M7D E;  3EG2 A;  1VQ4 T;  2YWW A;  1HD3 A;  5CKB A;  4E7J A;  2RQU A;  2EWN A;  3P8D A;  4ANJ A;  5GJW B;  2O88 A;  2RHX A;  4GLK A;  2QA4 T;  1ZA2 B;  2XID A;  2LJ3 A;  2DL4 A;  4JUV A;  4AG2 C;  1RI0 A;  1M1G A;  1I5L A;  4VUB A;  3OYN A;  1K73 U;  2OTL A;  4M78 E;  3JCM V;  1M3C A;  2K3B A;  1SSH A;  4M7A A;  3EGU A;  1W2B S;  1RAH B;  1CKA A;  1QW1 A;  2WSF E;  2ZPB B;  4O5V A;  2ATC B;  1YWO A;  4XQ3 A;  2BE7 D;  4XAX B;  1FWZ A;  3OBY A;  4HVU A;  4A4E A;  4OML A;  2RJD A;  4ATO A;  4M77 C;  3CCS A;  2DJZ A;  3MET A;  3SHW A;  3VS6 A;  2DAQ A;  1I5O B;  1TSF A;  2DL7 A;  2MAM A;  2XDP A;  5I21 A;  2EVR A;  3F70 A;  3NMZ C;  1Y71 A;  3NGP A;  3OS5 A;  1P92 A;  3M57 A;  5CKF A;  4JLI A;  3CCS T;  2A37 A;  3QKJ A;  2XD0 A;  2KY9 A;  1T3S A;  2VV5 A;  2GFA A;  2V8J A;  1N8R C;  1GRI A;  1Q7Y C;  3ULR B;  3VV0 A;  4FYY B;  3FJ5 A;  3TU4 K;  1ZBX A;  4JPB W;  4PFO A;  2YUN A;  3FDR A;  1Q82 U;  2CH4 A;  4Y28 E;  5AT1 B;  5LL6 S;  3CCU A;  4AMC A;  3X25 B;  2DKG A;  4BE0 A;  2BKD N;  3SWN A;  3G7Z A;  1TU0 B;  2MOX A;  1BI2 A;  4CC3 A;  3JCM J;  1M2O A;  2KYM A;  3CCU T;  1ABQ A;  1KQS S;  5GAO r;  8AT1 B;  2L3R A;  3E9G A;  4J7I A;  4M78 A;  3OYK A;  4X9D A;  3VRY A;  1MMA A;  2EQU A;  4BI3 A;  1ZUK A;  4C8Q B;  1U8R A;  1YI2 A;  1K9M U;  5IXB A;  4L6V 5;  5GAO q;  3CCL Q;  1X43 A;  2FG0 A;  3ER0 A;  2EYW A;  4J9D A;  1YHQ A;  2EQI A;  2HQH A;  3OA6 A;  5KYY A;  4PJO A;  1GCP A;  2HKN A;  4E7H A;  2CZ0 B;  1YI2 T;  2VKN A;  1WPY A;  4KGV B;  1M9S A;  2DA9 A;  2O4X A;  1YHQ T;  1I8F A;  2PVD B;  3VS1 A;  1M3A A;  4IIO A;  3RMS A;  1VQN Q;  2AZS A;  1OZ3 A;  2M16 A;  3URG A;  2EGE A;  1G3T A;  1B3Q A;  2DEQ A;  5CO7 A;  3RMQ A;  1PWT A;  4M75 G;  4F14 A;  1VQP A;  1OPL A;  1B34 A;  1G2B A;  1NLP C;  4C92 B;  1SEM A;  2FPD A;  3P8H A;  3OYE A;  3CC4 A;  3OYC A;  2ZZD A;  3CCQ Q;  5D7U A;  3LH5 A;  1N8R U;  2RK1 A;  1QVP A;  2ED0 A;  1Q95 G;  3KFV A;  2ZPH B;  1VQP T;  4EIK A;  1TUD A;  2DXT A;  3CC4 T;  2FRW A;  1Q7Y R;  5L23 A;  1UGP B;  2VXF A;  3E1S A;  3Q1J A;  2MWO A;  1JXO A;  1GFC A;  2KRN A;  1IO6 A;  3CMA Q;  1XNI A;  3NTI A;  3V7C A;  4OVA A;  1K76 A;  2EW3 A;  3G4S Q;  2K7A A;  3G71 Q;  3KUF A;  4KBM B;  5KCO A;  4P5N A;  1N27 A;  1LVK A;  4TVR A;  1T0J A;  3CCR Q;  5GAM d;  5KH6 A;  4LD9 K;  1QVG P;  2EGC A;  3X24 B;  3QPH A;  2JS0 A;  3HRS A;  1BCO A;  2YLB A;  2EQK A;  1YFN A;  2JVV A;  3RIR A;  4QW2 A;  1BU1 A;  2DM1 A;  5GAN 4;  3OYL A;  3EHQ A;  2B8A A;  2DD5 A;  2IIM A;  2DNU A;  1BK2 A;  3LLR A;  3JCM Q;  4XTV A;  4LD6 A;  4C92 E;  2KT8 A;  2DYI A;  4M75 E;  4L5G A;  2FYK A;  4F7U B;  1KD1 R;  1AOJ A;  2K2M A;  4J7F A;  4JRQ A;  1W6X A;  2H3E B;  3QBY A;  4M77 F;  3JCM P;  4FM4 B;  3X20 B;  5L8R E;  3OSS C;  1Q86 U;  1ZSZ B;  2XKO C;  1MGQ A;  2M0O A;  1BI1 A;  1SG5 A;  4QT7 A;  2K5L A;  5ECA A;  3UWN A;  3V8J A;  3CCL A;  1E7O A;  4L59 A;  3VUB A;  3OY9 A;  4BAC A;  1QQJ A;  1X6G A;  5GAN 7;  1WNL A;  2J7I A;  3CCL T;  3OW2 P;  4PLL A;  3JB9 F;  4O6J A;  5GJV B;  1M1K C;  4C8Q A;  2KDS A;  4J6X A;  3TQ7 P;  1VQN A;  2A7Y A;  1KJW A;  3O5Z A;  1QVF P;  3OQ5 A;  2ESW A;  4D8K A;  1ZLM A;  3CCJ Q;  2JM8 A;  5A0G A;  2E64 A;  5A2Q E;  1XQH A;  2YSQ A;  1RAB B;  2RNA A;  2DIL A;  1VQN T;  3CCQ A;  1K0X A;  2RMO A;  1KC8 R;  2EJ9 A;  1V76 A;  1MND A;  2K9G A;  1FYN A;  2VC8 A;  4F7U E;  4HVW A;  3VYH B;  1IZ6 A;  4EPC A;  1HK9 A;  3CCQ T;  1NE8 A;  1YIJ Q;  3RER A;  5AYF A;  3OB9 A;  3RES A;  3SDZ A;  3HFN A;  4LDW A;  2J6F A;  2DBM A;  4GBQ A;  4C92 A;  4EMK A;  4M75 A;  4RTX A;  1AEY A;  2J6O A;  3VJP A;  2EQM A;  2VB6 A;  2AKK A;  1QVG A;  2F5T X;  3BFM A;  3G71 A;  2RA2 A;  2MK5 A;  1YJN A;  4CC2 A;  2HSE B;  2R58 A;  5GAM e;  1R0B G;  2V1Q A;  3CCR A;  2CSQ A;  2EQJ A;  3AT1 B;  4E7L A;  3TEE A;  1VYV A;  2E4H A;  3G71 T;  3TSW A;  5GAN j;  1UUE A;  2KMT A;  1EZZ B;  3CCR T;  3CBM A;  1UDL A;  5FRN A;  4IIM A;  4MMK A;  2C06 A;  1AT1 B;  2CUD A;  2KQW A;  3BDL A;  3MJX A;  2DZC A;  2MF2 A;  1VQ8 Q;  5LJ3 f;  2EYZ A;  1OU9 A;  2BTT A;  3CCE Q;  2X3W D;  1YP5 A;  4K11 A;  1D09 B;  4C8Q D;  5I22 A;  1Y07 A;  1KSW A;  3QJY A;  1ABO A;  1VQM Q;  1NYF A;  3QYG B;  2ROT A;  3QWX X;  3UF4 A;  1M1K R;  2EBP A;  3VS5 A;  5GMK m;  3OW2 A;  2LT4 A;  1YJ9 Q;  2SEM A;  2V8K A;  4F7U A;  2QDY B;  4Z88 A;  4C0D B;  2X4Y A;  5CQX A;  3M0T A;  2GQV A;  3G6E Q;  1W4S A;  2QQ9 A;  1ZSZ A;  1WQW A;  4J9I A;  4BD3 A;  2J05 A;  5LJ3 e;  4HCB A;  1WHM A;  4BDZ A;  2FZK B;  3CCJ A;  3OYA A;  3PMT A;  4JRP A;  4N0A C;  1BIA A;  1K4U S;  3JCM X;  2ZPE B;  4OGE A;  5HK0 A;  4M7A B;  4HT9 A;  1WHJ A;  1UE9 A;  1TH7 A;  4JJC A;  3VYG A;  3CCJ T;  4RTW A;  2RHU A;  4OMN A;  2A0F B;  3CEY A;  2MPX C;  2CT4 A;  3M4G A;  1YIJ A;  3JCM c;  2ZPG B;  1Y57 A;  4BI4 A;  2OTL Q;  2QQA A;  4FIB A;  1QKW A;  4OF1 A;  5LJ5 j;  2GGR A;  3VKI A;  2CKK A;  2DBK A;  1G5V A;  1YIJ T;  2O01 E;  5GAM h;  9ATC B;  3QJ6 A;  1D1B A;  1WJR A;  1NEB A;  4LDX A;  1OUL A;  3NHN A;  4DEX A;  5KYX B;  2KSS A;  1Y0M A;  4V2S A;  2F2W A;  3NFC A;  3QG1 A;  4Z8A A;  4ZGD B;  4QVC A;  1IHW A;  4RTY A;  4JZ3 A;  2D6F A;  2RQT A;  3CBP A;  1H3H A;  1OX9 A;  3P8B B;  4AFU C;  4WTO B;  2CGH A;  2JS2 A;  1TWB A;  1ARK A;  2P84 A;  2VGM A;  2X3X D;  2HL3 A;  4M7D B;  1M90 C;  4FYV B;  2RO0 A;  3CQT A;  2LMJ A;  4CRI A;  2BUD A;  2E3I A;  5KYU B;  2COW A;  1JQQ A;  1M2V B;  3MEA A;  1CKB A;  3SEM A;  2VVK A;  2CH4 W;  1IRX A;  3CCE A;  3M56 A;  1XOV A;  2JTE A;  1MMD A;  5LJ3 g;  1OOT A;  4DOV A;  4M78 B;  3OYH A;  4GY5 A;  1VQ8 T;  1WXU A;  3J7A F;  4EDU A;  3CCE T;  1SHF A;  1NYG A;  2BZ8 A;  4PFZ A;  1VQ7 A;  3L2Q A;  2GCX A;  1VQM T;  1Z9Z A;  3SWN C;  4N4H A;  1K1Z A;  3EGX B;  1VQK Q;  5KYY B;  2JTM A;  2RD1 A;  1PD0 A;  1QVG S;  5CKD A;  3GIB A;  5LJ3 h;  3QZ9 B;  3UAT A;  4JJD A;  1D1C A;  1OU8 A;  4KGX B;  1Q82 C;  2WSC E;  1LJO A;  2D8H A;  2AIR B;  1D3B A;  3BDU A;  4A53 A;  2JTF A;  2LX9 A;  1X6B A;  4KT0 E;  3I56 Q;  1IHV A;  1YHQ Q;  4RG2 A;  2E3H A;  3QWY A;  2NUZ A;  1B34 B;  4RG8 A;  5FU6 C;  4LDU A;  2DVE A;  4QQ6 A;  1N9S A;  1NZ9 A;  1OV3 A;  5EC7 A;  1H8K A;  2X9H A;  2XK0 A;  4QVZ A;  5HY6 A;  2RHZ A;  2QAZ A;  5GMK e;  1U3O A;  4M77 G;  1K9M C;  3HPW A;  1VQP Q;  4ELZ C;  1M90 U;  1BB9 A;  3EAE A;  3QZ5 B;  1SF9 A;  3GLX A;  4NS5 A;  1K73 R;  1UG1 A;  5FRM A;  1AZE A;  3CC4 Q;  1LCK A;  3OW2 S;  3PNW C;  2OTL T;  3C4S A;  2HQE A;  2YUP A;  3PT9 A;  1IGU A;  1A0N B;  1JO8 A;  1QVF S;  1OPK A;  3MEV A;  4A4K A;  3ZL7 C;  2OAW A;  3LWI A;  2Z0W A;  3M9Q A;  4B9W A;  3JB9 G;  1PG5 B;  1UEB A;  2KYB A;  2MMP A;  2YDL A;  2D8J A;  1K8A U;  2DXC A;  1QCO A;  3CD6 Q;  4J83 A;  1VQ9 Q;  2CZ7 B;  5KYX A;  1G3S A;  2KRM A;  4CC7 A;  3OS0 A;  3J81 E;  1PKT A;  4J8O A;  3L2W A;  4AFS C;  3ME9 A;  3OYI A;  4ZTJ A;  2VYT A;  2XU8 A;  2O2O A;  1R0C B;  2O31 A;  1VOM A;  4ZNX A;  4E7Z A;  1YIT Q;  4M7D A;  2X51 A;  1QWF A;  4KUL A;  4WCI A;  2DL5 A;  2HL5 C;  1QWE A;  2LZ6 B;  2DE0 X;  4FYW B;  1Q82 R;  5KYU A;  1M2V A;  1X75 C;  3LGF A;  3OYY A;  4IUP A;  4M77 E;  4YTL A;  1VQK A;  1RAE B;  4M7A F;  1RAI B;  4KH0 B;  2BZY A;  3JSC A;  1RUW A;  5GAO p;  1ACM B;  5CR2 A;  1VQK T;  2HDA A;  2LRQ A;  4JRK A;  3VS0 A;  1MHN A;  3THK A;  1ZUU A;  1SHG A;  2DXU A;  4FT4 A;  2FB7 A;  3I56 A;  2QDL A;  4M7A D;  2MI6 A;  4BDY A;  1QP3 A;  3EGX A;  2AKL A;  3RKX A;  3EFS A;  3GBQ A;  1K9M R;  2CP2 A;  3A8O B;  2HBP A;  3VS4 A;  1WI7 A;  3S3N A;  1MV3 A;  2XMF A;  5J26 A;  4QKU A;  4DBQ A;  1X2K A;  3I56 T;  3PE0 A;  5GMK h;  2FL7 A;  3FEO A;  1Q86 C;  5DLQ E;  1M30 A;  3L2Z A;  3UA7 A;  1UJ0 A;  4A4H A;  2DEU A;  3CCM A;  1Z9Q A;  3RKW A;  4C8Q C;  4JS4 A;  1VUB A;  1UGQ B;  4EMK B;  4M75 B;  4MZM A;  4RTV A;  4R0K A;  4IUT A;  5C0M A;  1E6H A;  4IUV A;  3CCM T;  3EG0 A;  2IPO B;  3C0C A;  1M1F A;  2RJC A;  4BI8 B;  5D6Y A;  1N8R R;  2KXD A;  2QTV A;  3I5R A;  4LUE A;  1KK7 A;  2DX1 A;  3UA6 A;  1TUC A;  4PJL A;  2ROL A;  3V8K A;  1AHJ B;  1UJY A;  4XU0 A;  4M7D D;  1NG2 A;  2CUB A;  3QSU A;  1BI0 A;  1VYT A;  1WJQ A;  1VA7 A;  2QYZ A;  3LX7 A;  2K79 A;  3MO8 A;  3EHR A;  3CD6 A;  1VQ9 A;  3SFM A;  2G6F X;  1YJN Q;  1FX7 A;  2VXE A;  4FT2 A;  2VAS A;  1B07 A;  3CCV A;  1FMW A;  2YRD A;  2QG9 B;  2JZ2 A;  4D8D A;  4EMH A;  3PGG A;  2F2X A;  4PJO F;  4M78 D;  5EG2 A;  4PJJ A;  2HNI A;  1WXT A;  3CD6 T;  1VQ9 T;  3JCM W;  4N4I A;  4ZGJ B;  1YIT A;  2L3Q A;  2QEX A;  3CCV T;  5KYW B;  2EYQ A;  2GNC A;  4A63 B;  2RF0 A;  2COY A;  4R55 A;  1F1B B;  4PJO D;  1YIT T;  3V7R A;  1R77 A;  2NUP B;  3OMC A;  1M8V A;  2OTJ Q;  2DRK A;  3M5A A;  4C0G A;  2J06 A;  1VIE A;  2L5Q A;  1JJ2 P;  2KEA A;  1Q81 C;  2R5A A;  5DY9 A;  1OYX A;  1Q86 R;  2Y4X A;  2MIO A;  1ZUY A;  4E6R A;  2DPP B;  2YHT A;  3PIO A;  4AG1 C;  2A08 A;  3ZEH A;  5GAN 8;  5CK9 A;  2PU9 B;  1S1N A;  3EFR A;  2F2V A;  1C6V X;  2ECZ A;  2X4X A;  3OS1 A;  4RCC A;  3OYM A;  2Y4Y A;  2XI9 A;  1HSQ A;  2E65 A;  2DO3 A;  1D1A A;  2JJ9 A;  3VRZ A;  3A8G B;  3GOX A;  2QTX A;  2X4W A;  4XU2 A;  1QP2 A;  1ZSZ C;  5LJ3 d;  1QKX A;  4MZT A;  1WJS A;  1JBM A;  1PRM C;  4CC4 B;  4J6Y A;  5GAN f;  4OMQ A;  2JMA A;  1RLP C;  1ZSG A;  1AWO A;  1OEB A;  4B9X A;  1WXB A;  3M54 A;  3FB9 A;  4CI0 C;  3EG3 A;  1MMG A;  3HRU A;  3V7S A;  1X27 A;  1T0H A;  2DL3 A;  2OI3 A;  4PKC C;  3JCM b;  2LCL A;  2HZY A;  4FL6 A;  4DOW A;  4NOY A;  2CS7 A;  3V8L A;  2LP5 A;  1GCQ A;  4BUG A;  3GPL A;  2I0N A;  1Y96 B;  3H9N A;  1KIK A;  4HCC A;  3A8L B;  2DER A;  1KG1 A;  2CT3 A;  2DJQ A;  3ASK A;  4HVV A;  4ELY C;  4DBF A;  5CAI A;  4ESR A;  2ED1 A;  3E2U A;  1K9A A;  1Y7X A;  1YCS B;  2AK5 A;  2GF7 A;  6AT1 B;  2KE9 A;  5CKE A;  4PL6 A;  5HKC A;  2CYZ B;  1H64 1;  1WZO A;  1C0M A;  2YXY A;  4PK4 A;  3GF5 A;  5GAN 2;  2ZGW A;  2DET A;  1YBY A;  2PTK A;  4JZ4 A;  1ZHI A;  4C5I A;  4PLI A;  5GAN 6;  2D0N A;  1BCM A;  2DD4 A;  1G3Y A;  2RQW A;  2KAF A;  2V26 A;  2LT1 A;  1YJN T;  1PD1 A;  3LYI A;  2KBT A;  3O8V A;  3UPU A;  1PC0 A;  3CPF A;  1Q81 U;  4C8Q F;  1IXD A;  1UHC A;  3GNF B;  3MP1 A;  1QCF A;  2R57 A;  4BY6 B;  4DQ2 A;  5I11 A;  3NTH A;  1JJ2 A;  2PUK B;  2K5F A;  4ZN3 A;  2OTJ A;  4FW1 A;  4LDV A;  4EMG A;  1UHF A;  1WHH A;  5IHI A;  1TS9 A;  2LJ1 A;  2E5K A;  5GAM j;  4C5H A;  1KQ1 A;  5KYW A;  2B86 A;  4E7S A;  3EGD A;  2KT1 A;  1TTH B;  2DZ9 A;  2E70 A;  3FC3 A;  2CRE A;  2OTJ T;  3MKD A;  5HK3 A;  3BY7 A;  3X28 B;  4BB7 A;  2P0Q A;  2MCN A;  1EX4 A;  1D3B B;  5FLX E;  3C94 A;  3FJP A;  1VQ7 Q;  4A4F A;  2GTJ A;  5LJ5 f;  2NUP A;  1JXM A;  3DB3 A;  4C0F A;  1QVF A;  4C92 F;  4AFZ C;  4KUI A;  3TSZ A;  1EIF A;  3A5Z B;  2XDB A;  2RI2 A;  3H0I A;  1LNX A;  1RL2 A;  1U06 A;  1AWW A;  4FYX B;  2EYY A;  3PFS A;  2KXC A;  1I81 A;  2LQK A;  2JW4 A;  2HQX A;  4C92 D;  5FU7 B;  2EGA A;  4M75 D;  1ZQ1 A;  4LE9 A;  4NL3 A;  1BYM A;  2A3L A;  2D9T A;  1VQ5 A;  5GAN g;  4OB1 B;  3VS7 A;  2JUF A;  1WHK A;  4C0D C;  2XDD A;  2F69 A;  2EPD A;  3D7S B;  1O9S A;  1VQ5 T;  1AWJ A;  2QQR A;  3RDV A;  3JCM f;  2NUT B;  4B6M A;  2CP0 A;  5IT9 E;  4QQD A;  5CCA A;  5LJ3 j;  1WHL A;  3CME Q;  2RK2 A;  2JXB A;  1W70 A;  2EJF A;  1H3Z A;  4M7A C;  1RAD B;  3CC2 A;  4DBR A;  4JLG A;  1G3W A;  3I55 A;  3E9F A;  4F7U F;  2XIC A;  1Y96 A;  3VUZ A;  1XTD A;  1VIF A;  2DFU A;  5D6W A;  4E7K A;  3EH1 A;  1VQ6 Q;  4J9C A;  1CSK A;  3HFO A;  5I2M A;  3M0S A;  2QGF B;  3CC2 T;  3JCM e;  2LNV A;  3I55 T;  2ABL A;  3QDR B;  2G3R A;  2KK4 A;  1N6A A;  4E47 A;  3C95 A;  1N5Z A;  2LQW A;  2M02 A;  2HKQ B;  1JRI A;  2E10 A;  2F1L A;  2L2P A;  1LOJ A;  1I1J A;  1T3L A;  3MEW A;  3UDC A;  3DB4 A;  2RI5 A;  3JB9 J;  2OAU A;  1K8A C;  4M7D C;  2GBQ A;  2HCK A;  3IQL A;  1ZA1 B;  1NPR A;  1V1C A;  2DTI A;  5KCH A;  4LDY A;  3QDF A;  4F17 A;  2RI3 A;  2IG0 A;  3GP8 A;  3MEU A;  2O9V A;  4R56 A;  1O75 A;  4OB0 B;  1WQ7 A;  5LJ5 g;  4UC4 A;  3G1J A;  4OP0 A;  2QXF A;  3OYG A;  5M9O A;  1VQ7 T;  5A0D A;  2ENM A;  1FMV A;  4LN2 A;  1TG0 A;  3EG9 B;  1U5S A;  5FU6 B;  4FU6 A;  4HKE A;  4M78 C;  4PJO G;  3SB2 A;  2DF6 A;  4FSX A;  3S3O A;  2A36 A;  2BZX A;  2QI2 A;  5C6S A;  4ZTF A;  1K0S A;  2C0T A;  1VQ4 A;  2P4T A;  1PHT A;  3H0F A;  4PJO C;  5CQY A;  1S72 Q;  1JJ2 S;  1RLQ C;  5CVI A;  4AT1 B;  4MML A;  3EH2 A;  2E12 A;  3T9N A;  2YT6 A;  3JCM g;  1NPP A;  2GQI A;  5D6X A;  3CCM Q;  1WFW A;  1G83 A;  2VUB A;  3CME A;  1WX6 A;  2LQN A;  1BI3 A;  4M77 B;  4J9B A;  1M8M A;  3JB9 I;  5IH2 A;  2CP5 A;  2ZPF B;  4IUR A;  4J9H A;  1M90 R;  1HYO A;  4J9G A;  4OMF B;  2A28 A;  3CME T;  1SKU B;  3A1P A;  2NUT A;  1RAC B;  2L3S A;  3QHS A;  3JCM h;  5IXF A;  5CKH A;  2EKO A;  1VQ6 A;  2PQW A;  2J6K A;  2X35 A;  4Y91 A;  1RAA B;  5GMK j;  1WDX A;  4X34 A;  2LCS A;  4RTU A;  4JRI A;  1RAG B;  3A8M B;  4PJO E;  1VQ6 T;  2RPN A;  3M59 A;  1LPL A;  1VQO Q;  4OB3 B;  1ZX6 A;  3CCV Q;  1K8A R;  5J39 A;  2HEQ A;  2E5Q A;  4JS5 A;  3DLM A;  5IN1 A;  4F16 A;  4QQG A;  3L1A A;  3EFO B;  2EJG A;  2AT1 B;  2M51 A;  4M4Z A;  2QEX Q;  4AFQ C;  2K2V A;  3TVT A;  4OMO A;  2LTO A;  4FW2 A;  4RCB A;  4II1 A;  1DJ7 B;  4Z02 A;  3WVE B;  2QQS A;  1X69 A;  2LJ0 A;  4ME7 A;  3BE3 A;  5FRO A;  3MCA B;  4XU1 A;  5DLO A;  3MP8 A;  3L2R A;  4Q5W A;  1UEC A;  4OB2 B;  3EG1 A;  3QII A;  5GAO n;  2K3Y A;  1N9R A;  4IKF A;  3RR6 A;  2ZAE A;  5KE3 A;  1M5Q 1;  4IUQ A;  1YJW Q;  3CC7 A;  3M4Y A;  3MHX A;  4NL2 A;  3RBB B;  4FSS A;  2H8H A;  3HTR A;  4PJM A;  1B7T A;  2NWM A;  2E1H A;  3CC7 T;  5FW9 A;  4C8Q G;  1U1S A;  2FRY A;  2RHY A;  3HP9 A;  2MWP A;  1UB4 A;  2DVJ A;  2C0I A;  3HL8 A;  2RQV A;  2NLU A;  1OI1 A;  1S72 A;  3EG9 A;  3A8H B;  2V8I A;  1KD1 C;  1FMK A;  2CP3 A;  3HRT A;  2DTO A;  3RKY A;  3CPW P;  2DL8 A;  2K3X A;  1GBQ A;  2YRV A;  1PNJ A;  1ZBJ A;  3R6O A;  1S72 T;  1H92 A;  5GAN 5;  3VS2 A;  4M7D F;  1FXX A;  1M3B A;  2JT4 A;  5GAO m;  1MUZ A;  1X6O A;  3L2V A;  2KRS A;  1SRL A;  1UGS B;  4BE1 A;  1D0Z A;  4C92 G;  3DKM A;  2PNI A;  1AVZ C;  2HBW A;  3SD4 A;  1NBE B;  4N4G A;  3CXC P;  4HT8 A;  4M77 A;  3JB9 H;  4M78 F;  1GCQ C;  1WLP B;  1TXQ A;  1Q7Y U;  3KBG A;  3OMG A;  1M27 C;  4JJN K;  2EKH A;  3OBW A;  3M55 A;  3S6W A;  4C92 C;  4EMK C;  4M75 C;  3PVQ A; 
#chains in the Genus database with same CATH homology
 1YBY A;  1VQO A;  3CCS A;  2DJZ A;  3MET A;  1ZHI A;  4C5I A;  2KSS A;  5GAN d;  2DAQ A;  4PLI A;  2L89 A;  5GAN 6;  2MAM A;  2XDP A;  3NFC A;  3QG1 A;  4ZGD B;  4QVC A;  2X4J A;  5I21 A;  3PMI A;  3F70 A;  2DD4 A;  5GMK l;  2D6F A;  1G3Y A;  3CBP A;  1KC8 C;  3P8B B;  2KAF A;  1Y71 A;  2CGH A;  2LT1 A;  4C8Q E;  1YJN T;  3OS5 A;  1P92 A;  3LYI A;  3M57 A;  3O8V A;  5CKF A;  1YHQ A;  2VGM A;  1VQO T;  4JLI A;  1IRE B;  3CCS T;  3UPU A;  3CPF A;  3QKJ A;  4M7D B;  2RJE A;  1M90 C;  4A54 A;  4ZN1 A;  2XD0 A;  1Q81 U;  4C8Q F;  2KY9 A;  2VV5 A;  2GFA A;  2K57 A;  4C5G A;  2RO0 A;  2V8J A;  4CRI A;  1N8R C;  3GNF B;  3PTA A;  1Q7Y C;  2BUD A;  3MP1 A;  3VV0 A;  2R57 A;  3MEA A;  4BY6 B;  4DQ2 A;  1KHC A;  3NTH A;  3LWH A;  1JJ2 A;  2PUK B;  2K5F A;  4ZN3 A;  3CCE A;  2QEX T;  2OTJ A;  4LDV A;  3M56 A;  4EMG A;  3TU4 K;  1ZBX A;  2DXB A;  2EFI A;  1XOV A;  5LJ3 g;  3FDR A;  3QO3 A;  1Q82 U;  4Y28 E;  5GAM j;  2DIG A;  5LL6 S;  4DOV A;  3CCU A;  2ZCF B;  4M78 B;  4C5H A;  3X25 B;  5I2S A;  3OYH A;  1YJW A;  1KD1 U;  1KQ1 A;  2DKG A;  4GY5 A;  2DIQ A;  4BE0 A;  1VQ8 T;  2BKD N;  3J7A F;  4WF2 A;  3SWN A;  3G7Z A;  4F7U G;  4EDU A;  2DZ9 A;  3CCE T;  2E70 A;  4XTX A;  3FC3 A;  2OTJ T;  5J3B A;  2DK3 A;  5HK3 A;  3BY7 A;  3X28 B;  4D6W A;  4BB7 A;  2P0Q A;  1BI2 A;  4C5E A;  1VQ7 A;  2VGN A;  5KE2 A;  1D3B B;  5FLX E;  3L2Q A;  3JCM J;  3L42 A;  2M1H A;  3C94 A;  2GCX A;  3FJP A;  4A4F A;  1VQM T;  3CCU T;  3SWN C;  5LJ5 f;  4N4H A;  1KQS S;  3QUI A;  1YJW T;  4C0F A;  3DB3 A;  1QVF A;  4C92 F;  5GAO r;  4KUI A;  3OYD A;  2PVG B;  2JTM A;  3CPW A;  2RD1 A;  1EIF A;  3A5Z B;  1QVG S;  5CKD A;  2XDB A;  3GIB A;  2L3R A;  2RI2 A;  5LJ3 h;  3QZ9 B;  1LNX A;  3E9G A;  4J7I A;  4M78 A;  3OYK A;  1RL2 A;  4X9D A;  3L2U A;  3E19 A;  2EQU A;  3PFS A;  4BI3 A;  5IAY A;  1Q82 C;  4C8Q B;  1U8R A;  2WSC E;  4XTZ A;  4BE2 A;  1I81 A;  1LJO A;  1YI2 A;  1K9M U;  1D3B A;  2LQK A;  3HKS A;  3BDU A;  4A53 A;  4L6V 5;  5GAO q;  1X01 A;  2HQX A;  3ER0 A;  2JTF A;  5FU7 B;  4J6W A;  4M75 D;  3CBO A;  2LX9 A;  4KT0 E;  4M77 D;  1ZQ1 A;  4IUU A;  4MZP A;  4NL3 A;  2CZ1 B;  2A3L A;  2D9T A;  3M53 A;  3OA6 A;  1BYM A;  4RG2 A;  1GXI E;  1VQ5 A;  2JOY A;  4PJO A;  3FLG A;  4E7H A;  1B34 B;  2CZ0 B;  4RG8 A;  4C92 D;  5GAN g;  1YI2 T;  5FU6 C;  4LDU A;  2DVE A;  4OB1 B;  4DA4 A;  4QQ6 A;  1N9S A;  1WPY A;  1NZ9 A;  1M9S A;  2JUF A;  1BIB A;  2R5M A;  2O4X A;  3CXC A;  4C0D C;  1YHQ T;  2XDD A;  2F69 A;  1I8F A;  2XK0 A;  4QVZ A;  2PVD B;  3RMS A;  5HY6 A;  1O9S A;  2RHZ A;  2M16 A;  2DTH A;  1OZ3 A;  3URG A;  1VQ5 T;  5GMK e;  2QQR A;  3JCM f;  5LJ5 d;  4ZGE B;  2F5K A;  4HCZ A;  1KC8 U;  1G3T A;  2DEQ A;  5CO7 A;  3RMQ A;  4M75 G;  4M77 G;  2FHD A;  5IT9 E;  1K9M C;  1VQP A;  1OZ2 A;  4RMO A;  3HPW A;  5GAM f;  4QQD A;  5CCA A;  1B34 A;  5LJ3 j;  4JDS A;  4C92 B;  4ELZ C;  3P8H A;  3JB9 D;  1M90 U;  3EAE A;  3OYE A;  3CC4 A;  3OYC A;  2ZZD A;  3QZ5 B;  4XTY A;  2RK2 A;  3GLX A;  4NS5 A;  5FRM A;  3OSV A;  2K5I A;  1N8R U;  3FRN A;  4KUD K;  4LDX A;  2RK1 A;  1QVP A;  3OW2 S;  2EJF A;  2YLC A;  3PNW C;  2OTL T;  3C4S A;  2HQE A;  2ZPH B;  3PT9 A;  1VQP T;  1H3Z A;  5GAN e;  4E7I A;  2E6Z A;  3LH0 A;  4M7A C;  3S3M A;  2FVU A;  3CC2 A;  2DXT A;  4JLG A;  1G3W A;  3I55 A;  1QVF S;  3E9F A;  4F7U F;  3CC4 T;  2XIC A;  3MEV A;  1UGP B;  1Y96 A;  2VXF A;  4A4K A;  3E1S A;  3Q1J A;  3LWI A;  3VUZ A;  2MWO A;  1I4K 1;  1XTD A;  1VIF A;  3M9Q A;  4B9W A;  3H6Z A;  5D6W A;  3JB9 G;  1UEB A;  4E7K A;  2MMP A;  5GAN 3;  3HFO A;  2WSE E;  4RKU E;  5I2M A;  3CMA A;  3CC2 T;  3JCM e;  2LNV A;  3I55 T;  4A4G A;  3G4S A;  1XNI A;  3NTI A;  3V7C A;  4OVA A;  1K8A U;  3QDR B;  2G3R A;  2KK4 A;  3KUF A;  4KBM B;  5KCO A;  4P5N A;  1N6A A;  4E47 A;  3JCM d;  1NJI C;  2DXC A;  4V2S A;  1N27 A;  3C95 A;  4J83 A;  3OYB A;  2CZ7 B;  2LQ8 A;  3KXT A;  1G3S A;  4TVR A;  2RB6 A;  3CMA T;  3OS0 A;  5GAM d;  3J81 E;  2Y90 A;  4J8O A;  5KH6 A;  3L2W A;  3G4S T;  3ME9 A;  4LD9 K;  3OYI A;  4ZTJ A;  1WGS A;  1JRI A;  3X24 B;  2VYT A;  2XU8 A;  3QPH A;  4OGC A;  3HRS A;  2E10 A;  2E41 A;  2YLB A;  2EQK A;  1VQL A;  1LOJ A;  2D0Q B;  3ZBD A;  2JVV A;  3RIR A;  4M7D A;  4QW2 A;  3DLL A;  5GAN 4;  3MEW A;  3OYL A;  3UDC A;  4KUL A;  3DB4 A;  2B8A A;  2DD5 A;  2RHI A;  3LLR A;  3JCM Q;  2RI5 A;  4XTV A;  2ZPI B;  3JB9 J;  2OAU A;  4LD6 A;  1X75 C;  4C92 E;  1K8A C;  3LGF A;  4M75 E;  3OYY A;  4IUP A;  4L5G A;  2FYK A;  4M77 E;  4F7U B;  4M7D C;  5DM7 R;  3VU3 C;  1NPR A;  2DTI A;  4YTL A;  5KCH A;  1VQK A;  4LDY A;  1VQL T;  4J7F A;  3LW5 E;  2RI3 A;  2IG0 A;  3GP8 A;  5CIU A;  4JRQ A;  4M7A F;  3QBY A;  5GMK i;  3MEU A;  4QVD A;  4M75 F;  3WVD B;  4M77 F;  1O75 A;  4R56 A;  3JSC A;  1R8O B;  1WQ7 A;  1BKB A;  4OB0 B;  5LJ5 g;  3JCM P;  1M1K U;  4FM4 B;  4UC4 A;  4OP0 A;  4BY6 C;  3X20 B;  5L8R E;  5GAO p;  3OSS C;  4XU3 A;  1Q86 U;  2QXF A;  1W2B A;  2XKO C;  3OYG A;  5M9O A;  1VQ7 T;  5A0D A;  1MGQ A;  2M0O A;  1BI1 A;  3TRE A;  5CR2 A;  2K4Y A;  1VQK T;  2LRQ A;  4JRK A;  2RJF A;  2K5L A;  1MHN A;  3NTK A;  3UWN A;  3V8J A;  3JRZ A;  2DXU A;  2RH2 A;  5FU6 B;  4FU6 A;  4FT4 A;  4HKE A;  4PNO A;  2FB7 A;  4M78 C;  4PJO G;  3CCL A;  3I56 A;  3SB2 A;  4M7A D;  3HHT B;  4L59 A;  4FSX A;  3S3O A;  2MI6 A;  4BDY A;  1QP3 A;  3RKX A;  3VUB A;  3OY9 A;  3EFS A;  4BAC A;  1U1T A;  2QI2 A;  3A8O B;  3PIP A;  2RM4 A;  1WNL A;  2HBP A;  5GAN 7;  5C6S A;  4ZTF A;  3S3N A;  3JAM E;  2LCC A;  3CCL T;  4PLL A;  5J26 A;  3JB9 F;  2I2L A;  1VQ4 A;  2P4T A;  3I56 T;  5GMK h;  3OYJ A;  4O6J A;  1JB0 E;  1KHI A;  2KDS A;  4J6X A;  4C8Q A;  5LJ5 e;  1M1K C;  2A7Y A;  2FL7 A;  1VQN A;  4PJO C;  3FEO A;  3OS2 A;  1Q86 C;  2QQB A;  5CQY A;  3OQ5 A;  5DLQ E;  2P0K A;  1JJ2 S;  3L2Z A;  5CVI A;  4A4H A;  2JNG A;  2PUO B;  4M7A G;  4MML A;  2E12 A;  3FIF A;  2E64 A;  5A0G A;  3CCM A;  3ZFJ A;  3T9N A;  5A2Q E;  3RKW A;  4C8Q C;  3JCM g;  1VUB A;  1NPP A;  1XQH A;  5D6X A;  3OYF A;  4JS4 A;  2HAX A;  1UGQ B;  2VUB A;  1VQN T;  3CME A;  3CCQ A;  1BI3 A;  4EMK B;  4M75 B;  4M77 B;  1UGR B;  3GNG A;  4MZM A;  2EJ9 A;  5GAM g;  5FU7 C;  2KVQ G;  5GAN h;  1NJI U;  3JB9 I;  4IUT A;  5C0M A;  4IUV A;  2ZPF B;  3CCM T;  2VC8 A;  4F7U E;  4IUR A;  3VYH B;  1IZ6 A;  4OMF B;  4EPC A;  1M1F A;  2RJC A;  4BI8 B;  5D6Y A;  1HK9 A;  3CME T;  3CCQ T;  3UT1 A;  4MDW A;  1NE8 A;  3QHS A;  3RER A;  5AYF A;  3OB9 A;  3RES A;  3CPW S;  3SDZ A;  3HFN A;  4LDW A;  3V8K A;  3JCM h;  1AHJ B;  2LDM A;  4XU0 A;  5CKH A;  4M7D D;  2EKO A;  4C92 A;  4EMK A;  1VQ6 A;  2PQW A;  4M75 A;  1KQS A;  3QSU A;  4XTU A;  2X35 A;  1BI0 A;  4Y91 A;  3VJP A;  2EQM A;  3X26 B;  1WJQ A;  5GMK j;  1QVG A;  4X34 A;  2F5T X;  3BFM A;  3G71 A;  3HSB A;  2RA2 A;  3LX7 A;  4JRI A;  1YJN A;  3MO8 A;  3CD6 A;  1VQ9 A;  3M58 A;  3A8M B;  3SFM A;  3C12 A;  3RUX A;  1HXD A;  2R58 A;  5GAM e;  1FX7 A;  2VXE A;  3INZ A;  4FT2 A;  1VQ6 T;  3M59 A;  4PJO E;  3CCR A;  3CCV A;  4MDX A;  2EQJ A;  2LVM A;  4OB3 B;  4HA8 A;  2JZ2 A;  4EMH A;  4E7L A;  3PGG A;  3TEE A;  5J39 A;  2E5Q A;  4JS5 A;  2XHC A;  4PJO F;  3DLM A;  4M78 D;  3G71 T;  5EG2 A;  2AHJ B;  1K73 C;  4M7D G;  5IN1 A;  2HNI A;  4QQG A;  3CD6 T;  1VQ9 T;  3L1A A;  3JCM W;  5GAN j;  2EJG A;  4N4I A;  1SSF A;  4ZGJ B;  3CXC S;  1YIT A;  2KMT A;  2QEX A;  3CCR T;  3WXM B;  3CCV T;  3CBM A;  2E6N A;  3QXE B;  3MP6 A;  5FRN A;  3LGL A;  3N5B B;  3SWN B;  4MMK A;  2K2V A;  2C06 A;  2LTO A;  2KQW A;  2EYQ A;  3BDL A;  4RCB A;  4II1 A;  5A0L A;  1DJ7 B;  4Z02 A;  3WVE B;  2QQS A;  3H8Z A;  4R55 A;  4M7A E;  1PSF A;  2DZC A;  2XG8 D;  4ME7 A;  1VQ8 A;  4PJO D;  2MF2 A;  3BW1 A;  1YIT T;  4X9C A;  2EIF A;  5FRO A;  3V7R A;  2P0P A;  5LJ3 f;  3MCA B;  4XU1 A;  2L8D A;  3MP8 A;  3OMC A;  2M9U A;  4M78 G;  5DLO A;  1M8V A;  3L2R A;  3M5A A;  4Q5W A;  2EAY A;  4OB2 B;  4C8Q D;  4XTW A;  1Y07 A;  4C0G A;  3QII A;  1VQM A;  3QJY A;  1VIE A;  5GAO n;  2K3Y A;  1N9R A;  2IVW A;  4IKF A;  2WAC A;  5KE3 A;  3QYG B;  1M5Q 1;  2L5Q A;  4IUQ A;  2H3J A;  3CC7 A;  3M4Y A;  1YJ9 A;  3MHX A;  3J80 E;  4NL2 A;  5GAO l;  5GMK m;  2LC4 A;  2R5A A;  5DY9 A;  2LT4 A;  3OW2 A;  1Q81 C;  3AHU A;  3TCJ A;  1OYX A;  2Y4X A;  2V8K A;  4C0Z A;  4F7U A;  2DPP B;  2QDY B;  2BIV A;  2YHT A;  3G6E A;  1V29 B;  4C0D B;  3PIO A;  2X4Y A;  4PJO B;  3ZEH A;  1M4Z A;  2E1H A;  5CQX A;  2GQV A;  3CC7 T;  1PSE A;  1YJ9 T;  5GAN 8;  5CK9 A;  4C8Q G;  1U1S A;  2RHY A;  1W4S A;  2QQ9 A;  3HP9 A;  2MWP A;  1UB4 A;  2PU9 B;  5LJ5 h;  2X4X A;  3EFR A;  3HL8 A;  1WQW A;  2PVO B;  2JN0 A;  3OS1 A;  2NLU A;  3QYH B;  4RCC A;  4BD3 A;  3OYM A;  2O4X B;  2Y4Y A;  4N0A A;  2XI9 A;  5LJ3 e;  2CZ6 B;  2E65 A;  1OI1 A;  2DO3 A;  4HCB A;  1S72 A;  3A8G B;  3GOX A;  4BDZ A;  2QTX A;  3A8H B;  2V8I A;  2X4W A;  4XU2 A;  3G6E T;  1YCY A;  1KD1 C;  3HRT A;  2DTO A;  3CCJ A;  3RKY A;  1QP2 A;  3OYA A;  5LJ3 d;  3PMT A;  4J5Y A;  2QA4 A;  2GFU A;  1JBM A;  1WJS A;  4MZT A;  4JRP A;  2K3X A;  2HD0 A;  4N0A C;  4J6Y A;  1BIA A;  4XK8 E;  5GAN f;  4M7D E;  3JCM X;  2YRV A;  1VQ4 T;  4E7J A;  5CKB A;  2ZPE B;  3R6O A;  4OGE A;  2EWN A;  5HK0 A;  1S72 T;  4M7A B;  4B9X A;  4HT9 A;  3M54 A;  3P8D A;  5GAN 5;  3FB9 A;  1TH7 A;  4CI0 C;  4M7D F;  3VYG A;  3CCJ T;  1FXX A;  3HRU A;  2RHX A;  3V7S A;  4GLK A;  2RHU A;  5GAO m;  2QA4 T;  4PKC C;  3JCM b;  1KQ2 A;  2LCL A;  2XID A;  4JUV A;  4FL6 A;  1X6O A;  3L2V A;  1RI0 A;  4DOW A;  1M1G A;  4NOY A;  3CEY A;  1I5L A;  2CS7 A;  4VUB A;  1UGS B;  3V8L A;  4BE1 A;  3OYN A;  3M4G A;  1YIJ A;  3JCM c;  4C92 G;  1K73 U;  2ZPG B;  2OTL A;  3DKM A;  4BI4 A;  4BUG A;  3GPL A;  1Y96 B;  4HCC A;  4M78 E;  3A8L B;  3JCM V;  1KG1 A;  2QQA A;  4FIB A;  3ASK A;  3SD4 A;  4ELY C;  5CAI A;  4N4G A;  4M7A A;  4OF1 A;  5LJ5 j;  1W2B S;  4HT8 A;  1Y7X A;  2GF7 A;  4M77 A;  3JB9 H;  3VKI A;  4M78 F;  1QW1 A;  2WSF E;  2CKK A;  4PL6 A;  2ZPB B;  5CKE A;  4O5V A;  1Q7Y U;  1G5V A;  3KBG A;  1YIJ T;  2O01 E;  2CYZ B;  1H64 1;  3OMG A;  4XQ3 A;  5HKC A;  5GAM h;  4XAX B;  1FWZ A;  3GF5 A;  3OBY A;  5GAN 2;  4JJN K;  2ZGW A;  3OBW A;  3QJ6 A;  4A4E A;  3M55 A;  3S6W A;  4C92 C;  2RJD A;  4EMK C;  1WJR A;  4M75 C;  4ATO A;  4M77 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...