5LJ5j

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 13
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5j00
5GAOl 4M7AD 1I8FA 4PJOD 2DXUA 3JB9I 4V2SA 3INZA 4M78A 4M78G 4XTUA 5LJ5j 1BIAA 4XTVA 2RM4A 4M75G 1D3BA 2K57A 3FB9A 3QUIA 4M75E 5LJ3d 4F7UA 5GAMf 5LJ3g 3SWNC 5GAOq 3V7SA 2DTHA 4C92G 4EMKA 1Y96B 2RD1A 4M77G 4JRIA 4C8QG 2QTXA 4M7AB 1KQ1A 1WQWA 2DJZA 5GAOm 3JCMJ 4XU1A 1U1SA 4NL3A 4JLIA 5GMKi 4XTYA 4JRKA 5GANg 1D3BB 1WQ7A 4F7UE 2VXFA 4F7UG 3JCMf 4MMLA 3JCMQ 2RA2A 3HSBA 3SB2A 5GAOp 4XTZA 1BIBA 4PJOG 5LJ5e 1LJOA 4M75B 2E65A 3JCMX 1KQ2A 4J5YA 4PJOE 2DVEA 4M7AF 2DEQA 4RCBA 2CGHA 3BW1A 4NOYA 4C92B 5GAN3 4C92C 4HT9A 2YHTA 3HFNA 4M75D 4WF2A 5GANf 4M7DE 3SWNB 4M75F 3M4GA 1I5LA 2DXTA 2FB7A 4M75C 2VXEA 4OP0A 5GMKl 5LJ5g 3JCMP 2E41A 3RKXA 2HNIA 4M7AC 5LJ3j 5GAN7 3JCMh 5GAMg 4M7AA 1M8VA 3JCMb 5LJ3f 5GAMd 3QHSA 1HXDA 3AHUA 4EMKC 4M7DA 4M7AE 2DZCA 3L2ZA 4HA8A 4PJOF 4PNOA 4NL2A 5GAOr 5GANj 4XTWA 4C92D 2EJFA 4XQ3A 1MGQA 5CAIA 5GAOn 3JB9F 4EMKB 4XTXA 4PJOB 1WNLA 1JBMA 4M7DD 1LNXA 4M77F 4C8QF 2ZGWA 5GAMe 4M77E 4C8QE 4JUVA 3QO3A 5GAN6 4M78B 4RCCA 5GMKe 4X9DA 3JCMV 4J6XA 4C92A 5GANd 5GAN2 5GAN4 2FYKA 2EJ9A 3V8KA 3PGGA 1N9RA 4M75A 4EMHA 5GMKh 2YLCA 4XU2A 5GAMj 5GMKm 4M77A 4C8QA 3JCMe 2EJGA 2DTOA 3BFMA 3L1AA 3RIRA 3RKYA 3JB9D 4XU0A 5LJ5f 4C92F 4M7DB 5GAN5 5LJ3h 1M5Q1 3VU3C 4M78E 4XU3A 4QVCA 4X9CA 4J6YA 4Y91A 5DY9A 4QVDA 4M77D 4C8QD 5I21A 3EFSA 1WPYA 2E10A 2E64A 2EWNA 4N0AA 4M7DF 4C92E 2Y90A 4M7DC 4HT8A 3V8LA 3JCMd 1HK9A 5GMKj 5GANh 4M7AG 3FIFA 2DKGA 3JB9J 3RUXA 3EFRA 5GAMh 1Y96A 4PJOC 1X01A 3BDUA 1TH7A 3V8JA 3V7RA 4DQ2A 2DTIA 3JCMW 2RB6A 4F7UF 5GAN8 3BY7A 3RERA 3SWNA 1I81A 4A53A 5GANe 4EMGA 3FJPA 3GIBA 1U1TA 3QSUA 2EAYA 4J6WA 4M77B 1B34B 1N9SA 1YCYA 3RESA 3V7CA 4C8QB 5LJ5h 4PJOA 2VC8A 3JB9H 5LJ5d 4M7DG 2DZ9A 1B34A 3JCMg 1LOJA 4MMKA 3JCMc 3JB9G 4F7UB 4M78C 5LJ3e 1H641 2I2LA 4M78F 4A54A 4M77C 4C8QC 4M78D 3RKWA 2E1HA 4N0AC 1I4K1 2YLBA 3HFOA 2JN0A 1JRIA
chains in the Genus database with same CATH superfamily
2OAUA 2X9HA 5KYWA 2QQBA 2ECZA 3EG0A 2KROA 3FRNA 1ZSZA 2KR3A 2J05A 2K2MA 2CREA 4A4GA 2J6KA 2P0KA 1K76A 3JCMQ 1QMCA 3HRTA 4JZ4A 4BD3A 4FT4A 2DERA 2D9TA 4NOYA 4E2FB 3JAME 4C5EA 1WHKA 4OB1B 3CC2T 1V1CA 4RKUE 2BZ8A 4KUDK 1PSFA 2PU9B 5IHIA 3ZBDA 5FWBA 1RAEB 2V26A 1GRIA 4ZGJB 1VQLT 3CCRT 5GAOn 1M3CA 1UECA 1R77A 2F2XA 1BI2A 4DEYA 4C0ZA 1PRLC 4PFZA 2YRCA 1M30A 3LH0A 5GMKh 3PTAA 1KHIA 1H92A 3TEEA 4R55A 4C8QD 2DYIA 1QQJA 4C0DB 2EYQA 4OVAA 2NLUA 2EQIA 1K9MU 1OX9A 2YT6A 1YI2T 3FEOA 3A8OB 3MPUB 2CT4A 4GBQA 2E3HA 2ZAEA 3CCLQ 2VC8A 5KYYB 1KHCA 1VYTA 2HSPA 1LOJA 1NPRA 5GJVB 1F1BB 1M1KC 2L89A 1UJ0A 1ARKA 2FVUA 1LCKA 2L8DA 3OSVA 2DXUA 2DL7A 2K6DA 3FB9A 4ZN1A 2JTEA 3EGDA 4LDXA 1VQMT 2HCKA 4XU1A 1VQ5Q 5GANg 1QVFA 4F7UG 2ZPGB 5C0MA 4F17A 1W1FA 2XICA 1D0YA 4Z89A 2A3LA 2DEQA 2O2OA 2FPEA 5GAN3 1VQNQ 1Y57A 2JT4A 2K3XA 4ZTJA 5LJ5g 2DJQA 2CP3A 2JZ2A 2EGEA 2M02A 2FO0A 3M57A 1H8KA 1NYFA 1M2VB 2KDSA 4IIMA 1WYXA 2Y4YA 2JVVA 4J83A 1VQ9A 2B86A 5GAOr 4FT2A 4B6MA 4IURA 1SRLA 4PJNA 4OF1A 4EMKB 3CCVA 1VQPA 2DNUA 4RG8A 2QQ9A 2VGNA 4J7IA 2FL7A 2KSSA 2FHDA 2HKNA 2P84A 2CDTA 1EZZB 1OU9A 4J8OA 3S6WA 4M77A 3JCMe 2ROLA 2KT8A 3CCVT 4LDVA 3CCVQ 2FRWA 1Q7YC 1HJDA 3EFSA 4PLIA 2EPDA 2LNHB 1HK9A 1RL2A 3PNWC 3META 1TUCA 1YHQT 1X01A 1WJRA 1JXMA 4OMFB 3PE0A 3CCMT 3G6ET 3CC4Q 2E3IA 4Z88A 1KIKA 2QQAA 1AWWA 2A28A 1PRMC 4F7UB 4M78C 1W4SA 4M78F 1LPLA 2RMOA 2L3QA 4ATOA 1QVGS 1BCOA 2CP5A 3Q1JA 2EGCA 2RQRA 1I8FA 2R5AA 1FWZA 2FRYA 4M78A 1BB9A 3OS0A 1AHJB 1FXXA 2ZPIB 2L3RA 2DTHA 2DAQA 3HL8A 4M7AB 2LJ0A 2KAFA 3SHWA 3CCSA 3CMEA 1WHJA 2XIDA 4ELYC 3GP8A 1JQQA 4BY6B 4ZTFA 1LJOA 4M75B 4PK4A 4M7AF 4QW2A 3BW1A 2JJ9A 2R5MA 4DBRA 1Q81C 4BDYA 3CXCA 3NGPA 2ZPEB 3WVEB 3PIOA 5D6YA 3UA6A 3M0RA 3H0HA 2V8IA 2OTJQ 4HXJA 3EGDB 5EG2A 1YITQ 2CT3A 1K9MC 3CC7T 1FYNA 3TSWA 4FCYA 2P0QA 1TU0B 2EJ9A 3V8KA 4M75A 4AT1B 2E70A 4MZMA 2K5FA 2EVRA 3RDVA 1VQNA 3OW2P 2V8JA 3N5BB 1FMKA 1YWPA 1RI0A 4VUBA 3GNFB 2E10A 3OYBA 1QW1A 5GANh 2VASA 3FIFA 2EQMA 3JB9J 3I56Q 4PJOC 1TXQA 3QYHB 2K5LA 8AT1B 3HTRA 1SSHA 3J81E 1M9SA 4PJOA 5LJ5h 1B07A 4QVZA 5FU7C 1VQ6Q 4P5NA 2R57A 2OTLA 2ED1A 5KYWB 3ZL7C 3ZEHA 4N0AC 1UGSB 3AT1B 3LYIA 1MMNA 4J7FA 2RK1A 5A0LA 3M56A 4X1VA 2WACA 3G71T 2RM4A 1RAFB 2ED0A 2O88A 3SWNC 4IIOA 2DYBA 2MF2A 4BE0A 2C0TA 1GCPA 1IRXA 1VQ8A 2X3WD 4MMLA 3F70A 5C6SA 1MMAA 3RNJA 5GAOp 1PG5B 3QJ6A 3UT1A 1SHGA 4FSSA 3IQLA 2QXFA 1IGQA 1VQOQ 5DM7R 1NZ9A 1N6AA 3VUBA 4M7AE 3AHUA 4EMKC 2CH4W 3VKIA 1Y0MA 4PJOF 1S72Q 1RADB 2CP6A 3OBYA 1PNJA 3FJ5A 2RF0A 2EJFA 5DLOA 2DL3A 5CIUA 1M90U 4PJMA 3CMET 2RPNA 4GLMA 4RCCA 4J6XA 3G6EQ 1W2BS 5M9OA 2DTOA 3L1AA 3URGA 1S72T 1JJ2S 1PCXA 2BTTA 1BKBA 5LJ3h 1KC8R 4X9CA 2JM8A 3J7AF 4E6RA 4M7DC 3V8LA 3CC2A 2QG9B 2DKGA 3VS5A 5EC7A 2XDDA 1Q82U 3PFSA 3CCQA 2OTJA 1Y7XA 1JXOA 3CCMA 1W2BA 2RQTA 4B9XA 2K7AA 4FYVB 3OYMA 2RHZA 1YCYA 2QA4A 1M2OA 5IT9E 5HK0A 4BE1A 4LN2A 4N4IA 5KYYA 1JRIA 2HBWA 1ZBXA 1QP2A 1Q81U 2LCCA 4M75G 2K57A 1WX6A 2VV5A 3HKSA 3QBYA 3CCET 5GAOm 1WQWA 1S1NA 1YN8A 1K9AA 4TVRA 2ZPHB 2QTVA 1TUGB 4CRIA 3LGLA 4AMCA 4RCBA 2D6FA 1Z9QA 4HT9A 2JUFA 2BUDA 3MP1A 2KEAA 4RG2A 3L42A 1MUZA 2HL3A 3QHSA 1XTDA 1WI7A 1R0BG 5GANj 5FU7B 2RQWA 2ZPFB 4KGXB 3A8GB 1WNLA 3OYCA 5CKBA 5GAN6 2E6NA 3FLGA 2IIMA 2W10A 5GMKe 5GAN4 2DETA 1YCSB 2DL4A 1WIEA 3CCJT 1D0ZA 2OAWA 1I1JA 3BFMA 5ECAA 5GAN5 1Q7YU 1VQOA 3VU3C 4F04B 3OYIA 1AZEA 1ZSZB 4OMPA 2L2PA 3I56A 1KK7A 4E7LA 4AFUC 3JCMd 3MEUA 2GFAA 4II1A 2XG8D 1PHTA 1IGUA 5GAMh 1D1CA 2HQEA 3O5ZA 2WSEE 5GAN8 3CBOA 3E2UA 1WHLA 4BI4A 1AWOA 4D6WA 4MMKA 3LH5A 4E7JA 3CPWS 1VQ9Q 3OYJA 3CCRQ 5A0DA 5CO7A 2NUPA 2YLBA 1M3BA 1OPLA 1C6VX 1T3LA 4IUUA 3T9NA 3CMAQ 4E7IA 4M7AD 3QUIA 3G4ST 3MEVA 1N8RR 4M77G 2QTXA 2OX7A 3CXCS 4JRKA 1Q81R 1WQ7A 3UF4A 2MWPA 3G6EA 3JCMf 2VWFA 3SB2A 1DJ7B 1VQMQ 3CEYA 1ABQA 2E65A 1ZA1B 2FZGB 2DEUA 2O9SA 4WF2A 3CMAA 2EYZA 3OQ5A 1G8XA 2VXEA 2DL8A 2YWWA 4IUQA 3M9QA 1M90R 5LJ3j 5GAMg 3VV0A 1QVGA 1IXDA 1H3ZA 2YUQA 2JTMA 1PSEA 1VQPT 1MNEA 3CPWP 1GFDA 4PL6A 2BE7D 1VQOT 5KYNA 2VGMA 4J9DA 4L6V5 4JUVA 3QO3A 4OMMA 3OYFA 3CCUQ 1BYMA 3L2RA 1QCFA 1D09B 3QYGB 4HCBA 3KUFA 1YI2A 4BY6C 1PM3A 2KMTA 4LNPA 4FIBA 1M5Q1 1MV3A 4JJDA 1G83A 4OGEA 5KYUA 4PKCC 5I2MA 4KGVB 2QEXT 1UGRB 2KE9A 4OB0B 3EFRA 2JS2A 1U5SA 1YHQQ 1PKTA 2LZ6B 2LC4A 4LDUA 1RLPC 3M0UA 3CCJQ 4LXCA 1K8AU 1AOJA 3VYGA 2F5KA 5GANe 1OU8A 1VQLA 4KBMB 1GBRA 3M4YA 2LQNA 1M1GA 1KQSS 2XU8A 2PQWA 3VRYA 1ZUUA 1QVFP 2DRKA 3CCST 2NUTA 1SSFA 5GJWB 3TREA 4V2SA 3KXTA 3INZA 4YTLA 4XTVA 2ROTA 4C92G 1NPPA 3SDZA 4FYXB 4A4HA 1KQ1A 1IB8A 4NL3A 4XTYA 1YJWQ 1OZ2A 2VXFA 2OTLQ 2HDAA 3NTKA 2J6FA 4LUEA 1VQ6A 4L5GA 2MI6A 3J80E 2A08A 2KT1A 3X24B 4IKFA 2DILA 4OB3B 4KGZB 1UDLA 1FMVA 4M75F 3OYHA 3CCEQ 3ZFJA 4M75C 2MMPA 2SEMA 4A4EA 2K79A 2FZCB 3H41A 4J9IA 4AFQC 4AG2C 3I55A 2XD0A 2LX9A 4PNOA 3E9FA 1VQ4T 2E12A 4IUPA 1VQ8Q 1RAGB 2LX7A 2XKOC 2H3EB 2PTKA 3CXCP 1D1AA 1YITT 2FZKB 1X2QA 4J9CA 3VS3A 3PVLA 5GANd 2C06A 4LUDA 1E6HA 1VQMA 2DXCA 3VS6A 4OB2B 3CMAT 3QG1A 2FG0A 4XU2A 3RBBB 1UFFA 1QP3A 3JRZA 1M27C 1UHCA 1NM7A 4J6YA 3QPHA 2LTOA 5IH2A 4QVDA 2EYYA 4AG1C 2ESWA 4JJBA 4N0AA 1NEBA 1J3TA 2CP7A 2E6ZA 4LDYA 2A36A 2VB6A 3SWNA 2QA4Q 1VIEA 2QAZA 5I2SA 1MV0B 1WLPB 2ENMA 1K9MR 3JCMg 3LLRA 5KE2A 4RTUA 4F16A 3H6ZA 1S72A 4JLGA 4C8QC 4M78D 1N8RU 4CC7A 1WXTA 2P4RA 1Q82C 2AZVA 3CBPA 1VQ6T 4PJOD 4EIKA 3BE3A 4XTUA 5KYUB 1AEYA 4KRTA 3R6NA 4EMKA 4CC2A 2KRSA 2X4JA 4JLIA 1JO8A 1U06A 2DK3A 4JRQA 3I55T 1M1KU 2GTJA 1EX4A 1QKXA 3G4SQ 4C92B 5D7UA 4RMOA 1NEGA 1WHGA 3UATA 1YITA 4OP0A 3JCMP 3C0CA 2QGFB 3RKXA 2CP2A 2CUDA 2LT4A 4AFSC 3RMQA 4EPCA 1KD1R 4D8KA 2AIRB 5FROA 4JJNK 1D1BA 5HKCA 4A63B 4O5VA 2EYWA 4PLLA 1YJNT 4PJOB 3X28B 3H0FA 2MIOA 4M77E 2CYZB 3REBB 1GXIE 1VQLQ 4J9FA 2X3XD 4D8DA 5GAN2 3EG9A 3SFMA 2DIQA 4RTWA 5GMKm 2K3BA 2O4XB 1ZA2B 1SG5A 3EG2A 1ZHIA 1E6GA 2E64A 4RUGA 4FYYB 5FW9A 1K8AR 2L5QA 1YHQA 2FPDA 1YJ9T 3CD6Q 3V8JA 3V7RA 2DTIA 2QQRA 3BY7A 3CPFA 1I81A 5CQYA 4FU6A 1KFZA 2LT1A 1B7TA 1SPKA 5CKDA 3OSSC 3CCLT 2DE0X 1PKSA 2HL5C 5LJ3e 2HBPA 3X26B 2NYSA 1TTHB 3RKWA 1IZ6A 1NBEB 2HQXA 3OA6A 5FRNA 4BB7A 3A1PA 1HSQA 3NTIA 4M75E 1UEBA 1YNZA 4FL6A 1G2BA 4HCZA 1RUWA 1YJWA 3TQ7P 1YIJA 3QJYA 1YJNA 3CMEQ 2CKKA 3I5RA 2VYTA 4PJOG 3GBQA 3UDCA 4J5YA 1WHMA 5I22A 3G7ZA 2V1RA 5AT1B 2BKDN 4FW1A 4J9BA 4AFZC 2F2VA 2HZYA 5GMKl 5HK3A 1KJWA 5KYXB 2E41A 1UB4A 1VYVA 1WFWA 2SRCA 2VUBA 5GAMd 3OYYA 2DZCA 2CZ7B 3OYNA 1X6GA 2DM1A 4CC4B 1X69A 1RAHB 3DB3A 1K4US 4HKEA 4L59A 1QWEA 2A7YA 1HD3A 2EKOA 3CCRA 2RHUA 1I0CA 2KYMA 1BK2A 2EBPA 2COWA 5GAMj 4Y92A 1VQ8T 3M55A 2EQKA 8ATCB 1Y07A 3DKMA 4M78E 1N5ZA 3H8ZA 5DY9A 5I21A 2Z0WA 2J6OA 1V29B 3VYHB 3M0SA 3P8HA 1G5VA 1VQKA 1OZ3A 2YRVA 2PNIA 4MZPA 2COYA 4C8QB 1T0JA 4RTVA 1RI9A 2JXBA 5KE3A 3GF5A 2LJ3A 1Q95G 3X25B 4M77C 3LGFA 4JZ3A 4EDUA 3HFOA 1VQKQ 4HT8A 3PMTA 2YXYA 1KSWA 1ZUYA 4JS5A 1RAIB 3EHQA 1D3BA 4F7UA 2KQWA 2NWMA 1Q86U 1TG0A 3R6OA 4ZNXA 2NUPB 3CQTA 1U1SA 2EKHA 1SHFA 4PJJA 2QA4T 1HYOA 1VUBA 2JW4A 2KY9A 1KD1U 5IXBA 1WJQA 2CGHA 2QDLA 1YJ9Q 3KFVA 4PJLA 4X34A 1FX7A 1I5OB 2P0PA 4M7AC 4JRPA 1YP5A 2DPPB 2L0AA 2JOYA 1YJWT 3CD6T 4DOWA 3GNGA 5CAIA 1UUEA 1WA7A 3GOXA 1JBMA 2QK0A 2YSQA 3QZ5B 3CCEA 2FYKA 1KC8C 3E9GA 2MWOA 2YUPA 1VQPQ 4WTOB 3MEAA 4M7DB 4F14A 3M0PA 3WVDB 5IXFA 4J9EA 4PFPA 2AHJB 3CC2Q 4DBHA 4ZGEB 2LMJA 2EYXA 3CCMQ 1OOTA 2DLPA 1ABOA 1PD0A 2MAMA 1JU5C 3OW2S 5KCOA 1PC0A 3RESA 1B34B 3OYKA 1T0HA 1UG1A 3L2VA 3I5SA 3MJXA 1N8RC 1A0NB 1TUDA 3NFCA 1GCQA 3A8HB 4C0GA 2QEXQ 3CC7A 3DLLA 4M4ZA 3HRSA 3NHNA 2LDMA 1MNDA 3CCSQ 1PWTA 1BIAA 3A8MB 2X4YA 2E5KA 5FWCA 2KBTA 3JSCA 1Y96B 3UA7A 4OGCA 1YBYA 2XI9A 2J06A 1IHWA 2RHYA 1M2VA 2D0NA 2CUBA 2KXCA 3JCMX 4PJOE 2JMAA 2F2WA 3EG9B 2OI3A 2LJ1A 1VIFA 4KUIA 4BACA 5AYFA 1GBQA 3HFNA 4M7DE 3SWNB 1QVPA 3M4GA 3I9QA 1IO6A 4XAXB 2M51A 2RJDA 3P8BB 4Z02A 5GAN7 1NYGA 2A0FB 3MEWA 1M8VA 3JCMb 1HXDA 3OS2A 3I35A 3M58A 1NE8A 3L2QA 3E19A 1QKWA 5HCKA 2LRQA 1K73U 1MGQA 1BI0A 1K0XA 2CZ1B 3CCUT 1LNXA 4M77F 2ZGWA 3QDRB 3G4SA 2RHIA 3M0QA 4RTTA 3M53A 4X9DA 4A4FA 4C92A 1U8RA 1ZUKA 1AVZC 1N9RA 5J39A 1WZOA 3M54A 4FYWB 4KT0E 1K8AC 3JB9D 1G3YA 3THKA 3H9NA 2PVGB 3HP9A 3CCUA 2HAXA 4M77D 2X4XA 1VOMA 4JPBW 4ESRA 5CVIA 3UPUA 2F1LA 4M7AG 1G3WA 1TOVA 1TH7A 2JTFA 2VVKA 4ZN3A 4IUTA 2LCSA 2C0IA 4C5GA 1JJ2P 2MCNA 4J6WA 3QIIA 2DD4A 3JB9G 1B34A 3JCMc 3OS1A 1H641 2I2LA 2EGAA 3OB9A 2RI5A 2RHXA 2XMFA 2WSCE 1Q86R 2JN0A 2KVQG 1OYXA 1TWBA 5HY6A 3JB9I 4HVWA 2AK5A 2QEXA 3EFOA 3CC7Q 2GQVA 5LJ5j 3EFOB 5LJ3d 5GAOq 3OYAA 2D0QB 1ZSZC 5L23A 4E7KA 1VYUA 5J3BA 2RH2A 2ZCFB 1NLOC 7AT1B 2GTOA 4MDWA 5A2QE 3I55Q 2EW3A 4BI8B 3EH1A 2VKNA 3ULRB 2OJ2A 4R56A 3OYDA 1NJIR 4M75D 3OBWA 2O31A 2RI2A 3D7SB 2FB7A 3DB4A 1KQSP 3UWNA 2LVMA 4OMQA 2BZYA 3L2UA 4HA8A 3OW2A 4QT7A 2K3YA 2JS0A 4K11A 3OYGA 2CS7A 2O9VA 2KYBA 1M8MA 1P92A 5GAMe 4R0KA 3A8LB 3MP6A 4J9HA 2K4YA 3JCMV 1BI1A 3ER0A 2G3RA 3BDLA 2RN8A 2KK4A 1UGPB 2YLCA 2RO0A 2LP5A 1R0CB 4FW2A 1UE9A 3MHXA 2QQSA 3MO8A 1X43A 4N4GA 1N27A 1XQHA 1SKUB 4B9WA 1B3QA 5FU6B 3CC4T 1VQ4A 1UHFA 2EWNA 3CCQT 1UJYA 1ZBJA 1BI3A 2DBKA 1ZLMA 3RUXA 3EG3A 3X20B 2RB6A 2KI7A 3OS5A 1AWJA 2I0NA 3HPWA 2AT1B 4HVUA 2H3JA 3FJPA 1U1TA 3WXMB 1Y71A 2EAYA 3QSUA 2ZPBB 1XNIA 2H8HA 3CC4A 1ZSGA 2DIGA 2DZ9A 3QWXX 1YIJT 4ELZC 1TSFA 2RJEA 1W6XA 2E1HA 2HKQB 1I4K1 2GNCA 3OY9A 2R58A 1NLPC 2CSQA 4BDZA 2PVOB 4JS4A 4ME7A 2JMCA 3OMCA 2CZ0B 2YUOA 1O75A 5CCAA 1OULA 2DJZA 2GCXA 3DLMA 2YRDA 1K73C 2M1HA 4NS5A 1R8OB 2DO3A 1SEMA 5CKHA 2J7IA 1U3OA 3VS7A 2COZA 1YFNA 2HMAA 2P4TA 1VQ5A 1K73R 4MZTA 1WHHA 3TSZA 3JCMh 3C4SA 5LJ3f 4M7DA 1NJIU 5A0GA 2DBMA 3H0IA 2KNBB 1X27A 2DXBA 4XK8E 1K0SA 1G3TA 1UTIA 5KYXA 3OYLA 4C8QF 2EQJA 3RMSA 1QVFS 4Y28E 3LWHA 4Z8AA 1SF9A 2CH4A 1W2BP 1MMGA 2C0OA 3RKYA 2LQWA 4C0DC 1QLYA 1RABB 2X35A 2M9UA 2FPFA 1OPKA 5GMKj 2RK2A 1TS9A 3TU4K 1KD1C 2M0OA 4GY5A 1KC8U 1OV3A 3LW5E 4A53A 2GQIA 5IHKA 1N9SA 4KULA 3CD6A 1WXUA 1Q82R 3C94A 3G71Q 4Q5WA 1KG1A 4ORZA 5CK9A 2HEQA 2HSEB 4A54A 1YJNQ 2GFUA 2K5IA 4EMGA 1QCNA 2KRMA 1PD1A 5GAOl 1RAAB 2NUZA 1LVKA 4E7ZA 3MP8A 3V7SA 4DEXA 1H3HA 4DA4A 3MCAB 4DBQA 2ATCB 2CP0A 2E5QA 2V8KA 2KRNA 5FLXE 2RA2A 3HSBA 1WGSA 3VS0A 1BIBA 3CPWA 4LD9K 1CSKA 2ABLA 5D6WA 3CCQQ 2DVEA 3I56T 2YHTA 5GANf 2DL5A 2JNGA 3GPLA 4BE2A 2HNIA 3A98A 3CCLA 1UGVA 2B8AA 1ZQ1A 4ANJA 1G3SA 1X75C 1EIFA 2D8JA 3PT9A 4RTZA 1RACB 1EFNA 1M1FA 4RTXA 1K1ZA 1C0MA 2MPXC 1GFCA 2BE9B 2DRMA 4XTWA 4OMLA 4XQ3A 1OX8A 3JB9F 5KH6A 1VQ9T 2QDYB 3L2WA 4M7DD 4QQGA 1ZX6A 4C8QE 2V1QA 3S3OA 4C5IA 2EIFA 2LQKA 4CC3A 1X6OA 2DF6A 1D0XA 3TCJA 2EJGA 2QYZA 1OEBA 2X4WA 4XU0A 4C92F 1SRMA 3S3MA 1AWXA 4JDSA 1IREB 4E7SA 1WXBA 2AKKA 1ACMB 1W70A 1WPYA 2Y4XA 4C92E 2LCLA 2RQVA 1Y96A 4E7HA 1YI2Q 1Q7YR 1UGQB 1AD5A 1NG2A 4QQDA 2PVDB 1VQ7A 3OYEA 1O9SA 3QXEB 2WSFE 3GIBA 1Q86C 4LDWA 3JB9H 5I11A 2MOXA 2QI2A 2XDPA 4DOVA 1X6BA 3LWIA 1QWFA 3ASKA 1YWOA 3C95A 3EGXA 2CZ6B 3CCJA 6AT1B 4WCIA 5KCHA 1VQ7T 4BI3A 2K2VA 1VA7A 1Z9ZA 4CI0C 1M1KR 1YIJQ 1I07A 3VS2A 1QVGP 2RD1A 3JCMJ 4JRIA 3M5AA 1NJIC 5DLQE 1WDXA 3JV3A 1D3BB 4QQ6A 1E7OA 4XTZA 3VS1A 2YUNA 1T3SA 2X51A 4C5HA 3G71A 1AT1B 9ATCB 1CKAA 1MMDA 1XJWB 4C92C 3A5ZB 2L3PA 2DA9A 1I5LA 4JJCA 2YDLA 4M7AA 1BU1A 4LD6A 2OTJT 2DFUA 2O4XA 4RTYA 5J26A 5L8RE 4NL2A 3G1JA 2BIVA 1CKBA 2D8HA 1JJ2A 2EFIA 2D1XA 2GGRA 3GLXA 3PVQA 4M78B 3OMGA 3M59A 1OQKA 2IVWA 2GF7A 1IHVA 1RLQC 2EQUA 3C12A 5CKFA 4C0FA 5LJ5f 3QKJA 2RJFA 4LE9A 4XU3A 4QVCA 2XDBA 4Y91A 4E47A 1VQNT 4HVVA 2LQ8A 1VQKT 2F5TX 2Y90A 3ME9A 1BCMA 5IHNA 2KGTA 3HHTB 2AKLA 1C1AA 5CR2A 4QKUA 2G6FX 2L3SA 4HCKA 2XK0A 5FRMA 1M3AA 2K9GA 2PUOB 2NUTB 4M77B 4KH1B 3EGXB 3TVTA 2E4HA 4KH0B 1VQ4Q 4GLKA 4OMOA 1WJSA 3PMIA 1GCQC 1V76A 2MYSA 2PUKB 4UC4A 2IG0A 3O8VA 3VRZA 2DX1A 2DVJA 2CSIA 3SD4A 4M78G 2QGGA 5GAMf 1JEGA 5LJ3g 2F69A 3EAEA 4A4KA 5CQXA 1OI1A 4C8QG 2O01E 3MKDA 2MK5A 3VS4A 5GMKi 5IN1A 2OTLT 5IAYA 2RI3A 4F7UE 2PZ1A 4O6JA 5LJ5e 1KQ2A 3S3NA 4FSXA 2M16A 3SEMA 2HQHA 1GL5A 3LX7A 1JB0E 2DXTA 1X2KA 4PFOA 4J9GA 2LNVA 2M0YA 2RNAA 5D6XA 3L2ZA 3VUZA 4C92D 2QASA 3M0TA 4XTXA 3FC3A 1KQSA 3EG1A 2W0ZA 5CKEA 3NMZC 3REAB 2DD5A 1M4ZA 3CBMA 3NTHA 3QZ9B 4MDXA 3FDRA 3EGUA 4HCCA 4FM4B 3EHRA 2ZZDA 3PGGA 1FMWA 2DMOA 4EMHA 3HRUA 3PIPA 3QDFA 2HD0A 4C8QA 2AZSA 3RIRA 3RR6A 4ZGDB 1VQ5T 2IPOB 2RJCA 2XHCA 4M7DF 1QCOA 3NPFA 2RQUA 2JM9A 1VQ7Q 5FU6C 3U23A 3BDUA 4DQ2A 5LL6S 3JCMW 4F7UF 3EH2A 1YJ9A 3RERA 4DBFA 2KXDA 2A37A 3VJPA 1BBZA 1AZGB 4N4HA 2BZXA 2GBQA 3P8DA 3V7CA 5LJ5d 4M7DG 1XOVA 1M90C 3E1SA 3KBGA 4OMNA 2FEIA 4BUGA 1MHNA 4IUVA 3QWYA
chains in the Genus database with same CATH topology
2HQXA 1ZBXA 2R58A 2OAUA 4BDZA 2PVOB 4JS4A 4ME7A 1QP2A 3OA6A 5FRNA 4BB7A 1Q81U 2LCCA 3NTIA 3OMCA 2CZ0B 4M75G 2K57A 2QQBA 4M75E 1UEBA 2VV5A 3HKSA 4FL6A 4HCZA 3FRNA 3QBYA 1YJWA 1O75A 3CCET 5GAOm 1YIJA 3QJYA 1WQWA 2DJZA 2GCXA 4A4GA 5CCAA 1YJNA 2P0KA 3DLMA 4TVRA 2CKKA 1K73C 2ZPHB 3JCMQ 2M1HA 4NS5A 2VYTA 1R8OB 3HRTA 4BD3A 2DO3A 4CRIA 3LGLA 4PJOG 5CKHA 4FT4A 3UDCA 4J5YA 2D9TA 3G7ZA 4RCBA 2D6FA 4NOYA 2BKDN 4HT9A 3JAME 4C5EA 2P4TA 4OB1B 3CC2T 5GMKl 5HK3A 4RKUE 2E41A 1UB4A 2JUFA 4MZTA 1VQ5A 4KUDK 1PSFA 3JCMh 2BUDA 2PU9B 3C4SA 3MP1A 4RG2A 2VUBA 3L42A 3QHSA 5LJ3f 5GAMd 4M7DA 3OYYA 1XTDA 3ZBDA 2DZCA 1NJIU 2CZ7B 3OYNA 5A0GA 5GANj 5FU7B 2ZPFB 4ZGJB 1VQLT 3CCRT 5GAOn 2DXBA 4XK8E 1G3TA 3DB3A 3A8GB 1WNLA 4HKEA 1BI2A 4L59A 3OYLA 4C8QF 3OYCA 5CKBA 2A7YA 4C0ZA 2EKOA 5GAN6 2E6NA 2EQJA 3FLGA 3RMSA 3CCRA 2RHUA 5GMKe 4Y28E 1QVFS 3LWHA 5GAN4 3LH0A 5GMKh 3PTAA 3CCJT 1KHIA 5GAMj 1VQ8T 3M55A 3BFMA 3RKYA 2EQKA 4C0DC 5GAN5 1Q7YU 1VQOA 1Y07A 3DKMA 4M78E 3VU3C 3OYIA 3TEEA 2X35A 3H8ZA 4R55A 5DY9A 2M9UA 4C8QD 5I21A 3I56A 4E7LA 4C0DB 3JCMd 2EYQA 4OVAA 5GMKj 2RK2A 2GFAA 1V29B 2NLUA 2XG8D 3MEUA 4II1A 3VYHB 5GAMh 3TU4K 3P8HA 1KD1C 1G5VA 2M0OA 1K9MU 1VQKA 4GY5A 2HQEA 1YI2T 1KC8U 3FEOA 2WSEE 3A8OB 5GAN8 1OZ3A 2YRVA 3CBOA 3LW5E 4A53A 4MZPA 4BI4A 4C8QB 1N9SA 4KULA 3CD6A 3C94A 2VC8A 1KHCA 4Q5WA 1KG1A 4D6WA 5KE3A 1LOJA 4MMKA 5CK9A 4E7JA 1NPRA 3GF5A 1M1KC 2L89A 3CPWS 2FVUA 3X25B 3OYJA 4A54A 4M77C 5A0DA 2GFUA 2K5IA 3LGFA 5CO7A 2L8DA 2YLBA 4EDUA 3HFOA 3OSVA 4EMGA 4HT8A 3PMTA 5GAOl 4JS5A 2DXUA 4IUUA 3T9NA 4E7IA 1D3BA 3FB9A 3QUIA 4M7AD 3G4ST 3MP8A 3MEVA 4F7UA 3V7SA 4ZN1A 2KQWA 1Q86U 4DA4A 3MCAB 4M77G 4LDXA 2QTXA 3R6OA 1VQMT 4XU1A 1U1SA 2E5QA 2V8KA 3CXCS 4JRKA 5GANg 2QA4T 1QVFA 1WQ7A 2MWPA 4F7UG 3JCMf 5FLXE 1VUBA 3G6EA 2RA2A 3HSBA 3SB2A 1DJ7B 2ZPGB 5C0MA 1WGSA 1BIBA 3CEYA 3CPWA 2KY9A 2E65A 2XICA 1KD1U 5D6WA 4LD9K 2DVEA 1WJQA 2A3LA 3I56T 2DEQA 2CGHA 5GAN3 2YHTA 5GANf 4WF2A 3CMAA 2JNGA 3GPLA 2K3XA 4X34A 1FX7A 3OQ5A 5LJ5g 4ZTJA 2VXEA 4BE2A 2HNIA 2P0PA 4IUQA 3M9QA 2JZ2A 5LJ3j 4JRPA 3CCLA 4M7AC 2B8AA 5GAMg 1ZQ1A 3M57A 3VV0A 2DPPB 1QVGA 1G3SA 1X75C 2KDSA 1EIFA 2Y4YA 1H3ZA 2JOYA 2JVVA 4J83A 3PT9A 2JTMA 1PSEA 1YJWT 1VQPT 1VQ9A 1M1FA 5GAOr 4FT2A 4XTWA 3CD6T 4IURA 4DOWA 3GNGA 4XQ3A 5CAIA 3JB9F 4OF1A 5KH6A 4PL6A 4EMKB 3CCVA 1VQ9T 2QDYB 1VQPA 3L2WA 3GOXA 1JBMA 1VQOT 4RG8A 4QQGA 4M7DD 2VGMA 2QQ9A 2VGNA 4C8QE 4L6V5 4JUVA 3QO3A 4J7IA 4C5IA 3S3OA 3OYFA 2FL7A 2KSSA 2EIFA 2FHDA 2LQKA 3QZ5B 3CCEA 2FYKA 1BYMA 3L2RA 1KC8C 3E9GA 4J8OA 3S6WA 2MWOA 1X6OA 4M77A 3QYGB 2EJGA 3TCJA 3KUFA 3JCMe 1YI2A 4HCBA 2X4WA 2KMTA 4XU0A 4BY6C 4FIBA 4C92F 3MEAA 4M7DB 3S3MA 4JDSA 1IREB 1M5Q1 3CCVT 4LDVA 3WVDB 1Q7YC 2AHJB 1WPYA 3EFSA 2Y4XA 4OGEA 4PLIA 4C92E 4PKCC 4ZGEB 5I2MA 2LCLA 1HK9A 2QEXT 1UGRB 1RL2A 3PNWC 3META 4OB0B 3EFRA 1Y96A 4E7HA 1YHQT 1X01A 1UGQB 1WJRA 2LC4A 4QQDA 2PVDB 4LDUA 1VQ7A 3OYEA 2MAMA 1O9SA 4OMFB 1K8AU 3VYGA 3QXEB 2WSFE 2F5KA 5GANe 3CCMT 3OW2S 5KCOA 3G6ET 3GIBA 1VQLA 3RESA 1B34B 3OYKA 4KBMB 1Q86C 3M4YA 4LDWA 3JB9H 3L2VA 1M1GA 2QI2A 2QQAA 2XDPA 1KQSS 2XU8A 2PQWA 1N8RC 4F7UB 4M78C 4DOVA 1W4SA 3NFCA 3LWIA 4M78F 3ASKA 3A8HB 3CCST 4C0GA 3CC7A 3DLLA 4ATOA 3C95A 1QVGS 2CZ6B 3CCJA 3Q1JA 3HRSA 1I8FA 1SSFA 2LDMA 2R5AA 3TREA 5KCHA 3KXTA 1FWZA 1VQ7T 3INZA 4M78A 4YTLA 4V2SA 3OS0A 4BI3A 1BIAA 2K2VA 4XTVA 1AHJB 3A8MB 4CI0C 1FXXA 2ZPIB 2L3RA 2X4YA 2DTHA 4C92G 1NPPA 2DAQA 1Y96B 2RD1A 3HL8A 3JSCA 3M5AA 4JRIA 5DLQE 1KQ1A 4M7AB 3SDZA 4A4HA 3JCMJ 1NJIC 4OGCA 4NL3A 2KAFA 1YBYA 4XTYA 2XI9A 1OZ2A 1D3BB 3CCSA 2RHYA 2VXFA 4QQ6A 3CMEA 3NTKA 1VQ6A 2XIDA 4ELYC 4L5GA 4XTZA 4BY6B 3GP8A 4ZTFA 3JCMX 1LJOA 4M75B 4PJOE 2MI6A 3J80E 4C5HA 3G71A 4M7AF 4QW2A 3X24B 4IKFA 3BW1A 4KUIA 4BACA 1VIFA 4OB3B 4C92C 2R5MA 3A5ZB 3HFNA 5AYFA 4M7DE 3SWNB 4M75F 1QVPA 3OYHA 3M4GA 3ZFJA 1I5LA 4M75C 1Q81C 2MMPA 4XAXB 4BDYA 3CXCA 2RJDA 3P8BB 4A4EA 4Z02A 5GAN7 3MEWA 4M7AA 2ZPEB 4LD6A 3WVEB 1M8VA 3JCMb 2OTJT 1HXDA 2O4XA 3PIOA 3OS2A 5D6YA 5J26A 3I55A 3M58A 1NE8A 2XD0A 2LX9A 4PNOA 3L2QA 3E19A 3E9FA 5L8RE 4NL2A 1VQ4T 2E12A 4IUPA 2V8IA 2BIVA 2LRQA 2XKOC 1K73U 1MGQA 1BI0A 1JJ2A 2EFIA 5EG2A 2CZ1B 3CCUT 1YITT 1LNXA 4M77F 2ZGWA 1K9MC 3GLXA 3QDRB 3G4SA 2RHIA 4M78B 3OMGA 3CC7T 3M53A 3M59A 4X9DA 4A4FA 4C92A 5GANd 1U8RA 2C06A 2P0QA 2EJ9A 1VQMA 3V8KA 2DXCA 1N9RA 2IVWA 4M75A 4OB2B 5J39A 3CMAT 3QG1A 4XU2A 2GF7A 2E70A 3M54A 4KT0E 4MZMA 2EQUA 2K5FA 1K8AC 1QP3A 3JB9D 1VQNA 3C12A 5CKFA 1G3YA 2V8JA 3JRZA 3N5BB 3QKJA 4C0FA 2RJFA 5LJ5f 1RI0A 4XU3A 2PVGB 3HP9A 4QVCA 4J6YA 3CCUA 4Y91A 3QPHA 4E47A 2HAXA 2LTOA 1VQNT 4QVDA 4VUBA 4M77D 2X4XA 3GNFB 2E10A 4N0AA 2LQ8A 3OYBA 1VQKT 2F5TX 2Y90A 5CVIA 1QW1A 3ME9A 3UPUA 5GANh 4M7AG 3FIFA 2EQMA 3JB9J 1G3WA 4PJOC 1TH7A 2E6ZA 2JTFA 3HHTB 3QYHB 2K5LA 4ZN3A 4LDYA 4IUTA 2XDBA 3SWNA 5CR2A 3J81E 1VIEA 4C5GA 2XK0A 1M9SA 5I2SA 5FRMA 2PUOB 4J6WA 4M77B 4PJOA 5LJ5h 3QIIA 2DD4A 4QVZA 3JB9G 1B34A 3JCMg 3LLRA 3JCMc 5KE2A 3OS1A 4GLKA 5FU7C 1H641 4P5NA 3H6ZA 2I2LA 1S72A 2R57A 4JLGA 1WJSA 3OB9A 3PMIA 4C8QC 4M78D 2OTLA 2RI5A 2RHXA 1N8RU 3ZEHA 4N0AC 2WSCE 1UGSB 2PUKB 4UC4A 2IG0A 3LYIA 2KVQG 2JN0A 1OYXA 3O8VA 1Q82C 3CBPA 1VQ6T 4PJOD 4J7FA 5HY6A 2RK1A 3JB9I 5A0LA 2QEXA 3M56A 3SD4A 4M78G 2WACA 2GQVA 4XTUA 5LJ5j 3G71T 2RM4A 5LJ3d 5GAMf 5GAOq 3OYAA 5LJ3g 2D0QB 2F69A 3EAEA 3SWNC 4E7KA 4EMKA 4A4KA 5CQXA 1OI1A 4C8QG 2MF2A 2O01E 5J3BA 4BE0A 2RH2A 2X4JA 4JLIA 5GMKi 2ZCFB 5IN1A 2OTLT 1VQ8A 5IAYA 2RI3A 4F7UE 2DK3A 4MMLA 3F70A 5C6SA 4JRQA 3I55T 4MDWA 4O6JA 5GAOp 5A2QE 1M1KU 3QJ6A 5LJ5e 3UT1A 1KQ2A 3S3NA 4BI8B 4FSXA 2M16A 4C92B 4R56A 3OYDA 4RMOA 2QXFA 4M75D 3LX7A 3OBWA 2RI2A 1YITA 1JB0E 2DXTA 2FB7A 4OP0A 3JCMP 3DB4A 5DM7R 1NZ9A 3UWNA 3RKXA 1N6AA 2LVMA 2LT4A 3RMQA 3VUBA 4EPCA 2LNVA 4M7AE 5FROA 4EMKC 3AHUA 4JJNK 3VKIA 5D6XA 5HKCA 3L2UA 3L2ZA 4HA8A 4PJOF 3OW2A 3OBYA 3VUZA 4O5VA 2K3YA 4C92D 2EJFA 4PLLA 5DLOA 1YJNT 5CIUA 1M90U 3OYGA 2CS7A 4XTXA 3FC3A 1KQSA 4PJOB 3X28B 5CKEA 3CMET 1P92A 5GAMe 2DD5A 4M77E 1M4ZA 3CBMA 2CYZB 3NTHA 1GXIE 3A8LB 3MP6A 3QZ9B 4MDXA 3FDRA 4RCCA 2K4YA 3JCMV 5GAN2 4J6XA 1BI1A 4FM4B 3ER0A 3SFMA 2G3RA 1W2BS 5M9OA 4HCCA 2ZZDA 2DIQA 3BDLA 3PGGA 2KK4A 3HRUA 4EMHA 1UGPB 3PIPA 2YLCA 2RO0A 2HD0A 4C8QA 5GMKm 2DTOA 3MHXA 3L1AA 2QQSA 3RIRA 3URGA 1S72T 3MO8A 4ZGDB 1JJ2S 4N4GA 1VQ5T 1N27A 2O4XB 1BKBA 1XQHA 5LJ3h 4X9CA 2RJCA 4B9WA 5FU6B 1ZHIA 3CC4T 3QSUA 1VQ4A 2E64A 2EWNA 2XHCA 3CCQT 3J7AF 4M7DF 2L5QA 1YHQA 4M7DC 1BI3A 3V8LA 3CC2A 1YJ9T 2DKGA 2XDDA 3RUXA 1Q82U 5FU6C 3BDUA 3V8JA 4DQ2A 3PFSA 5LL6S 2DTIA 3V7RA 1Y7XA 3X20B 3CCQA 3JCMW 2OTJA 2RB6A 2QQRA 3CCMA 1W2BA 4F7UF 3BY7A 3OS5A 1YJ9A 3CPFA 3RERA 1I81A 5CQYA 4B9XA 3HPWA 4FU6A 3OYMA 3VJPA 2H3JA 3FJPA 1U1TA 2LT1A 1Y71A 2EAYA 2RHZA 1YCYA 2ZPBB 3WXMB 3V7CA 5CKDA 4N4HA 2QA4A 1XNIA 3P8DA 4M7DG 5LJ5d 5IT9E 3OSSC 3CCLT 2DIGA 3CC4A 1XOVA 2DZ9A 5HK0A 3E1SA 3KBGA 1YIJT 1M90C 4BE1A 4ELZC 5LJ3e 2HBPA 2RJEA 3X26B 4N4IA 4BUGA 3RKWA 1IZ6A 2E1HA 1MHNA 1I4K1 4IUVA 3OY9A 1JRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAO l;  4M7A D;  1I8F A;  4PJO D;  2DXU A;  3JB9 I;  4V2S A;  3INZ A;  4M78 A;  4M78 G;  4XTU A;  5LJ5 j;  1BIA A;  4XTV A;  2RM4 A;  4M75 G;  1D3B A;  2K57 A;  3FB9 A;  3QUI A;  4M75 E;  5LJ3 d;  4F7U A;  5GAM f;  5LJ3 g;  3SWN C;  5GAO q;  3V7S A;  2DTH A;  4C92 G;  4EMK A;  1Y96 B;  2RD1 A;  4M77 G;  4JRI A;  4C8Q G;  2QTX A;  4M7A B;  1KQ1 A;  1WQW A;  2DJZ A;  5GAO m;  3JCM J;  4XU1 A;  1U1S A;  4NL3 A;  4JLI A;  5GMK i;  4XTY A;  4JRK A;  5GAN g;  1D3B B;  1WQ7 A;  4F7U E;  2VXF A;  4F7U G;  3JCM f;  4MML A;  3JCM Q;  2RA2 A;  3HSB A;  3SB2 A;  5GAO p;  4XTZ A;  1BIB A;  4PJO G;  5LJ5 e;  1LJO A;  4M75 B;  2E65 A;  3JCM X;  1KQ2 A;  4J5Y A;  4PJO E;  2DVE A;  4M7A F;  2DEQ A;  4RCB A;  2CGH A;  3BW1 A;  4NOY A;  4C92 B;  5GAN 3;  4C92 C;  4HT9 A;  2YHT A;  3HFN A;  4M75 D;  4WF2 A;  5GAN f;  4M7D E;  3SWN B;  4M75 F;  3M4G A;  1I5L A;  2DXT A;  2FB7 A;  4M75 C;  2VXE A;  4OP0 A;  5GMK l;  5LJ5 g;  3JCM P;  2E41 A;  3RKX A;  2HNI A;  4M7A C;  5LJ3 j;  5GAN 7;  3JCM h;  5GAM g;  4M7A A;  1M8V A;  3JCM b;  5LJ3 f;  5GAM d;  3QHS A;  1HXD A;  3AHU A;  4EMK C;  4M7D A;  4M7A E;  2DZC A;  3L2Z A;  4HA8 A;  4PJO F;  4PNO A;  4NL2 A;  5GAO r;  5GAN j;  4XTW A;  4C92 D;  2EJF A;  4XQ3 A;  1MGQ A;  5CAI A;  5GAO n;  3JB9 F;  4EMK B;  4XTX A;  4PJO B;  1WNL A;  1JBM A;  4M7D D;  1LNX A;  4M77 F;  4C8Q F;  2ZGW A;  5GAM e;  4M77 E;  4C8Q E;  4JUV A;  3QO3 A;  5GAN 6;  4M78 B;  4RCC A;  5GMK e;  4X9D A;  3JCM V;  4J6X A;  4C92 A;  5GAN d;  5GAN 2;  5GAN 4;  2FYK A;  2EJ9 A;  3V8K A;  3PGG A;  1N9R A;  4M75 A;  4EMH A;  5GMK h;  2YLC A;  4XU2 A;  5GAM j;  5GMK m;  4M77 A;  4C8Q A;  3JCM e;  2EJG A;  2DTO A;  3BFM A;  3L1A A;  3RIR A;  3RKY A;  3JB9 D;  4XU0 A;  5LJ5 f;  4C92 F;  4M7D B;  5GAN 5;  5LJ3 h;  1M5Q 1;  3VU3 C;  4M78 E;  4XU3 A;  4QVC A;  4X9C A;  4J6Y A;  4Y91 A;  5DY9 A;  4QVD A;  4M77 D;  4C8Q D;  5I21 A;  3EFS A;  1WPY A;  2E10 A;  2E64 A;  2EWN A;  4N0A A;  4M7D F;  4C92 E;  2Y90 A;  4M7D C;  4HT8 A;  3V8L A;  3JCM d;  1HK9 A;  5GMK j;  5GAN h;  4M7A G;  3FIF A;  2DKG A;  3JB9 J;  3RUX A;  3EFR A;  5GAM h;  1Y96 A;  4PJO C;  1X01 A;  3BDU A;  1TH7 A;  3V8J A;  3V7R A;  4DQ2 A;  2DTI A;  3JCM W;  2RB6 A;  4F7U F;  5GAN 8;  3BY7 A;  3RER A;  3SWN A;  1I81 A;  4A53 A;  5GAN e;  4EMG A;  3FJP A;  3GIB A;  1U1T A;  3QSU A;  2EAY A;  4J6W A;  4M77 B;  1B34 B;  1N9S A;  1YCY A;  3RES A;  3V7C A;  4C8Q B;  5LJ5 h;  4PJO A;  2VC8 A;  3JB9 H;  5LJ5 d;  4M7D G;  2DZ9 A;  1B34 A;  3JCM g;  1LOJ A;  4MMK A;  3JCM c;  3JB9 G;  4F7U B;  4M78 C;  5LJ3 e;  1H64 1;  2I2L A;  4M78 F;  4A54 A;  4M77 C;  4C8Q C;  4M78 D;  3RKW A;  2E1H A;  4N0A C;  1I4K 1;  2YLB A;  3HFO A;  2JN0 A;  1JRI A; 
#chains in the Genus database with same CATH topology
 2OAU A;  2X9H A;  5KYW A;  2QQB A;  2ECZ A;  3EG0 A;  2KRO A;  3FRN A;  1ZSZ A;  2KR3 A;  2J05 A;  2K2M A;  2CRE A;  4A4G A;  2J6K A;  2P0K A;  1K76 A;  3JCM Q;  1QMC A;  3HRT A;  4JZ4 A;  4BD3 A;  4FT4 A;  2DER A;  2D9T A;  4NOY A;  4E2F B;  3JAM E;  4C5E A;  1WHK A;  4OB1 B;  3CC2 T;  1V1C A;  4RKU E;  2BZ8 A;  4KUD K;  1PSF A;  2PU9 B;  5IHI A;  3ZBD A;  5FWB A;  1RAE B;  2V26 A;  1GRI A;  4ZGJ B;  1VQL T;  3CCR T;  5GAO n;  1M3C A;  1UEC A;  1R77 A;  2F2X A;  1BI2 A;  4DEY A;  4C0Z A;  1PRL C;  4PFZ A;  2YRC A;  1M30 A;  3LH0 A;  5GMK h;  3PTA A;  1KHI A;  1H92 A;  3TEE A;  4R55 A;  4C8Q D;  2DYI A;  1QQJ A;  4C0D B;  2EYQ A;  4OVA A;  2NLU A;  2EQI A;  1K9M U;  1OX9 A;  2YT6 A;  1YI2 T;  3FEO A;  3A8O B;  3MPU B;  2CT4 A;  4GBQ A;  2E3H A;  2ZAE A;  3CCL Q;  2VC8 A;  5KYY B;  1KHC A;  1VYT A;  2HSP A;  1LOJ A;  1NPR A;  5GJV B;  1F1B B;  1M1K C;  2L89 A;  1UJ0 A;  1ARK A;  2FVU A;  1LCK A;  2L8D A;  3OSV A;  2DXU A;  2DL7 A;  2K6D A;  3FB9 A;  4ZN1 A;  2JTE A;  3EGD A;  4LDX A;  1VQM T;  2HCK A;  4XU1 A;  1VQ5 Q;  5GAN g;  1QVF A;  4F7U G;  2ZPG B;  5C0M A;  4F17 A;  1W1F A;  2XIC A;  1D0Y A;  4Z89 A;  2A3L A;  2DEQ A;  2O2O A;  2FPE A;  5GAN 3;  1VQN Q;  1Y57 A;  2JT4 A;  2K3X A;  4ZTJ A;  5LJ5 g;  2DJQ A;  2CP3 A;  2JZ2 A;  2EGE A;  2M02 A;  2FO0 A;  3M57 A;  1H8K A;  1NYF A;  1M2V B;  2KDS A;  4IIM A;  1WYX A;  2Y4Y A;  2JVV A;  4J83 A;  1VQ9 A;  2B86 A;  5GAO r;  4FT2 A;  4B6M A;  4IUR A;  1SRL A;  4PJN A;  4OF1 A;  4EMK B;  3CCV A;  1VQP A;  2DNU A;  4RG8 A;  2QQ9 A;  2VGN A;  4J7I A;  2FL7 A;  2KSS A;  2FHD A;  2HKN A;  2P84 A;  2CDT A;  1EZZ B;  1OU9 A;  4J8O A;  3S6W A;  4M77 A;  3JCM e;  2ROL A;  2KT8 A;  3CCV T;  4LDV A;  3CCV Q;  2FRW A;  1Q7Y C;  1HJD A;  3EFS A;  4PLI A;  2EPD A;  2LNH B;  1HK9 A;  1RL2 A;  3PNW C;  3MET A;  1TUC A;  1YHQ T;  1X01 A;  1WJR A;  1JXM A;  4OMF B;  3PE0 A;  3CCM T;  3G6E T;  3CC4 Q;  2E3I A;  4Z88 A;  1KIK A;  2QQA A;  1AWW A;  2A28 A;  1PRM C;  4F7U B;  4M78 C;  1W4S A;  4M78 F;  1LPL A;  2RMO A;  2L3Q A;  4ATO A;  1QVG S;  1BCO A;  2CP5 A;  3Q1J A;  2EGC A;  2RQR A;  1I8F A;  2R5A A;  1FWZ A;  2FRY A;  4M78 A;  1BB9 A;  3OS0 A;  1AHJ B;  1FXX A;  2ZPI B;  2L3R A;  2DTH A;  2DAQ A;  3HL8 A;  4M7A B;  2LJ0 A;  2KAF A;  3SHW A;  3CCS A;  3CME A;  1WHJ A;  2XID A;  4ELY C;  3GP8 A;  1JQQ A;  4BY6 B;  4ZTF A;  1LJO A;  4M75 B;  4PK4 A;  4M7A F;  4QW2 A;  3BW1 A;  2JJ9 A;  2R5M A;  4DBR A;  1Q81 C;  4BDY A;  3CXC A;  3NGP A;  2ZPE B;  3WVE B;  3PIO A;  5D6Y A;  3UA6 A;  3M0R A;  3H0H A;  2V8I A;  2OTJ Q;  4HXJ A;  3EGD B;  5EG2 A;  1YIT Q;  2CT3 A;  1K9M C;  3CC7 T;  1FYN A;  3TSW A;  4FCY A;  2P0Q A;  1TU0 B;  2EJ9 A;  3V8K A;  4M75 A;  4AT1 B;  2E70 A;  4MZM A;  2K5F A;  2EVR A;  3RDV A;  1VQN A;  3OW2 P;  2V8J A;  3N5B B;  1FMK A;  1YWP A;  1RI0 A;  4VUB A;  3GNF B;  2E10 A;  3OYB A;  1QW1 A;  5GAN h;  2VAS A;  3FIF A;  2EQM A;  3JB9 J;  3I56 Q;  4PJO C;  1TXQ A;  3QYH B;  2K5L A;  8AT1 B;  3HTR A;  1SSH A;  3J81 E;  1M9S A;  4PJO A;  5LJ5 h;  1B07 A;  4QVZ A;  5FU7 C;  1VQ6 Q;  4P5N A;  2R57 A;  2OTL A;  2ED1 A;  5KYW B;  3ZL7 C;  3ZEH A;  4N0A C;  1UGS B;  3AT1 B;  3LYI A;  1MMN A;  4J7F A;  2RK1 A;  5A0L A;  3M56 A;  4X1V A;  2WAC A;  3G71 T;  2RM4 A;  1RAF B;  2ED0 A;  2O88 A;  3SWN C;  4IIO A;  2DYB A;  2MF2 A;  4BE0 A;  2C0T A;  1GCP A;  1IRX A;  1VQ8 A;  2X3W D;  4MML A;  3F70 A;  5C6S A;  1MMA A;  3RNJ A;  5GAO p;  1PG5 B;  3QJ6 A;  3UT1 A;  1SHG A;  4FSS A;  3IQL A;  2QXF A;  1IGQ A;  1VQO Q;  5DM7 R;  1NZ9 A;  1N6A A;  3VUB A;  4M7A E;  3AHU A;  4EMK C;  2CH4 W;  3VKI A;  1Y0M A;  4PJO F;  1S72 Q;  1RAD B;  2CP6 A;  3OBY A;  1PNJ A;  3FJ5 A;  2RF0 A;  2EJF A;  5DLO A;  2DL3 A;  5CIU A;  1M90 U;  4PJM A;  3CME T;  2RPN A;  4GLM A;  4RCC A;  4J6X A;  3G6E Q;  1W2B S;  5M9O A;  2DTO A;  3L1A A;  3URG A;  1S72 T;  1JJ2 S;  1PCX A;  2BTT A;  1BKB A;  5LJ3 h;  1KC8 R;  4X9C A;  2JM8 A;  3J7A F;  4E6R A;  4M7D C;  3V8L A;  3CC2 A;  2QG9 B;  2DKG A;  3VS5 A;  5EC7 A;  2XDD A;  1Q82 U;  3PFS A;  3CCQ A;  2OTJ A;  1Y7X A;  1JXO A;  3CCM A;  1W2B A;  2RQT A;  4B9X A;  2K7A A;  4FYV B;  3OYM A;  2RHZ A;  1YCY A;  2QA4 A;  1M2O A;  5IT9 E;  5HK0 A;  4BE1 A;  4LN2 A;  4N4I A;  5KYY A;  1JRI A;  2HBW A;  1ZBX A;  1QP2 A;  1Q81 U;  2LCC A;  4M75 G;  2K57 A;  1WX6 A;  2VV5 A;  3HKS A;  3QBY A;  3CCE T;  5GAO m;  1WQW A;  1S1N A;  1YN8 A;  1K9A A;  4TVR A;  2ZPH B;  2QTV A;  1TUG B;  4CRI A;  3LGL A;  4AMC A;  4RCB A;  2D6F A;  1Z9Q A;  4HT9 A;  2JUF A;  2BUD A;  3MP1 A;  2KEA A;  4RG2 A;  3L42 A;  1MUZ A;  2HL3 A;  3QHS A;  1XTD A;  1WI7 A;  1R0B G;  5GAN j;  5FU7 B;  2RQW A;  2ZPF B;  4KGX B;  3A8G B;  1WNL A;  3OYC A;  5CKB A;  5GAN 6;  2E6N A;  3FLG A;  2IIM A;  2W10 A;  5GMK e;  5GAN 4;  2DET A;  1YCS B;  2DL4 A;  1WIE A;  3CCJ T;  1D0Z A;  2OAW A;  1I1J A;  3BFM A;  5ECA A;  5GAN 5;  1Q7Y U;  1VQO A;  3VU3 C;  4F04 B;  3OYI A;  1AZE A;  1ZSZ B;  4OMP A;  2L2P A;  3I56 A;  1KK7 A;  4E7L A;  4AFU C;  3JCM d;  3MEU A;  2GFA A;  4II1 A;  2XG8 D;  1PHT A;  1IGU A;  5GAM h;  1D1C A;  2HQE A;  3O5Z A;  2WSE E;  5GAN 8;  3CBO A;  3E2U A;  1WHL A;  4BI4 A;  1AWO A;  4D6W A;  4MMK A;  3LH5 A;  4E7J A;  3CPW S;  1VQ9 Q;  3OYJ A;  3CCR Q;  5A0D A;  5CO7 A;  2NUP A;  2YLB A;  1M3B A;  1OPL A;  1C6V X;  1T3L A;  4IUU A;  3T9N A;  3CMA Q;  4E7I A;  4M7A D;  3QUI A;  3G4S T;  3MEV A;  1N8R R;  4M77 G;  2QTX A;  2OX7 A;  3CXC S;  4JRK A;  1Q81 R;  1WQ7 A;  3UF4 A;  2MWP A;  3G6E A;  3JCM f;  2VWF A;  3SB2 A;  1DJ7 B;  1VQM Q;  3CEY A;  1ABQ A;  2E65 A;  1ZA1 B;  2FZG B;  2DEU A;  2O9S A;  4WF2 A;  3CMA A;  2EYZ A;  3OQ5 A;  1G8X A;  2VXE A;  2DL8 A;  2YWW A;  4IUQ A;  3M9Q A;  1M90 R;  5LJ3 j;  5GAM g;  3VV0 A;  1QVG A;  1IXD A;  1H3Z A;  2YUQ A;  2JTM A;  1PSE A;  1VQP T;  1MNE A;  3CPW P;  1GFD A;  4PL6 A;  2BE7 D;  1VQO T;  5KYN A;  2VGM A;  4J9D A;  4L6V 5;  4JUV A;  3QO3 A;  4OMM A;  3OYF A;  3CCU Q;  1BYM A;  3L2R A;  1QCF A;  1D09 B;  3QYG B;  4HCB A;  3KUF A;  1YI2 A;  4BY6 C;  1PM3 A;  2KMT A;  4LNP A;  4FIB A;  1M5Q 1;  1MV3 A;  4JJD A;  1G83 A;  4OGE A;  5KYU A;  4PKC C;  5I2M A;  4KGV B;  2QEX T;  1UGR B;  2KE9 A;  4OB0 B;  3EFR A;  2JS2 A;  1U5S A;  1YHQ Q;  1PKT A;  2LZ6 B;  2LC4 A;  4LDU A;  1RLP C;  3M0U A;  3CCJ Q;  4LXC A;  1K8A U;  1AOJ A;  3VYG A;  2F5K A;  5GAN e;  1OU8 A;  1VQL A;  4KBM B;  1GBR A;  3M4Y A;  2LQN A;  1M1G A;  1KQS S;  2XU8 A;  2PQW A;  3VRY A;  1ZUU A;  1QVF P;  2DRK A;  3CCS T;  2NUT A;  1SSF A;  5GJW B;  3TRE A;  4V2S A;  3KXT A;  3INZ A;  4YTL A;  4XTV A;  2ROT A;  4C92 G;  1NPP A;  3SDZ A;  4FYX B;  4A4H A;  1KQ1 A;  1IB8 A;  4NL3 A;  4XTY A;  1YJW Q;  1OZ2 A;  2VXF A;  2OTL Q;  2HDA A;  3NTK A;  2J6F A;  4LUE A;  1VQ6 A;  4L5G A;  2MI6 A;  3J80 E;  2A08 A;  2KT1 A;  3X24 B;  4IKF A;  2DIL A;  4OB3 B;  4KGZ B;  1UDL A;  1FMV A;  4M75 F;  3OYH A;  3CCE Q;  3ZFJ A;  4M75 C;  2MMP A;  2SEM A;  4A4E A;  2K79 A;  2FZC B;  3H41 A;  4J9I A;  4AFQ C;  4AG2 C;  3I55 A;  2XD0 A;  2LX9 A;  4PNO A;  3E9F A;  1VQ4 T;  2E12 A;  4IUP A;  1VQ8 Q;  1RAG B;  2LX7 A;  2XKO C;  2H3E B;  2PTK A;  3CXC P;  1D1A A;  1YIT T;  2FZK B;  1X2Q A;  4J9C A;  3VS3 A;  3PVL A;  5GAN d;  2C06 A;  4LUD A;  1E6H A;  1VQM A;  2DXC A;  3VS6 A;  4OB2 B;  3CMA T;  3QG1 A;  2FG0 A;  4XU2 A;  3RBB B;  1UFF A;  1QP3 A;  3JRZ A;  1M27 C;  1UHC A;  1NM7 A;  4J6Y A;  3QPH A;  2LTO A;  5IH2 A;  4QVD A;  2EYY A;  4AG1 C;  2ESW A;  4JJB A;  4N0A A;  1NEB A;  1J3T A;  2CP7 A;  2E6Z A;  4LDY A;  2A36 A;  2VB6 A;  3SWN A;  2QA4 Q;  1VIE A;  2QAZ A;  5I2S A;  1MV0 B;  1WLP B;  2ENM A;  1K9M R;  3JCM g;  3LLR A;  5KE2 A;  4RTU A;  4F16 A;  3H6Z A;  1S72 A;  4JLG A;  4C8Q C;  4M78 D;  1N8R U;  4CC7 A;  1WXT A;  2P4R A;  1Q82 C;  2AZV A;  3CBP A;  1VQ6 T;  4PJO D;  4EIK A;  3BE3 A;  4XTU A;  5KYU B;  1AEY A;  4KRT A;  3R6N A;  4EMK A;  4CC2 A;  2KRS A;  2X4J A;  4JLI A;  1JO8 A;  1U06 A;  2DK3 A;  4JRQ A;  3I55 T;  1M1K U;  2GTJ A;  1EX4 A;  1QKX A;  3G4S Q;  4C92 B;  5D7U A;  4RMO A;  1NEG A;  1WHG A;  3UAT A;  1YIT A;  4OP0 A;  3JCM P;  3C0C A;  2QGF B;  3RKX A;  2CP2 A;  2CUD A;  2LT4 A;  4AFS C;  3RMQ A;  4EPC A;  1KD1 R;  4D8K A;  2AIR B;  5FRO A;  4JJN K;  1D1B A;  5HKC A;  4A63 B;  4O5V A;  2EYW A;  4PLL A;  1YJN T;  4PJO B;  3X28 B;  3H0F A;  2MIO A;  4M77 E;  2CYZ B;  3REB B;  1GXI E;  1VQL Q;  4J9F A;  2X3X D;  4D8D A;  5GAN 2;  3EG9 A;  3SFM A;  2DIQ A;  4RTW A;  5GMK m;  2K3B A;  2O4X B;  1ZA2 B;  1SG5 A;  3EG2 A;  1ZHI A;  1E6G A;  2E64 A;  4RUG A;  4FYY B;  5FW9 A;  1K8A R;  2L5Q A;  1YHQ A;  2FPD A;  1YJ9 T;  3CD6 Q;  3V8J A;  3V7R A;  2DTI A;  2QQR A;  3BY7 A;  3CPF A;  1I81 A;  5CQY A;  4FU6 A;  1KFZ A;  2LT1 A;  1B7T A;  1SPK A;  5CKD A;  3OSS C;  3CCL T;  2DE0 X;  1PKS A;  2HL5 C;  5LJ3 e;  2HBP A;  3X26 B;  2NYS A;  1TTH B;  3RKW A;  1IZ6 A;  1NBE B;  2HQX A;  3OA6 A;  5FRN A;  4BB7 A;  3A1P A;  1HSQ A;  3NTI A;  4M75 E;  1UEB A;  1YNZ A;  4FL6 A;  1G2B A;  4HCZ A;  1RUW A;  1YJW A;  3TQ7 P;  1YIJ A;  3QJY A;  1YJN A;  3CME Q;  2CKK A;  3I5R A;  2VYT A;  4PJO G;  3GBQ A;  3UDC A;  4J5Y A;  1WHM A;  5I22 A;  3G7Z A;  2V1R A;  5AT1 B;  2BKD N;  4FW1 A;  4J9B A;  4AFZ C;  2F2V A;  2HZY A;  5GMK l;  5HK3 A;  1KJW A;  5KYX B;  2E41 A;  1UB4 A;  1VYV A;  1WFW A;  2SRC A;  2VUB A;  5GAM d;  3OYY A;  2DZC A;  2CZ7 B;  3OYN A;  1X6G A;  2DM1 A;  4CC4 B;  1X69 A;  1RAH B;  3DB3 A;  1K4U S;  4HKE A;  4L59 A;  1QWE A;  2A7Y A;  1HD3 A;  2EKO A;  3CCR A;  2RHU A;  1I0C A;  2KYM A;  1BK2 A;  2EBP A;  2COW A;  5GAM j;  4Y92 A;  1VQ8 T;  3M55 A;  2EQK A;  8ATC B;  1Y07 A;  3DKM A;  4M78 E;  1N5Z A;  3H8Z A;  5DY9 A;  5I21 A;  2Z0W A;  2J6O A;  1V29 B;  3VYH B;  3M0S A;  3P8H A;  1G5V A;  1VQK A;  1OZ3 A;  2YRV A;  2PNI A;  4MZP A;  2COY A;  4C8Q B;  1T0J A;  4RTV A;  1RI9 A;  2JXB A;  5KE3 A;  3GF5 A;  2LJ3 A;  1Q95 G;  3X25 B;  4M77 C;  3LGF A;  4JZ3 A;  4EDU A;  3HFO A;  1VQK Q;  4HT8 A;  3PMT A;  2YXY A;  1KSW A;  1ZUY A;  4JS5 A;  1RAI B;  3EHQ A;  1D3B A;  4F7U A;  2KQW A;  2NWM A;  1Q86 U;  1TG0 A;  3R6O A;  4ZNX A;  2NUP B;  3CQT A;  1U1S A;  2EKH A;  1SHF A;  4PJJ A;  2QA4 T;  1HYO A;  1VUB A;  2JW4 A;  2KY9 A;  1KD1 U;  5IXB A;  1WJQ A;  2CGH A;  2QDL A;  1YJ9 Q;  3KFV A;  4PJL A;  4X34 A;  1FX7 A;  1I5O B;  2P0P A;  4M7A C;  4JRP A;  1YP5 A;  2DPP B;  2L0A A;  2JOY A;  1YJW T;  3CD6 T;  4DOW A;  3GNG A;  5CAI A;  1UUE A;  1WA7 A;  3GOX A;  1JBM A;  2QK0 A;  2YSQ A;  3QZ5 B;  3CCE A;  2FYK A;  1KC8 C;  3E9G A;  2MWO A;  2YUP A;  1VQP Q;  4WTO B;  3MEA A;  4M7D B;  4F14 A;  3M0P A;  3WVD B;  5IXF A;  4J9E A;  4PFP A;  2AHJ B;  3CC2 Q;  4DBH A;  4ZGE B;  2LMJ A;  2EYX A;  3CCM Q;  1OOT A;  2DLP A;  1ABO A;  1PD0 A;  2MAM A;  1JU5 C;  3OW2 S;  5KCO A;  1PC0 A;  3RES A;  1B34 B;  3OYK A;  1T0H A;  1UG1 A;  3L2V A;  3I5S A;  3MJX A;  1N8R C;  1A0N B;  1TUD A;  3NFC A;  1GCQ A;  3A8H B;  4C0G A;  2QEX Q;  3CC7 A;  3DLL A;  4M4Z A;  3HRS A;  3NHN A;  2LDM A;  1MND A;  3CCS Q;  1PWT A;  1BIA A;  3A8M B;  2X4Y A;  2E5K A;  5FWC A;  2KBT A;  3JSC A;  1Y96 B;  3UA7 A;  4OGC A;  1YBY A;  2XI9 A;  2J06 A;  1IHW A;  2RHY A;  1M2V A;  2D0N A;  2CUB A;  2KXC A;  3JCM X;  4PJO E;  2JMA A;  2F2W A;  3EG9 B;  2OI3 A;  2LJ1 A;  1VIF A;  4KUI A;  4BAC A;  5AYF A;  1GBQ A;  3HFN A;  4M7D E;  3SWN B;  1QVP A;  3M4G A;  3I9Q A;  1IO6 A;  4XAX B;  2M51 A;  2RJD A;  3P8B B;  4Z02 A;  5GAN 7;  1NYG A;  2A0F B;  3MEW A;  1M8V A;  3JCM b;  1HXD A;  3OS2 A;  3I35 A;  3M58 A;  1NE8 A;  3L2Q A;  3E19 A;  1QKW A;  5HCK A;  2LRQ A;  1K73 U;  1MGQ A;  1BI0 A;  1K0X A;  2CZ1 B;  3CCU T;  1LNX A;  4M77 F;  2ZGW A;  3QDR B;  3G4S A;  2RHI A;  3M0Q A;  4RTT A;  3M53 A;  4X9D A;  4A4F A;  4C92 A;  1U8R A;  1ZUK A;  1AVZ C;  1N9R A;  5J39 A;  1WZO A;  3M54 A;  4FYW B;  4KT0 E;  1K8A C;  3JB9 D;  1G3Y A;  3THK A;  3H9N A;  2PVG B;  3HP9 A;  3CCU A;  2HAX A;  4M77 D;  2X4X A;  1VOM A;  4JPB W;  4ESR A;  5CVI A;  3UPU A;  2F1L A;  4M7A G;  1G3W A;  1TOV A;  1TH7 A;  2JTF A;  2VVK A;  4ZN3 A;  4IUT A;  2LCS A;  2C0I A;  4C5G A;  1JJ2 P;  2MCN A;  4J6W A;  3QII A;  2DD4 A;  3JB9 G;  1B34 A;  3JCM c;  3OS1 A;  1H64 1;  2I2L A;  2EGA A;  3OB9 A;  2RI5 A;  2RHX A;  2XMF A;  2WSC E;  1Q86 R;  2JN0 A;  2KVQ G;  1OYX A;  1TWB A;  5HY6 A;  3JB9 I;  4HVW A;  2AK5 A;  2QEX A;  3EFO A;  3CC7 Q;  2GQV A;  5LJ5 j;  3EFO B;  5LJ3 d;  5GAO q;  3OYA A;  2D0Q B;  1ZSZ C;  5L23 A;  4E7K A;  1VYU A;  5J3B A;  2RH2 A;  2ZCF B;  1NLO C;  7AT1 B;  2GTO A;  4MDW A;  5A2Q E;  3I55 Q;  2EW3 A;  4BI8 B;  3EH1 A;  2VKN A;  3ULR B;  2OJ2 A;  4R56 A;  3OYD A;  1NJI R;  4M75 D;  3OBW A;  2O31 A;  2RI2 A;  3D7S B;  2FB7 A;  3DB4 A;  1KQS P;  3UWN A;  2LVM A;  4OMQ A;  2BZY A;  3L2U A;  4HA8 A;  3OW2 A;  4QT7 A;  2K3Y A;  2JS0 A;  4K11 A;  3OYG A;  2CS7 A;  2O9V A;  2KYB A;  1M8M A;  1P92 A;  5GAM e;  4R0K A;  3A8L B;  3MP6 A;  4J9H A;  2K4Y A;  3JCM V;  1BI1 A;  3ER0 A;  2G3R A;  3BDL A;  2RN8 A;  2KK4 A;  1UGP B;  2YLC A;  2RO0 A;  2LP5 A;  1R0C B;  4FW2 A;  1UE9 A;  3MHX A;  2QQS A;  3MO8 A;  1X43 A;  4N4G A;  1N27 A;  1XQH A;  1SKU B;  4B9W A;  1B3Q A;  5FU6 B;  3CC4 T;  1VQ4 A;  1UHF A;  2EWN A;  3CCQ T;  1UJY A;  1ZBJ A;  1BI3 A;  2DBK A;  1ZLM A;  3RUX A;  3EG3 A;  3X20 B;  2RB6 A;  2KI7 A;  3OS5 A;  1AWJ A;  2I0N A;  3HPW A;  2AT1 B;  4HVU A;  2H3J A;  3FJP A;  1U1T A;  3WXM B;  1Y71 A;  2EAY A;  3QSU A;  2ZPB B;  1XNI A;  2H8H A;  3CC4 A;  1ZSG A;  2DIG A;  2DZ9 A;  3QWX X;  1YIJ T;  4ELZ C;  1TSF A;  2RJE A;  1W6X A;  2E1H A;  2HKQ B;  1I4K 1;  2GNC A;  3OY9 A;  2R58 A;  1NLP C;  2CSQ A;  4BDZ A;  2PVO B;  4JS4 A;  4ME7 A;  2JMC A;  3OMC A;  2CZ0 B;  2YUO A;  1O75 A;  5CCA A;  1OUL A;  2DJZ A;  2GCX A;  3DLM A;  2YRD A;  1K73 C;  2M1H A;  4NS5 A;  1R8O B;  2DO3 A;  1SEM A;  5CKH A;  2J7I A;  1U3O A;  3VS7 A;  2COZ A;  1YFN A;  2HMA A;  2P4T A;  1VQ5 A;  1K73 R;  4MZT A;  1WHH A;  3TSZ A;  3JCM h;  3C4S A;  5LJ3 f;  4M7D A;  1NJI U;  5A0G A;  2DBM A;  3H0I A;  2KNB B;  1X27 A;  2DXB A;  4XK8 E;  1K0S A;  1G3T A;  1UTI A;  5KYX A;  3OYL A;  4C8Q F;  2EQJ A;  3RMS A;  1QVF S;  4Y28 E;  3LWH A;  4Z8A A;  1SF9 A;  2CH4 A;  1W2B P;  1MMG A;  2C0O A;  3RKY A;  2LQW A;  4C0D C;  1QLY A;  1RAB B;  2X35 A;  2M9U A;  2FPF A;  1OPK A;  5GMK j;  2RK2 A;  1TS9 A;  3TU4 K;  1KD1 C;  2M0O A;  4GY5 A;  1KC8 U;  1OV3 A;  3LW5 E;  4A53 A;  2GQI A;  5IHK A;  1N9S A;  4KUL A;  3CD6 A;  1WXU A;  1Q82 R;  3C94 A;  3G71 Q;  4Q5W A;  1KG1 A;  4ORZ A;  5CK9 A;  2HEQ A;  2HSE B;  4A54 A;  1YJN Q;  2GFU A;  2K5I A;  4EMG A;  1QCN A;  2KRM A;  1PD1 A;  5GAO l;  1RAA B;  2NUZ A;  1LVK A;  4E7Z A;  3MP8 A;  3V7S A;  4DEX A;  1H3H A;  4DA4 A;  3MCA B;  4DBQ A;  2ATC B;  2CP0 A;  2E5Q A;  2V8K A;  2KRN A;  5FLX E;  2RA2 A;  3HSB A;  1WGS A;  3VS0 A;  1BIB A;  3CPW A;  4LD9 K;  1CSK A;  2ABL A;  5D6W A;  3CCQ Q;  2DVE A;  3I56 T;  2YHT A;  5GAN f;  2DL5 A;  2JNG A;  3GPL A;  4BE2 A;  2HNI A;  3A98 A;  3CCL A;  1UGV A;  2B8A A;  1ZQ1 A;  4ANJ A;  1G3S A;  1X75 C;  1EIF A;  2D8J A;  3PT9 A;  4RTZ A;  1RAC B;  1EFN A;  1M1F A;  4RTX A;  1K1Z A;  1C0M A;  2MPX C;  1GFC A;  2BE9 B;  2DRM A;  4XTW A;  4OML A;  4XQ3 A;  1OX8 A;  3JB9 F;  5KH6 A;  1VQ9 T;  2QDY B;  3L2W A;  4M7D D;  4QQG A;  1ZX6 A;  4C8Q E;  2V1Q A;  3S3O A;  4C5I A;  2EIF A;  2LQK A;  4CC3 A;  1X6O A;  2DF6 A;  1D0X A;  3TCJ A;  2EJG A;  2QYZ A;  1OEB A;  2X4W A;  4XU0 A;  4C92 F;  1SRM A;  3S3M A;  1AWX A;  4JDS A;  1IRE B;  4E7S A;  1WXB A;  2AKK A;  1ACM B;  1W70 A;  1WPY A;  2Y4X A;  4C92 E;  2LCL A;  2RQV A;  1Y96 A;  4E7H A;  1YI2 Q;  1Q7Y R;  1UGQ B;  1AD5 A;  1NG2 A;  4QQD A;  2PVD B;  1VQ7 A;  3OYE A;  1O9S A;  3QXE B;  2WSF E;  3GIB A;  1Q86 C;  4LDW A;  3JB9 H;  5I11 A;  2MOX A;  2QI2 A;  2XDP A;  4DOV A;  1X6B A;  3LWI A;  1QWF A;  3ASK A;  1YWO A;  3C95 A;  3EGX A;  2CZ6 B;  3CCJ A;  6AT1 B;  4WCI A;  5KCH A;  1VQ7 T;  4BI3 A;  2K2V A;  1VA7 A;  1Z9Z A;  4CI0 C;  1M1K R;  1YIJ Q;  1I07 A;  3VS2 A;  1QVG P;  2RD1 A;  3JCM J;  4JRI A;  3M5A A;  1NJI C;  5DLQ E;  1WDX A;  3JV3 A;  1D3B B;  4QQ6 A;  1E7O A;  4XTZ A;  3VS1 A;  2YUN A;  1T3S A;  2X51 A;  4C5H A;  3G71 A;  1AT1 B;  9ATC B;  1CKA A;  1MMD A;  1XJW B;  4C92 C;  3A5Z B;  2L3P A;  2DA9 A;  1I5L A;  4JJC A;  2YDL A;  4M7A A;  1BU1 A;  4LD6 A;  2OTJ T;  2DFU A;  2O4X A;  4RTY A;  5J26 A;  5L8R E;  4NL2 A;  3G1J A;  2BIV A;  1CKB A;  2D8H A;  1JJ2 A;  2EFI A;  2D1X A;  2GGR A;  3GLX A;  3PVQ A;  4M78 B;  3OMG A;  3M59 A;  1OQK A;  2IVW A;  2GF7 A;  1IHV A;  1RLQ C;  2EQU A;  3C12 A;  5CKF A;  4C0F A;  5LJ5 f;  3QKJ A;  2RJF A;  4LE9 A;  4XU3 A;  4QVC A;  2XDB A;  4Y91 A;  4E47 A;  1VQN T;  4HVV A;  2LQ8 A;  1VQK T;  2F5T X;  2Y90 A;  3ME9 A;  1BCM A;  5IHN A;  2KGT A;  3HHT B;  2AKL A;  1C1A A;  5CR2 A;  4QKU A;  2G6F X;  2L3S A;  4HCK A;  2XK0 A;  5FRM A;  1M3A A;  2K9G A;  2PUO B;  2NUT B;  4M77 B;  4KH1 B;  3EGX B;  3TVT A;  2E4H A;  4KH0 B;  1VQ4 Q;  4GLK A;  4OMO A;  1WJS A;  3PMI A;  1GCQ C;  1V76 A;  2MYS A;  2PUK B;  4UC4 A;  2IG0 A;  3O8V A;  3VRZ A;  2DX1 A;  2DVJ A;  2CSI A;  3SD4 A;  4M78 G;  2QGG A;  5GAM f;  1JEG A;  5LJ3 g;  2F69 A;  3EAE A;  4A4K A;  5CQX A;  1OI1 A;  4C8Q G;  2O01 E;  3MKD A;  2MK5 A;  3VS4 A;  5GMK i;  5IN1 A;  2OTL T;  5IAY A;  2RI3 A;  4F7U E;  2PZ1 A;  4O6J A;  5LJ5 e;  1KQ2 A;  3S3N A;  4FSX A;  2M16 A;  3SEM A;  2HQH A;  1GL5 A;  3LX7 A;  1JB0 E;  2DXT A;  1X2K A;  4PFO A;  4J9G A;  2LNV A;  2M0Y A;  2RNA A;  5D6X A;  3L2Z A;  3VUZ A;  4C92 D;  2QAS A;  3M0T A;  4XTX A;  3FC3 A;  1KQS A;  3EG1 A;  2W0Z A;  5CKE A;  3NMZ C;  3REA B;  2DD5 A;  1M4Z A;  3CBM A;  3NTH A;  3QZ9 B;  4MDX A;  3FDR A;  3EGU A;  4HCC A;  4FM4 B;  3EHR A;  2ZZD A;  3PGG A;  1FMW A;  2DMO A;  4EMH A;  3HRU A;  3PIP A;  3QDF A;  2HD0 A;  4C8Q A;  2AZS A;  3RIR A;  3RR6 A;  4ZGD B;  1VQ5 T;  2IPO B;  2RJC A;  2XHC A;  4M7D F;  1QCO A;  3NPF A;  2RQU A;  2JM9 A;  1VQ7 Q;  5FU6 C;  3U23 A;  3BDU A;  4DQ2 A;  5LL6 S;  3JCM W;  4F7U F;  3EH2 A;  1YJ9 A;  3RER A;  4DBF A;  2KXD A;  2A37 A;  3VJP A;  1BBZ A;  1AZG B;  4N4H A;  2BZX A;  2GBQ A;  3P8D A;  3V7C A;  5LJ5 d;  4M7D G;  1XOV A;  1M90 C;  3E1S A;  3KBG A;  4OMN A;  2FEI A;  4BUG A;  1MHN A;  4IUV A;  3QWY A; 
#chains in the Genus database with same CATH homology
 2HQX A;  1ZBX A;  2R58 A;  2OAU A;  4BDZ A;  2PVO B;  4JS4 A;  4ME7 A;  1QP2 A;  3OA6 A;  5FRN A;  4BB7 A;  1Q81 U;  2LCC A;  3NTI A;  3OMC A;  2CZ0 B;  4M75 G;  2K57 A;  2QQB A;  4M75 E;  1UEB A;  2VV5 A;  3HKS A;  4FL6 A;  4HCZ A;  3FRN A;  3QBY A;  1YJW A;  1O75 A;  3CCE T;  5GAO m;  1YIJ A;  3QJY A;  1WQW A;  2DJZ A;  2GCX A;  4A4G A;  5CCA A;  1YJN A;  2P0K A;  3DLM A;  4TVR A;  2CKK A;  1K73 C;  2ZPH B;  3JCM Q;  2M1H A;  4NS5 A;  2VYT A;  1R8O B;  3HRT A;  4BD3 A;  2DO3 A;  4CRI A;  3LGL A;  4PJO G;  5CKH A;  4FT4 A;  3UDC A;  4J5Y A;  2D9T A;  3G7Z A;  4RCB A;  2D6F A;  4NOY A;  2BKD N;  4HT9 A;  3JAM E;  4C5E A;  2P4T A;  4OB1 B;  3CC2 T;  5GMK l;  5HK3 A;  4RKU E;  2E41 A;  1UB4 A;  2JUF A;  4MZT A;  1VQ5 A;  4KUD K;  1PSF A;  3JCM h;  2BUD A;  2PU9 B;  3C4S A;  3MP1 A;  4RG2 A;  2VUB A;  3L42 A;  3QHS A;  5LJ3 f;  5GAM d;  4M7D A;  3OYY A;  1XTD A;  3ZBD A;  2DZC A;  1NJI U;  2CZ7 B;  3OYN A;  5A0G A;  5GAN j;  5FU7 B;  2ZPF B;  4ZGJ B;  1VQL T;  3CCR T;  5GAO n;  2DXB A;  4XK8 E;  1G3T A;  3DB3 A;  3A8G B;  1WNL A;  4HKE A;  1BI2 A;  4L59 A;  3OYL A;  4C8Q F;  3OYC A;  5CKB A;  2A7Y A;  4C0Z A;  2EKO A;  5GAN 6;  2E6N A;  2EQJ A;  3FLG A;  3RMS A;  3CCR A;  2RHU A;  5GMK e;  4Y28 E;  1QVF S;  3LWH A;  5GAN 4;  3LH0 A;  5GMK h;  3PTA A;  3CCJ T;  1KHI A;  5GAM j;  1VQ8 T;  3M55 A;  3BFM A;  3RKY A;  2EQK A;  4C0D C;  5GAN 5;  1Q7Y U;  1VQO A;  1Y07 A;  3DKM A;  4M78 E;  3VU3 C;  3OYI A;  3TEE A;  2X35 A;  3H8Z A;  4R55 A;  5DY9 A;  2M9U A;  4C8Q D;  5I21 A;  3I56 A;  4E7L A;  4C0D B;  3JCM d;  2EYQ A;  4OVA A;  5GMK j;  2RK2 A;  2GFA A;  1V29 B;  2NLU A;  2XG8 D;  3MEU A;  4II1 A;  3VYH B;  5GAM h;  3TU4 K;  3P8H A;  1KD1 C;  1G5V A;  2M0O A;  1K9M U;  1VQK A;  4GY5 A;  2HQE A;  1YI2 T;  1KC8 U;  3FEO A;  2WSE E;  3A8O B;  5GAN 8;  1OZ3 A;  2YRV A;  3CBO A;  3LW5 E;  4A53 A;  4MZP A;  4BI4 A;  4C8Q B;  1N9S A;  4KUL A;  3CD6 A;  3C94 A;  2VC8 A;  1KHC A;  4Q5W A;  1KG1 A;  4D6W A;  5KE3 A;  1LOJ A;  4MMK A;  5CK9 A;  4E7J A;  1NPR A;  3GF5 A;  1M1K C;  2L89 A;  3CPW S;  2FVU A;  3X25 B;  3OYJ A;  4A54 A;  4M77 C;  5A0D A;  2GFU A;  2K5I A;  3LGF A;  5CO7 A;  2L8D A;  2YLB A;  4EDU A;  3HFO A;  3OSV A;  4EMG A;  4HT8 A;  3PMT A;  5GAO l;  4JS5 A;  2DXU A;  4IUU A;  3T9N A;  4E7I A;  1D3B A;  3FB9 A;  3QUI A;  4M7A D;  3G4S T;  3MP8 A;  3MEV A;  4F7U A;  3V7S A;  4ZN1 A;  2KQW A;  1Q86 U;  4DA4 A;  3MCA B;  4M77 G;  4LDX A;  2QTX A;  3R6O A;  1VQM T;  4XU1 A;  1U1S A;  2E5Q A;  2V8K A;  3CXC S;  4JRK A;  5GAN g;  2QA4 T;  1QVF A;  1WQ7 A;  2MWP A;  4F7U G;  3JCM f;  5FLX E;  1VUB A;  3G6E A;  2RA2 A;  3HSB A;  3SB2 A;  1DJ7 B;  2ZPG B;  5C0M A;  1WGS A;  1BIB A;  3CEY A;  3CPW A;  2KY9 A;  2E65 A;  2XIC A;  1KD1 U;  5D6W A;  4LD9 K;  2DVE A;  1WJQ A;  2A3L A;  3I56 T;  2DEQ A;  2CGH A;  5GAN 3;  2YHT A;  5GAN f;  4WF2 A;  3CMA A;  2JNG A;  3GPL A;  2K3X A;  4X34 A;  1FX7 A;  3OQ5 A;  5LJ5 g;  4ZTJ A;  2VXE A;  4BE2 A;  2HNI A;  2P0P A;  4IUQ A;  3M9Q A;  2JZ2 A;  5LJ3 j;  4JRP A;  3CCL A;  4M7A C;  2B8A A;  5GAM g;  1ZQ1 A;  3M57 A;  3VV0 A;  2DPP B;  1QVG A;  1G3S A;  1X75 C;  2KDS A;  1EIF A;  2Y4Y A;  1H3Z A;  2JOY A;  2JVV A;  4J83 A;  3PT9 A;  2JTM A;  1PSE A;  1YJW T;  1VQP T;  1VQ9 A;  1M1F A;  5GAO r;  4FT2 A;  4XTW A;  3CD6 T;  4IUR A;  4DOW A;  3GNG A;  4XQ3 A;  5CAI A;  3JB9 F;  4OF1 A;  5KH6 A;  4PL6 A;  4EMK B;  3CCV A;  1VQ9 T;  2QDY B;  1VQP A;  3L2W A;  3GOX A;  1JBM A;  1VQO T;  4RG8 A;  4QQG A;  4M7D D;  2VGM A;  2QQ9 A;  2VGN A;  4C8Q E;  4L6V 5;  4JUV A;  3QO3 A;  4J7I A;  4C5I A;  3S3O A;  3OYF A;  2FL7 A;  2KSS A;  2EIF A;  2FHD A;  2LQK A;  3QZ5 B;  3CCE A;  2FYK A;  1BYM A;  3L2R A;  1KC8 C;  3E9G A;  4J8O A;  3S6W A;  2MWO A;  1X6O A;  4M77 A;  3QYG B;  2EJG A;  3TCJ A;  3KUF A;  3JCM e;  1YI2 A;  4HCB A;  2X4W A;  2KMT A;  4XU0 A;  4BY6 C;  4FIB A;  4C92 F;  3MEA A;  4M7D B;  3S3M A;  4JDS A;  1IRE B;  1M5Q 1;  3CCV T;  4LDV A;  3WVD B;  1Q7Y C;  2AHJ B;  1WPY A;  3EFS A;  2Y4X A;  4OGE A;  4PLI A;  4C92 E;  4PKC C;  4ZGE B;  5I2M A;  2LCL A;  1HK9 A;  2QEX T;  1UGR B;  1RL2 A;  3PNW C;  3MET A;  4OB0 B;  3EFR A;  1Y96 A;  4E7H A;  1YHQ T;  1X01 A;  1UGQ B;  1WJR A;  2LC4 A;  4QQD A;  2PVD B;  4LDU A;  1VQ7 A;  3OYE A;  2MAM A;  1O9S A;  4OMF B;  1K8A U;  3VYG A;  3QXE B;  2WSF E;  2F5K A;  5GAN e;  3CCM T;  3OW2 S;  5KCO A;  3G6E T;  3GIB A;  1VQL A;  3RES A;  1B34 B;  3OYK A;  4KBM B;  1Q86 C;  3M4Y A;  4LDW A;  3JB9 H;  3L2V A;  1M1G A;  2QI2 A;  2QQA A;  2XDP A;  1KQS S;  2XU8 A;  2PQW A;  1N8R C;  4F7U B;  4M78 C;  4DOV A;  1W4S A;  3NFC A;  3LWI A;  4M78 F;  3ASK A;  3A8H B;  3CCS T;  4C0G A;  3CC7 A;  3DLL A;  4ATO A;  3C95 A;  1QVG S;  2CZ6 B;  3CCJ A;  3Q1J A;  3HRS A;  1I8F A;  1SSF A;  2LDM A;  2R5A A;  3TRE A;  5KCH A;  3KXT A;  1FWZ A;  1VQ7 T;  3INZ A;  4M78 A;  4YTL A;  4V2S A;  3OS0 A;  4BI3 A;  1BIA A;  2K2V A;  4XTV A;  1AHJ B;  3A8M B;  4CI0 C;  1FXX A;  2ZPI B;  2L3R A;  2X4Y A;  2DTH A;  4C92 G;  1NPP A;  2DAQ A;  1Y96 B;  2RD1 A;  3HL8 A;  3JSC A;  3M5A A;  4JRI A;  5DLQ E;  1KQ1 A;  4M7A B;  3SDZ A;  4A4H A;  3JCM J;  1NJI C;  4OGC A;  4NL3 A;  2KAF A;  1YBY A;  4XTY A;  2XI9 A;  1OZ2 A;  1D3B B;  3CCS A;  2RHY A;  2VXF A;  4QQ6 A;  3CME A;  3NTK A;  1VQ6 A;  2XID A;  4ELY C;  4L5G A;  4XTZ A;  4BY6 B;  3GP8 A;  4ZTF A;  3JCM X;  1LJO A;  4M75 B;  4PJO E;  2MI6 A;  3J80 E;  4C5H A;  3G71 A;  4M7A F;  4QW2 A;  3X24 B;  4IKF A;  3BW1 A;  4KUI A;  4BAC A;  1VIF A;  4OB3 B;  4C92 C;  2R5M A;  3A5Z B;  3HFN A;  5AYF A;  4M7D E;  3SWN B;  4M75 F;  1QVP A;  3OYH A;  3M4G A;  3ZFJ A;  1I5L A;  4M75 C;  1Q81 C;  2MMP A;  4XAX B;  4BDY A;  3CXC A;  2RJD A;  3P8B B;  4A4E A;  4Z02 A;  5GAN 7;  3MEW A;  4M7A A;  2ZPE B;  4LD6 A;  3WVE B;  1M8V A;  3JCM b;  2OTJ T;  1HXD A;  2O4X A;  3PIO A;  3OS2 A;  5D6Y A;  5J26 A;  3I55 A;  3M58 A;  1NE8 A;  2XD0 A;  2LX9 A;  4PNO A;  3L2Q A;  3E19 A;  3E9F A;  5L8R E;  4NL2 A;  1VQ4 T;  2E12 A;  4IUP A;  2V8I A;  2BIV A;  2LRQ A;  2XKO C;  1K73 U;  1MGQ A;  1BI0 A;  1JJ2 A;  2EFI A;  5EG2 A;  2CZ1 B;  3CCU T;  1YIT T;  1LNX A;  4M77 F;  2ZGW A;  1K9M C;  3GLX A;  3QDR B;  3G4S A;  2RHI A;  4M78 B;  3OMG A;  3CC7 T;  3M53 A;  3M59 A;  4X9D A;  4A4F A;  4C92 A;  5GAN d;  1U8R A;  2C06 A;  2P0Q A;  2EJ9 A;  1VQM A;  3V8K A;  2DXC A;  1N9R A;  2IVW A;  4M75 A;  4OB2 B;  5J39 A;  3CMA T;  3QG1 A;  4XU2 A;  2GF7 A;  2E70 A;  3M54 A;  4KT0 E;  4MZM A;  2EQU A;  2K5F A;  1K8A C;  1QP3 A;  3JB9 D;  1VQN A;  3C12 A;  5CKF A;  1G3Y A;  2V8J A;  3JRZ A;  3N5B B;  3QKJ A;  4C0F A;  2RJF A;  5LJ5 f;  1RI0 A;  4XU3 A;  2PVG B;  3HP9 A;  4QVC A;  4J6Y A;  3CCU A;  4Y91 A;  3QPH A;  4E47 A;  2HAX A;  2LTO A;  1VQN T;  4QVD A;  4VUB A;  4M77 D;  2X4X A;  3GNF B;  2E10 A;  4N0A A;  2LQ8 A;  3OYB A;  1VQK T;  2F5T X;  2Y90 A;  5CVI A;  1QW1 A;  3ME9 A;  3UPU A;  5GAN h;  4M7A G;  3FIF A;  2EQM A;  3JB9 J;  1G3W A;  4PJO C;  1TH7 A;  2E6Z A;  2JTF A;  3HHT B;  3QYH B;  2K5L A;  4ZN3 A;  4LDY A;  4IUT A;  2XDB A;  3SWN A;  5CR2 A;  3J81 E;  1VIE A;  4C5G A;  2XK0 A;  1M9S A;  5I2S A;  5FRM A;  2PUO B;  4J6W A;  4M77 B;  4PJO A;  5LJ5 h;  3QII A;  2DD4 A;  4QVZ A;  3JB9 G;  1B34 A;  3JCM g;  3LLR A;  3JCM c;  5KE2 A;  3OS1 A;  4GLK A;  5FU7 C;  1H64 1;  4P5N A;  3H6Z A;  2I2L A;  1S72 A;  2R57 A;  4JLG A;  1WJS A;  3OB9 A;  3PMI A;  4C8Q C;  4M78 D;  2OTL A;  2RI5 A;  2RHX A;  1N8R U;  3ZEH A;  4N0A C;  2WSC E;  1UGS B;  2PUK B;  4UC4 A;  2IG0 A;  3LYI A;  2KVQ G;  2JN0 A;  1OYX A;  3O8V A;  1Q82 C;  3CBP A;  1VQ6 T;  4PJO D;  4J7F A;  5HY6 A;  2RK1 A;  3JB9 I;  5A0L A;  2QEX A;  3M56 A;  3SD4 A;  4M78 G;  2WAC A;  2GQV A;  4XTU A;  5LJ5 j;  3G71 T;  2RM4 A;  5LJ3 d;  5GAM f;  5GAO q;  3OYA A;  5LJ3 g;  2D0Q B;  2F69 A;  3EAE A;  3SWN C;  4E7K A;  4EMK A;  4A4K A;  5CQX A;  1OI1 A;  4C8Q G;  2MF2 A;  2O01 E;  5J3B A;  4BE0 A;  2RH2 A;  2X4J A;  4JLI A;  5GMK i;  2ZCF B;  5IN1 A;  2OTL T;  1VQ8 A;  5IAY A;  2RI3 A;  4F7U E;  2DK3 A;  4MML A;  3F70 A;  5C6S A;  4JRQ A;  3I55 T;  4MDW A;  4O6J A;  5GAO p;  5A2Q E;  1M1K U;  3QJ6 A;  5LJ5 e;  3UT1 A;  1KQ2 A;  3S3N A;  4BI8 B;  4FSX A;  2M16 A;  4C92 B;  4R56 A;  3OYD A;  4RMO A;  2QXF A;  4M75 D;  3LX7 A;  3OBW A;  2RI2 A;  1YIT A;  1JB0 E;  2DXT A;  2FB7 A;  4OP0 A;  3JCM P;  3DB4 A;  5DM7 R;  1NZ9 A;  3UWN A;  3RKX A;  1N6A A;  2LVM A;  2LT4 A;  3RMQ A;  3VUB A;  4EPC A;  2LNV A;  4M7A E;  5FRO A;  4EMK C;  3AHU A;  4JJN K;  3VKI A;  5D6X A;  5HKC A;  3L2U A;  3L2Z A;  4HA8 A;  4PJO F;  3OW2 A;  3OBY A;  3VUZ A;  4O5V A;  2K3Y A;  4C92 D;  2EJF A;  4PLL A;  5DLO A;  1YJN T;  5CIU A;  1M90 U;  3OYG A;  2CS7 A;  4XTX A;  3FC3 A;  1KQS A;  4PJO B;  3X28 B;  5CKE A;  3CME T;  1P92 A;  5GAM e;  2DD5 A;  4M77 E;  1M4Z A;  3CBM A;  2CYZ B;  3NTH A;  1GXI E;  3A8L B;  3MP6 A;  3QZ9 B;  4MDX A;  3FDR A;  4RCC A;  2K4Y A;  3JCM V;  5GAN 2;  4J6X A;  1BI1 A;  4FM4 B;  3ER0 A;  3SFM A;  2G3R A;  1W2B S;  5M9O A;  4HCC A;  2ZZD A;  2DIQ A;  3BDL A;  3PGG A;  2KK4 A;  3HRU A;  4EMH A;  1UGP B;  3PIP A;  2YLC A;  2RO0 A;  2HD0 A;  4C8Q A;  5GMK m;  2DTO A;  3MHX A;  3L1A A;  2QQS A;  3RIR A;  3URG A;  1S72 T;  3MO8 A;  4ZGD B;  1JJ2 S;  4N4G A;  1VQ5 T;  1N27 A;  2O4X B;  1BKB A;  1XQH A;  5LJ3 h;  4X9C A;  2RJC A;  4B9W A;  5FU6 B;  1ZHI A;  3CC4 T;  3QSU A;  1VQ4 A;  2E64 A;  2EWN A;  2XHC A;  3CCQ T;  3J7A F;  4M7D F;  2L5Q A;  1YHQ A;  4M7D C;  1BI3 A;  3V8L A;  3CC2 A;  1YJ9 T;  2DKG A;  2XDD A;  3RUX A;  1Q82 U;  5FU6 C;  3BDU A;  3V8J A;  4DQ2 A;  3PFS A;  5LL6 S;  2DTI A;  3V7R A;  1Y7X A;  3X20 B;  3CCQ A;  3JCM W;  2OTJ A;  2RB6 A;  2QQR A;  3CCM A;  1W2B A;  4F7U F;  3BY7 A;  3OS5 A;  1YJ9 A;  3CPF A;  3RER A;  1I81 A;  5CQY A;  4B9X A;  3HPW A;  4FU6 A;  3OYM A;  3VJP A;  2H3J A;  3FJP A;  1U1T A;  2LT1 A;  1Y71 A;  2EAY A;  2RHZ A;  1YCY A;  2ZPB B;  3WXM B;  3V7C A;  5CKD A;  4N4H A;  2QA4 A;  1XNI A;  3P8D A;  4M7D G;  5LJ5 d;  5IT9 E;  3OSS C;  3CCL T;  2DIG A;  3CC4 A;  1XOV A;  2DZ9 A;  5HK0 A;  3E1S A;  3KBG A;  1YIJ T;  1M90 C;  4BE1 A;  4ELZ C;  5LJ3 e;  2HBP A;  2RJE A;  3X26 B;  4N4I A;  4BUG A;  3RKW A;  1IZ6 A;  2E1H A;  1MHN A;  1I4K 1;  4IUV A;  3OY9 A;  1JRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...