5LJ5j

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
94
Chain Sequence
b'RAELEELEEFEFKHGPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTEKKGKNVINRERFISKLFLRGDSVIVVLKTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 13
structure length 94
sequence length 94
chains with identical sequence m
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5j00
5GMKe 3RUXA 1X01A 4PJOF 4C8QC 4M7AF 1WPYA 2RB6A 3V7CA 2JN0A 2HNIA 4M77C 3RKWA 3SWNA 5LJ5g 1LOJA 4M78D 3M4GA 4JRIA 3RIRA 1D3BA 3JB9I 3JB9J 5GANf 1N9SA 4M75A 1WQWA 1YCYA 4F7UG 3JCMV 4PJOB 4XTZA 4M7AB 2DEQA 5LJ5h 2DXTA 2K57A 1Y96A 2VXFA 4PJOG 5GANe 3SWNC 5GMKl 4WF2A 1BIAA 4X9DA 3PGGA 5I21A 5GMKi 3EFSA 4M7DF 3SB2A 3JCMJ 1M8VA 4M75C 1B34B 2DVEA 5GAOm 4J5YA 4V2SA 3AHUA 4C8QG 5GAMj 3GIBA 3VU3C 4M77G 4HT9A 1H641 4C92D 4F7UF 4NOYA 1N9RA 3JCMg 3V8JA 5GANd 3JB9H 4M7DB 3EFRA 3FIFA 5GAN3 2QTXA 4XQ3A 2E10A 4M7DG 3JCMh 4EMKA 1U1SA 4F7UE 1KQ1A 4OP0A 3RKYA 5DY9A 3JCMX 4PJOE 2YHTA 4M7AE 4DQ2A 3BW1A 4C8QF 2DTIA 4F7UB 4QVDA 3RERA 5GAMf 1U1TA 4J6WA 5LJ5j 3QHSA 3JCMb 4M77F 3QSUA 2DXUA 4M75G 2EJGA 4HA8A 2YLCA 4C92A 4A54A 4Y91A 2FB7A 4EMKC 1I4K1 5GAMe 3JCMP 2E65A 4C8QE 3JB9F 4XU3A 4NL3A 1MGQA 4PJOD 3INZA 4M77E 3V8LA 5GAOl 2EAYA 3V8KA 4M7AD 2RA2A 3HFNA 3L2ZA 1BIBA 3BFMA 4C8QB 5LJ3g 4EMHA 3HFOA 4M78A 4M77B 4C92C 3QUIA 2Y90A 4M7DE 2FYKA 5LJ5f 4C8QD 1HXDA 4M75F 5LJ3h 2I2LA 3JB9G 5GAMd 1KQ2A 4XTXA 3JCMc 5GAN2 5GAOn 5GAN4 5LJ5e 2DZCA 5GMKh 2RD1A 2YLBA 4M78C 3JCMQ 2DJZA 4PJOA 1JBMA 4M75E 3SWNB 3V7RA 4M7AA 4M7DD 1I8FA 2EJ9A 2EJFA 3BY7A 4PNOA 1D3BB 3RKXA 4M75B 4XU2A 5GANg 1LNXA 4RCBA 1B34A 2RM4A 5LJ3f 3FB9A 4XTVA 4PJOC 1Y96B 4M7AC 2DTHA 2DTOA 5LJ5d 4C92G 5GAOq 2EWNA 1WNLA 2DZ9A 4M75D 4N0AA 3V7SA 5GANh 3JCMf 2E64A 4J6XA 1LJOA 3QO3A 3BDUA 4HT8A 4M7DA 3JCMe 5GAOp 1JRIA 3JCMW 4M78B 4MMKA 4MMLA 4A53A 4M78G 5LJ3j 5GAOr 1M5Q1 4N0AC 5CAIA 5GAN8 4J6YA 2DKGA 2VXEA 4XU1A 5GAN5 1I81A 4M77D 4JLIA 5GMKj 5GAN7 2ZGWA 1HK9A 5LJ3d 1TH7A 2E1HA 4JRKA 4C92F 4F7UA 5GAN6 3JB9D 4M7DC 3HSBA 4XU0A 4EMKB 4QVCA 2CGHA 3FJPA 3JCMd 4EMGA 4RCCA 4M7AG 4C92E 4XTUA 5GMKm 1WQ7A 4JUVA 4M78F 5GAMg 2E41A 4X9CA 4C8QA 4C92B 2VC8A 4XTYA 1I5LA 5GANj 4M77A 3RESA 4NL2A 5LJ3e 5GAMh 4M78E 4XTWA 3L1AA
chains in the Genus database with same CATH superfamily
4Y28E 1EIFA 3Q1JA 2GTOA 3RR6A 3CCQT 1QWEA 2JM8A 3TCJA 4MDXA 1HSQA 2EFIA 1VIEA 3I56A 3RIRA 1BKBA 5LJ5h 2DXTA 3NFCA 3BDLA 4OB0B 3JCMJ 1KQSP 4V2SA 2M1HA 3R6OA 4X1VA 3X24B 3G71Q 3OW2S 1N6AA 2IIMA 4F14A 1X6OA 4DOWA 1VQKQ 1NJIU 3JB9H 4M7DB 3CCMA 5GAN3 2QXFA 2CH4A 1VQ7T 1BK2A 4LUEA 1O75A 2V26A 2V8IA 3CCVQ 2P4RA 4J6WA 3QXEB 1G5VA 1NM7A 1IB8A 2X4YA 2DETA 1WXTA 1UEBA 1I1JA 3T9NA 4EMHA 1DJ7B 4M77B 1W2BA 1OQKA 2EKHA 2HBWA 4LNPA 4KGXB 2KGTA 1PSFA 2DYBA 4M75F 2K5IA 1VQLT 3JCMc 2QQSA 2HQHA 4FCYA 4N4GA 3OYKA 3A8OB 4M7DD 1N8RR 1I8FA 1VYTA 1YI2T 3UT1A 5KYXA 2HAXA 4D8KA 2KR3A 3V7SA 1G8XA 3UA7A 5FLXE 3ZBDA 2B8AA 2QA4A 3JCMW 1UG1A 5LJ3j 4J6YA 3LWHA 2BKDN 4ELZC 1I81A 4M77D 5CIUA 4IUUA 2NUTA 2M02A 4RMOA 4QVCA 2EYXA 2ZPEB 4HCZA 5GMKm 1AWJA 4JUVA 2ZPFB 5LL6S 4PFPA 1Q81C 3G4SQ 4C0GA 1MMGA 3RBBB 2QEXQ 4II1A 2LC4A 1WFWA 1C6VX 1VQPT 1T3LA 2W10A 5KE3A 1Q82R 1PWTA 3LH5A 4OMMA 1UTIA 1RAAB 1VQNA 1Q95G 3G6ET 1JJ2S 1EZZB 5DLOA 3MP1A 5GANe 2HMAA 4ZGEB 4BB7A 2EGEA 2HKQB 2PVGB 3PIPA 1B34B 4J5YA 3CCUA 4QQDA 4M77G 2LCLA 1QVGP 1M9SA 2D6FA 1AVZC 4LDVA 3OYGA 2DF6A 2J7IA 3AT1B 4OP0A 4GLKA 4M7AE 2RF0A 4X34A 1I0CA 2DMOA 1SSHA 1G3WA 4NL3A 1U3OA 2PQWA 4BY6B 2X9HA 5LJ3g 1AWOA 3HFOA 4L5GA 4O6JA 1PKSA 1NPPA 2VV5A 1BCOA 1RAHB 2ED1A 2HSEB 1G3TA 1ABOA 2DJZA 2JS0A 4M75E 4M7AA 1D3BB 1B3QA 2XG8D 5KYYB 3META 1M3CA 3G71A 4J6XA 2MWPA 2V1RA 1VQ9Q 2EYWA 4FW2A 1VQ4Q 4IKFA 5KCOA 1X69A 1ZHIA 5CCAA 3CCVA 4J7IA 3E9FA 4E7HA 1HD3A 3LYIA 3P8BB 3MEVA 1X27A 1K1ZA 3L42A 2Y4XA 2L8DA 1MNDA 3M0QA 2KDSA 2MYSA 5IHKA 1ACMB 1VQPA 2ZZDA 2KK4A 3TSZA 2XI9A 3EG0A 4RTYA 1T3SA 4AMCA 3FDRA 1ZUYA 2CKKA 2VGNA 2X3WD 3X28B 1FMKA 3H0FA 2DBMA 1RI9A 4BI4A 2RI3A 5HY6A 1YCYA 2BTTA 3MEUA 1KFZA 5GMKl 2RJDA 4WF2A 2XICA 2LT4A 4X9DA 3PGGA 2J6KA 2HZYA 3H8ZA 4M75C 4DBHA 1IZ6A 1GCQC 4OMPA 3MHXA 1WIEA 2IVWA 1K9MR 2LQNA 2VYTA 1G83A 4XQ3A 2KE9A 1UE9A 3ER0A 3BW1A 2KMTA 2EJGA 4C92A 2RK1A 4DBFA 2RA2A 4C8QB 3G4SA 2QEXA 5IAYA 2BZXA 2RPNA 3EGXB 4KUIA 5GAMd 2K3BA 3H9NA 2MI6A 4KH0B 1KD1C 1YHQQ 1K0XA 2I0NA 3CD6A 1LNXA 4RCBA 1M1KC 2HEQA 4EIKA 1ZQ1A 3JCMf 1QVFP 3NTIA 3VS5A 2QDYB 5GAOp 1JRIA 2CUDA 3M56A 1X6GA 5FU6B 2CZ6B 2G6FX 1PRLC 3EGDB 4UC4A 2ENMA 3OW2P 4JRKA 2H3JA 1R77A 1KQSS 3SFMA 3N5BB 2PNIA 4QQGA 3GNGA 5FW9A 2JN0A 5A0DA 5IT9E 1CSKA 4Q5WA 3M0RA 1BI0A 3M4GA 1NEBA 3A8GB 4BD3A 3VJPA 5CK9A 1M1GA 1YJ9Q 4XK8E 1RL2A 1PM3A 2E6ZA 3GPLA 2SRCA 3RMSA 5I21A 3KBGA 2GF7A 2W0ZA 2NUPA 4C8QG 4C0DB 1VQOA 1VQ9A 3OS5A 2X51A 1VQ4A 1R0CB 3VS2A 1OZ2A 2VKNA 4ZTFA 2EQJA 3M0PA 3JCMh 1KQ1A 2D8HA 4E7ZA 4PJOE 3VV0A 2YHTA 2PU9B 4O5VA 2LNVA 3A8MB 1D1BA 2YLCA 3PVLA 5FRNA 4XU3A 2KY9A 1UGVA 4C5GA 5J39A 2WSFE 3JAME 1Y07A 4PJNA 4M78A 1I5OB 3MJXA 3L2UA 1UGSB 1N8RC 2QGGA 5GAN2 3VUZA 4L59A 4PJOA 1WZOA 1S72T 1WYXA 1OX8A 2C0OA 4PJLA 2CP6A 5KYUB 3FB9A 3OYEA 3I5SA 2JVVA 4IUQA 1RABB 2NUZA 4HT8A 4M78B 3CCLQ 1Q86U 1VQ5T 1JXOA 2RI5A 1ZX6A 3CC7T 4F7UA 4AFSC 1MUZA 3HKSA 3ZL7C 4RCCA 3FLGA 1RAEB 4BDYA 1UFFA 2DX1A 2OTJA 3MCAB 1QVGS 1M2VB 1YWPA 5GANj 1OX9A 4FYWB 2KAFA 3QJ6A 2NYSA 1Q82C 5GAOn 3J81E 2DM1A 1VQMT 4KGZB 2YSQA 4JLGA 5KYWA 4AT1B 3SWNA 1UJYA 2YDLA 2GFAA 4M78D 2CYZB 1N9SA 2KROA 1OU9A 1YHQA 2DEUA 3VRZA 3DB4A 4M7DF 4J7FA 2AIRB 2DRKA 3E9GA 2LRQA 4RTVA 5FU7C 1N9RA 3V8JA 2GNCA 3LX7A 2A37A 1WHHA 4AFQC 2VASA 5DY9A 2DRMA 3RERA 1K73R 1QLYA 4M77F 3TREA 3QSUA 1OPLA 4PFZA 3OSSC 3JCMP 2H8HA 3V8KA 4A4HA 3CMAQ 1BIBA 5CKBA 2HL5C 2X4WA 5I2MA 2LX9A 4PJMA 2F1LA 2E12A 3GLXA 2CP5A 2RHYA 2OAWA 1KQ2A 1GXIE 2P0KA 3A8LB 1TG0A 3EFOA 1XQHA 2K5FA 2DXBA 1YJ9A 2EQIA 2EYQA 1RLQC 4LE9A 3UPUA 5GANg 2GBQA 1SHGA 4RTXA 2RQRA 3FRNA 2DTOA 1UUEA 3VUBA 2QASA 1LJOA 2J6FA 1QCNA 2EQKA 3OA6A 3CXCA 1KHIA 3OMCA 2YUQA 2ZGWA 3A8HB 1ABQA 1VQ8Q 4HCKA 2MPXC 4E2FB 3I55A 4P5NA 2DAQA 1QP2A 2HQEA 3MKDA 2OI3A 4BE0A 2CH4W 1OPKA 1UGPB 2KT1A 3NGPA 4FT4A 1OV3A 2ECZA 4JRIA 2QA4T 3JB9J 3CC2T 2DIQA 1Y96A 2QGFB 1QCOA 1YP5A 4DA4A 1WXBA 4TVRA 1QKXA 1KK7A 2X4JA 3TVTA 1ZSGA 3EG9B 2A28A 1FYNA 1H641 1YNZA 2LMJA 3NPFA 1AZEA 1M3AA 2YUOA 3OY9A 4OF1A 2KRMA 3VS1A 3CCSA 1QVFS 4R55A 2XKOC 3OS2A 4A54A 4EMKC 5GAMe 2F2WA 1N8RU 2MIOA 1VQNT 3REAB 2KVQG 4M77E 2M0YA 3L2ZA 4A4EA 1PHTA 4ORZA 1ZSZC 2Y90A 1YI2Q 1ZUKA 1FXXA 2WSEE 8AT1B 5LJ3h 2FZKB 3CCUT 1MMDA 3QZ9B 1MNEA 1QCFA 4LUDA 3QWXX 2COZA 2RI2A 1RI0A 2CP3A 5KE2A 4AFUC 1BCMA 3VS7A 5LJ5d 1MV0B 2EWNA 3LLRA 2JT4A 1RACB 2MK5A 1ARKA 3M55A 5I2SA 2M9UA 1KC8R 2VWFA 4HVVA 4A53A 1YIJQ 3A5ZB 3UF4A 1Q7YR 2K79A 5LJ3d 1K9AA 1AWXA 4M7DC 1ZA2B 3ZFJA 1Q82U 4MZMA 2CGHA 2MMPA 4BE1A 2DNUA 2K9GA 1VOMA 4ZNXA 2KRSA 3WVEB 2XIDA 1WA7A 4NL2A 2L3SA 2CP2A 5FWBA 1M90R 1UGQB 3CC2A 2OAUA 4Z88A 4JJBA 3HP9A 4M77C 2ZAEA 3G71T 2E5KA 1MMNA 3VS3A 1NLPC 2DL8A 1JJ2A 1WQWA 2DD4A 1X2KA 3CPFA 5EG2A 3CCVT 5KYXB 6AT1B 2DFUA 9ATCB 1W2BS 4IIMA 2M16A 1TSFA 5I11A 1WDXA 2QG9B 2RHUA 1V76A 4FU6A 4QVZA 5CQXA 4M7DG 1U1SA 3WVDB 2VVKA 4C8QF 2NUTB 3C94A 4A63B 3QZ5B 1EFNA 1VQ8A 2M51A 2DXUA 5FRMA 2E65A 1BI1A 1WHGA 2FPDA 2FZCB 1UGRB 3G1JA 3ASKA 1FX7A 1RADB 3QYHB 2MCNA 2I2LA 3OYMA 3NMZC 4XTXA 1JXMA 3H41A 3CC4Q 4AG2C 4JJNK 1SPKA 3BY7A 1HYOA 1PNJA 3LGFA 4J83A 1Y7XA 3MPUB 4YTLA 1WGSA 1VQ6Q 1WJSA 3MO8A 4J9DA 5CKDA 1W1FA 1M8MA 2HD0A 2DL7A 2VB6A 2A36A 5CAIA 5GAN5 3G4ST 5GAN7 1NYFA 2QEXT 3JB9D 2FPEA 2EGCA 2V8JA 4XU0A 2FO0A 3QBYA 1UHCA 3O5ZA 3QJYA 1NYGA 1CKBA 4X9CA 4OGEA 4JZ3A 3E19A 3CD6T 2YRVA 2RHXA 3J80E 5GMKe 2JTFA 3RUXA 4BY6C 1VQKA 1YJWQ 1D0ZA 2QDLA 4CRIA 1K9MU 2V1QA 4M75A 2JNGA 1GCQA 1SSFA 3JCMV 4M7AB 2F5TX 1Q86C 4PL6A 4QW2A 3OS0A 2DE0X 3QPHA 1GL5A 4A4FA 4E7LA 1YIJA 2DL4A 1WI7A 2R5MA 4KBMB 3FIFA 1K4US 4JS5A 3FEOA 4N4IA 1NG2A 4DEXA 4DQ2A 1OOTA 2RO0A 4IURA 4HA8A 2EKOA 2LNHB 1LCKA 4C5EA 2FB7A 2GQIA 4C8QE 4MZPA 2XDBA 1TTHB 3INZA 4M7AD 1M27C 1RAFB 4OB2B 2XDDA 3QUIA 4RTWA 4JRPA 2XD0A 1LVKA 1TUCA 4JJCA 3CMEQ 4DBRA 1VQOT 1VQ9T 2ESWA 4BUGA 2BIVA 1VQ4T 2CSQA 3RKXA 3CBOA 1D1CA 4L6V5 2A7YA 2G3RA 1U5SA 1G3SA 3EG1A 4M75D 1VUBA 4FT2A 1E7OA 2KRNA 5J3BA 1X2QA 4R56A 2COWA 3UATA 4OMOA 3OYBA 2DKGA 4EDUA 2L0AA 5C6SA 2L5QA 1BI2A 3M5AA 3JSCA 4M7AG 2JM9A 1MV3A 4RTTA 4QT7A 4B6MA 4MZTA 1IHVA 4C92B 1D09B 3OYJA 3KXTA 2R5AA 4LDXA 3CCRQ 2RQTA 2X4XA 4C0FA 1S1NA 1VIFA 4PFOA 4C8QC 3CCEQ 1CKAA 3CC4A 4OMLA 4PLIA 5GANf 3I5RA 1WHJA 4Z8AA 4QKUA 1VQ6A 3TU4K 3CPWA 2DVEA 2P84A 1V1CA 5GAMj 2EW3A 4HT9A 4C92D 2OTJT 4NOYA 2CZ1B 4KUDK 2MF2A 5ECAA 2R58A 2JMCA 4Y92A 5FU6C 3C4SA 1HJDA 3CQTA 3EGUA 1GRIA 2YXYA 2LJ0A 1UHFA 2LDMA 4OMNA 4LD9K 3V8LA 1YHQT 1D0YA 2CDTA 2ROTA 1BYMA 4IUVA 2FYKA 5CR2A 1S72Q 1T0HA 1YJWA 1WXUA 4ELYC 5LJ5e 3M4YA 1YJNQ 5IH2A 2EJ9A 1YBYA 4LXCA 4RG2A 2D0QB 2EVRA 4C92G 2ABLA 3M0SA 5GANh 2OTLQ 3CC7Q 2O31A 5HK0A 3FJ5A 4E6RA 2D0NA 2PZ1A 5KYNA 2NUPB 1Q81R 5GAOr 3S3NA 2LVMA 2H3EB 2JXBA 2DVJA 3H0IA 2XK0A 4LDWA 4RUGA 1W2BP 4OGCA 1ZBJA 2QQBA 2AHJB 1TUDA 3JCMd 1M3BA 4EMGA 2AK5A 4XTUA 1YWOA 3P8DA 3SD4A 1GCPA 5GAMg 3OYHA 5IXBA 1Y0MA 1YJ9T 2DBKA 3OBYA 3NHNA 2DD5A 3EG2A 1C1AA 2P0PA 5D7UA 7AT1B 4OMFB 1X43A 3RKWA 2QQAA 1TOVA 1YCSB 2SEMA 3JB9I 3CMEA 2NLUA 4PJOB 1D1AA 1FMVA 2K57A 1OZ3A 2A08A 1K73U 1X6BA 3M0UA 4BI3A 2JUFA 3RNJA 3KUFA 3VS4A 2OX7A 2CP0A 3I55T 3L2QA 1KSWA 1NZ9A 3I56Q 2KSSA 1Y71A 2K6DA 3JRZA 2DXCA 4F7UB 4ZGDB 4J9GA 2PTKA 3HRSA 4HCCA 1YFNA 4FSXA 3QIIA 4PJOD 1WHLA 3DLLA 3PE0A 4BDZA 3GNFB 1VYVA 1U8RA 3M59A 3LW5E 2ROLA 3A98A 2F5KA 3CCMQ 2EIFA 2D8JA 5KYWB 3E2UA 2OJ2A 3SWNB 2QAZA 4GY5A 1C0MA 2RH2A 1BBZA 1OU8A 1EX4A 5A0GA 1IHWA 1SRLA 4ZN3A 3CCST 3EG3A 3BDUA 5AYFA 4A4GA 2Z0WA 1OYXA 4M78G 3QKJA 4N0AC 4JRQA 1RAIB 4XU1A 3CCJQ 2QQRA 2QTVA 3QYGB 5GMKj 1YITQ 2K2MA 1HK9A 3LGLA 4C0ZA 4HCBA 2FZGB 2C06A 2J6OA 3M54A 4JJDA 1RLPC 2VGMA 5CVIA 1YN8A 3I9QA 1WQ7A 3CBMA 5D6WA 3L2RA 2V8KA 3QDRB 2E41A 1IRXA 4XTYA 2L3PA 5C0MA 2YUNA 3OBWA 2HQXA 4XTWA 2HKNA 1H3ZA 2LP5A 4E7IA 1IGUA 1T0JA 2RB6A 3EHQA 5IN1A 3M57A 1YJNA 2CUBA 2YWWA 4B9WA 2AZSA 5HK3A 1FMWA 3EFOB 3M0TA 2ZCFB 4XTZA 2DEQA 4F7UG 2VXFA 2JS2A 3CCQQ 2XHCA 2OTLA 4KGVB 4ZGJB 2FPFA 4RTUA 3G7ZA 3CMAT 1J3TA 2K7AA 4J9BA 4EMKA 2RQUA 4CC4B 5I22A 2AZVA 3VYGA 5HKCA 4QVDA 2MAMA 3REBB 2JTMA 3LWIA 1ZSZA 4PK4A 3JB9F 4CC2A 2O4XA 1KD1R 1MGQA 1K9MC 1NLOC 5CKHA 3CCUQ 3HFNA 3OW2A 1M1KR 1VQ7Q 4OMQA 2YRCA 4M7DE 1TUGB 1K8AR 2O01E 4ANJA 3CCLA 1TXQA 2VUBA 3CXCS 3QG1A 2DZCA 2RD1A 2YLBA 1KC8U 3JCMQ 5DLQE 2EJFA 1NBEB 3OS1A 1ZLMA 1Y96B 1VA7A 4PKCC 1WNLA 1QQJA 3OYAA 1VQLQ 5IXFA 1VQ8T 4MDWA 2E3HA 3C95A 2PVDB 4M7DA 1A0NB 2DL3A 2Y4YA 5GJWB 4ZTJA 4ZN1A 1M90U 1WJQA 8ATCB 4C5IA 3DLMA 2E4HA 4HVWA 1AHJB 1H92A 3HRTA 4AG1C 1QKWA 3P8HA 1SKUB 2DILA 3TQ7P 1QP3A 1KJWA 3VS6A 2VC8A 2YT6A 3X25B 1I5LA 2CZ0B 2K5LA 4M77A 2KEAA 2LT1A 2E5QA 3UA6A 2JOYA 3EHRA 3V7CA 4M7AF 4J9CA 2HNIA 1E6HA 1PKTA 2RJCA 1TWBA 4Z89A 3OYDA 1LOJA 3HPWA 4EPCA 2J05A 5DM7R 2RHIA 2PUOB 1BIAA 3OB9A 2ZPIB 5GAOm 1O9SA 1VQPQ 1IREB 2RJEA 3CMAA 3AHUA 4E7JA 3FC3A 3D7SB 3EH1A 3G6EQ 3CPWP 2FHDA 5IHIA 4BI8B 4LN2A 1B07A 1U06A 2QTXA 3CCJA 4JZ4A 2X3XD 2XU8A 5IHNA 1YITA 3UWNA 1H3HA 2XMFA 1AT1B 1K76A 2QK0A 1VQKT 5LJ5j 4FM4B 2JMAA 5EC7A 2BE7D 2HDAA 2FRYA 2RQVA 1NJIR 4RKUE 2HCKA 1KG1A 2EPDA 3J7AF 4HVUA 2AKKA 4HXJA 2CZ7B 2JW4A 1M4ZA 3IQLA 3X26B 1XTDA 3E1SA 4WTOB 4OB3B 3OYFA 2KXCA 3OYLA 4BACA 3V7RA 4J9EA 1YIJT 3OQ5A 2O2OA 4J9IA 2LZ6B 1SG5A 4JPBW 2DA9A 2MOXA 1B34A 1SEMA 4XTVA 5GAOq 3CCQA 1R8OB 3M9QA 3JCMe 3PMTA 4MMKA 2LQWA 2A3LA 2LX7A 2VXEA 1MMAA 3JV3A 2JZ2A 4NS5A 4C92F 1JB0E 1JU5C 1RUWA 4DBQA 2AKLA 3OMGA 2DK3A 3HSBA 3VRYA 1G2BA 3CD6Q 4PLLA 4Z02A 1D0XA 3OYCA 3MEAA 1VQ7A 3HTRA 2GTJA 3S3OA 1UDLA 2KT8A 3HHTB 3HL8A 2HSPA 3PIOA 2DJQA 5LJ5g 2KQWA 1D3BA 3X20B 2LJ1A 3URGA 4D8DA 1Z9QA 5HCKA 2LCCA 1OI1A 4KT0E 4RTZA 5KYYA 5GMKi 2GGRA 3OYYA 3GP8A 5A2QE 1XJWB 2QI2A 1VQLA 1NPRA 2C0IA 1GBRA 1MHNA 4D6WA 2E6NA 1YI2A 2DO3A 3M53A 1AD5A 2RK2A 1R0BG 3BE3A 4FYVB 1XNIA 3QDFA 3KFVA 4FSSA 2CREA 3OYNA 4GLMA 1JQQA 2GCXA 5GAMf 2D9TA 1AEYA 3H6ZA 2QYZA 3A1PA 4Y91A 3CC4T 4DEYA 3S3MA 3CEYA 5M9OA 5GAOl 2P4TA 4LDUA 2FL7A 1SRMA 1VQOQ 2COYA 1VQ6T 5CKFA 1WHKA 1TS9A 1SF9A 1ZBXA 3JB9G 1M1FA 1K73C 4FYXB 2K2VA 4J8OA 2KNBB 4PNOA 3THKA 4F04B 4M75B 2DL5A 2RM4A 3ME9A 4M7AC 4E7KA 2E64A 3QO3A 2BE9B 3G6EA 4MMLA 3L2VA 2P0QA 5GAN8 2EYYA 3ZEHA 2LJ3A 2CT3A 2R57A 1TH7A 4FYYB 1NE8A 1PD0A 1YJWT 3FJPA 2CP7A 4FIBA 4C92E 1ZA1B 4FW1A 4E7SA 4M78F 1JEGA 2KXDA 4C8QA 2RHZA 1I07A 3RESA 3TSWA 3EGXA 2A0FB 4K11A 5GAMh 2KBTA 4PJOF 2WSCE 1BB9A 2LTOA 4KRTA 1GFCA 1W4SA 2LCSA 5KH6A 2ED0A 5KCHA 1KQSA 2K4YA 3CXCP 4CC3A 1UECA 2OTJQ 3PNWC 3EFSA 5FWCA 3SB2A 1M8VA 5FROA 2F2VA 4BE2A 3SHWA 3VU3C 3GF5A 4F7UF 3EGDA 2RQWA 1G3YA 4N4HA 2E10A 2KYBA 5D6XA 4HKEA 2DTIA 1U1TA 2IG0A 4M75G 3C12A 2KYMA 1Y57A 3CMET 1QVPA 3DB3A 1K8AC 3BFMA 3QWYA 4C92C 3C0CA 3H0HA 4CC7A 2DIGA 4C8QD 1HXDA 3VS0A 5GAN4 2HBPA 4KULA 3PVQA 2YRDA 5D6YA 1Q81U 4XAXB 2ZPBB 1QWFA 4XU2A 4IUPA 1BI3A 2B86A 1WX6A 2JTEA 1N5ZA 2IPOB 1PG5B 1M30A 3CCRT 3DKMA 2DLPA 2NWMA 3CCET 5A0LA 2CS7A 4F17A 2JJ9A 1KC8C 3CPWS 4JS4A 1VQ5Q 3O8VA 5AT1B 5LJ3e 1Q7YC 4M78E 5CKEA 3L1AA 3RMQA 2YUPA 2XDPA 2O9SA 3NTHA 4C0DC 2E3IA 5GJVB 2K3YA 1W70A 5KYUA 3SDZA 3VYHB 5J26A 3I55Q 1M90C 1QVGA 1VQMQ 4WCIA 4LDYA 1M2OA 3GIBA 2C0TA 1E6GA 1QW1A 2FVUA 5GANd 3EFRA 2FRWA 2BZ8A 3WXMB 4DOVA 2EQMA 2EYZA 3MP8A 4F7UE 2M0OA 2ATCB 3GBQA 1GFDA 1SHFA 3QHSA 1H8KA 1NJIC 1YJNT 1M2VA 1QMCA 4QQ6A 1UB4A 2X35A 4AFZC 1JJ2P 4R0KA 2EAYA 4CI0C 1TU0B 3PT9A 4ATOA 1XOVA 3OYIA 1WJRA 1P92A 4VUBA 1KHCA 2F2XA 2ZPHB 2OTLT 5CQYA 5GMKh 4M78C 2AT1B 2GQVA 1JBMA 1UJ0A 1WLPB 3CCSQ 1PRMC 2EQUA 1PD1A 2L3QA 2KI7A 4PJOC 4RG8A 2DTHA 3MP6A 2DZ9A 1PC0A 4N0AA 1AWWA 3M58A 4J9HA 5FU7B 1JO8A 2LQKA 3NTKA 4M4ZA 4F16A 3CCRA 2ZPGB 2LQ8A 1AOJA 4OB1B 4ESRA 2O9VA 3CCEA 1OULA 4JLIA 2L89A 4LD6A 2RJFA 5GAN6 3PTAA 2K3XA 3CCLT 3MEWA 4IUTA 1K0SA 4GBQA 2BUDA 4A4KA 2RMOA 1Z9ZA 3U23A 3EAEA 2EGAA 1Q86R 4JDSA 1B7TA 4B9XA 1X01A 1WPYA 2WACA 2D1XA 3F70A 2PUKB 1V29B 2RN8A 5CO7A 1F1BB 2O88A 2L3RA 4PJOG 3SWNC 4IIOA 2DERA 1RAGB 3I56T 2BZYA 4KH1B 2PVOB 3PMIA 1GBQA 1KD1U 2QA4Q 3SEMA 3JCMg 3CC2Q 1S72A 1M1KU 1W6XA 2E70A 2J06A 3UDCA 2CSIA 3RKYA 1K8AU 3S6WA 3JCMX 3EH2A 3I35A 3CCMT 1VYUA 3TEEA 3GOXA 3JCMb 4C5HA 1I4K1 2CT4A 2DYIA 1VQ5A 3LH0A 3PFSA 1LPLA 3ULRB 1BU1A 3CC7A 3R6NA 1FWZA 5L8RE 5LJ5f 3HRUA 1N27A 2FEIA 2DPPB 3RDVA 1X75C 1VQNQ 1ZUUA 4OVAA 1QVFA 3CCJT 1IGQA 2L2PA 1YITT 2HL3A 5LJ3f 3OSVA 1NEGA 1PCXA 2F69A 3EG9A 4FL6A 1OEBA 1VQMA 1IO6A 4E47A 2FG0A 2QQ9A 2MWOA 3CBPA 5L23A 1M5Q1 1WHMA 4ME7A 2E1HA 2RNAA 2EBPA 4EMKB 1Q7YU 1IXDA 1PSEA 2GFUA 1KIKA 1AZGB 1ZSZB 3VKIA 2O4XB 4J9FA 4PJJA 3L2WA
chains in the Genus database with same CATH topology
4Y28E 3J81E 1EIFA 2X4XA 3Q1JA 4C0FA 3S3OA 1VIFA 4C8QC 3HHTB 3HL8A 3CCQT 1VQMT 3PIOA 4JLGA 3TCJA 4MDXA 3SWNA 2EFIA 5LJ5g 3CC4A 1VIEA 2KQWA 2GFAA 4M78D 3RIRA 1BKBA 3I56A 1D3BA 2CYZB 4PLIA 1N9SA 3X20B 5GANf 3URGA 1YHQA 1VQ8A 5LJ5h 2DXTA 3NFCA 2LCCA 1OI1A 3DB4A 4KT0E 1VQ6A 3BDLA 5GMKi 4M7DF 4OB0B 4J7FA 3OYYA 3TU4K 3JCMJ 3CPWA 2DVEA 3GP8A 5A2QE 2QI2A 1VQLA 1NPRA 4V2SA 2M1HA 3R6OA 3X24B 1MHNA 3OW2S 5GAMj 4D6WA 1N6AA 3E9GA 2LRQA 2E6NA 4HT9A 4C92D 2OTJT 5FU7C 4NOYA 1N9RA 3V8JA 1X6OA 2CZ1B 3LX7A 4DOWA 4KUDK 1YI2A 1NJIU 3JB9H 2DO3A 3M53A 3CCMA 2MF2A 5GAN3 4M7DB 2R58A 2RK2A 2QXFA 1VQ7T 1XNIA 5FU6C 3C4SA 1O75A 5DY9A 2V8IA 3OYNA 3RERA 2GCXA 5GAMf 4J6WA 2D9TA 3QXEB 4M77F 3H6ZA 3TREA 3QSUA 1G5VA 2QEXT 3OSSC 4Y91A 3CC4T 3JCMP 2X4YA 2LDMA 3S3MA 3CEYA 4LD9K 5M9OA 5GAOl 3V8LA 1YHQT 3V8KA 2P4TA 4A4HA 4LDUA 1BIBA 1UEBA 5CKBA 3T9NA 2FL7A 4EMHA 1DJ7B 4M77B 2X4WA 5I2MA 1W2BA 2LX9A 1VQ6T 1BYMA 5CKFA 4IUVA 2E12A 2FYKA 5CR2A 1PSFA 3GLXA 1ZBXA 2K5IA 2RHYA 4M75F 3JB9G 1YJWA 1VQLT 1KQ2A 3JCMc 1GXIE 1M1FA 2QQSA 3M4YA 4ELYC 2P0KA 5LJ5e 1K73C 3A8LB 2K2VA 4N4GA 3OYKA 4J8OA 3A8OB 1XQHA 2K5FA 4M7DD 2DXBA 1I8FA 2EJ9A 1YI2T 4PNOA 1YJ9A 2EYQA 1YBYA 3UT1A 4RG2A 4M75B 3UPUA 5GANg 2HAXA 2RM4A 2D0QB 3ME9A 3FRNA 4M7AC 2DTOA 3VUBA 4C92G 4E7KA 3V7SA 5GANh 2E64A 1LJOA 5HK0A 3QO3A 5FLXE 3ZBDA 2B8AA 2QA4A 3JCMW 3G6EA 4MMLA 3L2VA 2P0QA 5LJ3j 5GAOr 2EQKA 5GAN8 3OA6A 3CXCA 1KHIA 4J6YA 3LWHA 2BKDN 2LVMA 3ZEHA 4ELZC 1I81A 4M77D 2R57A 3OMCA 5CIUA 4IUUA 2ZGWA 2XK0A 4LDWA 1TH7A 1NE8A 3A8HB 4OGCA 4RMOA 2QQBA 2AHJB 4QVCA 1YJWT 2ZPEB 3FJPA 4EMGA 3JCMd 4FIBA 4C92E 4XTUA 4HCZA 5GMKm 3P8DA 4JUVA 2ZPFB 5LL6S 3SD4A 4M78F 5GAMg 4C8QA 3OYHA 3I55A 4P5NA 2DAQA 2RHZA 1Q81C 3RESA 1YJ9T 3OBYA 3OY9A 1QP2A 2DD5A 5GAMh 2HQEA 4C0GA 4BE0A 4II1A 2P0PA 4PJOF 1UGPB 2LC4A 2WSCE 2LTOA 4OMFB 1VQPT 5KE3A 3RKWA 2QQAA 4FT4A 1W4SA 3JB9I 3CMEA 4JRIA 2NLUA 2QA4T 5KH6A 3JB9J 2DIQA 3G6ET 3CC2T 1VQNA 5KCHA 1KQSA 2K4YA 1JJ2S 5DLOA 4PJOB 3MP1A 5GANe 2K57A 1Y96A 4ZGEB 1OZ3A 4DA4A 4BB7A 3PNWC 3EFSA 3SB2A 4TVRA 2PVGB 3PIPA 1M8VA 1K73U 1B34B 2X4JA 4J5YA 3CCUA 4BI3A 5FROA 4BE2A 4QQDA 3VU3C 4M77G 2JUFA 3S3NA 3GF5A 1H641 3KUFA 4F7UF 2LCLA 1M9SA 3I55T 3L2QA 2D6FA 1G3YA 4LDVA 4N4HA 2E10A 3OYGA 1NZ9A 4OP0A 2KSSA 4GLKA 4M7AE 5D6XA 1Y71A 3JRZA 4HKEA 2DXCA 2DTIA 4OF1A 4X34A 4F7UB 4ZGDB 1U1TA 1G3WA 3CCSA 1QVFS 4R55A 2IG0A 2XKOC 4M75G 3OS2A 3C12A 4A54A 4EMKC 5GAMe 3HRSA 4HCCA 3CMET 1N8RU 4FSXA 1QVPA 3QIIA 3DB3A 4NL3A 2KVQG 2PQWA 1K8AC 1VQNT 4M77E 4PJOD 3L2ZA 3DLLA 4BDZA 4BY6B 3BFMA 4A4EA 5LJ3g 3GNFB 3HFOA 4C92C 4L5GA 2Y90A 1U8RA 3M59A 4O6JA 1NPPA 2VV5A 3LW5E 2DIGA 1FXXA 1HXDA 2WSEE 4C8QD 5LJ3h 2F5KA 1Q82U 3CCUT 5GAN4 2HBPA 1G3TA 3QZ9B 2EIFA 4KULA 5D6YA 2DJZA 1Q81U 4M75E 3SWNB 4M7AA 4GY5A 4XAXB 2ZPBB 1D3BB 2RI2A 1RI0A 2RH2A 4XU2A 5KE2A 4IUPA 1BI3A 2XG8D 3META 5LJ5d 2EWNA 5A0GA 3LLRA 3G71A 4ZN3A 4J6XA 3CCST 2MWPA 3M55A 5I2SA 3BDUA 5AYFA 4A4GA 2M9UA 1OYXA 4A53A 3A5ZB 4M78G 3QKJA 4N0AC 4JRQA 4XU1A 4IKFA 2QQRA 3QYGB 5KCOA 3CCRT 5GMKj 1ZHIA 1HK9A 3DKMA 5LJ3d 5CCAA 3LGLA 4C0ZA 3CCVA 4M7DC 4J7IA 4HCBA 2C06A 3ZFJA 3E9FA 3M54A 4MZMA 4E7HA 2CGHA 2MMPA 5A0LA 2CS7A 2VGMA 3LYIA 3P8BB 5CVIA 3MEVA 4BE1A 1WQ7A 3CBMA 5D6WA 3L2RA 2V8KA 3L42A 3QDRB 2Y4XA 2L8DA 2E41A 3WVEB 1KC8C 2XIDA 4XTYA 2KDSA 3CPWS 4JS4A 3O8VA 4NL2A 5C0MA 5LJ3e 1VQPA 2ZZDA 4M78E 3OBWA 2HQXA 5CKEA 1Q7YC 4XTWA 2KK4A 3L1AA 3RMQA 2XI9A 1H3ZA 1UGQB 3CC2A 2OAUA 2XDPA 4E7IA 2RB6A 3NTHA 5IN1A 3HP9A 3M57A 4M77C 4C0DC 3G71T 1YJNA 3FDRA 3X28B 2CKKA 2VGNA 4BI4A 4B9WA 1JJ2A 2RI3A 5HY6A 1WQWA 1YCYA 3MEUA 2K3YA 4F7UG 5HK3A 2ZCFB 4XTZA 2DD4A 2DEQA 2VXFA 5GMKl 2RJDA 4WF2A 2XICA 3SDZA 2LT4A 3CPFA 3PGGA 4X9DA 5EG2A 5J26A 3VYHB 3CCVT 3H8ZA 4M75C 1IZ6A 1M90C 1QVGA 2XHCA 2OTLA 4LDYA 3MHXA 4ZGJB 3GIBA 2IVWA 1W2BS 1QW1A 2FVUA 2M16A 5GANd 3EFRA 2VYTA 3G7ZA 2RHUA 4FU6A 4QVZA 5CQXA 4XQ3A 3WXMB 3CMAT 4DOVA 4M7DG 2EQMA 3MP8A 4EMKA 1U1SA 3WVDB 4F7UE 2M0OA 3ER0A 3BW1A 3VYGA 4C8QF 5HKCA 4QVDA 3C94A 2MAMA 3QHSA 3QZ5B 2KMTA 1NJIC 2DXUA 2JTMA 2EJGA 3LWIA 4C92A 2RK1A 1YJNT 5FRMA 3JB9F 4QQ6A 2E65A 1BI1A 1UB4A 2O4XA 1MGQA 2X35A 1K9MC 5CKHA 1UGRB 2EAYA 2RA2A 3HFNA 4C8QB 3G4SA 4CI0C 3OW2A 3ASKA 3PT9A 1FX7A 2QEXA 5IAYA 4ATOA 3QYHB 4M7DE 1XOVA 4KUIA 2O01E 3CCLA 3OYIA 1WJRA 1P92A 2I2LA 4VUBA 1KHCA 2VUBA 2ZPHB 3QG1A 4XTXA 5GAMd 3OYMA 3CXCS 5CQYA 2OTLT 2DZCA 5GMKh 2RD1A 2YLBA 1KC8U 4M78C 3JCMQ 2MI6A 5DLQE 2GQVA 4JJNK 1JBMA 2EJFA 3BY7A 1KD1C 3LGFA 2EQUA 1Y7XA 4J83A 3OS1A 3CD6A 1LNXA 4RCBA 4YTLA 1WGSA 1M1KC 4PJOC 1WJSA 1Y96B 4RG8A 2DTHA 3MP6A 4PKCC 3MO8A 1WNLA 2DZ9A 4N0AA 5CKDA 1ZQ1A 3M58A 5FU7B 3OYAA 3JCMf 2LQKA 1VQ8T 3NTKA 3NTIA 4MDWA 3C95A 2PVDB 3CCRA 2QDYB 4M7DA 2ZPGB 1JRIA 2HD0A 2LQ8A 3M56A 5GAOp 2Y4YA 5FU6B 4OB1B 4ZTJA 2CZ6B 5CAIA 4UC4A 3CCEA 4ZN1A 5GAN5 3G4ST 5GAN7 4JLIA 2L89A 1M90U 4JRKA 1WJQA 2H3JA 2RJFA 4LD6A 2V8JA 4C5IA 5GAN6 3DLMA 3PTAA 3JB9D 1AHJB 4XU0A 1KQSS 2K3XA 3QBYA 3SFMA 3HRTA 3CCLT 3MEWA 4IUTA 3N5BB 2BUDA 4A4KA 3P8HA 3QJYA 1QP3A 3EAEA 4X9CA 2VC8A 4QQGA 3X25B 1I5LA 4OGEA 2CZ0B 2K5LA 4M77A 2LT1A 3E19A 4JDSA 3CD6T 2YRVA 2RHXA 3GNGA 3J80E 4B9XA 2E5QA 5GMKe 2JTFA 3RUXA 1X01A 4BY6C 2JOYA 1WPYA 2WACA 3V7CA 1VQKA 2JN0A 4M7AF 2HNIA 5A0DA 2RJCA 4Q5WA 3F70A 5IT9E 4CRIA 1BI0A 1K9MU 3OYDA 2PUKB 1LOJA 3HPWA 3M4GA 4EPCA 1V29B 4M75A 3A8GB 5CO7A 4BD3A 3VJPA 2JNGA 1SSFA 3JCMV 5CK9A 5DM7R 1M1GA 2RHIA 4XK8E 2L3RA 4M7AB 1RL2A 2F5TX 4PJOG 1Q86C 3SWNC 2PUOB 2E6ZA 3I56T 3GPLA 3RMSA 1BIAA 5I21A 3OB9A 4PL6A 3KBGA 4QW2A 2GF7A 3OS0A 2ZPIB 5GAOm 1O9SA 2PVOB 3QPHA 3PMIA 1IREB 2RJEA 4A4FA 3CMAA 4C8QG 4C0DB 3AHUA 4E7JA 4E7LA 3FC3A 1VQOA 1KD1U 1VQ9A 3JCMg 3OS5A 1YIJA 1VQ4A 2FHDA 2R5MA 1S72A 4KBMB 3FIFA 1OZ2A 4BI8B 4JS5A 2QTXA 3CCJA 3FEOA 4ZTFA 2EQJA 1M1KU 2E70A 2XU8A 1YITA 4N4IA 3JCMh 3UDCA 3UWNA 1KQ1A 3RKYA 1K8AU 3S6WA 3JCMX 4PJOE 3VV0A 2YHTA 2PU9B 4DQ2A 4O5VA 2LNVA 3CCMT 1VQKT 3A8MB 3TEEA 5LJ5j 3GOXA 3JCMb 2RO0A 4FM4B 4IURA 4HA8A 4C5HA 2YLCA 2EKOA 4C5EA 2FB7A 1I4K1 4C8QE 4MZPA 4XU3A 2KY9A 5FRNA 2XDBA 1VQ5A 3LH0A 3INZA 3PFSA 4M7AD 4C5GA 5J39A 2WSFE 3JAME 1Y07A 4OB2B 4RKUE 3CC7A 2XDDA 1KG1A 4M78A 1FWZA 3QUIA 4JRPA 3L2UA 1UGSB 5L8RE 3J7AF 5LJ5f 2XD0A 2CZ7B 3HRUA 1M4ZA 1N8RC 1N27A 3X26B 2DPPB 3VUZA 4L59A 5GAN2 1XTDA 3E1SA 4OB3B 3OYFA 1X75C 4PJOA 1VQOT 3OYLA 4BACA 3V7RA 4BUGA 1VQ9T 1YIJT 2BIVA 3OQ5A 1VQ4T 1S72T 3RKXA 4OVAA 3CBOA 1QVFA 3CCJT 1YITT 1B34A 4L6V5 2A7YA 2G3RA 5LJ3f 3FB9A 3OSVA 4XTVA 1G3SA 3OYEA 5GAOq 2F69A 2JVVA 4FL6A 4IUQA 1R8OB 1VUBA 4M75D 4FT2A 3CCQA 1VQMA 3M9QA 4E47A 5J3BA 2QQ9A 4HT8A 3JCMe 2MWOA 4R56A 3PMTA 4M78B 4MMKA 1Q86U 2A3LA 3CBPA 1M5Q1 1VQ5T 4ME7A 2RI5A 3OYBA 2DKGA 2VXEA 3CC7T 4EDUA 2JZ2A 4NS5A 3CCET 4C92F 1JB0E 4F7UA 2E1HA 3OMGA 2DK3A 3HSBA 5C6SA 4EMKB 3HKSA 2L5QA 1BI2A 3M5AA 1Q7YU 3JSCA 4M7AG 4RCCA 3FLGA 4BDYA 1PSEA 2GFUA 3MCAB 2OTJA 4MZTA 4PLLA 4Z02A 4C92B 3OYJA 3KXTA 1QVGS 3OYCA 5GANj 3MEAA 3VKIA 2KAFA 2O4XB 2R5AA 3QJ6A 1Q82C 4LDXA 1VQ7A 5GAOn 3L2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK e;  3RUX A;  1X01 A;  4PJO F;  4C8Q C;  4M7A F;  1WPY A;  2RB6 A;  3V7C A;  2JN0 A;  2HNI A;  4M77 C;  3RKW A;  3SWN A;  5LJ5 g;  1LOJ A;  4M78 D;  3M4G A;  4JRI A;  3RIR A;  1D3B A;  3JB9 I;  3JB9 J;  5GAN f;  1N9S A;  4M75 A;  1WQW A;  1YCY A;  4F7U G;  3JCM V;  4PJO B;  4XTZ A;  4M7A B;  2DEQ A;  5LJ5 h;  2DXT A;  2K57 A;  1Y96 A;  2VXF A;  4PJO G;  5GAN e;  3SWN C;  5GMK l;  4WF2 A;  1BIA A;  4X9D A;  3PGG A;  5I21 A;  5GMK i;  3EFS A;  4M7D F;  3SB2 A;  3JCM J;  1M8V A;  4M75 C;  1B34 B;  2DVE A;  5GAO m;  4J5Y A;  4V2S A;  3AHU A;  4C8Q G;  5GAM j;  3GIB A;  3VU3 C;  4M77 G;  4HT9 A;  1H64 1;  4C92 D;  4F7U F;  4NOY A;  1N9R A;  3JCM g;  3V8J A;  5GAN d;  3JB9 H;  4M7D B;  3EFR A;  3FIF A;  5GAN 3;  2QTX A;  4XQ3 A;  2E10 A;  4M7D G;  3JCM h;  4EMK A;  1U1S A;  4F7U E;  1KQ1 A;  4OP0 A;  3RKY A;  5DY9 A;  3JCM X;  4PJO E;  2YHT A;  4M7A E;  4DQ2 A;  3BW1 A;  4C8Q F;  2DTI A;  4F7U B;  4QVD A;  3RER A;  5GAM f;  1U1T A;  4J6W A;  5LJ5 j;  3QHS A;  3JCM b;  4M77 F;  3QSU A;  2DXU A;  4M75 G;  2EJG A;  4HA8 A;  2YLC A;  4C92 A;  4A54 A;  4Y91 A;  2FB7 A;  4EMK C;  1I4K 1;  5GAM e;  3JCM P;  2E65 A;  4C8Q E;  3JB9 F;  4XU3 A;  4NL3 A;  1MGQ A;  4PJO D;  3INZ A;  4M77 E;  3V8L A;  5GAO l;  2EAY A;  3V8K A;  4M7A D;  2RA2 A;  3HFN A;  3L2Z A;  1BIB A;  3BFM A;  4C8Q B;  5LJ3 g;  4EMH A;  3HFO A;  4M78 A;  4M77 B;  4C92 C;  3QUI A;  2Y90 A;  4M7D E;  2FYK A;  5LJ5 f;  4C8Q D;  1HXD A;  4M75 F;  5LJ3 h;  2I2L A;  3JB9 G;  5GAM d;  1KQ2 A;  4XTX A;  3JCM c;  5GAN 2;  5GAO n;  5GAN 4;  5LJ5 e;  2DZC A;  5GMK h;  2RD1 A;  2YLB A;  4M78 C;  3JCM Q;  2DJZ A;  4PJO A;  1JBM A;  4M75 E;  3SWN B;  3V7R A;  4M7A A;  4M7D D;  1I8F A;  2EJ9 A;  2EJF A;  3BY7 A;  4PNO A;  1D3B B;  3RKX A;  4M75 B;  4XU2 A;  5GAN g;  1LNX A;  4RCB A;  1B34 A;  2RM4 A;  5LJ3 f;  3FB9 A;  4XTV A;  4PJO C;  1Y96 B;  4M7A C;  2DTH A;  2DTO A;  5LJ5 d;  4C92 G;  5GAO q;  2EWN A;  1WNL A;  2DZ9 A;  4M75 D;  4N0A A;  3V7S A;  5GAN h;  3JCM f;  2E64 A;  4J6X A;  1LJO A;  3QO3 A;  3BDU A;  4HT8 A;  4M7D A;  3JCM e;  5GAO p;  1JRI A;  3JCM W;  4M78 B;  4MMK A;  4MML A;  4A53 A;  4M78 G;  5LJ3 j;  5GAO r;  1M5Q 1;  4N0A C;  5CAI A;  5GAN 8;  4J6Y A;  2DKG A;  2VXE A;  4XU1 A;  5GAN 5;  1I81 A;  4M77 D;  4JLI A;  5GMK j;  5GAN 7;  2ZGW A;  1HK9 A;  5LJ3 d;  1TH7 A;  2E1H A;  4JRK A;  4C92 F;  4F7U A;  5GAN 6;  3JB9 D;  4M7D C;  3HSB A;  4XU0 A;  4EMK B;  4QVC A;  2CGH A;  3FJP A;  3JCM d;  4EMG A;  4RCC A;  4M7A G;  4C92 E;  4XTU A;  5GMK m;  1WQ7 A;  4JUV A;  4M78 F;  5GAM g;  2E41 A;  4X9C A;  4C8Q A;  4C92 B;  2VC8 A;  4XTY A;  1I5L A;  5GAN j;  4M77 A;  3RES A;  4NL2 A;  5LJ3 e;  5GAM h;  4M78 E;  4XTW A;  3L1A A; 
#chains in the Genus database with same CATH topology
 4Y28 E;  1EIF A;  3Q1J A;  2GTO A;  3RR6 A;  3CCQ T;  1QWE A;  2JM8 A;  3TCJ A;  4MDX A;  1HSQ A;  2EFI A;  1VIE A;  3I56 A;  3RIR A;  1BKB A;  5LJ5 h;  2DXT A;  3NFC A;  3BDL A;  4OB0 B;  3JCM J;  1KQS P;  4V2S A;  2M1H A;  3R6O A;  4X1V A;  3X24 B;  3G71 Q;  3OW2 S;  1N6A A;  2IIM A;  4F14 A;  1X6O A;  4DOW A;  1VQK Q;  1NJI U;  3JB9 H;  4M7D B;  3CCM A;  5GAN 3;  2QXF A;  2CH4 A;  1VQ7 T;  1BK2 A;  4LUE A;  1O75 A;  2V26 A;  2V8I A;  3CCV Q;  2P4R A;  4J6W A;  3QXE B;  1G5V A;  1NM7 A;  1IB8 A;  2X4Y A;  2DET A;  1WXT A;  1UEB A;  1I1J A;  3T9N A;  4EMH A;  1DJ7 B;  4M77 B;  1W2B A;  1OQK A;  2EKH A;  2HBW A;  4LNP A;  4KGX B;  2KGT A;  1PSF A;  2DYB A;  4M75 F;  2K5I A;  1VQL T;  3JCM c;  2QQS A;  2HQH A;  4FCY A;  4N4G A;  3OYK A;  3A8O B;  4M7D D;  1N8R R;  1I8F A;  1VYT A;  1YI2 T;  3UT1 A;  5KYX A;  2HAX A;  4D8K A;  2KR3 A;  3V7S A;  1G8X A;  3UA7 A;  5FLX E;  3ZBD A;  2B8A A;  2QA4 A;  3JCM W;  1UG1 A;  5LJ3 j;  4J6Y A;  3LWH A;  2BKD N;  4ELZ C;  1I81 A;  4M77 D;  5CIU A;  4IUU A;  2NUT A;  2M02 A;  4RMO A;  4QVC A;  2EYX A;  2ZPE B;  4HCZ A;  5GMK m;  1AWJ A;  4JUV A;  2ZPF B;  5LL6 S;  4PFP A;  1Q81 C;  3G4S Q;  4C0G A;  1MMG A;  3RBB B;  2QEX Q;  4II1 A;  2LC4 A;  1WFW A;  1C6V X;  1VQP T;  1T3L A;  2W10 A;  5KE3 A;  1Q82 R;  1PWT A;  3LH5 A;  4OMM A;  1UTI A;  1RAA B;  1VQN A;  1Q95 G;  3G6E T;  1JJ2 S;  1EZZ B;  5DLO A;  3MP1 A;  5GAN e;  2HMA A;  4ZGE B;  4BB7 A;  2EGE A;  2HKQ B;  2PVG B;  3PIP A;  1B34 B;  4J5Y A;  3CCU A;  4QQD A;  4M77 G;  2LCL A;  1QVG P;  1M9S A;  2D6F A;  1AVZ C;  4LDV A;  3OYG A;  2DF6 A;  2J7I A;  3AT1 B;  4OP0 A;  4GLK A;  4M7A E;  2RF0 A;  4X34 A;  1I0C A;  2DMO A;  1SSH A;  1G3W A;  4NL3 A;  1U3O A;  2PQW A;  4BY6 B;  2X9H A;  5LJ3 g;  1AWO A;  3HFO A;  4L5G A;  4O6J A;  1PKS A;  1NPP A;  2VV5 A;  1BCO A;  1RAH B;  2ED1 A;  2HSE B;  1G3T A;  1ABO A;  2DJZ A;  2JS0 A;  4M75 E;  4M7A A;  1D3B B;  1B3Q A;  2XG8 D;  5KYY B;  3MET A;  1M3C A;  3G71 A;  4J6X A;  2MWP A;  2V1R A;  1VQ9 Q;  2EYW A;  4FW2 A;  1VQ4 Q;  4IKF A;  5KCO A;  1X69 A;  1ZHI A;  5CCA A;  3CCV A;  4J7I A;  3E9F A;  4E7H A;  1HD3 A;  3LYI A;  3P8B B;  3MEV A;  1X27 A;  1K1Z A;  3L42 A;  2Y4X A;  2L8D A;  1MND A;  3M0Q A;  2KDS A;  2MYS A;  5IHK A;  1ACM B;  1VQP A;  2ZZD A;  2KK4 A;  3TSZ A;  2XI9 A;  3EG0 A;  4RTY A;  1T3S A;  4AMC A;  3FDR A;  1ZUY A;  2CKK A;  2VGN A;  2X3W D;  3X28 B;  1FMK A;  3H0F A;  2DBM A;  1RI9 A;  4BI4 A;  2RI3 A;  5HY6 A;  1YCY A;  2BTT A;  3MEU A;  1KFZ A;  5GMK l;  2RJD A;  4WF2 A;  2XIC A;  2LT4 A;  4X9D A;  3PGG A;  2J6K A;  2HZY A;  3H8Z A;  4M75 C;  4DBH A;  1IZ6 A;  1GCQ C;  4OMP A;  3MHX A;  1WIE A;  2IVW A;  1K9M R;  2LQN A;  2VYT A;  1G83 A;  4XQ3 A;  2KE9 A;  1UE9 A;  3ER0 A;  3BW1 A;  2KMT A;  2EJG A;  4C92 A;  2RK1 A;  4DBF A;  2RA2 A;  4C8Q B;  3G4S A;  2QEX A;  5IAY A;  2BZX A;  2RPN A;  3EGX B;  4KUI A;  5GAM d;  2K3B A;  3H9N A;  2MI6 A;  4KH0 B;  1KD1 C;  1YHQ Q;  1K0X A;  2I0N A;  3CD6 A;  1LNX A;  4RCB A;  1M1K C;  2HEQ A;  4EIK A;  1ZQ1 A;  3JCM f;  1QVF P;  3NTI A;  3VS5 A;  2QDY B;  5GAO p;  1JRI A;  2CUD A;  3M56 A;  1X6G A;  5FU6 B;  2CZ6 B;  2G6F X;  1PRL C;  3EGD B;  4UC4 A;  2ENM A;  3OW2 P;  4JRK A;  2H3J A;  1R77 A;  1KQS S;  3SFM A;  3N5B B;  2PNI A;  4QQG A;  3GNG A;  5FW9 A;  2JN0 A;  5A0D A;  5IT9 E;  1CSK A;  4Q5W A;  3M0R A;  1BI0 A;  3M4G A;  1NEB A;  3A8G B;  4BD3 A;  3VJP A;  5CK9 A;  1M1G A;  1YJ9 Q;  4XK8 E;  1RL2 A;  1PM3 A;  2E6Z A;  3GPL A;  2SRC A;  3RMS A;  5I21 A;  3KBG A;  2GF7 A;  2W0Z A;  2NUP A;  4C8Q G;  4C0D B;  1VQO A;  1VQ9 A;  3OS5 A;  2X51 A;  1VQ4 A;  1R0C B;  3VS2 A;  1OZ2 A;  2VKN A;  4ZTF A;  2EQJ A;  3M0P A;  3JCM h;  1KQ1 A;  2D8H A;  4E7Z A;  4PJO E;  3VV0 A;  2YHT A;  2PU9 B;  4O5V A;  2LNV A;  3A8M B;  1D1B A;  2YLC A;  3PVL A;  5FRN A;  4XU3 A;  2KY9 A;  1UGV A;  4C5G A;  5J39 A;  2WSF E;  3JAM E;  1Y07 A;  4PJN A;  4M78 A;  1I5O B;  3MJX A;  3L2U A;  1UGS B;  1N8R C;  2QGG A;  5GAN 2;  3VUZ A;  4L59 A;  4PJO A;  1WZO A;  1S72 T;  1WYX A;  1OX8 A;  2C0O A;  4PJL A;  2CP6 A;  5KYU B;  3FB9 A;  3OYE A;  3I5S A;  2JVV A;  4IUQ A;  1RAB B;  2NUZ A;  4HT8 A;  4M78 B;  3CCL Q;  1Q86 U;  1VQ5 T;  1JXO A;  2RI5 A;  1ZX6 A;  3CC7 T;  4F7U A;  4AFS C;  1MUZ A;  3HKS A;  3ZL7 C;  4RCC A;  3FLG A;  1RAE B;  4BDY A;  1UFF A;  2DX1 A;  2OTJ A;  3MCA B;  1QVG S;  1M2V B;  1YWP A;  5GAN j;  1OX9 A;  4FYW B;  2KAF A;  3QJ6 A;  2NYS A;  1Q82 C;  5GAO n;  3J81 E;  2DM1 A;  1VQM T;  4KGZ B;  2YSQ A;  4JLG A;  5KYW A;  4AT1 B;  3SWN A;  1UJY A;  2YDL A;  2GFA A;  4M78 D;  2CYZ B;  1N9S A;  2KRO A;  1OU9 A;  1YHQ A;  2DEU A;  3VRZ A;  3DB4 A;  4M7D F;  4J7F A;  2AIR B;  2DRK A;  3E9G A;  2LRQ A;  4RTV A;  5FU7 C;  1N9R A;  3V8J A;  2GNC A;  3LX7 A;  2A37 A;  1WHH A;  4AFQ C;  2VAS A;  5DY9 A;  2DRM A;  3RER A;  1K73 R;  1QLY A;  4M77 F;  3TRE A;  3QSU A;  1OPL A;  4PFZ A;  3OSS C;  3JCM P;  2H8H A;  3V8K A;  4A4H A;  3CMA Q;  1BIB A;  5CKB A;  2HL5 C;  2X4W A;  5I2M A;  2LX9 A;  4PJM A;  2F1L A;  2E12 A;  3GLX A;  2CP5 A;  2RHY A;  2OAW A;  1KQ2 A;  1GXI E;  2P0K A;  3A8L B;  1TG0 A;  3EFO A;  1XQH A;  2K5F A;  2DXB A;  1YJ9 A;  2EQI A;  2EYQ A;  1RLQ C;  4LE9 A;  3UPU A;  5GAN g;  2GBQ A;  1SHG A;  4RTX A;  2RQR A;  3FRN A;  2DTO A;  1UUE A;  3VUB A;  2QAS A;  1LJO A;  2J6F A;  1QCN A;  2EQK A;  3OA6 A;  3CXC A;  1KHI A;  3OMC A;  2YUQ A;  2ZGW A;  3A8H B;  1ABQ A;  1VQ8 Q;  4HCK A;  2MPX C;  4E2F B;  3I55 A;  4P5N A;  2DAQ A;  1QP2 A;  2HQE A;  3MKD A;  2OI3 A;  4BE0 A;  2CH4 W;  1OPK A;  1UGP B;  2KT1 A;  3NGP A;  4FT4 A;  1OV3 A;  2ECZ A;  4JRI A;  2QA4 T;  3JB9 J;  3CC2 T;  2DIQ A;  1Y96 A;  2QGF B;  1QCO A;  1YP5 A;  4DA4 A;  1WXB A;  4TVR A;  1QKX A;  1KK7 A;  2X4J A;  3TVT A;  1ZSG A;  3EG9 B;  2A28 A;  1FYN A;  1H64 1;  1YNZ A;  2LMJ A;  3NPF A;  1AZE A;  1M3A A;  2YUO A;  3OY9 A;  4OF1 A;  2KRM A;  3VS1 A;  3CCS A;  1QVF S;  4R55 A;  2XKO C;  3OS2 A;  4A54 A;  4EMK C;  5GAM e;  2F2W A;  1N8R U;  2MIO A;  1VQN T;  3REA B;  2KVQ G;  4M77 E;  2M0Y A;  3L2Z A;  4A4E A;  1PHT A;  4ORZ A;  1ZSZ C;  2Y90 A;  1YI2 Q;  1ZUK A;  1FXX A;  2WSE E;  8AT1 B;  5LJ3 h;  2FZK B;  3CCU T;  1MMD A;  3QZ9 B;  1MNE A;  1QCF A;  4LUD A;  3QWX X;  2COZ A;  2RI2 A;  1RI0 A;  2CP3 A;  5KE2 A;  4AFU C;  1BCM A;  3VS7 A;  5LJ5 d;  1MV0 B;  2EWN A;  3LLR A;  2JT4 A;  1RAC B;  2MK5 A;  1ARK A;  3M55 A;  5I2S A;  2M9U A;  1KC8 R;  2VWF A;  4HVV A;  4A53 A;  1YIJ Q;  3A5Z B;  3UF4 A;  1Q7Y R;  2K79 A;  5LJ3 d;  1K9A A;  1AWX A;  4M7D C;  1ZA2 B;  3ZFJ A;  1Q82 U;  4MZM A;  2CGH A;  2MMP A;  4BE1 A;  2DNU A;  2K9G A;  1VOM A;  4ZNX A;  2KRS A;  3WVE B;  2XID A;  1WA7 A;  4NL2 A;  2L3S A;  2CP2 A;  5FWB A;  1M90 R;  1UGQ B;  3CC2 A;  2OAU A;  4Z88 A;  4JJB A;  3HP9 A;  4M77 C;  2ZAE A;  3G71 T;  2E5K A;  1MMN A;  3VS3 A;  1NLP C;  2DL8 A;  1JJ2 A;  1WQW A;  2DD4 A;  1X2K A;  3CPF A;  5EG2 A;  3CCV T;  5KYX B;  6AT1 B;  2DFU A;  9ATC B;  1W2B S;  4IIM A;  2M16 A;  1TSF A;  5I11 A;  1WDX A;  2QG9 B;  2RHU A;  1V76 A;  4FU6 A;  4QVZ A;  5CQX A;  4M7D G;  1U1S A;  3WVD B;  2VVK A;  4C8Q F;  2NUT B;  3C94 A;  4A63 B;  3QZ5 B;  1EFN A;  1VQ8 A;  2M51 A;  2DXU A;  5FRM A;  2E65 A;  1BI1 A;  1WHG A;  2FPD A;  2FZC B;  1UGR B;  3G1J A;  3ASK A;  1FX7 A;  1RAD B;  3QYH B;  2MCN A;  2I2L A;  3OYM A;  3NMZ C;  4XTX A;  1JXM A;  3H41 A;  3CC4 Q;  4AG2 C;  4JJN K;  1SPK A;  3BY7 A;  1HYO A;  1PNJ A;  3LGF A;  4J83 A;  1Y7X A;  3MPU B;  4YTL A;  1WGS A;  1VQ6 Q;  1WJS A;  3MO8 A;  4J9D A;  5CKD A;  1W1F A;  1M8M A;  2HD0 A;  2DL7 A;  2VB6 A;  2A36 A;  5CAI A;  5GAN 5;  3G4S T;  5GAN 7;  1NYF A;  2QEX T;  3JB9 D;  2FPE A;  2EGC A;  2V8J A;  4XU0 A;  2FO0 A;  3QBY A;  1UHC A;  3O5Z A;  3QJY A;  1NYG A;  1CKB A;  4X9C A;  4OGE A;  4JZ3 A;  3E19 A;  3CD6 T;  2YRV A;  2RHX A;  3J80 E;  5GMK e;  2JTF A;  3RUX A;  4BY6 C;  1VQK A;  1YJW Q;  1D0Z A;  2QDL A;  4CRI A;  1K9M U;  2V1Q A;  4M75 A;  2JNG A;  1GCQ A;  1SSF A;  3JCM V;  4M7A B;  2F5T X;  1Q86 C;  4PL6 A;  4QW2 A;  3OS0 A;  2DE0 X;  3QPH A;  1GL5 A;  4A4F A;  4E7L A;  1YIJ A;  2DL4 A;  1WI7 A;  2R5M A;  4KBM B;  3FIF A;  1K4U S;  4JS5 A;  3FEO A;  4N4I A;  1NG2 A;  4DEX A;  4DQ2 A;  1OOT A;  2RO0 A;  4IUR A;  4HA8 A;  2EKO A;  2LNH B;  1LCK A;  4C5E A;  2FB7 A;  2GQI A;  4C8Q E;  4MZP A;  2XDB A;  1TTH B;  3INZ A;  4M7A D;  1M27 C;  1RAF B;  4OB2 B;  2XDD A;  3QUI A;  4RTW A;  4JRP A;  2XD0 A;  1LVK A;  1TUC A;  4JJC A;  3CME Q;  4DBR A;  1VQO T;  1VQ9 T;  2ESW A;  4BUG A;  2BIV A;  1VQ4 T;  2CSQ A;  3RKX A;  3CBO A;  1D1C A;  4L6V 5;  2A7Y A;  2G3R A;  1U5S A;  1G3S A;  3EG1 A;  4M75 D;  1VUB A;  4FT2 A;  1E7O A;  2KRN A;  5J3B A;  1X2Q A;  4R56 A;  2COW A;  3UAT A;  4OMO A;  3OYB A;  2DKG A;  4EDU A;  2L0A A;  5C6S A;  2L5Q A;  1BI2 A;  3M5A A;  3JSC A;  4M7A G;  2JM9 A;  1MV3 A;  4RTT A;  4QT7 A;  4B6M A;  4MZT A;  1IHV A;  4C92 B;  1D09 B;  3OYJ A;  3KXT A;  2R5A A;  4LDX A;  3CCR Q;  2RQT A;  2X4X A;  4C0F A;  1S1N A;  1VIF A;  4PFO A;  4C8Q C;  3CCE Q;  1CKA A;  3CC4 A;  4OML A;  4PLI A;  5GAN f;  3I5R A;  1WHJ A;  4Z8A A;  4QKU A;  1VQ6 A;  3TU4 K;  3CPW A;  2DVE A;  2P84 A;  1V1C A;  5GAM j;  2EW3 A;  4HT9 A;  4C92 D;  2OTJ T;  4NOY A;  2CZ1 B;  4KUD K;  2MF2 A;  5ECA A;  2R58 A;  2JMC A;  4Y92 A;  5FU6 C;  3C4S A;  1HJD A;  3CQT A;  3EGU A;  1GRI A;  2YXY A;  2LJ0 A;  1UHF A;  2LDM A;  4OMN A;  4LD9 K;  3V8L A;  1YHQ T;  1D0Y A;  2CDT A;  2ROT A;  1BYM A;  4IUV A;  2FYK A;  5CR2 A;  1S72 Q;  1T0H A;  1YJW A;  1WXU A;  4ELY C;  5LJ5 e;  3M4Y A;  1YJN Q;  5IH2 A;  2EJ9 A;  1YBY A;  4LXC A;  4RG2 A;  2D0Q B;  2EVR A;  4C92 G;  2ABL A;  3M0S A;  5GAN h;  2OTL Q;  3CC7 Q;  2O31 A;  5HK0 A;  3FJ5 A;  4E6R A;  2D0N A;  2PZ1 A;  5KYN A;  2NUP B;  1Q81 R;  5GAO r;  3S3N A;  2LVM A;  2H3E B;  2JXB A;  2DVJ A;  3H0I A;  2XK0 A;  4LDW A;  4RUG A;  1W2B P;  4OGC A;  1ZBJ A;  2QQB A;  2AHJ B;  1TUD A;  3JCM d;  1M3B A;  4EMG A;  2AK5 A;  4XTU A;  1YWO A;  3P8D A;  3SD4 A;  1GCP A;  5GAM g;  3OYH A;  5IXB A;  1Y0M A;  1YJ9 T;  2DBK A;  3OBY A;  3NHN A;  2DD5 A;  3EG2 A;  1C1A A;  2P0P A;  5D7U A;  7AT1 B;  4OMF B;  1X43 A;  3RKW A;  2QQA A;  1TOV A;  1YCS B;  2SEM A;  3JB9 I;  3CME A;  2NLU A;  4PJO B;  1D1A A;  1FMV A;  2K57 A;  1OZ3 A;  2A08 A;  1K73 U;  1X6B A;  3M0U A;  4BI3 A;  2JUF A;  3RNJ A;  3KUF A;  3VS4 A;  2OX7 A;  2CP0 A;  3I55 T;  3L2Q A;  1KSW A;  1NZ9 A;  3I56 Q;  2KSS A;  1Y71 A;  2K6D A;  3JRZ A;  2DXC A;  4F7U B;  4ZGD B;  4J9G A;  2PTK A;  3HRS A;  4HCC A;  1YFN A;  4FSX A;  3QII A;  4PJO D;  1WHL A;  3DLL A;  3PE0 A;  4BDZ A;  3GNF B;  1VYV A;  1U8R A;  3M59 A;  3LW5 E;  2ROL A;  3A98 A;  2F5K A;  3CCM Q;  2EIF A;  2D8J A;  5KYW B;  3E2U A;  2OJ2 A;  3SWN B;  2QAZ A;  4GY5 A;  1C0M A;  2RH2 A;  1BBZ A;  1OU8 A;  1EX4 A;  5A0G A;  1IHW A;  1SRL A;  4ZN3 A;  3CCS T;  3EG3 A;  3BDU A;  5AYF A;  4A4G A;  2Z0W A;  1OYX A;  4M78 G;  3QKJ A;  4N0A C;  4JRQ A;  1RAI B;  4XU1 A;  3CCJ Q;  2QQR A;  2QTV A;  3QYG B;  5GMK j;  1YIT Q;  2K2M A;  1HK9 A;  3LGL A;  4C0Z A;  4HCB A;  2FZG B;  2C06 A;  2J6O A;  3M54 A;  4JJD A;  1RLP C;  2VGM A;  5CVI A;  1YN8 A;  3I9Q A;  1WQ7 A;  3CBM A;  5D6W A;  3L2R A;  2V8K A;  3QDR B;  2E41 A;  1IRX A;  4XTY A;  2L3P A;  5C0M A;  2YUN A;  3OBW A;  2HQX A;  4XTW A;  2HKN A;  1H3Z A;  2LP5 A;  4E7I A;  1IGU A;  1T0J A;  2RB6 A;  3EHQ A;  5IN1 A;  3M57 A;  1YJN A;  2CUB A;  2YWW A;  4B9W A;  2AZS A;  5HK3 A;  1FMW A;  3EFO B;  3M0T A;  2ZCF B;  4XTZ A;  2DEQ A;  4F7U G;  2VXF A;  2JS2 A;  3CCQ Q;  2XHC A;  2OTL A;  4KGV B;  4ZGJ B;  2FPF A;  4RTU A;  3G7Z A;  3CMA T;  1J3T A;  2K7A A;  4J9B A;  4EMK A;  2RQU A;  4CC4 B;  5I22 A;  2AZV A;  3VYG A;  5HKC A;  4QVD A;  2MAM A;  3REB B;  2JTM A;  3LWI A;  1ZSZ A;  4PK4 A;  3JB9 F;  4CC2 A;  2O4X A;  1KD1 R;  1MGQ A;  1K9M C;  1NLO C;  5CKH A;  3CCU Q;  3HFN A;  3OW2 A;  1M1K R;  1VQ7 Q;  4OMQ A;  2YRC A;  4M7D E;  1TUG B;  1K8A R;  2O01 E;  4ANJ A;  3CCL A;  1TXQ A;  2VUB A;  3CXC S;  3QG1 A;  2DZC A;  2RD1 A;  2YLB A;  1KC8 U;  3JCM Q;  5DLQ E;  2EJF A;  1NBE B;  3OS1 A;  1ZLM A;  1Y96 B;  1VA7 A;  4PKC C;  1WNL A;  1QQJ A;  3OYA A;  1VQL Q;  5IXF A;  1VQ8 T;  4MDW A;  2E3H A;  3C95 A;  2PVD B;  4M7D A;  1A0N B;  2DL3 A;  2Y4Y A;  5GJW B;  4ZTJ A;  4ZN1 A;  1M90 U;  1WJQ A;  8ATC B;  4C5I A;  3DLM A;  2E4H A;  4HVW A;  1AHJ B;  1H92 A;  3HRT A;  4AG1 C;  1QKW A;  3P8H A;  1SKU B;  2DIL A;  3TQ7 P;  1QP3 A;  1KJW A;  3VS6 A;  2VC8 A;  2YT6 A;  3X25 B;  1I5L A;  2CZ0 B;  2K5L A;  4M77 A;  2KEA A;  2LT1 A;  2E5Q A;  3UA6 A;  2JOY A;  3EHR A;  3V7C A;  4M7A F;  4J9C A;  2HNI A;  1E6H A;  1PKT A;  2RJC A;  1TWB A;  4Z89 A;  3OYD A;  1LOJ A;  3HPW A;  4EPC A;  2J05 A;  5DM7 R;  2RHI A;  2PUO B;  1BIA A;  3OB9 A;  2ZPI B;  5GAO m;  1O9S A;  1VQP Q;  1IRE B;  2RJE A;  3CMA A;  3AHU A;  4E7J A;  3FC3 A;  3D7S B;  3EH1 A;  3G6E Q;  3CPW P;  2FHD A;  5IHI A;  4BI8 B;  4LN2 A;  1B07 A;  1U06 A;  2QTX A;  3CCJ A;  4JZ4 A;  2X3X D;  2XU8 A;  5IHN A;  1YIT A;  3UWN A;  1H3H A;  2XMF A;  1AT1 B;  1K76 A;  2QK0 A;  1VQK T;  5LJ5 j;  4FM4 B;  2JMA A;  5EC7 A;  2BE7 D;  2HDA A;  2FRY A;  2RQV A;  1NJI R;  4RKU E;  2HCK A;  1KG1 A;  2EPD A;  3J7A F;  4HVU A;  2AKK A;  4HXJ A;  2CZ7 B;  2JW4 A;  1M4Z A;  3IQL A;  3X26 B;  1XTD A;  3E1S A;  4WTO B;  4OB3 B;  3OYF A;  2KXC A;  3OYL A;  4BAC A;  3V7R A;  4J9E A;  1YIJ T;  3OQ5 A;  2O2O A;  4J9I A;  2LZ6 B;  1SG5 A;  4JPB W;  2DA9 A;  2MOX A;  1B34 A;  1SEM A;  4XTV A;  5GAO q;  3CCQ A;  1R8O B;  3M9Q A;  3JCM e;  3PMT A;  4MMK A;  2LQW A;  2A3L A;  2LX7 A;  2VXE A;  1MMA A;  3JV3 A;  2JZ2 A;  4NS5 A;  4C92 F;  1JB0 E;  1JU5 C;  1RUW A;  4DBQ A;  2AKL A;  3OMG A;  2DK3 A;  3HSB A;  3VRY A;  1G2B A;  3CD6 Q;  4PLL A;  4Z02 A;  1D0X A;  3OYC A;  3MEA A;  1VQ7 A;  3HTR A;  2GTJ A;  3S3O A;  1UDL A;  2KT8 A;  3HHT B;  3HL8 A;  2HSP A;  3PIO A;  2DJQ A;  5LJ5 g;  2KQW A;  1D3B A;  3X20 B;  2LJ1 A;  3URG A;  4D8D A;  1Z9Q A;  5HCK A;  2LCC A;  1OI1 A;  4KT0 E;  4RTZ A;  5KYY A;  5GMK i;  2GGR A;  3OYY A;  3GP8 A;  5A2Q E;  1XJW B;  2QI2 A;  1VQL A;  1NPR A;  2C0I A;  1GBR A;  1MHN A;  4D6W A;  2E6N A;  1YI2 A;  2DO3 A;  3M53 A;  1AD5 A;  2RK2 A;  1R0B G;  3BE3 A;  4FYV B;  1XNI A;  3QDF A;  3KFV A;  4FSS A;  2CRE A;  3OYN A;  4GLM A;  1JQQ A;  2GCX A;  5GAM f;  2D9T A;  1AEY A;  3H6Z A;  2QYZ A;  3A1P A;  4Y91 A;  3CC4 T;  4DEY A;  3S3M A;  3CEY A;  5M9O A;  5GAO l;  2P4T A;  4LDU A;  2FL7 A;  1SRM A;  1VQO Q;  2COY A;  1VQ6 T;  5CKF A;  1WHK A;  1TS9 A;  1SF9 A;  1ZBX A;  3JB9 G;  1M1F A;  1K73 C;  4FYX B;  2K2V A;  4J8O A;  2KNB B;  4PNO A;  3THK A;  4F04 B;  4M75 B;  2DL5 A;  2RM4 A;  3ME9 A;  4M7A C;  4E7K A;  2E64 A;  3QO3 A;  2BE9 B;  3G6E A;  4MML A;  3L2V A;  2P0Q A;  5GAN 8;  2EYY A;  3ZEH A;  2LJ3 A;  2CT3 A;  2R57 A;  1TH7 A;  4FYY B;  1NE8 A;  1PD0 A;  1YJW T;  3FJP A;  2CP7 A;  4FIB A;  4C92 E;  1ZA1 B;  4FW1 A;  4E7S A;  4M78 F;  1JEG A;  2KXD A;  4C8Q A;  2RHZ A;  1I07 A;  3RES A;  3TSW A;  3EGX A;  2A0F B;  4K11 A;  5GAM h;  2KBT A;  4PJO F;  2WSC E;  1BB9 A;  2LTO A;  4KRT A;  1GFC A;  1W4S A;  2LCS A;  5KH6 A;  2ED0 A;  5KCH A;  1KQS A;  2K4Y A;  3CXC P;  4CC3 A;  1UEC A;  2OTJ Q;  3PNW C;  3EFS A;  5FWC A;  3SB2 A;  1M8V A;  5FRO A;  2F2V A;  4BE2 A;  3SHW A;  3VU3 C;  3GF5 A;  4F7U F;  3EGD A;  2RQW A;  1G3Y A;  4N4H A;  2E10 A;  2KYB A;  5D6X A;  4HKE A;  2DTI A;  1U1T A;  2IG0 A;  4M75 G;  3C12 A;  2KYM A;  1Y57 A;  3CME T;  1QVP A;  3DB3 A;  1K8A C;  3BFM A;  3QWY A;  4C92 C;  3C0C A;  3H0H A;  4CC7 A;  2DIG A;  4C8Q D;  1HXD A;  3VS0 A;  5GAN 4;  2HBP A;  4KUL A;  3PVQ A;  2YRD A;  5D6Y A;  1Q81 U;  4XAX B;  2ZPB B;  1QWF A;  4XU2 A;  4IUP A;  1BI3 A;  2B86 A;  1WX6 A;  2JTE A;  1N5Z A;  2IPO B;  1PG5 B;  1M30 A;  3CCR T;  3DKM A;  2DLP A;  2NWM A;  3CCE T;  5A0L A;  2CS7 A;  4F17 A;  2JJ9 A;  1KC8 C;  3CPW S;  4JS4 A;  1VQ5 Q;  3O8V A;  5AT1 B;  5LJ3 e;  1Q7Y C;  4M78 E;  5CKE A;  3L1A A;  3RMQ A;  2YUP A;  2XDP A;  2O9S A;  3NTH A;  4C0D C;  2E3I A;  5GJV B;  2K3Y A;  1W70 A;  5KYU A;  3SDZ A;  3VYH B;  5J26 A;  3I55 Q;  1M90 C;  1QVG A;  1VQM Q;  4WCI A;  4LDY A;  1M2O A;  3GIB A;  2C0T A;  1E6G A;  1QW1 A;  2FVU A;  5GAN d;  3EFR A;  2FRW A;  2BZ8 A;  3WXM B;  4DOV A;  2EQM A;  2EYZ A;  3MP8 A;  4F7U E;  2M0O A;  2ATC B;  3GBQ A;  1GFD A;  1SHF A;  3QHS A;  1H8K A;  1NJI C;  1YJN T;  1M2V A;  1QMC A;  4QQ6 A;  1UB4 A;  2X35 A;  4AFZ C;  1JJ2 P;  4R0K A;  2EAY A;  4CI0 C;  1TU0 B;  3PT9 A;  4ATO A;  1XOV A;  3OYI A;  1WJR A;  1P92 A;  4VUB A;  1KHC A;  2F2X A;  2ZPH B;  2OTL T;  5CQY A;  5GMK h;  4M78 C;  2AT1 B;  2GQV A;  1JBM A;  1UJ0 A;  1WLP B;  3CCS Q;  1PRM C;  2EQU A;  1PD1 A;  2L3Q A;  2KI7 A;  4PJO C;  4RG8 A;  2DTH A;  3MP6 A;  2DZ9 A;  1PC0 A;  4N0A A;  1AWW A;  3M58 A;  4J9H A;  5FU7 B;  1JO8 A;  2LQK A;  3NTK A;  4M4Z A;  4F16 A;  3CCR A;  2ZPG B;  2LQ8 A;  1AOJ A;  4OB1 B;  4ESR A;  2O9V A;  3CCE A;  1OUL A;  4JLI A;  2L89 A;  4LD6 A;  2RJF A;  5GAN 6;  3PTA A;  2K3X A;  3CCL T;  3MEW A;  4IUT A;  1K0S A;  4GBQ A;  2BUD A;  4A4K A;  2RMO A;  1Z9Z A;  3U23 A;  3EAE A;  2EGA A;  1Q86 R;  4JDS A;  1B7T A;  4B9X A;  1X01 A;  1WPY A;  2WAC A;  2D1X A;  3F70 A;  2PUK B;  1V29 B;  2RN8 A;  5CO7 A;  1F1B B;  2O88 A;  2L3R A;  4PJO G;  3SWN C;  4IIO A;  2DER A;  1RAG B;  3I56 T;  2BZY A;  4KH1 B;  2PVO B;  3PMI A;  1GBQ A;  1KD1 U;  2QA4 Q;  3SEM A;  3JCM g;  3CC2 Q;  1S72 A;  1M1K U;  1W6X A;  2E70 A;  2J06 A;  3UDC A;  2CSI A;  3RKY A;  1K8A U;  3S6W A;  3JCM X;  3EH2 A;  3I35 A;  3CCM T;  1VYU A;  3TEE A;  3GOX A;  3JCM b;  4C5H A;  1I4K 1;  2CT4 A;  2DYI A;  1VQ5 A;  3LH0 A;  3PFS A;  1LPL A;  3ULR B;  1BU1 A;  3CC7 A;  3R6N A;  1FWZ A;  5L8R E;  5LJ5 f;  3HRU A;  1N27 A;  2FEI A;  2DPP B;  3RDV A;  1X75 C;  1VQN Q;  1ZUU A;  4OVA A;  1QVF A;  3CCJ T;  1IGQ A;  2L2P A;  1YIT T;  2HL3 A;  5LJ3 f;  3OSV A;  1NEG A;  1PCX A;  2F69 A;  3EG9 A;  4FL6 A;  1OEB A;  1VQM A;  1IO6 A;  4E47 A;  2FG0 A;  2QQ9 A;  2MWO A;  3CBP A;  5L23 A;  1M5Q 1;  1WHM A;  4ME7 A;  2E1H A;  2RNA A;  2EBP A;  4EMK B;  1Q7Y U;  1IXD A;  1PSE A;  2GFU A;  1KIK A;  1AZG B;  1ZSZ B;  3VKI A;  2O4X B;  4J9F A;  4PJJ A;  3L2W A; 
#chains in the Genus database with same CATH homology
 4Y28 E;  3J81 E;  1EIF A;  2X4X A;  3Q1J A;  4C0F A;  3S3O A;  1VIF A;  4C8Q C;  3HHT B;  3HL8 A;  3CCQ T;  1VQM T;  3PIO A;  4JLG A;  3TCJ A;  4MDX A;  3SWN A;  2EFI A;  5LJ5 g;  3CC4 A;  1VIE A;  2KQW A;  2GFA A;  4M78 D;  3RIR A;  1BKB A;  3I56 A;  1D3B A;  2CYZ B;  4PLI A;  1N9S A;  3X20 B;  5GAN f;  3URG A;  1YHQ A;  1VQ8 A;  5LJ5 h;  2DXT A;  3NFC A;  2LCC A;  1OI1 A;  3DB4 A;  4KT0 E;  1VQ6 A;  3BDL A;  5GMK i;  4M7D F;  4OB0 B;  4J7F A;  3OYY A;  3TU4 K;  3JCM J;  3CPW A;  2DVE A;  3GP8 A;  5A2Q E;  2QI2 A;  1VQL A;  1NPR A;  4V2S A;  2M1H A;  3R6O A;  3X24 B;  1MHN A;  3OW2 S;  5GAM j;  4D6W A;  1N6A A;  3E9G A;  2LRQ A;  2E6N A;  4HT9 A;  4C92 D;  2OTJ T;  5FU7 C;  4NOY A;  1N9R A;  3V8J A;  1X6O A;  2CZ1 B;  3LX7 A;  4DOW A;  4KUD K;  1YI2 A;  1NJI U;  3JB9 H;  2DO3 A;  3M53 A;  3CCM A;  2MF2 A;  5GAN 3;  4M7D B;  2R58 A;  2RK2 A;  2QXF A;  1VQ7 T;  1XNI A;  5FU6 C;  3C4S A;  1O75 A;  5DY9 A;  2V8I A;  3OYN A;  3RER A;  2GCX A;  5GAM f;  4J6W A;  2D9T A;  3QXE B;  4M77 F;  3H6Z A;  3TRE A;  3QSU A;  1G5V A;  2QEX T;  3OSS C;  4Y91 A;  3CC4 T;  3JCM P;  2X4Y A;  2LDM A;  3S3M A;  3CEY A;  4LD9 K;  5M9O A;  5GAO l;  3V8L A;  1YHQ T;  3V8K A;  2P4T A;  4A4H A;  4LDU A;  1BIB A;  1UEB A;  5CKB A;  3T9N A;  2FL7 A;  4EMH A;  1DJ7 B;  4M77 B;  2X4W A;  5I2M A;  1W2B A;  2LX9 A;  1VQ6 T;  1BYM A;  5CKF A;  4IUV A;  2E12 A;  2FYK A;  5CR2 A;  1PSF A;  3GLX A;  1ZBX A;  2K5I A;  2RHY A;  4M75 F;  3JB9 G;  1YJW A;  1VQL T;  1KQ2 A;  3JCM c;  1GXI E;  1M1F A;  2QQS A;  3M4Y A;  4ELY C;  2P0K A;  5LJ5 e;  1K73 C;  3A8L B;  2K2V A;  4N4G A;  3OYK A;  4J8O A;  3A8O B;  1XQH A;  2K5F A;  4M7D D;  2DXB A;  1I8F A;  2EJ9 A;  1YI2 T;  4PNO A;  1YJ9 A;  2EYQ A;  1YBY A;  3UT1 A;  4RG2 A;  4M75 B;  3UPU A;  5GAN g;  2HAX A;  2RM4 A;  2D0Q B;  3ME9 A;  3FRN A;  4M7A C;  2DTO A;  3VUB A;  4C92 G;  4E7K A;  3V7S A;  5GAN h;  2E64 A;  1LJO A;  5HK0 A;  3QO3 A;  5FLX E;  3ZBD A;  2B8A A;  2QA4 A;  3JCM W;  3G6E A;  4MML A;  3L2V A;  2P0Q A;  5LJ3 j;  5GAO r;  2EQK A;  5GAN 8;  3OA6 A;  3CXC A;  1KHI A;  4J6Y A;  3LWH A;  2BKD N;  2LVM A;  3ZEH A;  4ELZ C;  1I81 A;  4M77 D;  2R57 A;  3OMC A;  5CIU A;  4IUU A;  2ZGW A;  2XK0 A;  4LDW A;  1TH7 A;  1NE8 A;  3A8H B;  4OGC A;  4RMO A;  2QQB A;  2AHJ B;  4QVC A;  1YJW T;  2ZPE B;  3FJP A;  4EMG A;  3JCM d;  4FIB A;  4C92 E;  4XTU A;  4HCZ A;  5GMK m;  3P8D A;  4JUV A;  2ZPF B;  5LL6 S;  3SD4 A;  4M78 F;  5GAM g;  4C8Q A;  3OYH A;  3I55 A;  4P5N A;  2DAQ A;  2RHZ A;  1Q81 C;  3RES A;  1YJ9 T;  3OBY A;  3OY9 A;  1QP2 A;  2DD5 A;  5GAM h;  2HQE A;  4C0G A;  4BE0 A;  4II1 A;  2P0P A;  4PJO F;  1UGP B;  2LC4 A;  2WSC E;  2LTO A;  4OMF B;  1VQP T;  5KE3 A;  3RKW A;  2QQA A;  4FT4 A;  1W4S A;  3JB9 I;  3CME A;  4JRI A;  2NLU A;  2QA4 T;  5KH6 A;  3JB9 J;  2DIQ A;  3G6E T;  3CC2 T;  1VQN A;  5KCH A;  1KQS A;  2K4Y A;  1JJ2 S;  5DLO A;  4PJO B;  3MP1 A;  5GAN e;  2K57 A;  1Y96 A;  4ZGE B;  1OZ3 A;  4DA4 A;  4BB7 A;  3PNW C;  3EFS A;  3SB2 A;  4TVR A;  2PVG B;  3PIP A;  1M8V A;  1K73 U;  1B34 B;  2X4J A;  4J5Y A;  3CCU A;  4BI3 A;  5FRO A;  4BE2 A;  4QQD A;  3VU3 C;  4M77 G;  2JUF A;  3S3N A;  3GF5 A;  1H64 1;  3KUF A;  4F7U F;  2LCL A;  1M9S A;  3I55 T;  3L2Q A;  2D6F A;  1G3Y A;  4LDV A;  4N4H A;  2E10 A;  3OYG A;  1NZ9 A;  4OP0 A;  2KSS A;  4GLK A;  4M7A E;  5D6X A;  1Y71 A;  3JRZ A;  4HKE A;  2DXC A;  2DTI A;  4OF1 A;  4X34 A;  4F7U B;  4ZGD B;  1U1T A;  1G3W A;  3CCS A;  1QVF S;  4R55 A;  2IG0 A;  2XKO C;  4M75 G;  3OS2 A;  3C12 A;  4A54 A;  4EMK C;  5GAM e;  3HRS A;  4HCC A;  3CME T;  1N8R U;  4FSX A;  1QVP A;  3QII A;  3DB3 A;  4NL3 A;  2KVQ G;  2PQW A;  1K8A C;  1VQN T;  4M77 E;  4PJO D;  3L2Z A;  3DLL A;  4BDZ A;  4BY6 B;  3BFM A;  4A4E A;  5LJ3 g;  3GNF B;  3HFO A;  4C92 C;  4L5G A;  2Y90 A;  1U8R A;  3M59 A;  4O6J A;  1NPP A;  2VV5 A;  3LW5 E;  2DIG A;  1FXX A;  1HXD A;  2WSE E;  4C8Q D;  5LJ3 h;  2F5K A;  1Q82 U;  3CCU T;  5GAN 4;  2HBP A;  1G3T A;  3QZ9 B;  2EIF A;  4KUL A;  5D6Y A;  2DJZ A;  1Q81 U;  4M75 E;  3SWN B;  4M7A A;  4GY5 A;  4XAX B;  2ZPB B;  1D3B B;  2RI2 A;  1RI0 A;  2RH2 A;  4XU2 A;  5KE2 A;  4IUP A;  1BI3 A;  2XG8 D;  3MET A;  5LJ5 d;  2EWN A;  5A0G A;  3LLR A;  3G71 A;  4ZN3 A;  4J6X A;  3CCS T;  2MWP A;  3M55 A;  5I2S A;  3BDU A;  5AYF A;  4A4G A;  2M9U A;  1OYX A;  4A53 A;  3A5Z B;  4M78 G;  3QKJ A;  4N0A C;  4JRQ A;  4XU1 A;  4IKF A;  2QQR A;  3QYG B;  5KCO A;  3CCR T;  5GMK j;  1ZHI A;  1HK9 A;  3DKM A;  5LJ3 d;  5CCA A;  3LGL A;  4C0Z A;  3CCV A;  4M7D C;  4J7I A;  4HCB A;  2C06 A;  3ZFJ A;  3E9F A;  3M54 A;  4MZM A;  4E7H A;  2CGH A;  2MMP A;  5A0L A;  2CS7 A;  2VGM A;  3LYI A;  3P8B B;  5CVI A;  3MEV A;  4BE1 A;  1WQ7 A;  3CBM A;  5D6W A;  3L2R A;  2V8K A;  3L42 A;  3QDR B;  2Y4X A;  2L8D A;  2E41 A;  3WVE B;  1KC8 C;  2XID A;  4XTY A;  2KDS A;  3CPW S;  4JS4 A;  3O8V A;  4NL2 A;  5C0M A;  5LJ3 e;  1VQP A;  2ZZD A;  4M78 E;  3OBW A;  2HQX A;  5CKE A;  1Q7Y C;  4XTW A;  2KK4 A;  3L1A A;  3RMQ A;  2XI9 A;  1H3Z A;  1UGQ B;  3CC2 A;  2OAU A;  2XDP A;  4E7I A;  2RB6 A;  3NTH A;  5IN1 A;  3HP9 A;  3M57 A;  4M77 C;  4C0D C;  3G71 T;  1YJN A;  3FDR A;  3X28 B;  2CKK A;  2VGN A;  4BI4 A;  4B9W A;  1JJ2 A;  2RI3 A;  5HY6 A;  1WQW A;  1YCY A;  3MEU A;  2K3Y A;  4F7U G;  5HK3 A;  2ZCF B;  4XTZ A;  2DD4 A;  2DEQ A;  2VXF A;  5GMK l;  2RJD A;  4WF2 A;  2XIC A;  3SDZ A;  2LT4 A;  3CPF A;  3PGG A;  4X9D A;  5EG2 A;  5J26 A;  3VYH B;  3CCV T;  3H8Z A;  4M75 C;  1IZ6 A;  1M90 C;  1QVG A;  2XHC A;  2OTL A;  4LDY A;  3MHX A;  4ZGJ B;  3GIB A;  2IVW A;  1W2B S;  1QW1 A;  2FVU A;  2M16 A;  5GAN d;  3EFR A;  2VYT A;  3G7Z A;  2RHU A;  4FU6 A;  4QVZ A;  5CQX A;  4XQ3 A;  3WXM B;  3CMA T;  4DOV A;  4M7D G;  2EQM A;  3MP8 A;  4EMK A;  1U1S A;  3WVD B;  4F7U E;  2M0O A;  3ER0 A;  3BW1 A;  3VYG A;  4C8Q F;  5HKC A;  4QVD A;  3C94 A;  2MAM A;  3QHS A;  3QZ5 B;  2KMT A;  1NJI C;  2DXU A;  2JTM A;  2EJG A;  3LWI A;  4C92 A;  2RK1 A;  1YJN T;  5FRM A;  3JB9 F;  4QQ6 A;  2E65 A;  1BI1 A;  1UB4 A;  2O4X A;  1MGQ A;  2X35 A;  1K9M C;  5CKH A;  1UGR B;  2EAY A;  2RA2 A;  3HFN A;  4C8Q B;  3G4S A;  4CI0 C;  3OW2 A;  3ASK A;  3PT9 A;  1FX7 A;  2QEX A;  5IAY A;  4ATO A;  3QYH B;  4M7D E;  1XOV A;  4KUI A;  2O01 E;  3CCL A;  3OYI A;  1WJR A;  1P92 A;  2I2L A;  4VUB A;  1KHC A;  2VUB A;  2ZPH B;  3QG1 A;  4XTX A;  5GAM d;  3OYM A;  3CXC S;  5CQY A;  2OTL T;  2DZC A;  5GMK h;  2RD1 A;  2YLB A;  1KC8 U;  4M78 C;  3JCM Q;  2MI6 A;  5DLQ E;  2GQV A;  4JJN K;  1JBM A;  2EJF A;  3BY7 A;  1KD1 C;  3LGF A;  2EQU A;  1Y7X A;  4J83 A;  3OS1 A;  3CD6 A;  1LNX A;  4RCB A;  4YTL A;  1WGS A;  1M1K C;  4PJO C;  1WJS A;  1Y96 B;  4RG8 A;  2DTH A;  3MP6 A;  4PKC C;  3MO8 A;  1WNL A;  2DZ9 A;  4N0A A;  5CKD A;  1ZQ1 A;  3M58 A;  5FU7 B;  3OYA A;  3JCM f;  2LQK A;  1VQ8 T;  3NTK A;  3NTI A;  4MDW A;  3C95 A;  2PVD B;  3CCR A;  2QDY B;  4M7D A;  2ZPG B;  1JRI A;  2HD0 A;  2LQ8 A;  3M56 A;  5GAO p;  2Y4Y A;  5FU6 B;  4OB1 B;  4ZTJ A;  2CZ6 B;  5CAI A;  4UC4 A;  3CCE A;  4ZN1 A;  5GAN 5;  3G4S T;  5GAN 7;  4JLI A;  2L89 A;  1M90 U;  4JRK A;  1WJQ A;  2H3J A;  2RJF A;  4LD6 A;  2V8J A;  4C5I A;  5GAN 6;  3DLM A;  3PTA A;  3JB9 D;  1AHJ B;  4XU0 A;  1KQS S;  2K3X A;  3QBY A;  3SFM A;  3HRT A;  3CCL T;  3MEW A;  4IUT A;  3N5B B;  2BUD A;  4A4K A;  3P8H A;  3QJY A;  1QP3 A;  3EAE A;  4X9C A;  2VC8 A;  4QQG A;  3X25 B;  1I5L A;  4OGE A;  2CZ0 B;  2K5L A;  4M77 A;  2LT1 A;  3E19 A;  4JDS A;  3CD6 T;  2YRV A;  2RHX A;  3GNG A;  3J80 E;  4B9X A;  2E5Q A;  5GMK e;  2JTF A;  3RUX A;  1X01 A;  4BY6 C;  2JOY A;  1WPY A;  2WAC A;  3V7C A;  1VQK A;  2JN0 A;  4M7A F;  2HNI A;  5A0D A;  2RJC A;  4Q5W A;  3F70 A;  5IT9 E;  4CRI A;  1BI0 A;  1K9M U;  3OYD A;  2PUK B;  1LOJ A;  3HPW A;  3M4G A;  4EPC A;  1V29 B;  4M75 A;  3A8G B;  5CO7 A;  4BD3 A;  3VJP A;  2JNG A;  1SSF A;  3JCM V;  5CK9 A;  5DM7 R;  1M1G A;  2RHI A;  4XK8 E;  2L3R A;  4M7A B;  1RL2 A;  2F5T X;  4PJO G;  1Q86 C;  3SWN C;  2PUO B;  2E6Z A;  3I56 T;  3GPL A;  3RMS A;  1BIA A;  5I21 A;  3OB9 A;  4PL6 A;  3KBG A;  4QW2 A;  2GF7 A;  3OS0 A;  2ZPI B;  5GAO m;  1O9S A;  2PVO B;  3QPH A;  3PMI A;  1IRE B;  2RJE A;  4A4F A;  3CMA A;  4C8Q G;  4C0D B;  3AHU A;  4E7J A;  4E7L A;  3FC3 A;  1VQO A;  1KD1 U;  1VQ9 A;  3JCM g;  3OS5 A;  1YIJ A;  1VQ4 A;  2FHD A;  2R5M A;  1S72 A;  4KBM B;  3FIF A;  1OZ2 A;  4BI8 B;  4JS5 A;  2QTX A;  3CCJ A;  3FEO A;  4ZTF A;  2EQJ A;  1M1K U;  2E70 A;  2XU8 A;  1YIT A;  4N4I A;  3JCM h;  3UDC A;  3UWN A;  1KQ1 A;  3RKY A;  1K8A U;  3S6W A;  3JCM X;  4PJO E;  3VV0 A;  2YHT A;  2PU9 B;  4DQ2 A;  4O5V A;  2LNV A;  3CCM T;  1VQK T;  3A8M B;  3TEE A;  5LJ5 j;  3GOX A;  3JCM b;  2RO0 A;  4FM4 B;  4IUR A;  4HA8 A;  4C5H A;  2YLC A;  2EKO A;  4C5E A;  2FB7 A;  1I4K 1;  4C8Q E;  4MZP A;  4XU3 A;  2KY9 A;  5FRN A;  2XDB A;  1VQ5 A;  3LH0 A;  3INZ A;  3PFS A;  4M7A D;  4C5G A;  5J39 A;  2WSF E;  3JAM E;  1Y07 A;  4OB2 B;  4RKU E;  3CC7 A;  2XDD A;  1KG1 A;  4M78 A;  1FWZ A;  3QUI A;  4JRP A;  3L2U A;  1UGS B;  5L8R E;  3J7A F;  5LJ5 f;  2XD0 A;  2CZ7 B;  3HRU A;  1M4Z A;  1N8R C;  1N27 A;  3X26 B;  2DPP B;  3VUZ A;  4L59 A;  5GAN 2;  1XTD A;  3E1S A;  4OB3 B;  3OYF A;  1X75 C;  4PJO A;  1VQO T;  3OYL A;  4BAC A;  3V7R A;  4BUG A;  1VQ9 T;  1YIJ T;  2BIV A;  3OQ5 A;  1VQ4 T;  1S72 T;  3RKX A;  4OVA A;  3CBO A;  1QVF A;  3CCJ T;  1YIT T;  1B34 A;  4L6V 5;  2A7Y A;  2G3R A;  5LJ3 f;  3FB9 A;  3OSV A;  4XTV A;  1G3S A;  3OYE A;  5GAO q;  2F69 A;  2JVV A;  4FL6 A;  4IUQ A;  1R8O B;  1VUB A;  4M75 D;  4FT2 A;  3CCQ A;  1VQM A;  3M9Q A;  4E47 A;  5J3B A;  2QQ9 A;  4HT8 A;  3JCM e;  2MWO A;  4R56 A;  3PMT A;  4M78 B;  4MMK A;  1Q86 U;  2A3L A;  3CBP A;  1M5Q 1;  1VQ5 T;  4ME7 A;  2RI5 A;  3OYB A;  2DKG A;  2VXE A;  3CC7 T;  4EDU A;  2JZ2 A;  4NS5 A;  3CCE T;  4C92 F;  1JB0 E;  4F7U A;  2E1H A;  3OMG A;  2DK3 A;  3HSB A;  5C6S A;  4EMK B;  3HKS A;  2L5Q A;  1BI2 A;  3M5A A;  1Q7Y U;  3JSC A;  4M7A G;  4RCC A;  3FLG A;  4BDY A;  1PSE A;  2GFU A;  3MCA B;  2OTJ A;  4MZT A;  4PLL A;  4Z02 A;  4C92 B;  3OYJ A;  3KXT A;  1QVG S;  3OYC A;  5GAN j;  3MEA A;  3VKI A;  2KAF A;  2O4X B;  2R5A A;  3QJ6 A;  1Q82 C;  4LDX A;  1VQ7 A;  5GAO n;  3L2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...