5LJ5j

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 13
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5j00
4PJOA 1Y96B 3L1AA 4J6XA 4J6WA 3V8LA 4M75E 3FJPA 5LJ5g 5GANf 3JCMd 3JB9G 1WQ7A 4C92D 1U1SA 5DY9A 5GANh 4M7DE 5GAMf 3JCMW 3JCMP 2FB7A 4M78D 4F7UA 2E65A 4C92A 1I5LA 4M77D 4M75C 4C8QB 4NL3A 4M7AE 5GMKm 3SWNA 2EAYA 5GAN2 4JRIA 3JCMc 5GMKj 4PJOB 1M8VA 1BIBA 4M7DD 3QHSA 1B34A 4M77F 4XTZA 3RKYA 5I21A 5GMKi 5GANj 3FIFA 2DTOA 1U1TA 4EMGA 5GAMj 4M7DA 5GAOl 4M7AD 4F7UE 1WPYA 2YHTA 2DXTA 3RUXA 3JCMh 4M7AA 4C8QG 4RCBA 1WNLA 1LJOA 5LJ5d 4M78E 4XQ3A 3HSBA 1WQWA 2DVEA 3L2ZA 1B34B 4M75B 4PJOG 5GAN4 4M77E 3JB9F 1BIAA 1JRIA 4PNOA 2YLCA 4XU1A 5LJ3g 1JBMA 4C92C 3BY7A 4RCCA 2EJ9A 3V7SA 4M78C 1I81A 3SWNC 5GAOr 3JB9I 2DXUA 4M77C 3JCMe 3JCMX 1I8FA 1N9RA 5GANg 4M78A 3JCMV 3RKWA 5GAN7 5GAMg 4M7DC 4JRKA 1KQ1A 1X01A 2YLBA 4M75G 2DTHA 4M77A 2VXFA 4NL2A 4XTWA 4XU2A 1HXDA 4Y91A 2RB6A 5LJ5h 4A54A 2DTIA 3BDUA 4F7UB 5GAN5 4M7AC 4X9DA 2QTXA 4C92B 4EMKA 5CAIA 1YCYA 2Y90A 4C8QF 1LOJA 4XU3A 3JCMf 3JB9D 2DKGA 4N0AC 4M78B 2E41A 4PJOF 3SWNB 3RERA 4J5YA 4WF2A 2E64A 4M77B 2DJZA 2K57A 4N0AA 3RESA 3JCMQ 3GIBA 1N9SA 4M7DB 5GAOn 5LJ5e 2VXEA 2EJGA 4XTVA 3EFSA 1D3BA 3RIRA 4F7UG 5GMKl 5GANd 1KQ2A 2DZCA 4XTXA 4C92G 4EMHA 4M7AB 3M4GA 4MMKA 5GAMd 5LJ3d 4MMLA 4M78G 4M75F 2DZ9A 1H641 2HNIA 3BFMA 3FB9A 4A53A 4M77G 4XTYA 1MGQA 3HFNA 4EMKC 4C8QD 2EJFA 5GAN6 5LJ5f 3V8KA 4DQ2A 4M7DG 1D3BB 4PJOD 3JCMb 5GAOm 3V8JA 1TH7A 2RD1A 1HK9A 4XTUA 3INZA 5GMKh 4M7AG 1M5Q1 4HA8A 1I4K1 2E10A 3VU3C 4HT9A 3V7RA 4JUVA 3QUIA 5LJ3f 3AHUA 5GAMh 5GAN3 5LJ5j 3BW1A 5LJ3h 3JCMg 4F7UF 3JB9J 3QSUA 2RA2A 4C92F 2CGHA 2DEQA 2E1HA 2JN0A 2VC8A 4M75D 4NOYA 2RM4A 4EMKB 5GAOp 4C8QE 4M78F 1LNXA 2EWNA 3SB2A 3QO3A 5GMKe 4QVDA 3JCMJ 4X9CA 3PGGA 4HT8A 4M75A 3RKXA 3HFOA 4PJOE 4OP0A 1Y96A 5GAOq 5GANe 2ZGWA 5LJ3j 4M7DF 5GAMe 4C8QC 5LJ3e 4QVCA 4J6YA 4C92E 4PJOC 4JLIA 2I2LA 3EFRA 3JB9H 4M7AF 5GAN8 4C8QA 4V2SA 3V7CA 2FYKA 4XU0A
chains in the Genus database with same CATH superfamily
4E7LA 1VQ7Q 2LMJA 3OYJA 3MCAB 3MEUA 1SG5A 4WCIA 1VQNT 3PTAA 1M8MA 2E65A 5J3BA 4DBRA 2EAYA 3JCMc 4A63B 2WSEE 1TS9A 3QHSA 1G3YA 3CMEQ 5CKDA 3UA6A 4BDZA 1VQLA 2RHYA 2O31A 4KUDK 4J83A 1ZSZC 1WXBA 4OF1A 1NJIU 3CCVA 1W4SA 1YJ9T 3HHTB 3EHRA 5I22A 1ZSZA 1PSEA 1ZQ1A 4HVWA 1VQ5T 1RAAB 2BE7D 2HAXA 3QJ6A 4M4ZA 5GANg 2GQIA 3RKWA 4BY6C 2OJ2A 5DLQE 4XU2A 2X35A 4KGZB 1KFZA 2MAMA 5CKHA 2I0NA 2P0KA 5EC7A 1VOMA 2K57A 3RESA 2J6KA 2RHZA 3EHQA 4QQDA 4B9XA 2KDSA 5CKEA 3CCLQ 4J9EA 4XTYA 2EKHA 4KH0B 4C8QD 1KIKA 3M5AA 4LDVA 4M7DG 3SD4A 1TH7A 3OYHA 3INZA 5GMKh 1AZGB 1I4K1 4HT9A 4RTZA 4JUVA 1LVKA 4LUDA 1R0BG 1G83A 3QSUA 4ZN3A 1RI9A 4M78F 4JZ4A 4M75A 1YWOA 3H0HA 3OMGA 2MWOA 3CBOA 1TSFA 2LQNA 4J6YA 4BI4A 3LH5A 1NBEB 2ZPEB 3L1AA 4K11A 5KCHA 5GANf 1MUZA 2A28A 2PVOB 2VYTA 3NGPA 1JJ2P 1K76A 1K73U 1YNZA 4M77D 1OX8A 1WXTA 4PJOB 1AD5A 4JZ3A 1UGPB 1KHIA 4LDUA 4IUPA 1MV0B 2KE9A 2RPNA 2YHTA 4JS5A 1EFNA 2RK2A 3P8HA 4MDWA 3RNJA 4Z89A 1KD1U 1M3BA 1PG5B 1EZZB 4R55A 1NEGA 2RJCA 2XICA 4LDWA 1WDXA 3NTKA 1QW1A 1PD1A 2C0IA 1KQ1A 3VYGA 2YLBA 2GCXA 1RAEB 3WVDB 1HXDA 2DIQA 1Q86U 1SHFA 4F7UB 2CSIA 3OQ5A 5KE3A 4C92B 5CAIA 5FW9A 3JB9D 2WSFE 3VUZA 2K6DA 2KK4A 2LT1A 3SWNB 4LE9A 2FPDA 2YUOA 2RF0A 4BI8B 4HCCA 5KYYA 4AFSC 1D0XA 2A3LA 1Q7YU 1K1ZA 1GFCA 4MMKA 2E3HA 2BUDA 4ATOA 4M75F 3OYDA 1G3SA 2HQHA 1WZOA 1I5OB 2XHCA 4XTUA 2NWMA 3BDLA 3URGA 3LGFA 4PJMA 1VQNQ 1U3OA 4PL6A 5GAN3 2LQWA 2E1HA 2DEQA 2VC8A 4NOYA 3JAME 5GAOp 2PU9B 2XDDA 1NYFA 4OGCA 4QVDA 2R57A 2NYSA 1OQKA 2BE9B 4E7SA 1M1KU 3I55Q 2MYSA 5CVIA 3OYKA 1MV3A 1YJ9Q 1WLPB 4KT0E 2CDTA 3JB9H 4FU6A 3A8OB 1VQ5Q 5LJ5g 3A1PA 3JCMd 1KG1A 3GF5A 3VJPA 1GCQA 3MP8A 1YJNQ 1K73R 2JVVA 2ESWA 3EGUA 2YXYA 5I21A 2L3QA 2X4WA 2GQVA 1VQ6Q 2LCLA 1IHVA 1AHJB 1JXOA 3OYFA 5CKFA 4C8QG 1WQWA 1JRIA 2EQUA 1WYXA 3REBB 3CCRQ 4ESRA 1VQKQ 3S3MA 1M27C 3JB9I 3G71A 3L2RA 4ELZC 2LX9A 2V1RA 5GAN5 2Y4YA 1TOVA 4PK4A 2Y90A 1VYTA 4BE1A 3CCET 1QP2A 1PCXA 1D09B 4JDSA 1I07A 1N6AA 3KBGA 4M7DB 4HVVA 1RUWA 4ZN1A 1VQPT 1KQ2A 3VKIA 4WTOB 1K9MR 1Q7YR 4M77G 2PUKB 1MGQA 2L5QA 3QWXX 1BI0A 2CH4A 5GAN6 5LJ5f 2K2MA 1D3BB 3CBPA 4AFQC 1MNEA 3OW2P 2OAUA 3SEMA 4ZGDB 4RG8A 2O4XB 1QVFA 2FEIA 1BCMA 4CI0C 2HKNA 1G3WA 1C0MA 4QQ6A 1E6GA 2RM4A 2B8AA 1TXQA 2KROA 2ZZDA 1M2VA 1QCOA 1Q82U 1UGVA 4JLIA 4KUIA 3EFRA 4J9BA 3HP9A 1BI3A 3PT9A 4B9WA 3EGDA 4QT7A 4J6WA 3VS6A 2IPOB 2FRWA 1D1AA 1UDLA 3JB9G 1WHLA 3EFOB 1UGSB 5GANh 2H8HA 3MP1A 2VWFA 3L42A 3QXEB 1W1FA 1RI0A 1K0SA 2LNVA 1K73C 4JRIA 1D1CA 1K0XA 1ZLMA 4C5EA 3RKYA 2DTOA 2VV5A 5EG2A 4C5GA 2KGTA 2QTVA 1V29B 3QYGB 1RL2A 3CC7T 1B34B 3EG1A 5KE2A 2FZGB 2LT4A 2HEQA 2GTJA 2EGCA 4PJLA 1O9SA 1ARKA 3CCJT 1KD1C 1M90R 1X6OA 1GBQA 3OYGA 2JTMA 4KRTA 1NPRA 1PKTA 3JCMe 1IB8A 3MEWA 3FRNA 4DBQA 5KYXB 2ZPIB 3CCQA 3GPLA 5D6XA 2D9TA 1Q86C 1AOJA 2YT6A 2K9GA 5A2QE 5HKCA 2DPPB 4ZGEB 1CSKA 2A7YA 3L2WA 1K9AA 2P0PA 3MPUB 2JTFA 2B86A 3CC2T 1GL5A 2FVUA 3JSCA 2E5KA 2X9HA 4E2FB 2V26A 5GANd 1BKBA 3TU4K 2XG8D 4PFPA 1K9MC 2E4HA 1Q7YC 1IREB 3P8DA 3LW5E 4X34A 1SRMA 2FO0A 2EYYA 2HBPA 3OYAA 3CMET 1FMVA 3UT1A 2IIMA 3CC7A 1VQ4Q 2E10A 3MKDA 5KYWA 1V76A 3CCJA 1KQSA 2K2VA 1M1GA 2DBKA 3M0TA 1ZBXA 3X28B 1FXXA 1V1CA 2C0TA 5FWCA 3G4SQ 4Z8AA 4OB0B 1C1AA 2PTKA 1G5VA 4QKUA 2CT4A 5FWBA 1YITA 3TQ7P 3U23A 3I9QA 2YUNA 3S3NA 1UTIA 4MDXA 1X6GA 1CKBA 3M55A 3M53A 1Y96B 2EYQA 2ED1A 1VQ7A 2NUTB 4IUQA 4F04B 5LL6S 3M0PA 4C8QB 4M7AE 2RHUA 2HSPA 2LTOA 5ECAA 1M8VA 3CPWA 1Y7XA 1M9SA 1Y0MA 1JXMA 2GBQA 2F5TX 4QW2A 3CMEA 4MZPA 3WXMB 1QCNA 1F1BB 3CCEQ 4M7AA 5GAN4 5A0LA 3FC3A 2F5KA 3OYYA 1VQPQ 2HQXA 2AZSA 3C4SA 3F70A 4J9GA 3EG9B 2RI5A 1X27A 2F2VA 3PE0A 3H0FA 1W6XA 4JRKA 3EG0A 1UGRB 2RB6A 2CZ6B 4O5VA 4X9DA 2COYA 2CP7A 4L6V5 5CR2A 3RERA 4HCBA 2F69A 4M77B 5IHKA 1SKUB 2Z0WA 2A0FB 3EFSA 2QEXQ 1VIEA 1UHCA 3RBBB 3PIPA 2RQVA 3A8HB 4IURA 3CCLA 3M0SA 2EW3A 2M02A 2J6FA 2RD1A 3H41A 4NS5A 1OULA 1M5Q1 2KXCA 1QMCA 4EPCA 5LJ3f 3GOXA 5GAMh 2LX7A 4IKFA 3E9FA 1SPKA 1OV3A 3CXCA 2R58A 3UPUA 4LUEA 5GANe 1EX4A 2JXBA 1YIJQ 1M3AA 3VS2A 1AWWA 2HMAA 4QVCA 5KYUB 4FT2A 1R8OB 2DA9A 2I2LA 1Q82C 4AG1C 4M7AF 4RTYA 4AFUC 3ULRB 3NTHA 1NLOC 1Y07A 1YP5A 4PJJA 3VV0A 3L2VA 1QVFS 3X25B 2A08A 5GANj 2KRNA 2M9UA 2D1XA 1UB4A 3OSVA 2F1LA 3CBMA 2SRCA 4OMNA 2VKNA 5LJ5d 4M78E 1OEBA 3CC2Q 1VQ8Q 3PVLA 2JTEA 1N8RR 2DF6A 3QDFA 4BDYA 2CP5A 4M78C 2M16A 1PRLC 2JM8A 1SF9A 4RTWA 3JCMX 4F16A 3EG2A 1I8FA 3LWIA 4M78A 4HCKA 2E6NA 1XTDA 1X01A 2DTHA 2OX7A 3I55T 2AKLA 4ZTJA 1W70A 2YUPA 3OW2A 1UJ0A 3OYCA 3CCUQ 1XNIA 4OMLA 2E5QA 3HTRA 3JCMQ 3TCJA 4AT1B 1M1FA 3HL8A 4OVAA 3X26B 5HY6A 1YJNT 3TREA 4C0GA 3C12A 1VQ6T 2K4YA 2KYBA 1WHGA 2HKQB 4FT4A 1D0YA 4F17A 4KULA 2RI3A 2QG9B 2K5LA 2NLUA 5FU7B 3QYHB 1VQNA 3E2UA 5IH2A 3CCRT 4EMKB 3THKA 1VQKT 1OZ3A 2V8JA 2RQWA 1Y57A 2GNCA 3HFOA 3CMAQ 2QQ9A 1IO6A 3I55A 1IZ6A 4C92E 1YFNA 4RTUA 5CO7A 2ATCB 1NLPC 1YJ9A 3A5ZB 4M75E 2KR3A 2DE0X 1VQ5A 4F7UA 2XDBA 4C92A 2FPEA 4M75C 4II1A 2IG0A 2M1HA 3SWNA 3I56T 1KQSS 1YJNA 4N4GA 1JJ2S 1PKSA 4EDUA 4HXJA 4DEXA 1VQ6A 2JUFA 1WNLA 2L8DA 3ZFJA 1KQSP 4N4HA 4RKUE 4PLLA 2C06A 1N8RC 4RCCA 2JOYA 3CCRA 1OPLA 1R77A 1LPLA 1ZSZB 2FHDA 2WSCE 1VIFA 2LNHB 2RJEA 3DKMA 4NL2A 2CP6A 4PFOA 3SFMA 4IUVA 1HD3A 1Y71A 2CS7A 2XU8A 2L3SA 3NMZC 4PJOF 5A0GA 3VYHB 1UFFA 2YRCA 4JPBW 4BY6B 1FYNA 5C6SA 5LJ5e 3EGXB 3L2UA 3CPWP 2OTLQ 4MMLA 3FB9A 1J3TA 1SEMA 3CC4Q 1TTHB 4LNPA 1HK9A 3M0UA 3X20B 2XMFA 3VS7A 2KI7A 3AHUA 1VQ9T 3G6EQ 5LJ5j 5LJ3h 4F7UF 1WGSA 3UATA 3S3OA 4C92F 1UG1A 1K9MU 1H3HA 3L2QA 4UC4A 2EWNA 3LX7A 2EPDA 4OP0A 2EFIA 1WJQA 3CCVQ 1VA7A 2J7IA 3VS0A 2O9SA 1ABQA 1W2BP 3REAB 4RUGA 4J6XA 1SSFA 5CIUA 1OPKA 4M7DE 3QG1A 2QGGA 2P4TA 4LXCA 4J7IA 1VUBA 2RH2A 4OGEA 3Q1JA 4M7DA 5GJWB 1AWOA 3CXCS 3H0IA 3M58A 1BU1A 3HRUA 2EQMA 5CQYA 2DVEA 3I5SA 4L59A 3QZ9B 1VQ4T 4FW1A 1GCQC 7AT1B 3MHXA 2D0NA 2DXUA 3CXCP 3HKSA 5GAMg 3G4ST 1PD0A 2DRKA 4ORZA 3A8MB 4L5GA 2LCSA 2DJQA 4N0AC 2KRSA 2ZAEA 1X2QA 2DL4A 2KBTA 1M90U 5C0MA 4N0AA 4J8OA 1U06A 2EYZA 1ABOA 1XQHA 4E7HA 4OB1B 2EGAA 3I35A 4KGVB 3BFMA 1MHNA 5KYYB 1EIFA 2ZPGB 2HZYA 1XJWB 1GXIE 2YRDA 3V8JA 1SRLA 3UDCA 1VQ4A 1LCKA 1MMNA 3I56Q 2CGHA 1N5ZA 2L0AA 3OW2S 3QPHA 1JB0E 1H8KA 3OBWA 1AZEA 5GMKe 3G4SA 4HT8A 4X9CA 4Z88A 1ZX6A 1UGQB 2V8IA 1OZ2A 1KHCA 4M7DF 2QGFB 1QKXA 2PNIA 2E3IA 1YN8A 2VGNA 2BIVA 2D6FA 2QDYB 4MZTA 5GAMf 4M78D 1FMWA 1H3ZA 2QI2A 5IHNA 3M0QA 1YI2Q 4GY5A 5FU6C 4FSSA 5GMKm 3JV3A 5GMKj 2DNUA 2EBPA 2QEXT 2CH4W 2QK0A 2DMOA 1OYXA 2E70A 2E6ZA 2G6FX 4RMOA 3CCEA 3CCMQ 3META 5FLXE 3C95A 1JBMA 2BKDN 1VQPA 1YJWT 2COWA 1SSHA 2FZKB 4GLKA 1IXDA 2YRVA 2VXFA 3M57A 5KH6A 1FMKA 3BDUA 1PM3A 4E7IA 1YIJT 2KRMA 1Q95G 3DLLA 2DYIA 2E64A 3N5BB 1VQ9Q 4DEYA 5HCKA 2SEMA 2CT3A 4FW2A 1D1BA 4VUBA 2QEXA 2Y4XA 2DZ9A 5M9OA 2P84A 4FYXB 2PVDB 2JMAA 3TEEA 3KUFA 2KNBB 1WIEA 3M0RA 1T0HA 3M54A 3HRSA 2ZCFB 1VQ8T 3CPFA 2FL7A 1RLQC 2NUPA 4M75D 3PMTA 2V8KA 3CD6Q 3ASKA 2JS2A 1TG0A 3QO3A 1QVGP 2L3PA 3PGGA 5IXBA 2L2PA 1NYGA 1CKAA 1ZBJA 2ZGWA 4HCZA 1ACMB 3D7SB 4ZTFA 5LJ3j 4OMMA 2EKOA 1YIJA 5FROA 1Z9QA 1RLPC 3VRYA 1KSWA 4V2SA 2KEAA 3V7CA 3QZ5B 1YHQQ 3I5RA 1PC0A 4C0DC 4ZGJB 5D7UA 1G8XA 1M2VB 3M56A 1QVPA 4TVRA 1ZUUA 1HYOA 3CCUT 4DBFA 3G71Q 4FCYA 3HPWA 3EGDB 1S72T 3PIOA 3UA7A 2MPXC 2MCNA 3H8ZA 4EIKA 3FIFA 2LJ0A 1QP3A 4JRQA 4OB3B 5DLOA 1VQOQ 2DERA 1KK7A 1BIAA 4BE2A 3CC2A 2LDMA 1KC8U 3VS4A 1VQ8A 2DIGA 2EJ9A 1X43A 4Q5WA 2KQWA 2AT1B 3VS5A 5GAOr 2CP2A 3MEAA 1PSFA 5DM7R 1TUCA 3OYLA 5J39A 4XK8E 5LJ3g 2XIDA 2OI3A 3GLXA 5IHIA 4FYYB 4M7AC 3CMAT 1N27A 2H3JA 2QQAA 4C8QF 4JJNK 1M4ZA 2DKGA 1K8AU 8ATCB 3EH2A 2ZPFB 4J5YA 1N8RU 3ZL7C 1H92A 1N9SA 3CCUA 1M90C 2X51A 2RQUA 2E12A 4KBMB 2FZCB 2YUQA 2X3XD 2K3YA 4M78G 1Q81R 3RMQA 2RMOA 2NUZA 1BI1A 3OYNA 2LJ1A 3MJXA 2HSEB 3AT1B 3QDRB 4IIMA 1W2BA 3OS1A 2KVQG 1QKWA 1AWXA 2EGEA 3OYBA 2C0OA 5KYWB 4MZMA 4C0DB 2QYZA 3CMAA 4LDXA 2JM9A 1PRMC 2CKKA 2P0QA 4PFZA 9ATCB 2K3BA 3MEVA 3IQLA 3GP8A 1GFDA 2DRMA 1WQ7A 1YJWQ 3SDZA 1RACB 1MMGA 4NL3A 4O6JA 3LYIA 4ELYC 4ME7A 1G3TA 1S1NA 2AHJB 4A4GA 2CUBA 2OTLT 2X4JA 3H9NA 4B6MA 1UJYA 4J9FA 1WPYA 2K5FA 2CUDA 3VRZA 1TWBA 3CC4T 4RCBA 2LC4A 2DK3A 3JB9F 1IHWA 3J7AF 4CC4B 3KXTA 4BACA 3BY7A 2L89A 1IGUA 4RG2A 2EQJA 1I81A 2JZ2A 1FWZA 1RABB 2GFAA 1KC8R 4X1VA 3G6ET 2XDPA 4C5HA 4M75G 1ZHIA 2KT8A 4Y91A 1VQLT 4E47A 2DTIA 4C0FA 2MIOA 4EMKA 2QA4Q 3CCVT 2WACA 3UF4A 2OTJQ 2FPFA 2GTOA 3QKJA 2R5MA 1K8AR 2F2WA 2MF2A 2LRQA 1ZUYA 3OS5A 3RIRA 5GMKl 1I1JA 2ZPHB 1YBYA 4EMHA 5GAMd 3OYEA 2OTLA 2LQKA 2CZ0B 3ME9A 1HJDA 2A37A 2GF7A 3CC4A 1O75A 4ZNXA 4AG2C 1BBZA 3VS1A 4IUTA 2XD0A 1PHTA 2HBWA 3OYIA 3G6EA 1S72Q 6AT1B 2O88A 1YCSB 2CREA 2EQKA 1LNXA 2RO0A 4PJOE 2BZ8A 1WJSA 3CCSQ 1FX7A 1BI2A 1UEBA 4PJOC 4PJNA 1WA7A 1U8RA 4R0KA 3M4YA 2KXDA 4DBHA 1WI7A 5GAN8 4XU0A 4PJOA 3QIIA 1NM7A 1VYVA 2JW4A 2LVMA 5L8RE 1MMDA 2K3XA 2CZ1B 3FLGA 5FRNA 5HK0A 1KJWA 1TU0B 4C0ZA 3A8GB 1VQMQ 2ZPBB 3GBQA 1AT1B 4LN2A 3ZBDA 3OYMA 2XK0A 3EGXA 2JT4A 1NPPA 2HL3A 4F7UE 3RMSA 1OU8A 4OMFB 3LH0A 2LCCA 2MWPA 2ABLA 4LD9K 1M30A 4XU1A 1QWFA 4RTTA 4C92C 3GNFB 5J26A 2AKKA 2X3WD 3NPFA 3SWNC 1KC8C 3TVTA 4P5NA 1WXUA 5L23A 2RHIA 5GAN7 3EAEA 4XTWA 3M9QA 2DXCA 2RK1A 1ZA2B 1BB9A 3DLMA 4M78B 4DOVA 1K8AC 2QQSA 2V1QA 2YDLA 1IGQA 3GIBA 2VXEA 3DB3A 4XTVA 2M0YA 1VQKA 3PMIA 4E7ZA 2K79A 3DB4A 1BK2A 4D8KA 1YI2T 1H641 3TSZA 1QVGA 2RHXA 1JU5C 1MMAA 5HK3A 4DQ2A 3CPWS 2J05A 2VVKA 2DX1A 2DL7A 1OOTA 4HA8A 3P8BB 2W10A 2RQRA 2D8HA 3CCMT 4PLIA 2COZA 3JB9J 3WVEB 1D0ZA 4J9IA 1UUEA 2DM1A 3I56A 3SB2A 3JCMJ 4BUGA 3RKXA 5CKBA 2D8JA 1DJ7B 3E9GA 5GAMe 2GGRA 1R0CB 2A36A 1ZA1B 2O9VA 4E7JA 2KT1A 1TUGB 1NJIR 1T0JA 4OMPA 5AYFA 1U1SA 5DY9A 3JCMP 1AVZC 3OS0A 2FB7A 1OU9A 4CRIA 3OBYA 1W2BS 1YI2A 4XAXB 4KGXB 1BIBA 1WJRA 1VQLQ 4XTZA 1QWEA 1BYMA 1U1TA 1T3LA 4EMGA 5GAMj 4J9HA 3S6WA 2DEUA 4M7AD 2DVJA 2PUOB 2HD0A 1NE8A 5A0DA 2DXTA 4LDYA 3JCMh 1GRIA 2VUBA 3HSBA 3OSSC 4M75B 3CCMA 4QVZA 4PNOA 3R6OA 2CZ7B 3LLRA 3O8VA 4GBQA 4FSXA 2DILA 1X6BA 4J7FA 1A0NB 4HKEA 3O5ZA 3CD6T 1B3QA 4M7DC 4AMCA 4IIOA 1E7OA 2DYBA 4DA4A 3LWHA 2QTXA 1YCYA 4XU3A 4CC2A 2CP3A 4WF2A 3QBYA 2MI6A 1YHQT 4CC7A 3E19A 1VQ9A 4Y92A 1AWJA 1D3BA 3OY9A 2BZYA 3OS2A 5LJ3d 2AK5A 3G71T 5I2SA 2O4XA 4E7KA 1UECA 2DL5A 1JEGA 5GAOm 4BB7A 2W0ZA 1E6HA 3VU3C 4KH1B 2GFUA 1X69A 1VQOT 1BCOA 3JRZA 2XKOC 4RTVA 2JN0A 2EYWA 3CD6A 5IN1A 3EG3A 2LQ8A 5CQXA 2L3RA 3EFOA 3FEOA 1QVFP 3H6ZA 2RNAA 1NJIC 2BZXA 3RR6A 1YHQA 1KD1R 4OB2B 2KY9A 5IXFA 1UE9A 3EH1A 3VS3A 2PZ1A 5KYNA 4FIBA 5GJVB 2DXBA 3NFCA 4BE0A 1QCFA 2IVWA 1B34A 2JJ9A 5D6YA 2LJ3A 3E1SA 2DL3A 1Q86R 1WHKA 4A4HA 2QXFA 3RUXA 2DD5A 2PVGB 1VQOA 5KYXA 1M2OA 1NEBA 3V7SA 2K5IA 2AZVA 1HSQA 3C94A 2HQEA 1WX6A 3PFSA 4FYVB 2ROLA 4BI3A 2JS0A 3TSWA 1GBRA 2E41A 4R56A 1WHHA 2DJZA 2K7AA 2HDAA 2O01E 4OMQA 5GAOn 2KMTA 4A4FA 4JJCA 4Y28E 4LD6A 3MP6A 1PWTA 1RADB 2HNIA 4A53A 2DO3A 3CEYA 1M1KR 4J9CA 2JNGA 5KCOA 4PJOD 3JCMb 3CCQT 1X75C 4M7AG 4OMOA 1PNJA 2QAZA 1G2BA 4JLGA 1VYUA 2VB6A 5I11A 3A8LB 1JO8A 4IUUA 4A4KA 1Q81U 5AT1B 4C8QE 2KYMA 1C6VX 2ENMA 1JQQA 1Y96A 5GAOq 3HRTA 4C8QC 2NUTA 5LJ3e 1RAGB 2O2OA 4JRPA 1QVGS 4C8QA 2FYKA 3V8LA 4Z02A 2QA4T 3FJPA 4C92D 2OTJT 4CC3A 3LGLA 1YJWA 3OB9A 2CYZB 2VASA 3A98A 4FM4B 4BD3A 3T9NA 2M0OA 1P92A 2ED0A 2RI2A 4A4EA 1YITT 1NZ9A 2EVRA 2MK5A 4JS4A 4HVUA 1LJOA 3EG9A 4XQ3A 5FU6B 3L2ZA 4M77E 1XOVA 4JJBA 1OX9A 2FG0A 3J80E 1VQ7T 3PNWC 3QWYA 3BE3A 4M77C 4PKCC 3OA6A 1N9RA 5FRMA 8AT1B 2HCKA 4M77A 2KAFA 2J06A 2JMCA 3CCST 2DFUA 1MNDA 2CP0A 1OI1A 2QDLA 3ER0A 1UHFA 5CK9A 1RAIB 2QA4A 3J81E 2YWWA 2CSQA 2OTJA 2EJGA 1JJ2A 2DZCA 5IAYA 4JJDA 3M4GA 1AEYA 1QQJA 1X2KA 2XI9A 3RDVA 3X24B 1M1KC 2DD4A 3HFNA 1VQMT 2DAQA 2EJFA 3FDRA 1RAHB 3V8KA 4C5IA 2ROTA 1Q82R 5IT9E 2LZ6B 1Z9ZA 3GNGA 1IRXA 2RQTA 2BTTA 3BW1A 3JCMg 1U5SA 2RA2A 5KYUA 1ZUKA 3PVQA 1RAFB 3NHNA 1S72A 4F14A 3CCSA 3CCLT 2D0QB 2J6OA 2NUPB 4DOWA 3ZEHA 4AFZC 1B07A 1B7TA 2DBMA 4D8DA 1WHMA 3OMCA 4N4IA 3JCMW 2X4XA 1NG2A 2LP5A 1I5LA 3M59A 2DETA 5GAN2 2AIRB 4ANJA 4M7DD 1VQMA 4M77F 4E6RA 5GMKi 3KFVA 5GAOl 4D6WA 2DL8A 3CQTA 3FJ5A 2YSQA 4FYWB 4PJOG 2VGMA 3VUBA 2YLCA 4J9DA 1WFWA 2ECZA 3C0CA 1WHJA 3R6NA 2OAWA 3JCMV 5CCAA 5I2MA 2QASA 2QQRA 3CCQQ 2R5AA 5LJ5h 4A54A 1GCPA 4GLMA 3G1JA 4YTLA 3JCMf 2KSSA 2P4RA 2FRYA 2EQIA 4F7UG 1T3SA 4C92G 4XTXA 4M7AB 5FU7C 3G7ZA 2RN8A 4RTXA 2H3EB 3QJYA 1QLYA 2RJDA 3NTIA 4EMKC 3CC7Q 2EYXA 1K4US 2MOXA 3CCJQ 3V7RA 2G3RA 1TUDA 1YWPA 3QUIA 2PQWA 2HL5C 1M3CA 5D6WA 2RJFA 2MMPA 4QQGA 2F2XA 3MO8A 1YITQ 1Q81C 2X4YA 1SHGA 3SHWA 1I0CA 2EIFA 1ZSGA 2M51A 2DLPA 4FL6A 2QQBA 3UWNA 1LOJA
chains in the Genus database with same CATH topology
1Y96B 2EYQA 4E7LA 3VJPA 5AYFA 1U1SA 2QDYB 4MZTA 5DY9A 3OYJA 4IUQA 3MCAB 5GAMf 3MEUA 3JCMP 3OS0A 1VQ7A 2FB7A 4M78D 1VQNT 1H3ZA 3PTAA 2E65A 2QI2A 5J3BA 5LL6S 4CRIA 4GY5A 5FU6C 3OBYA 4C8QB 1W2BS 5GMKm 4M7AE 2RHUA 1YI2A 2EAYA 2LTOA 4XAXB 3JCMc 5GMKj 3CPWA 1Y7XA 1M9SA 2WSEE 1M8VA 1BIBA 1WJRA 3QHSA 2QEXT 1G3YA 4XTZA 1BYMA 5CKDA 2F5TX 4BDZA 1U1TA 4QW2A 4EMGA 1OYXA 2E70A 5GAMj 4MZPA 3S6WA 3WXMB 3CMEA 2RHYA 1VQLA 2PUOB 4M7AD 2HD0A 4KUDK 2E6ZA 4J83A 1NE8A 2BIVA 4OF1A 4RMOA 5A0DA 2DXTA 4LDYA 3JCMh 3CCVA 1W4SA 1YJ9T 3HHTB 3CCEA 1NJIU 2VUBA 4M7AA 3META 3OSSC 3HSBA 4M75B 1PSEA 5A0LA 1ZQ1A 4QVZA 5FLXE 5GAN4 4PNOA 3C95A 3R6OA 3FC3A 1JBMA 2CZ7B 2F5KA 3LLRA 2BKDN 2HQXA 3F70A 3C4SA 3O8VA 3OYYA 5GANh 1VQ5T 1VQPA 4FSXA 2HAXA 3QJ6A 1YJWT 4J7FA 4GLKA 2YRVA 2RI5A 5GANg 4HKEA 3RKWA 4BY6C 3CD6T 4M7DC 4JRKA 2VXFA 4XU2A 5DLQE 2X35A 3M57A 1UGRB 2RB6A 5KH6A 2CZ6B 3BDUA 4O5VA 4DA4A 4X9DA 3LWHA 4E7IA 2QTXA 1YIJT 1YCYA 2MAMA 4XU3A 4L6V5 5CR2A 5CKHA 3DLLA 3RERA 4WF2A 3QBYA 2E64A 2F69A 3N5BB 4M77B 2MI6A 2P0KA 4HCBA 2K57A 3RESA 1YHQT 3E19A 1VQ9A 2RHZA 3EFSA 4QQDA 1D3BA 4B9XA 3OY9A 2KDSA 1VIEA 5CKEA 3PIPA 4VUBA 3OS2A 5LJ3d 2QEXA 2Y4XA 3G71T 2DZ9A 5I2SA 5M9OA 3A8HB 2O4XA 4IURA 4XTYA 3CCLA 4E7KA 4C8QD 3M5AA 4LDVA 4M7DG 5GAOm 3SD4A 2PVDB 1TH7A 3TEEA 2RD1A 3KUFA 4BB7A 3OYHA 4NS5A 3INZA 5GMKh 1M5Q1 1I4K1 3VU3C 4HT9A 2GFUA 1VQOT 4JUVA 3M54A 3HRSA 4EPCA 5LJ3f 3GOXA 5GAMh 2ZCFB 3JRZA 1VQ8T 3QSUA 3CPFA 2FL7A 2XKOC 4ZN3A 4IKFA 2JN0A 4M75D 3PMTA 2V8KA 3E9FA 3ASKA 4M78F 3CD6A 3QO3A 5IN1A 3PGGA 3CXCA 2R58A 4M75A 2LQ8A 5CQXA 3UPUA 2L3RA 3OMGA 5GANe 2ZGWA 2MWOA 3CBOA 4HCZA 4ZTFA 5LJ3j 2EKOA 1YIJA 4QVCA 4FT2A 3FEOA 4J6YA 5FROA 4BI4A 1R8OB 2I2LA 1Q82C 2ZPEB 4M7AF 3H6ZA 4V2SA 3V7CA 3QZ5B 1NJIC 4C0DC 3L1AA 4ZGJB 3NTHA 5KCHA 1YHQA 5GANf 3M56A 2PVOB 2VYTA 1QVPA 4OB2B 2KY9A 1Y07A 4TVRA 1K73U 3CCUT 3HPWA 4M77D 3VV0A 3L2VA 4FIBA 1QVFS 3X25B 2DXBA 3NFCA 4BE0A 3PIOA 1S72T 4PJOB 2IVWA 1B34A 3H8ZA 5GANj 1UGPB 3FIFA 1KHIA 4LDUA 2M9UA 5D6YA 1UB4A 3OSVA 3CBMA 3E1SA 4IUPA 3CCMA 2YHTA 4A4HA 2QXFA 3RUXA 1QP3A 4JRQA 2DD5A 4OB3B 5DLOA 5LJ5d 2PVGB 4M78E 4JS5A 2RK2A 3P8HA 4MDWA 1VQOA 1KD1U 1BIAA 4BE2A 3CC2A 2LDMA 1KC8U 1VQ8A 2DIGA 2EJ9A 4Q5WA 4BDYA 3V7SA 2KQWA 2K5IA 4R55A 4M78C 2M16A 2RJCA 5GAOr 2XICA 4LDWA 3MEAA 1PSFA 3C94A 3JCMX 1I8FA 5DM7R 3LWIA 4M78A 2HQEA 3NTKA 1QW1A 3OYLA 3PFSA 5J39A 2E6NA 4XK8E 1XTDA 1KQ1A 1X01A 2XIDA 2YLBA 2DTHA 3VYGA 4BI3A 5LJ3g 2GCXA 3WVDB 1HXDA 2DIQA 3GLXA 1Q86U 4M7AC 4F7UB 3CMAT 5KE3A 1N27A 3OQ5A 3I55T 4C92B 5CAIA 2H3JA 2QQAA 4C8QF 4JJNK 3JB9D 2WSFE 1M4ZA 2DKGA 3VUZA 4ZTJA 2KK4A 2E41A 2LT1A 3SWNB 1K8AU 4R56A 2ZPFB 4J5YA 1N8RU 3OW2A 2DJZA 3OYCA 1XNIA 2E5QA 4BI8B 3JCMQ 4HCCA 1N9SA 3TCJA 3CCUA 2O01E 5GAOn 1M90C 2E12A 2KMTA 4A4FA 2A3LA 1M1FA 3HL8A 4KBMB 4OVAA 1Q7YU 4Y28E 3X26B 4MMKA 2K3YA 4LD6A 3MP6A 5HY6A 2BUDA 4M78G 4ATOA 4M75F 3OYDA 3RMQA 2HNIA 1G3SA 4A53A 2DO3A 1YJNT 3TREA 3CEYA 2JNGA 5KCOA 4PJOD 1BI1A 3JCMb 3CCQT 4C0GA 3OYNA 2XHCA 3C12A 1X75C 1VQ6T 2K4YA 4XTUA 4FT4A 4M7AG 3BDLA 3URGA 3LGFA 3QDRB 4JLGA 2RI3A 4KULA 1W2BA 2K5LA 2NLUA 5FU7B 3QYHB 4PL6A 5GAN3 1VQNA 4NL3A 3OS1A 2E1HA 2DEQA 2KVQG 2VC8A 4NOYA 4EMKB 3A8LB 4IUUA 3JAME 4A4KA 2PU9B 4C8QE 5GAOp 1Q81U 1OZ3A 2V8JA 1VQKT 2XDDA 4OGCA 4QVDA 3OYBA 2R57A 1M1KU 3HFOA 1Y96A 4MZMA 5GAOq 4C0DB 2QQ9A 5CVIA 3HRTA 3OYKA 3CMAA 4LDXA 4C8QC 3I55A 1IZ6A 5LJ3e 2CKKA 2P0QA 4KT0E 4C92E 5CO7A 3JB9H 3MEVA 1YJ9A 4JRPA 1QVGS 4C8QA 4FU6A 3A5ZB 2FYKA 3GP8A 3A8OB 3V8LA 4Z02A 4M75E 2QA4T 3FJPA 5LJ5g 3JCMd 1KG1A 1WQ7A 4C92D 1VQ5A 2OTJT 4F7UA 3SDZA 2XDBA 4C92A 3LGLA 1YJWA 3GF5A 4II1A 2IG0A 3OB9A 2M1HA 4M75C 3MP8A 3LYIA 4O6JA 3SWNA 2JVVA 2CYZB 4ME7A 4ELYC 3I56T 1KQSS 1G3TA 1YJNA 4FM4B 2AHJB 4A4GA 4BD3A 5I21A 3T9NA 2M0OA 1P92A 4N4GA 2RI2A 4A4EA 1YITT 1JJ2S 2X4WA 2OTLT 4EDUA 2GQVA 2X4JA 2LCLA 1NZ9A 1WPYA 2D6FA 1VQ6A 1AHJB 4JS4A 2K5FA 2JUFA 3CC4T 3OYFA 5CKFA 4RCBA 1LJOA 1WNLA 2LC4A 4C8QG 2L8DA 4XQ3A 1WQWA 2DK3A 3L2ZA 5FU6B 4N4HA 4RKUE 4PLLA 4M77E 3ZFJA 1JRIA 2EQUA 2C06A 3JB9F 1N8RC 1XOVA 3J80E 3KXTA 3J7AF 4BACA 3BY7A 4RCCA 2L89A 1VQ7T 2JOYA 3PNWC 4RG2A 3CCRA 2EQJA 3S3MA 1I81A 2JZ2A 1FWZA 2GFAA 3CCRT 3JB9I 4M77C 3G6ET 4PKCC 3OA6A 1N9RA 5FRMA 3G71A 2FHDA 2WSCE 1VIFA 3L2RA 2XDPA 4C5HA 2RJEA 4M75G 4M77A 3DKMA 4NL2A 4ELZC 1ZHIA 2LX9A 3SFMA 2KAFA 4Y91A 1VQLT 3CCST 4E47A 2DTIA 5GAN5 2Y4YA 4IUVA 4C0FA 4EMKA 2Y90A 1Y71A 2CS7A 1OI1A 3ER0A 5CK9A 2XU8A 5A0GA 4PJOF 3CCVT 2WACA 3VYHB 2QA4A 4BE1A 3CCET 3J81E 1QP2A 3QKJA 4JDSA 2R5MA 2OTJA 1N6AA 2MF2A 4BY6B 2LRQA 3KBGA 4M7DB 5C6SA 5LJ5e 2EJGA 4ZN1A 3OS5A 3L2UA 1VQPT 3RIRA 5GMKl 1JJ2A 1KQ2A 2ZPHB 2DZCA 5IAYA 1YBYA 4EMHA 3M4GA 5GAMd 3VKIA 3OYEA 4MMLA 3FB9A 2OTLA 2LQKA 2XI9A 4M77G 2PUKB 1MGQA 2CZ0B 2L5QA 2DD4A 3ME9A 3HFNA 3X24B 1VQMT 1BI0A 2DAQA 2EJFA 3FDRA 5GAN6 5LJ5f 3V8KA 1D3BB 2GF7A 4C5IA 3CC4A 1O75A 3CBPA 5IT9E 1HK9A 3X20B 2OAUA 4ZGDB 4RG8A 2O4XB 3GNGA 1QVFA 4IUTA 4CI0C 3AHUA 1VQ9T 1G3WA 4QQ6A 5LJ5j 2XD0A 3BW1A 5LJ3h 1WGSA 3JCMg 4F7UF 3S3OA 2RA2A 4C92F 3OYIA 3G6EA 1K9MU 3L2QA 2RM4A 4UC4A 2B8AA 2EQKA 2RO0A 1LNXA 2EWNA 3LX7A 1S72A 4PJOE 1WJSA 4OP0A 1FX7A 2EFIA 1WJQA 2ZZDA 3CCSA 1BI2A 3CCLT 2D0QB 1Q82U 1UEBA 4PJOC 4JLIA 4KUIA 3ZEHA 4DOWA 3EFRA 1U8RA 3HP9A 3M4YA 5GAN8 1BI3A 3PT9A 4B9WA 4XU0A 4PJOA 4J6XA 4J6WA 3QIIA 3JB9G 1SSFA 1UGSB 3OMCA 5CIUA 2LVMA 3L42A 3MP1A 4N4IA 5L8RE 3QG1A 2K3XA 2P4TA 2CZ1B 2X4XA 1RI0A 3QXEB 3FLGA 5FRNA 5HK0A 1I5LA 3M59A 4C0ZA 2LNVA 1K73C 5GAN2 4JRIA 3A8GB 4J7IA 4M7DD 2ZPBB 4C5EA 4M77F 1VQMA 3RKYA 5GMKi 2DTOA 1VUBA 2RH2A 2VV5A 4OGEA 3Q1JA 4M7DA 5EG2A 3ZBDA 4C5GA 5GAOl 3OYMA 2XK0A 4D6WA 1NPPA 4F7UE 3QYGB 1V29B 3RMSA 3CXCS 1RL2A 3M58A 4OMFB 1M1KC 3LH0A 2LCCA 2MWPA 2EQMA 3HRUA 5CQYA 3CC7T 4LD9K 4PJOG 2DVEA 2VGMA 1B34B 5KE2A 2LT4A 3VUBA 2YLCA 4XU1A 4L59A 3QZ9B 4C92C 1VQ4T 1O9SA 3GNFB 5J26A 3CCJT 1KD1C 1X6OA 3OYGA 2JTMA 3SWNC 3MHXA 1KC8C 1NPRA 2DXUA 4P5NA 3JCMe 2RHIA 3JCMV 5CCAA 3HKSA 3FRNA 3MEWA 5GAMg 5GAN7 3G4ST 2ZPIB 3EAEA 4XTWA 5I2MA 3M9QA 2QQRA 2R5AA 3A8MB 4L5GA 5LJ5h 4A54A 2DXCA 2RK1A 3CCQA 3GPLA 5D6XA 2D9TA 4YTLA 1Q86C 3JCMf 5A2QE 5HKCA 2DPPB 3DLMA 4M78B 4N0AC 2KSSA 4ZGEB 2A7YA 4DOVA 3L2WA 2P0PA 1K8AC 1M90U 2JTFA 5C0MA 2QQSA 3CC2T 4N0AA 4J8OA 3GIBA 2FVUA 3JSCA 2VXEA 3DB3A 4XTVA 1XQHA 4F7UG 4E7HA 5GANd 1BKBA 4OB1B 4C92G 3M55A 3PMIA 4XTXA 3TU4K 4M7AB 1VQKA 2XG8D 3DB4A 1K9MC 1Q7YC 5FU7C 1IREB 1YI2T 3G7ZA 1H641 3BFMA 3P8DA 1QVGA 2RHXA 3LW5E 4X34A 3QJYA 1MHNA 2RJDA 3NTIA 4EMKC 1EIFA 5HK3A 2ZPGB 4DQ2A 3OYAA 2HBPA 3CMET 3UT1A 1GXIE 3V8JA 3CPWS 3JCMW 3CC7A 4HA8A 2E10A 3P8BB 3V7RA 2G3RA 3UDCA 1VQ4A 3CCJA 3CCMT 2K2VA 1KQSA 3QUIA 1M1GA 2PQWA 4PLIA 1ZBXA 3JB9J 3X28B 1FXXA 2CGHA 3WVEB 5D6WA 3OW2S 3QPHA 1JB0E 2RJFA 3OBWA 4OB0B 2MMPA 4QQGA 3I56A 1G5VA 3SB2A 3MO8A 5GMKe 3G4SA 4HT8A 3JCMJ 4X9CA 4BUGA 1Q81C 3RKXA 2X4YA 1UGQB 1YITA 2V8IA 1OZ2A 5CKBA 1KHCA 1DJ7B 4M7DF 3E9GA 5GAMe 2EIFA 3S3NA 4M7DE 4FL6A 4MDXA 4E7JA 2VGNA 2QQBA 3UWNA 1LOJA 3M53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO A;  1Y96 B;  3L1A A;  4J6X A;  4J6W A;  3V8L A;  4M75 E;  3FJP A;  5LJ5 g;  5GAN f;  3JCM d;  3JB9 G;  1WQ7 A;  4C92 D;  1U1S A;  5DY9 A;  5GAN h;  4M7D E;  5GAM f;  3JCM W;  3JCM P;  2FB7 A;  4M78 D;  4F7U A;  2E65 A;  4C92 A;  1I5L A;  4M77 D;  4M75 C;  4C8Q B;  4NL3 A;  4M7A E;  5GMK m;  3SWN A;  2EAY A;  5GAN 2;  4JRI A;  3JCM c;  5GMK j;  4PJO B;  1M8V A;  1BIB A;  4M7D D;  3QHS A;  1B34 A;  4M77 F;  4XTZ A;  3RKY A;  5I21 A;  5GMK i;  5GAN j;  3FIF A;  2DTO A;  1U1T A;  4EMG A;  5GAM j;  4M7D A;  5GAO l;  4M7A D;  4F7U E;  1WPY A;  2YHT A;  2DXT A;  3RUX A;  3JCM h;  4M7A A;  4C8Q G;  4RCB A;  1WNL A;  1LJO A;  5LJ5 d;  4M78 E;  4XQ3 A;  3HSB A;  1WQW A;  2DVE A;  3L2Z A;  1B34 B;  4M75 B;  4PJO G;  5GAN 4;  4M77 E;  3JB9 F;  1BIA A;  1JRI A;  4PNO A;  2YLC A;  4XU1 A;  5LJ3 g;  1JBM A;  4C92 C;  3BY7 A;  4RCC A;  2EJ9 A;  3V7S A;  4M78 C;  1I81 A;  3SWN C;  5GAO r;  3JB9 I;  2DXU A;  4M77 C;  3JCM e;  3JCM X;  1I8F A;  1N9R A;  5GAN g;  4M78 A;  3JCM V;  3RKW A;  5GAN 7;  5GAM g;  4M7D C;  4JRK A;  1KQ1 A;  1X01 A;  2YLB A;  4M75 G;  2DTH A;  4M77 A;  2VXF A;  4NL2 A;  4XTW A;  4XU2 A;  1HXD A;  4Y91 A;  2RB6 A;  5LJ5 h;  4A54 A;  2DTI A;  3BDU A;  4F7U B;  5GAN 5;  4M7A C;  4X9D A;  2QTX A;  4C92 B;  4EMK A;  5CAI A;  1YCY A;  2Y90 A;  4C8Q F;  1LOJ A;  4XU3 A;  3JCM f;  3JB9 D;  2DKG A;  4N0A C;  4M78 B;  2E41 A;  4PJO F;  3SWN B;  3RER A;  4J5Y A;  4WF2 A;  2E64 A;  4M77 B;  2DJZ A;  2K57 A;  4N0A A;  3RES A;  3JCM Q;  3GIB A;  1N9S A;  4M7D B;  5GAO n;  5LJ5 e;  2VXE A;  2EJG A;  4XTV A;  3EFS A;  1D3B A;  3RIR A;  4F7U G;  5GMK l;  5GAN d;  1KQ2 A;  2DZC A;  4XTX A;  4C92 G;  4EMH A;  4M7A B;  3M4G A;  4MMK A;  5GAM d;  5LJ3 d;  4MML A;  4M78 G;  4M75 F;  2DZ9 A;  1H64 1;  2HNI A;  3BFM A;  3FB9 A;  4A53 A;  4M77 G;  4XTY A;  1MGQ A;  3HFN A;  4EMK C;  4C8Q D;  2EJF A;  5GAN 6;  5LJ5 f;  3V8K A;  4DQ2 A;  4M7D G;  1D3B B;  4PJO D;  3JCM b;  5GAO m;  3V8J A;  1TH7 A;  2RD1 A;  1HK9 A;  4XTU A;  3INZ A;  5GMK h;  4M7A G;  1M5Q 1;  4HA8 A;  1I4K 1;  2E10 A;  3VU3 C;  4HT9 A;  3V7R A;  4JUV A;  3QUI A;  5LJ3 f;  3AHU A;  5GAM h;  5GAN 3;  5LJ5 j;  3BW1 A;  5LJ3 h;  3JCM g;  4F7U F;  3JB9 J;  3QSU A;  2RA2 A;  4C92 F;  2CGH A;  2DEQ A;  2E1H A;  2JN0 A;  2VC8 A;  4M75 D;  4NOY A;  2RM4 A;  4EMK B;  5GAO p;  4C8Q E;  4M78 F;  1LNX A;  2EWN A;  3SB2 A;  3QO3 A;  5GMK e;  4QVD A;  3JCM J;  4X9C A;  3PGG A;  4HT8 A;  4M75 A;  3RKX A;  3HFO A;  4PJO E;  4OP0 A;  1Y96 A;  5GAO q;  5GAN e;  2ZGW A;  5LJ3 j;  4M7D F;  5GAM e;  4C8Q C;  5LJ3 e;  4QVC A;  4J6Y A;  4C92 E;  4PJO C;  4JLI A;  2I2L A;  3EFR A;  3JB9 H;  4M7A F;  5GAN 8;  4C8Q A;  4V2S A;  3V7C A;  2FYK A;  4XU0 A; 
#chains in the Genus database with same CATH topology
 4E7L A;  1VQ7 Q;  2LMJ A;  3OYJ A;  3MCA B;  3MEU A;  1SG5 A;  4WCI A;  1VQN T;  3PTA A;  1M8M A;  2E65 A;  5J3B A;  4DBR A;  2EAY A;  3JCM c;  4A63 B;  2WSE E;  1TS9 A;  3QHS A;  1G3Y A;  3CME Q;  5CKD A;  3UA6 A;  4BDZ A;  1VQL A;  2RHY A;  2O31 A;  4KUD K;  4J83 A;  1ZSZ C;  1WXB A;  4OF1 A;  1NJI U;  3CCV A;  1W4S A;  1YJ9 T;  3HHT B;  3EHR A;  5I22 A;  1ZSZ A;  1PSE A;  1ZQ1 A;  4HVW A;  1VQ5 T;  1RAA B;  2BE7 D;  2HAX A;  3QJ6 A;  4M4Z A;  5GAN g;  2GQI A;  3RKW A;  4BY6 C;  2OJ2 A;  5DLQ E;  4XU2 A;  2X35 A;  4KGZ B;  1KFZ A;  2MAM A;  5CKH A;  2I0N A;  2P0K A;  5EC7 A;  1VOM A;  2K57 A;  3RES A;  2J6K A;  2RHZ A;  3EHQ A;  4QQD A;  4B9X A;  2KDS A;  5CKE A;  3CCL Q;  4J9E A;  4XTY A;  2EKH A;  4KH0 B;  4C8Q D;  1KIK A;  3M5A A;  4LDV A;  4M7D G;  3SD4 A;  1TH7 A;  3OYH A;  3INZ A;  5GMK h;  1AZG B;  1I4K 1;  4HT9 A;  4RTZ A;  4JUV A;  1LVK A;  4LUD A;  1R0B G;  1G83 A;  3QSU A;  4ZN3 A;  1RI9 A;  4M78 F;  4JZ4 A;  4M75 A;  1YWO A;  3H0H A;  3OMG A;  2MWO A;  3CBO A;  1TSF A;  2LQN A;  4J6Y A;  4BI4 A;  3LH5 A;  1NBE B;  2ZPE B;  3L1A A;  4K11 A;  5KCH A;  5GAN f;  1MUZ A;  2A28 A;  2PVO B;  2VYT A;  3NGP A;  1JJ2 P;  1K76 A;  1K73 U;  1YNZ A;  4M77 D;  1OX8 A;  1WXT A;  4PJO B;  1AD5 A;  4JZ3 A;  1UGP B;  1KHI A;  4LDU A;  4IUP A;  1MV0 B;  2KE9 A;  2RPN A;  2YHT A;  4JS5 A;  1EFN A;  2RK2 A;  3P8H A;  4MDW A;  3RNJ A;  4Z89 A;  1KD1 U;  1M3B A;  1PG5 B;  1EZZ B;  4R55 A;  1NEG A;  2RJC A;  2XIC A;  4LDW A;  1WDX A;  3NTK A;  1QW1 A;  1PD1 A;  2C0I A;  1KQ1 A;  3VYG A;  2YLB A;  2GCX A;  1RAE B;  3WVD B;  1HXD A;  2DIQ A;  1Q86 U;  1SHF A;  4F7U B;  2CSI A;  3OQ5 A;  5KE3 A;  4C92 B;  5CAI A;  5FW9 A;  3JB9 D;  2WSF E;  3VUZ A;  2K6D A;  2KK4 A;  2LT1 A;  3SWN B;  4LE9 A;  2FPD A;  2YUO A;  2RF0 A;  4BI8 B;  4HCC A;  5KYY A;  4AFS C;  1D0X A;  2A3L A;  1Q7Y U;  1K1Z A;  1GFC A;  4MMK A;  2E3H A;  2BUD A;  4ATO A;  4M75 F;  3OYD A;  1G3S A;  2HQH A;  1WZO A;  1I5O B;  2XHC A;  4XTU A;  2NWM A;  3BDL A;  3URG A;  3LGF A;  4PJM A;  1VQN Q;  1U3O A;  4PL6 A;  5GAN 3;  2LQW A;  2E1H A;  2DEQ A;  2VC8 A;  4NOY A;  3JAM E;  5GAO p;  2PU9 B;  2XDD A;  1NYF A;  4OGC A;  4QVD A;  2R57 A;  2NYS A;  1OQK A;  2BE9 B;  4E7S A;  1M1K U;  3I55 Q;  2MYS A;  5CVI A;  3OYK A;  1MV3 A;  1YJ9 Q;  1WLP B;  4KT0 E;  2CDT A;  3JB9 H;  4FU6 A;  3A8O B;  1VQ5 Q;  5LJ5 g;  3A1P A;  3JCM d;  1KG1 A;  3GF5 A;  3VJP A;  1GCQ A;  3MP8 A;  1YJN Q;  1K73 R;  2JVV A;  2ESW A;  3EGU A;  2YXY A;  5I21 A;  2L3Q A;  2X4W A;  2GQV A;  1VQ6 Q;  2LCL A;  1IHV A;  1AHJ B;  1JXO A;  3OYF A;  5CKF A;  4C8Q G;  1WQW A;  1JRI A;  2EQU A;  1WYX A;  3REB B;  3CCR Q;  4ESR A;  1VQK Q;  3S3M A;  1M27 C;  3JB9 I;  3G71 A;  3L2R A;  4ELZ C;  2LX9 A;  2V1R A;  5GAN 5;  2Y4Y A;  1TOV A;  4PK4 A;  2Y90 A;  1VYT A;  4BE1 A;  3CCE T;  1QP2 A;  1PCX A;  1D09 B;  4JDS A;  1I07 A;  1N6A A;  3KBG A;  4M7D B;  4HVV A;  1RUW A;  4ZN1 A;  1VQP T;  1KQ2 A;  3VKI A;  4WTO B;  1K9M R;  1Q7Y R;  4M77 G;  2PUK B;  1MGQ A;  2L5Q A;  3QWX X;  1BI0 A;  2CH4 A;  5GAN 6;  5LJ5 f;  2K2M A;  1D3B B;  3CBP A;  4AFQ C;  1MNE A;  3OW2 P;  2OAU A;  3SEM A;  4ZGD B;  4RG8 A;  2O4X B;  1QVF A;  2FEI A;  1BCM A;  4CI0 C;  2HKN A;  1G3W A;  1C0M A;  4QQ6 A;  1E6G A;  2RM4 A;  2B8A A;  1TXQ A;  2KRO A;  2ZZD A;  1M2V A;  1QCO A;  1Q82 U;  1UGV A;  4JLI A;  4KUI A;  3EFR A;  4J9B A;  3HP9 A;  1BI3 A;  3PT9 A;  4B9W A;  3EGD A;  4QT7 A;  4J6W A;  3VS6 A;  2IPO B;  2FRW A;  1D1A A;  1UDL A;  3JB9 G;  1WHL A;  3EFO B;  1UGS B;  5GAN h;  2H8H A;  3MP1 A;  2VWF A;  3L42 A;  3QXE B;  1W1F A;  1RI0 A;  1K0S A;  2LNV A;  1K73 C;  4JRI A;  1D1C A;  1K0X A;  1ZLM A;  4C5E A;  3RKY A;  2DTO A;  2VV5 A;  5EG2 A;  4C5G A;  2KGT A;  2QTV A;  1V29 B;  3QYG B;  1RL2 A;  3CC7 T;  1B34 B;  3EG1 A;  5KE2 A;  2FZG B;  2LT4 A;  2HEQ A;  2GTJ A;  2EGC A;  4PJL A;  1O9S A;  1ARK A;  3CCJ T;  1KD1 C;  1M90 R;  1X6O A;  1GBQ A;  3OYG A;  2JTM A;  4KRT A;  1NPR A;  1PKT A;  3JCM e;  1IB8 A;  3MEW A;  3FRN A;  4DBQ A;  5KYX B;  2ZPI B;  3CCQ A;  3GPL A;  5D6X A;  2D9T A;  1Q86 C;  1AOJ A;  2YT6 A;  2K9G A;  5A2Q E;  5HKC A;  2DPP B;  4ZGE B;  1CSK A;  2A7Y A;  3L2W A;  1K9A A;  2P0P A;  3MPU B;  2JTF A;  2B86 A;  3CC2 T;  1GL5 A;  2FVU A;  3JSC A;  2E5K A;  2X9H A;  4E2F B;  2V26 A;  5GAN d;  1BKB A;  3TU4 K;  2XG8 D;  4PFP A;  1K9M C;  2E4H A;  1Q7Y C;  1IRE B;  3P8D A;  3LW5 E;  4X34 A;  1SRM A;  2FO0 A;  2EYY A;  2HBP A;  3OYA A;  3CME T;  1FMV A;  3UT1 A;  2IIM A;  3CC7 A;  1VQ4 Q;  2E10 A;  3MKD A;  5KYW A;  1V76 A;  3CCJ A;  1KQS A;  2K2V A;  1M1G A;  2DBK A;  3M0T A;  1ZBX A;  3X28 B;  1FXX A;  1V1C A;  2C0T A;  5FWC A;  3G4S Q;  4Z8A A;  4OB0 B;  1C1A A;  2PTK A;  1G5V A;  4QKU A;  2CT4 A;  5FWB A;  1YIT A;  3TQ7 P;  3U23 A;  3I9Q A;  2YUN A;  3S3N A;  1UTI A;  4MDX A;  1X6G A;  1CKB A;  3M55 A;  3M53 A;  1Y96 B;  2EYQ A;  2ED1 A;  1VQ7 A;  2NUT B;  4IUQ A;  4F04 B;  5LL6 S;  3M0P A;  4C8Q B;  4M7A E;  2RHU A;  2HSP A;  2LTO A;  5ECA A;  1M8V A;  3CPW A;  1Y7X A;  1M9S A;  1Y0M A;  1JXM A;  2GBQ A;  2F5T X;  4QW2 A;  3CME A;  4MZP A;  3WXM B;  1QCN A;  1F1B B;  3CCE Q;  4M7A A;  5GAN 4;  5A0L A;  3FC3 A;  2F5K A;  3OYY A;  1VQP Q;  2HQX A;  2AZS A;  3C4S A;  3F70 A;  4J9G A;  3EG9 B;  2RI5 A;  1X27 A;  2F2V A;  3PE0 A;  3H0F A;  1W6X A;  4JRK A;  3EG0 A;  1UGR B;  2RB6 A;  2CZ6 B;  4O5V A;  4X9D A;  2COY A;  2CP7 A;  4L6V 5;  5CR2 A;  3RER A;  4HCB A;  2F69 A;  4M77 B;  5IHK A;  1SKU B;  2Z0W A;  2A0F B;  3EFS A;  2QEX Q;  1VIE A;  1UHC A;  3RBB B;  3PIP A;  2RQV A;  3A8H B;  4IUR A;  3CCL A;  3M0S A;  2EW3 A;  2M02 A;  2J6F A;  2RD1 A;  3H41 A;  4NS5 A;  1OUL A;  1M5Q 1;  2KXC A;  1QMC A;  4EPC A;  5LJ3 f;  3GOX A;  5GAM h;  2LX7 A;  4IKF A;  3E9F A;  1SPK A;  1OV3 A;  3CXC A;  2R58 A;  3UPU A;  4LUE A;  5GAN e;  1EX4 A;  2JXB A;  1YIJ Q;  1M3A A;  3VS2 A;  1AWW A;  2HMA A;  4QVC A;  5KYU B;  4FT2 A;  1R8O B;  2DA9 A;  2I2L A;  1Q82 C;  4AG1 C;  4M7A F;  4RTY A;  4AFU C;  3ULR B;  3NTH A;  1NLO C;  1Y07 A;  1YP5 A;  4PJJ A;  3VV0 A;  3L2V A;  1QVF S;  3X25 B;  2A08 A;  5GAN j;  2KRN A;  2M9U A;  2D1X A;  1UB4 A;  3OSV A;  2F1L A;  3CBM A;  2SRC A;  4OMN A;  2VKN A;  5LJ5 d;  4M78 E;  1OEB A;  3CC2 Q;  1VQ8 Q;  3PVL A;  2JTE A;  1N8R R;  2DF6 A;  3QDF A;  4BDY A;  2CP5 A;  4M78 C;  2M16 A;  1PRL C;  2JM8 A;  1SF9 A;  4RTW A;  3JCM X;  4F16 A;  3EG2 A;  1I8F A;  3LWI A;  4M78 A;  4HCK A;  2E6N A;  1XTD A;  1X01 A;  2DTH A;  2OX7 A;  3I55 T;  2AKL A;  4ZTJ A;  1W70 A;  2YUP A;  3OW2 A;  1UJ0 A;  3OYC A;  3CCU Q;  1XNI A;  4OML A;  2E5Q A;  3HTR A;  3JCM Q;  3TCJ A;  4AT1 B;  1M1F A;  3HL8 A;  4OVA A;  3X26 B;  5HY6 A;  1YJN T;  3TRE A;  4C0G A;  3C12 A;  1VQ6 T;  2K4Y A;  2KYB A;  1WHG A;  2HKQ B;  4FT4 A;  1D0Y A;  4F17 A;  4KUL A;  2RI3 A;  2QG9 B;  2K5L A;  2NLU A;  5FU7 B;  3QYH B;  1VQN A;  3E2U A;  5IH2 A;  3CCR T;  4EMK B;  3THK A;  1VQK T;  1OZ3 A;  2V8J A;  2RQW A;  1Y57 A;  2GNC A;  3HFO A;  3CMA Q;  2QQ9 A;  1IO6 A;  3I55 A;  1IZ6 A;  4C92 E;  1YFN A;  4RTU A;  5CO7 A;  2ATC B;  1NLP C;  1YJ9 A;  3A5Z B;  4M75 E;  2KR3 A;  2DE0 X;  1VQ5 A;  4F7U A;  2XDB A;  4C92 A;  2FPE A;  4M75 C;  4II1 A;  2IG0 A;  2M1H A;  3SWN A;  3I56 T;  1KQS S;  1YJN A;  4N4G A;  1JJ2 S;  1PKS A;  4EDU A;  4HXJ A;  4DEX A;  1VQ6 A;  2JUF A;  1WNL A;  2L8D A;  3ZFJ A;  1KQS P;  4N4H A;  4RKU E;  4PLL A;  2C06 A;  1N8R C;  4RCC A;  2JOY A;  3CCR A;  1OPL A;  1R77 A;  1LPL A;  1ZSZ B;  2FHD A;  2WSC E;  1VIF A;  2LNH B;  2RJE A;  3DKM A;  4NL2 A;  2CP6 A;  4PFO A;  3SFM A;  4IUV A;  1HD3 A;  1Y71 A;  2CS7 A;  2XU8 A;  2L3S A;  3NMZ C;  4PJO F;  5A0G A;  3VYH B;  1UFF A;  2YRC A;  4JPB W;  4BY6 B;  1FYN A;  5C6S A;  5LJ5 e;  3EGX B;  3L2U A;  3CPW P;  2OTL Q;  4MML A;  3FB9 A;  1J3T A;  1SEM A;  3CC4 Q;  1TTH B;  4LNP A;  1HK9 A;  3M0U A;  3X20 B;  2XMF A;  3VS7 A;  2KI7 A;  3AHU A;  1VQ9 T;  3G6E Q;  5LJ5 j;  5LJ3 h;  4F7U F;  1WGS A;  3UAT A;  3S3O A;  4C92 F;  1UG1 A;  1K9M U;  1H3H A;  3L2Q A;  4UC4 A;  2EWN A;  3LX7 A;  2EPD A;  4OP0 A;  2EFI A;  1WJQ A;  3CCV Q;  1VA7 A;  2J7I A;  3VS0 A;  2O9S A;  1ABQ A;  1W2B P;  3REA B;  4RUG A;  4J6X A;  1SSF A;  5CIU A;  1OPK A;  4M7D E;  3QG1 A;  2QGG A;  2P4T A;  4LXC A;  4J7I A;  1VUB A;  2RH2 A;  4OGE A;  3Q1J A;  4M7D A;  5GJW B;  1AWO A;  3CXC S;  3H0I A;  3M58 A;  1BU1 A;  3HRU A;  2EQM A;  5CQY A;  2DVE A;  3I5S A;  4L59 A;  3QZ9 B;  1VQ4 T;  4FW1 A;  1GCQ C;  7AT1 B;  3MHX A;  2D0N A;  2DXU A;  3CXC P;  3HKS A;  5GAM g;  3G4S T;  1PD0 A;  2DRK A;  4ORZ A;  3A8M B;  4L5G A;  2LCS A;  2DJQ A;  4N0A C;  2KRS A;  2ZAE A;  1X2Q A;  2DL4 A;  2KBT A;  1M90 U;  5C0M A;  4N0A A;  4J8O A;  1U06 A;  2EYZ A;  1ABO A;  1XQH A;  4E7H A;  4OB1 B;  2EGA A;  3I35 A;  4KGV B;  3BFM A;  1MHN A;  5KYY B;  1EIF A;  2ZPG B;  2HZY A;  1XJW B;  1GXI E;  2YRD A;  3V8J A;  1SRL A;  3UDC A;  1VQ4 A;  1LCK A;  1MMN A;  3I56 Q;  2CGH A;  1N5Z A;  2L0A A;  3OW2 S;  3QPH A;  1JB0 E;  1H8K A;  3OBW A;  1AZE A;  5GMK e;  3G4S A;  4HT8 A;  4X9C A;  4Z88 A;  1ZX6 A;  1UGQ B;  2V8I A;  1OZ2 A;  1KHC A;  4M7D F;  2QGF B;  1QKX A;  2PNI A;  2E3I A;  1YN8 A;  2VGN A;  2BIV A;  2D6F A;  2QDY B;  4MZT A;  5GAM f;  4M78 D;  1FMW A;  1H3Z A;  2QI2 A;  5IHN A;  3M0Q A;  1YI2 Q;  4GY5 A;  5FU6 C;  4FSS A;  5GMK m;  3JV3 A;  5GMK j;  2DNU A;  2EBP A;  2QEX T;  2CH4 W;  2QK0 A;  2DMO A;  1OYX A;  2E70 A;  2E6Z A;  2G6F X;  4RMO A;  3CCE A;  3CCM Q;  3MET A;  5FLX E;  3C95 A;  1JBM A;  2BKD N;  1VQP A;  1YJW T;  2COW A;  1SSH A;  2FZK B;  4GLK A;  1IXD A;  2YRV A;  2VXF A;  3M57 A;  5KH6 A;  1FMK A;  3BDU A;  1PM3 A;  4E7I A;  1YIJ T;  2KRM A;  1Q95 G;  3DLL A;  2DYI A;  2E64 A;  3N5B B;  1VQ9 Q;  4DEY A;  5HCK A;  2SEM A;  2CT3 A;  4FW2 A;  1D1B A;  4VUB A;  2QEX A;  2Y4X A;  2DZ9 A;  5M9O A;  2P84 A;  4FYX B;  2PVD B;  2JMA A;  3TEE A;  3KUF A;  2KNB B;  1WIE A;  3M0R A;  1T0H A;  3M54 A;  3HRS A;  2ZCF B;  1VQ8 T;  3CPF A;  2FL7 A;  1RLQ C;  2NUP A;  4M75 D;  3PMT A;  2V8K A;  3CD6 Q;  3ASK A;  2JS2 A;  1TG0 A;  3QO3 A;  1QVG P;  2L3P A;  3PGG A;  5IXB A;  2L2P A;  1NYG A;  1CKA A;  1ZBJ A;  2ZGW A;  4HCZ A;  1ACM B;  3D7S B;  4ZTF A;  5LJ3 j;  4OMM A;  2EKO A;  1YIJ A;  5FRO A;  1Z9Q A;  1RLP C;  3VRY A;  1KSW A;  4V2S A;  2KEA A;  3V7C A;  3QZ5 B;  1YHQ Q;  3I5R A;  1PC0 A;  4C0D C;  4ZGJ B;  5D7U A;  1G8X A;  1M2V B;  3M56 A;  1QVP A;  4TVR A;  1ZUU A;  1HYO A;  3CCU T;  4DBF A;  3G71 Q;  4FCY A;  3HPW A;  3EGD B;  1S72 T;  3PIO A;  3UA7 A;  2MPX C;  2MCN A;  3H8Z A;  4EIK A;  3FIF A;  2LJ0 A;  1QP3 A;  4JRQ A;  4OB3 B;  5DLO A;  1VQO Q;  2DER A;  1KK7 A;  1BIA A;  4BE2 A;  3CC2 A;  2LDM A;  1KC8 U;  3VS4 A;  1VQ8 A;  2DIG A;  2EJ9 A;  1X43 A;  4Q5W A;  2KQW A;  2AT1 B;  3VS5 A;  5GAO r;  2CP2 A;  3MEA A;  1PSF A;  5DM7 R;  1TUC A;  3OYL A;  5J39 A;  4XK8 E;  5LJ3 g;  2XID A;  2OI3 A;  3GLX A;  5IHI A;  4FYY B;  4M7A C;  3CMA T;  1N27 A;  2H3J A;  2QQA A;  4C8Q F;  4JJN K;  1M4Z A;  2DKG A;  1K8A U;  8ATC B;  3EH2 A;  2ZPF B;  4J5Y A;  1N8R U;  3ZL7 C;  1H92 A;  1N9S A;  3CCU A;  1M90 C;  2X51 A;  2RQU A;  2E12 A;  4KBM B;  2FZC B;  2YUQ A;  2X3X D;  2K3Y A;  4M78 G;  1Q81 R;  3RMQ A;  2RMO A;  2NUZ A;  1BI1 A;  3OYN A;  2LJ1 A;  3MJX A;  2HSE B;  3AT1 B;  3QDR B;  4IIM A;  1W2B A;  3OS1 A;  2KVQ G;  1QKW A;  1AWX A;  2EGE A;  3OYB A;  2C0O A;  5KYW B;  4MZM A;  4C0D B;  2QYZ A;  3CMA A;  4LDX A;  2JM9 A;  1PRM C;  2CKK A;  2P0Q A;  4PFZ A;  9ATC B;  2K3B A;  3MEV A;  3IQL A;  3GP8 A;  1GFD A;  2DRM A;  1WQ7 A;  1YJW Q;  3SDZ A;  1RAC B;  1MMG A;  4NL3 A;  4O6J A;  3LYI A;  4ELY C;  4ME7 A;  1G3T A;  1S1N A;  2AHJ B;  4A4G A;  2CUB A;  2OTL T;  2X4J A;  3H9N A;  4B6M A;  1UJY A;  4J9F A;  1WPY A;  2K5F A;  2CUD A;  3VRZ A;  1TWB A;  3CC4 T;  4RCB A;  2LC4 A;  2DK3 A;  3JB9 F;  1IHW A;  3J7A F;  4CC4 B;  3KXT A;  4BAC A;  3BY7 A;  2L89 A;  1IGU A;  4RG2 A;  2EQJ A;  1I81 A;  2JZ2 A;  1FWZ A;  1RAB B;  2GFA A;  1KC8 R;  4X1V A;  3G6E T;  2XDP A;  4C5H A;  4M75 G;  1ZHI A;  2KT8 A;  4Y91 A;  1VQL T;  4E47 A;  2DTI A;  4C0F A;  2MIO A;  4EMK A;  2QA4 Q;  3CCV T;  2WAC A;  3UF4 A;  2OTJ Q;  2FPF A;  2GTO A;  3QKJ A;  2R5M A;  1K8A R;  2F2W A;  2MF2 A;  2LRQ A;  1ZUY A;  3OS5 A;  3RIR A;  5GMK l;  1I1J A;  2ZPH B;  1YBY A;  4EMH A;  5GAM d;  3OYE A;  2OTL A;  2LQK A;  2CZ0 B;  3ME9 A;  1HJD A;  2A37 A;  2GF7 A;  3CC4 A;  1O75 A;  4ZNX A;  4AG2 C;  1BBZ A;  3VS1 A;  4IUT A;  2XD0 A;  1PHT A;  2HBW A;  3OYI A;  3G6E A;  1S72 Q;  6AT1 B;  2O88 A;  1YCS B;  2CRE A;  2EQK A;  1LNX A;  2RO0 A;  4PJO E;  2BZ8 A;  1WJS A;  3CCS Q;  1FX7 A;  1BI2 A;  1UEB A;  4PJO C;  4PJN A;  1WA7 A;  1U8R A;  4R0K A;  3M4Y A;  2KXD A;  4DBH A;  1WI7 A;  5GAN 8;  4XU0 A;  4PJO A;  3QII A;  1NM7 A;  1VYV A;  2JW4 A;  2LVM A;  5L8R E;  1MMD A;  2K3X A;  2CZ1 B;  3FLG A;  5FRN A;  5HK0 A;  1KJW A;  1TU0 B;  4C0Z A;  3A8G B;  1VQM Q;  2ZPB B;  3GBQ A;  1AT1 B;  4LN2 A;  3ZBD A;  3OYM A;  2XK0 A;  3EGX A;  2JT4 A;  1NPP A;  2HL3 A;  4F7U E;  3RMS A;  1OU8 A;  4OMF B;  3LH0 A;  2LCC A;  2MWP A;  2ABL A;  4LD9 K;  1M30 A;  4XU1 A;  1QWF A;  4RTT A;  4C92 C;  3GNF B;  5J26 A;  2AKK A;  2X3W D;  3NPF A;  3SWN C;  1KC8 C;  3TVT A;  4P5N A;  1WXU A;  5L23 A;  2RHI A;  5GAN 7;  3EAE A;  4XTW A;  3M9Q A;  2DXC A;  2RK1 A;  1ZA2 B;  1BB9 A;  3DLM A;  4M78 B;  4DOV A;  1K8A C;  2QQS A;  2V1Q A;  2YDL A;  1IGQ A;  3GIB A;  2VXE A;  3DB3 A;  4XTV A;  2M0Y A;  1VQK A;  3PMI A;  4E7Z A;  2K79 A;  3DB4 A;  1BK2 A;  4D8K A;  1YI2 T;  1H64 1;  3TSZ A;  1QVG A;  2RHX A;  1JU5 C;  1MMA A;  5HK3 A;  4DQ2 A;  3CPW S;  2J05 A;  2VVK A;  2DX1 A;  2DL7 A;  1OOT A;  4HA8 A;  3P8B B;  2W10 A;  2RQR A;  2D8H A;  3CCM T;  4PLI A;  2COZ A;  3JB9 J;  3WVE B;  1D0Z A;  4J9I A;  1UUE A;  2DM1 A;  3I56 A;  3SB2 A;  3JCM J;  4BUG A;  3RKX A;  5CKB A;  2D8J A;  1DJ7 B;  3E9G A;  5GAM e;  2GGR A;  1R0C B;  2A36 A;  1ZA1 B;  2O9V A;  4E7J A;  2KT1 A;  1TUG B;  1NJI R;  1T0J A;  4OMP A;  5AYF A;  1U1S A;  5DY9 A;  3JCM P;  1AVZ C;  3OS0 A;  2FB7 A;  1OU9 A;  4CRI A;  3OBY A;  1W2B S;  1YI2 A;  4XAX B;  4KGX B;  1BIB A;  1WJR A;  1VQL Q;  4XTZ A;  1QWE A;  1BYM A;  1U1T A;  1T3L A;  4EMG A;  5GAM j;  4J9H A;  3S6W A;  2DEU A;  4M7A D;  2DVJ A;  2PUO B;  2HD0 A;  1NE8 A;  5A0D A;  2DXT A;  4LDY A;  3JCM h;  1GRI A;  2VUB A;  3HSB A;  3OSS C;  4M75 B;  3CCM A;  4QVZ A;  4PNO A;  3R6O A;  2CZ7 B;  3LLR A;  3O8V A;  4GBQ A;  4FSX A;  2DIL A;  1X6B A;  4J7F A;  1A0N B;  4HKE A;  3O5Z A;  3CD6 T;  1B3Q A;  4M7D C;  4AMC A;  4IIO A;  1E7O A;  2DYB A;  4DA4 A;  3LWH A;  2QTX A;  1YCY A;  4XU3 A;  4CC2 A;  2CP3 A;  4WF2 A;  3QBY A;  2MI6 A;  1YHQ T;  4CC7 A;  3E19 A;  1VQ9 A;  4Y92 A;  1AWJ A;  1D3B A;  3OY9 A;  2BZY A;  3OS2 A;  5LJ3 d;  2AK5 A;  3G71 T;  5I2S A;  2O4X A;  4E7K A;  1UEC A;  2DL5 A;  1JEG A;  5GAO m;  4BB7 A;  2W0Z A;  1E6H A;  3VU3 C;  4KH1 B;  2GFU A;  1X69 A;  1VQO T;  1BCO A;  3JRZ A;  2XKO C;  4RTV A;  2JN0 A;  2EYW A;  3CD6 A;  5IN1 A;  3EG3 A;  2LQ8 A;  5CQX A;  2L3R A;  3EFO A;  3FEO A;  1QVF P;  3H6Z A;  2RNA A;  1NJI C;  2BZX A;  3RR6 A;  1YHQ A;  1KD1 R;  4OB2 B;  2KY9 A;  5IXF A;  1UE9 A;  3EH1 A;  3VS3 A;  2PZ1 A;  5KYN A;  4FIB A;  5GJV B;  2DXB A;  3NFC A;  4BE0 A;  1QCF A;  2IVW A;  1B34 A;  2JJ9 A;  5D6Y A;  2LJ3 A;  3E1S A;  2DL3 A;  1Q86 R;  1WHK A;  4A4H A;  2QXF A;  3RUX A;  2DD5 A;  2PVG B;  1VQO A;  5KYX A;  1M2O A;  1NEB A;  3V7S A;  2K5I A;  2AZV A;  1HSQ A;  3C94 A;  2HQE A;  1WX6 A;  3PFS A;  4FYV B;  2ROL A;  4BI3 A;  2JS0 A;  3TSW A;  1GBR A;  2E41 A;  4R56 A;  1WHH A;  2DJZ A;  2K7A A;  2HDA A;  2O01 E;  4OMQ A;  5GAO n;  2KMT A;  4A4F A;  4JJC A;  4Y28 E;  4LD6 A;  3MP6 A;  1PWT A;  1RAD B;  2HNI A;  4A53 A;  2DO3 A;  3CEY A;  1M1K R;  4J9C A;  2JNG A;  5KCO A;  4PJO D;  3JCM b;  3CCQ T;  1X75 C;  4M7A G;  4OMO A;  1PNJ A;  2QAZ A;  1G2B A;  4JLG A;  1VYU A;  2VB6 A;  5I11 A;  3A8L B;  1JO8 A;  4IUU A;  4A4K A;  1Q81 U;  5AT1 B;  4C8Q E;  2KYM A;  1C6V X;  2ENM A;  1JQQ A;  1Y96 A;  5GAO q;  3HRT A;  4C8Q C;  2NUT A;  5LJ3 e;  1RAG B;  2O2O A;  4JRP A;  1QVG S;  4C8Q A;  2FYK A;  3V8L A;  4Z02 A;  2QA4 T;  3FJP A;  4C92 D;  2OTJ T;  4CC3 A;  3LGL A;  1YJW A;  3OB9 A;  2CYZ B;  2VAS A;  3A98 A;  4FM4 B;  4BD3 A;  3T9N A;  2M0O A;  1P92 A;  2ED0 A;  2RI2 A;  4A4E A;  1YIT T;  1NZ9 A;  2EVR A;  2MK5 A;  4JS4 A;  4HVU A;  1LJO A;  3EG9 A;  4XQ3 A;  5FU6 B;  3L2Z A;  4M77 E;  1XOV A;  4JJB A;  1OX9 A;  2FG0 A;  3J80 E;  1VQ7 T;  3PNW C;  3QWY A;  3BE3 A;  4M77 C;  4PKC C;  3OA6 A;  1N9R A;  5FRM A;  8AT1 B;  2HCK A;  4M77 A;  2KAF A;  2J06 A;  2JMC A;  3CCS T;  2DFU A;  1MND A;  2CP0 A;  1OI1 A;  2QDL A;  3ER0 A;  1UHF A;  5CK9 A;  1RAI B;  2QA4 A;  3J81 E;  2YWW A;  2CSQ A;  2OTJ A;  2EJG A;  1JJ2 A;  2DZC A;  5IAY A;  4JJD A;  3M4G A;  1AEY A;  1QQJ A;  1X2K A;  2XI9 A;  3RDV A;  3X24 B;  1M1K C;  2DD4 A;  3HFN A;  1VQM T;  2DAQ A;  2EJF A;  3FDR A;  1RAH B;  3V8K A;  4C5I A;  2ROT A;  1Q82 R;  5IT9 E;  2LZ6 B;  1Z9Z A;  3GNG A;  1IRX A;  2RQT A;  2BTT A;  3BW1 A;  3JCM g;  1U5S A;  2RA2 A;  5KYU A;  1ZUK A;  3PVQ A;  1RAF B;  3NHN A;  1S72 A;  4F14 A;  3CCS A;  3CCL T;  2D0Q B;  2J6O A;  2NUP B;  4DOW A;  3ZEH A;  4AFZ C;  1B07 A;  1B7T A;  2DBM A;  4D8D A;  1WHM A;  3OMC A;  4N4I A;  3JCM W;  2X4X A;  1NG2 A;  2LP5 A;  1I5L A;  3M59 A;  2DET A;  5GAN 2;  2AIR B;  4ANJ A;  4M7D D;  1VQM A;  4M77 F;  4E6R A;  5GMK i;  3KFV A;  5GAO l;  4D6W A;  2DL8 A;  3CQT A;  3FJ5 A;  2YSQ A;  4FYW B;  4PJO G;  2VGM A;  3VUB A;  2YLC A;  4J9D A;  1WFW A;  2ECZ A;  3C0C A;  1WHJ A;  3R6N A;  2OAW A;  3JCM V;  5CCA A;  5I2M A;  2QAS A;  2QQR A;  3CCQ Q;  2R5A A;  5LJ5 h;  4A54 A;  1GCP A;  4GLM A;  3G1J A;  4YTL A;  3JCM f;  2KSS A;  2P4R A;  2FRY A;  2EQI A;  4F7U G;  1T3S A;  4C92 G;  4XTX A;  4M7A B;  5FU7 C;  3G7Z A;  2RN8 A;  4RTX A;  2H3E B;  3QJY A;  1QLY A;  2RJD A;  3NTI A;  4EMK C;  3CC7 Q;  2EYX A;  1K4U S;  2MOX A;  3CCJ Q;  3V7R A;  2G3R A;  1TUD A;  1YWP A;  3QUI A;  2PQW A;  2HL5 C;  1M3C A;  5D6W A;  2RJF A;  2MMP A;  4QQG A;  2F2X A;  3MO8 A;  1YIT Q;  1Q81 C;  2X4Y A;  1SHG A;  3SHW A;  1I0C A;  2EIF A;  1ZSG A;  2M51 A;  2DLP A;  4FL6 A;  2QQB A;  3UWN A;  1LOJ A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  2EYQ A;  4E7L A;  3VJP A;  5AYF A;  1U1S A;  2QDY B;  4MZT A;  5DY9 A;  3OYJ A;  4IUQ A;  3MCA B;  5GAM f;  3MEU A;  3JCM P;  3OS0 A;  1VQ7 A;  2FB7 A;  4M78 D;  1VQN T;  1H3Z A;  3PTA A;  2E65 A;  2QI2 A;  5J3B A;  5LL6 S;  4CRI A;  4GY5 A;  5FU6 C;  3OBY A;  4C8Q B;  1W2B S;  5GMK m;  4M7A E;  2RHU A;  1YI2 A;  2EAY A;  2LTO A;  4XAX B;  3JCM c;  5GMK j;  3CPW A;  1Y7X A;  1M9S A;  2WSE E;  1M8V A;  1BIB A;  1WJR A;  3QHS A;  2QEX T;  1G3Y A;  4XTZ A;  1BYM A;  5CKD A;  2F5T X;  4BDZ A;  1U1T A;  4QW2 A;  4EMG A;  1OYX A;  2E70 A;  5GAM j;  4MZP A;  3S6W A;  3WXM B;  3CME A;  2RHY A;  1VQL A;  2PUO B;  4M7A D;  2HD0 A;  4KUD K;  2E6Z A;  4J83 A;  1NE8 A;  2BIV A;  4OF1 A;  4RMO A;  5A0D A;  2DXT A;  4LDY A;  3JCM h;  3CCV A;  1W4S A;  1YJ9 T;  3HHT B;  3CCE A;  1NJI U;  2VUB A;  4M7A A;  3MET A;  3OSS C;  3HSB A;  4M75 B;  1PSE A;  5A0L A;  1ZQ1 A;  4QVZ A;  5FLX E;  5GAN 4;  4PNO A;  3C95 A;  3R6O A;  3FC3 A;  1JBM A;  2CZ7 B;  2F5K A;  3LLR A;  2BKD N;  2HQX A;  3F70 A;  3C4S A;  3O8V A;  3OYY A;  5GAN h;  1VQ5 T;  1VQP A;  4FSX A;  2HAX A;  3QJ6 A;  1YJW T;  4J7F A;  4GLK A;  2YRV A;  2RI5 A;  5GAN g;  4HKE A;  3RKW A;  4BY6 C;  3CD6 T;  4M7D C;  4JRK A;  2VXF A;  4XU2 A;  5DLQ E;  2X35 A;  3M57 A;  1UGR B;  2RB6 A;  5KH6 A;  2CZ6 B;  3BDU A;  4O5V A;  4DA4 A;  4X9D A;  3LWH A;  4E7I A;  2QTX A;  1YIJ T;  1YCY A;  2MAM A;  4XU3 A;  4L6V 5;  5CR2 A;  5CKH A;  3DLL A;  3RER A;  4WF2 A;  3QBY A;  2E64 A;  2F69 A;  3N5B B;  4M77 B;  2MI6 A;  2P0K A;  4HCB A;  2K57 A;  3RES A;  1YHQ T;  3E19 A;  1VQ9 A;  2RHZ A;  3EFS A;  4QQD A;  1D3B A;  4B9X A;  3OY9 A;  2KDS A;  1VIE A;  5CKE A;  3PIP A;  4VUB A;  3OS2 A;  5LJ3 d;  2QEX A;  2Y4X A;  3G71 T;  2DZ9 A;  5I2S A;  5M9O A;  3A8H B;  2O4X A;  4IUR A;  4XTY A;  3CCL A;  4E7K A;  4C8Q D;  3M5A A;  4LDV A;  4M7D G;  5GAO m;  3SD4 A;  2PVD B;  1TH7 A;  3TEE A;  2RD1 A;  3KUF A;  4BB7 A;  3OYH A;  4NS5 A;  3INZ A;  5GMK h;  1M5Q 1;  1I4K 1;  3VU3 C;  4HT9 A;  2GFU A;  1VQO T;  4JUV A;  3M54 A;  3HRS A;  4EPC A;  5LJ3 f;  3GOX A;  5GAM h;  2ZCF B;  3JRZ A;  1VQ8 T;  3QSU A;  3CPF A;  2FL7 A;  2XKO C;  4ZN3 A;  4IKF A;  2JN0 A;  4M75 D;  3PMT A;  2V8K A;  3E9F A;  3ASK A;  4M78 F;  3CD6 A;  3QO3 A;  5IN1 A;  3PGG A;  3CXC A;  2R58 A;  4M75 A;  2LQ8 A;  5CQX A;  3UPU A;  2L3R A;  3OMG A;  5GAN e;  2ZGW A;  2MWO A;  3CBO A;  4HCZ A;  4ZTF A;  5LJ3 j;  2EKO A;  1YIJ A;  4QVC A;  4FT2 A;  3FEO A;  4J6Y A;  5FRO A;  4BI4 A;  1R8O B;  2I2L A;  1Q82 C;  2ZPE B;  4M7A F;  3H6Z A;  4V2S A;  3V7C A;  3QZ5 B;  1NJI C;  4C0D C;  3L1A A;  4ZGJ B;  3NTH A;  5KCH A;  1YHQ A;  5GAN f;  3M56 A;  2PVO B;  2VYT A;  1QVP A;  4OB2 B;  2KY9 A;  1Y07 A;  4TVR A;  1K73 U;  3CCU T;  3HPW A;  4M77 D;  3VV0 A;  3L2V A;  4FIB A;  1QVF S;  3X25 B;  2DXB A;  3NFC A;  4BE0 A;  3PIO A;  1S72 T;  4PJO B;  2IVW A;  1B34 A;  3H8Z A;  5GAN j;  1UGP B;  3FIF A;  1KHI A;  4LDU A;  2M9U A;  5D6Y A;  1UB4 A;  3OSV A;  3CBM A;  3E1S A;  4IUP A;  3CCM A;  2YHT A;  4A4H A;  2QXF A;  3RUX A;  1QP3 A;  4JRQ A;  2DD5 A;  4OB3 B;  5DLO A;  5LJ5 d;  2PVG B;  4M78 E;  4JS5 A;  2RK2 A;  3P8H A;  4MDW A;  1VQO A;  1KD1 U;  1BIA A;  4BE2 A;  3CC2 A;  2LDM A;  1KC8 U;  1VQ8 A;  2DIG A;  2EJ9 A;  4Q5W A;  4BDY A;  3V7S A;  2KQW A;  2K5I A;  4R55 A;  4M78 C;  2M16 A;  2RJC A;  5GAO r;  2XIC A;  4LDW A;  3MEA A;  1PSF A;  3C94 A;  3JCM X;  1I8F A;  5DM7 R;  3LWI A;  4M78 A;  2HQE A;  3NTK A;  1QW1 A;  3OYL A;  3PFS A;  5J39 A;  2E6N A;  4XK8 E;  1XTD A;  1KQ1 A;  1X01 A;  2XID A;  2YLB A;  2DTH A;  3VYG A;  4BI3 A;  5LJ3 g;  2GCX A;  3WVD B;  1HXD A;  2DIQ A;  3GLX A;  1Q86 U;  4M7A C;  4F7U B;  3CMA T;  5KE3 A;  1N27 A;  3OQ5 A;  3I55 T;  4C92 B;  5CAI A;  2H3J A;  2QQA A;  4C8Q F;  4JJN K;  3JB9 D;  2WSF E;  1M4Z A;  2DKG A;  3VUZ A;  4ZTJ A;  2KK4 A;  2E41 A;  2LT1 A;  3SWN B;  1K8A U;  4R56 A;  2ZPF B;  4J5Y A;  1N8R U;  3OW2 A;  2DJZ A;  3OYC A;  1XNI A;  2E5Q A;  4BI8 B;  3JCM Q;  4HCC A;  1N9S A;  3TCJ A;  3CCU A;  2O01 E;  5GAO n;  1M90 C;  2E12 A;  2KMT A;  4A4F A;  2A3L A;  1M1F A;  3HL8 A;  4KBM B;  4OVA A;  1Q7Y U;  4Y28 E;  3X26 B;  4MMK A;  2K3Y A;  4LD6 A;  3MP6 A;  5HY6 A;  2BUD A;  4M78 G;  4ATO A;  4M75 F;  3OYD A;  3RMQ A;  2HNI A;  1G3S A;  4A53 A;  2DO3 A;  1YJN T;  3TRE A;  3CEY A;  2JNG A;  5KCO A;  4PJO D;  1BI1 A;  3JCM b;  3CCQ T;  4C0G A;  3OYN A;  2XHC A;  3C12 A;  1X75 C;  1VQ6 T;  2K4Y A;  4XTU A;  4FT4 A;  4M7A G;  3BDL A;  3URG A;  3LGF A;  3QDR B;  4JLG A;  2RI3 A;  4KUL A;  1W2B A;  2K5L A;  2NLU A;  5FU7 B;  3QYH B;  4PL6 A;  5GAN 3;  1VQN A;  4NL3 A;  3OS1 A;  2E1H A;  2DEQ A;  2KVQ G;  2VC8 A;  4NOY A;  4EMK B;  3A8L B;  4IUU A;  3JAM E;  4A4K A;  2PU9 B;  4C8Q E;  5GAO p;  1Q81 U;  1OZ3 A;  2V8J A;  1VQK T;  2XDD A;  4OGC A;  4QVD A;  3OYB A;  2R57 A;  1M1K U;  3HFO A;  1Y96 A;  4MZM A;  5GAO q;  4C0D B;  2QQ9 A;  5CVI A;  3HRT A;  3OYK A;  3CMA A;  4LDX A;  4C8Q C;  3I55 A;  1IZ6 A;  5LJ3 e;  2CKK A;  2P0Q A;  4KT0 E;  4C92 E;  5CO7 A;  3JB9 H;  3MEV A;  1YJ9 A;  4JRP A;  1QVG S;  4C8Q A;  4FU6 A;  3A5Z B;  2FYK A;  3GP8 A;  3A8O B;  3V8L A;  4Z02 A;  4M75 E;  2QA4 T;  3FJP A;  5LJ5 g;  3JCM d;  1KG1 A;  1WQ7 A;  4C92 D;  1VQ5 A;  2OTJ T;  4F7U A;  3SDZ A;  2XDB A;  4C92 A;  3LGL A;  1YJW A;  3GF5 A;  4II1 A;  2IG0 A;  3OB9 A;  2M1H A;  4M75 C;  3MP8 A;  3LYI A;  4O6J A;  3SWN A;  2JVV A;  2CYZ B;  4ME7 A;  4ELY C;  3I56 T;  1KQS S;  1G3T A;  1YJN A;  4FM4 B;  2AHJ B;  4A4G A;  4BD3 A;  5I21 A;  3T9N A;  2M0O A;  1P92 A;  4N4G A;  2RI2 A;  4A4E A;  1YIT T;  1JJ2 S;  2X4W A;  2OTL T;  4EDU A;  2GQV A;  2X4J A;  2LCL A;  1NZ9 A;  1WPY A;  2D6F A;  1VQ6 A;  1AHJ B;  4JS4 A;  2K5F A;  2JUF A;  3CC4 T;  3OYF A;  5CKF A;  4RCB A;  1LJO A;  1WNL A;  2LC4 A;  4C8Q G;  2L8D A;  4XQ3 A;  1WQW A;  2DK3 A;  3L2Z A;  5FU6 B;  4N4H A;  4RKU E;  4PLL A;  4M77 E;  3ZFJ A;  1JRI A;  2EQU A;  2C06 A;  3JB9 F;  1N8R C;  1XOV A;  3J80 E;  3KXT A;  3J7A F;  4BAC A;  3BY7 A;  4RCC A;  2L89 A;  1VQ7 T;  2JOY A;  3PNW C;  4RG2 A;  3CCR A;  2EQJ A;  3S3M A;  1I81 A;  2JZ2 A;  1FWZ A;  2GFA A;  3CCR T;  3JB9 I;  4M77 C;  3G6E T;  4PKC C;  3OA6 A;  1N9R A;  5FRM A;  3G71 A;  2FHD A;  2WSC E;  1VIF A;  3L2R A;  2XDP A;  4C5H A;  2RJE A;  4M75 G;  4M77 A;  3DKM A;  4NL2 A;  4ELZ C;  1ZHI A;  2LX9 A;  3SFM A;  2KAF A;  4Y91 A;  1VQL T;  3CCS T;  4E47 A;  2DTI A;  5GAN 5;  2Y4Y A;  4IUV A;  4C0F A;  4EMK A;  2Y90 A;  1Y71 A;  2CS7 A;  1OI1 A;  3ER0 A;  5CK9 A;  2XU8 A;  5A0G A;  4PJO F;  3CCV T;  2WAC A;  3VYH B;  2QA4 A;  4BE1 A;  3CCE T;  3J81 E;  1QP2 A;  3QKJ A;  4JDS A;  2R5M A;  2OTJ A;  1N6A A;  2MF2 A;  4BY6 B;  2LRQ A;  3KBG A;  4M7D B;  5C6S A;  5LJ5 e;  2EJG A;  4ZN1 A;  3OS5 A;  3L2U A;  1VQP T;  3RIR A;  5GMK l;  1JJ2 A;  1KQ2 A;  2ZPH B;  2DZC A;  5IAY A;  1YBY A;  4EMH A;  3M4G A;  5GAM d;  3VKI A;  3OYE A;  4MML A;  3FB9 A;  2OTL A;  2LQK A;  2XI9 A;  4M77 G;  2PUK B;  1MGQ A;  2CZ0 B;  2L5Q A;  2DD4 A;  3ME9 A;  3HFN A;  3X24 B;  1VQM T;  1BI0 A;  2DAQ A;  2EJF A;  3FDR A;  5GAN 6;  5LJ5 f;  3V8K A;  1D3B B;  2GF7 A;  4C5I A;  3CC4 A;  1O75 A;  3CBP A;  5IT9 E;  1HK9 A;  3X20 B;  2OAU A;  4ZGD B;  4RG8 A;  2O4X B;  3GNG A;  1QVF A;  4IUT A;  4CI0 C;  3AHU A;  1VQ9 T;  1G3W A;  4QQ6 A;  5LJ5 j;  2XD0 A;  3BW1 A;  5LJ3 h;  1WGS A;  3JCM g;  4F7U F;  3S3O A;  2RA2 A;  4C92 F;  3OYI A;  3G6E A;  1K9M U;  3L2Q A;  2RM4 A;  4UC4 A;  2B8A A;  2EQK A;  2RO0 A;  1LNX A;  2EWN A;  3LX7 A;  1S72 A;  4PJO E;  1WJS A;  4OP0 A;  1FX7 A;  2EFI A;  1WJQ A;  2ZZD A;  3CCS A;  1BI2 A;  3CCL T;  2D0Q B;  1Q82 U;  1UEB A;  4PJO C;  4JLI A;  4KUI A;  3ZEH A;  4DOW A;  3EFR A;  1U8R A;  3HP9 A;  3M4Y A;  5GAN 8;  1BI3 A;  3PT9 A;  4B9W A;  4XU0 A;  4PJO A;  4J6X A;  4J6W A;  3QII A;  3JB9 G;  1SSF A;  1UGS B;  3OMC A;  5CIU A;  2LVM A;  3L42 A;  3MP1 A;  4N4I A;  5L8R E;  3QG1 A;  2K3X A;  2P4T A;  2CZ1 B;  2X4X A;  1RI0 A;  3QXE B;  3FLG A;  5FRN A;  5HK0 A;  1I5L A;  3M59 A;  4C0Z A;  2LNV A;  1K73 C;  5GAN 2;  4JRI A;  3A8G B;  4J7I A;  4M7D D;  2ZPB B;  4C5E A;  4M77 F;  1VQM A;  3RKY A;  5GMK i;  2DTO A;  1VUB A;  2RH2 A;  2VV5 A;  4OGE A;  3Q1J A;  4M7D A;  5EG2 A;  3ZBD A;  4C5G A;  5GAO l;  3OYM A;  2XK0 A;  4D6W A;  1NPP A;  4F7U E;  3QYG B;  1V29 B;  3RMS A;  3CXC S;  1RL2 A;  3M58 A;  4OMF B;  1M1K C;  3LH0 A;  2LCC A;  2MWP A;  2EQM A;  3HRU A;  5CQY A;  3CC7 T;  4LD9 K;  4PJO G;  2DVE A;  2VGM A;  1B34 B;  5KE2 A;  2LT4 A;  3VUB A;  2YLC A;  4XU1 A;  4L59 A;  3QZ9 B;  4C92 C;  1VQ4 T;  1O9S A;  3GNF B;  5J26 A;  3CCJ T;  1KD1 C;  1X6O A;  3OYG A;  2JTM A;  3SWN C;  3MHX A;  1KC8 C;  1NPR A;  2DXU A;  4P5N A;  3JCM e;  2RHI A;  3JCM V;  5CCA A;  3HKS A;  3FRN A;  3MEW A;  5GAM g;  5GAN 7;  3G4S T;  2ZPI B;  3EAE A;  4XTW A;  5I2M A;  3M9Q A;  2QQR A;  2R5A A;  3A8M B;  4L5G A;  5LJ5 h;  4A54 A;  2DXC A;  2RK1 A;  3CCQ A;  3GPL A;  5D6X A;  2D9T A;  4YTL A;  1Q86 C;  3JCM f;  5A2Q E;  5HKC A;  2DPP B;  3DLM A;  4M78 B;  4N0A C;  2KSS A;  4ZGE B;  2A7Y A;  4DOV A;  3L2W A;  2P0P A;  1K8A C;  1M90 U;  2JTF A;  5C0M A;  2QQS A;  3CC2 T;  4N0A A;  4J8O A;  3GIB A;  2FVU A;  3JSC A;  2VXE A;  3DB3 A;  4XTV A;  1XQH A;  4F7U G;  4E7H A;  5GAN d;  1BKB A;  4OB1 B;  4C92 G;  3M55 A;  3PMI A;  4XTX A;  3TU4 K;  4M7A B;  1VQK A;  2XG8 D;  3DB4 A;  1K9M C;  1Q7Y C;  5FU7 C;  1IRE B;  1YI2 T;  3G7Z A;  1H64 1;  3BFM A;  3P8D A;  1QVG A;  2RHX A;  3LW5 E;  4X34 A;  3QJY A;  1MHN A;  2RJD A;  3NTI A;  4EMK C;  1EIF A;  5HK3 A;  2ZPG B;  4DQ2 A;  3OYA A;  2HBP A;  3CME T;  3UT1 A;  1GXI E;  3V8J A;  3CPW S;  3JCM W;  3CC7 A;  4HA8 A;  2E10 A;  3P8B B;  3V7R A;  2G3R A;  3UDC A;  1VQ4 A;  3CCJ A;  3CCM T;  2K2V A;  1KQS A;  3QUI A;  1M1G A;  2PQW A;  4PLI A;  1ZBX A;  3JB9 J;  3X28 B;  1FXX A;  2CGH A;  3WVE B;  5D6W A;  3OW2 S;  3QPH A;  1JB0 E;  2RJF A;  3OBW A;  4OB0 B;  2MMP A;  4QQG A;  3I56 A;  1G5V A;  3SB2 A;  3MO8 A;  5GMK e;  3G4S A;  4HT8 A;  3JCM J;  4X9C A;  4BUG A;  1Q81 C;  3RKX A;  2X4Y A;  1UGQ B;  1YIT A;  2V8I A;  1OZ2 A;  5CKB A;  1KHC A;  1DJ7 B;  4M7D F;  3E9G A;  5GAM e;  2EIF A;  3S3N A;  4M7D E;  4FL6 A;  4MDX A;  4E7J A;  2VGN A;  2QQB A;  3UWN A;  1LOJ A;  3M53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...