5LJBA

Crystal structure of holo human crbp1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
134
structure length
134
Chain Sequence
b'PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 1
publication title Structural and molecular determinants affecting the interaction of retinol with human CRBP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Retinol-binding protein
total genus 35
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5ljbA00
4QAEA 1QFVA 2BLGA 5L8IA 1EQDA 2WWPA 4YBUA 3P6GA 4NNTA 3I0AA 3MVFA 3B2HA 1HBPA 1ZNDA 3CBCA 3WJGA 2HLVA 4Y0PA 4YFPA 1X89A 2L5PA 4NNSA 5HBSA 1HMTA 5LJGA 3HWEA 2LB6A 3P6HA 5HTEA 2KT4B 4AZMA 2WQ9A 1AB0A 5HZ8A 1LIFA 1QG5A 3WJBA 4ZGUA 3PP6A 4GNWA 4DQ3A 4HFOA 4I3BA 5LJBA 4AW8A 1SY3A 3EYCA 1GXAA 2AKQA 2QM9A 1O8VA 1MUPA 3JSQA 1IFBA 5HAEA 2MJIA 5EDCA 4HPDA 4QYPA 4ZHFA 1BLRA 3KFHA 1GKAA 1NP4A 2OFRX 3MBTA 2Q39A 4YCHA 4ZJ0A 3TGAA 3S26A 1MX8A 1X8NA 2NNQA 4XMHA 1MVGA 1OEKA 2JU8A 1IFCA 4NP1A 1PM1X 1T8VA 3U9PC 3NX1A 5H9AA 5DG4A 1JYJA 2FT9A 1FDQA 1KT7A 3VG6A 3I17A 4I9RA 5LJEA 2HNXA 4ORYA 3VG5A 2KTDA 2W2FA 1HMSA 3D95A 1XCAA 4Y0SA 2JU3A 1BM5A 1CRBA 4Y0QA 4YDAA 5HZ5A 1DFVA 3DTQA 2FLJA 4XMGA 3CBSA 5B29A 5EEEA 3O2YA 1RBPA 1OPAA 1ZNGA 1ZNKA 2CM4A 4NYQA 1YWCA 1LFOA 1A57A 2FTBA 4N7CA 1X8OA 2OZQA 3OJYC 3UEXA 4YKOA 3B2IA 5H9LA 5IO7A 1BJ7A 5BVQA 1EPBA 4ARHA 3ZQ3A 4ZHHA 2K23A 5HTDA 1G5WA 1X8PA 1KZWA 5F58A 3BU9A 1KT5A 3B2JA 5HZ6A 1ICNA 1GX8A 5F1EA 1IKJA 1JZUA 1I06A 1SXWA 4OMWA 4TKHA 1OPBA 1TOWA 1MDCA 2A3FX 1LIDA 1SY1A 4N7DA 4WBKA 4ALBA 5HCDC 1EALA 4YMYA 1EIOA 1B8EA 2NNDA 4GE1A 4YBPA 4HPBA 3HWGA 4M6SA 4BQUA 3BY0A 1A3YA 2L67A 3P6DA 5EZ2A 3UEWA 5L8NA 1JYDA 2R74A 5H8TA 3FEKA 5HZQA 5HA1A 3BLGA 2Q2MA 3FIQA 4RUUA 2AH7X 1S44A 4MVLA 5KIDA 3T1DA 3APXA 1AELA 1R0UA 3BSZE 4K19A 3VG7A 2QO5A 4QGXA 4GH7A 2FWVA 3NQ3A 3PPTA 1E02A 2FS7A 1VYGA 1KOIA 3K3LA 1FTPA 3EBKA 4A1HA 2FR2A 4XMDA 4UU3A 2W2AA 2L68A 1NP1A 2JN3A 4NLIA 5F6BA 4D6AA 1GKAB 3DSZA 1LKEA 2WUTA 1IKEA 2MO5A 2DM5A 4GETA 5LJCA 1X8UA 3VG3A 1KT6A 3G7XA 3L4RA 2OVDA 1PBOA 1E00A 3TGCA 4EEJA 2LFOA 1TW4A 3KFIA 1KQXA 2YG2A 2G79A 5F7GA 3WJFA 1XKIA 4IB6A 3RSWA 1GX9A 1QABE 1GGLA 5HCCC 1X8QA 3RZYA 1EW3A 4YH0A 2CZTA 3APVA 2LBVA 2CBRA 3FW4A 3BX8A 4LZUA 1CJ5A 1OBUA 4IMNA 4EFGA 1E06A 1AQBA 1E5PA 1T68X 2AMMX 4QZUA 4AZPA 5HZ9A 2GC9A 5EEDA 3C78X 4OS3A 3BS2A 4A8ZA 2HMBA 1KXOA 1SXYA 3IA8A 3STKA 4IBAA 4TLJA 2FR3A 1TVQA 1G7NA 4NYRA 2X46A 5HWZA 4YDBA 2R56A 5B27A 3FR2A 1I4UA 3FA7A 2RCTA 4YGZA 2XSTA 1GT5A 1DZPA 4OS8A 3HK1A 5F6ZA 1TOUA 1P6PA 1ERXA 1BBPA 1IW2A 4YFRA 1GT4A 1HMRA 1BRPA 3WJCA 3CR6A 4IAWA 1BRQA 1SXXA 3APUA 4OMXA 4TKJA 1AVGI 2NNEA 1G74A 1OEEA 4NLJA 3VG4A 4AZOA 1OBPA 4WFUA 3PH5A 3VG2A 1ADLA 2AT3X 1L6MA 4ES7A 1I05A 2N93A 1GM6A 1LICA 1MX7A 2OFMX 4AZQA 4I3DA 3KFFA 2OVEA 1GT1A 5IO5A 4ZH6A 3BX7A 1ZNHA 4ZH9A 1KGLA 1BEBA 3FELA 5LKFA 1QQSA 1BSOA 3U03A 4CK4A 2WEWA 1YIVA 1QFTA 2XKLA 1DZJA 4TJZA 1JV4A 1RLBE 3STNA 3ZUOA 3CQRA 4ORXA 3B2KA 3WJDA 4ORRA 2P8GA 2IFBA 2O62A 2RD7C 1YWDA 3NADA 1FE3A 1CBRA 3NP1A 1ACDA 1DZKA 3NX2A 2FRSA 5CE4A 3KZAA 1QY2A 2HYSA 5KHPA 5FENA 4ZR2A 1TXLA 1VYFA 1LNMA 3FA9A 3UEVA 4ZHCA 3FA6A 1VPRA 3WBGA 3D97A 2AT6X 3HWDA 2E4JA 2WQAE 4Y0RA 2CM9A 2OVAA 1EPAA 2GTFX 2WR6A 2ANSA 4YGGA 1IIUA 3PEDA 4R0BA 1FEMA 4IMOA 1EXSA 1CBQA 4TQ2A 2POAA 4YGHA 4KIIA 5DPQA 2RQ0A 5BVSA 4TKBA 4A60A 3APWA 1UZ2X 3FLLA 1JJJA 2A2UA 1KQWA 2WSJA 3ELZA 4IAXA 4RUNA 3GAQA 4OS0A 1O1UA 1HN2A 5LJHA 4I3CA 1FENA 1PMPA 2Q4NA 1OBQA 4TNNA 3BRNA 3CWKA 1YWBA 2AL0X 4YCEA 5H9KA 5L8OA 3Q6LA 1PEEA 2WEXA 1JBHA 5BVTA 1U0XA 1O1VA 4ZCBA 5HCEC 2MM3A 1LF7A 1HBQA 2ASNX 1HQPA 2W2BA 4GKCA 4ORUA 3TZSA 2A0AA 3P6CA 5HA0A 1D3SA 2CZUA 4ORSA 4EXZA 3NPOA 1SY2A 1DC9A 1ICMA 1ML7A 1U18A 1KT3A 3O19A 4ZHDA 1SA8A 2QOSC 1S7DA 1SXUA 3P6EA 2A2GA 5D45A 2RCQA 1UREA 1KZXA 5EPQA 4QGWA 4QYNA 3F8AA 1QY1A 4EDEA 3SAOA 1YP6A 2AT0X 4DQ4A 2ACPX 1FELA 2EU7X 3AKNA 5FFHA 2JU7A 3FMZA 3F9DA 4HPCA 4LKTA 4AZNA 4UU2A 4GRJA 3AKMA 3NQ9A 5D8JA 2JOZA 2AT8X 2NP1A 4XMFA 4MVKA 1T0VA 3TF6A 2QO4A 3FEPA 3QKGA 4ORWA 1OEJA 1ERBA 1DZMA 2R73A 3CQNA 3EMMA 1DV9A 5D4AA 5D48A 3UEUA 2RA6A 4ZFXA 3FR5A 5JR8A 3PECA 1A2DA 4LZVA 5EDBA 4ALOA 5IO6A 1ZNEA 2GJ5A 2X45A 3HWFA 4QGVA 3TGBA 1S2PA 1BSYA 1X71A 4O9SA 5H9NA 2G7BA 4XMCA 5KICA 1NGLA 4HPAA 5C0NA 5D47A 4AYHA 5LKEA 1LIEA 4MVIA 2CBSA 4LKPA 1G85A 1CBIA 3FENA 1DF3A 3EM0A 1QWDA 1Z24A 3EBWA 1EUOA 4ZHGA 1A18A 1H91A 3NR3A 3STMX 1B0OA 2Q2PA 1EIIA 4ODDA 2HZQA 3CMPA 3KFGA 3C76X 3IFBA 1GT3A 2F73A 3BU1A 3FW5A 1BWYA 4YKMA 3ELXA 1SY0A 4PSQA 1I04A 3B2LA 3C77X 2LBAA 1LPJA 3P6FA 1ALBA 2QO6A 4YFQA 2ACOA 1KT4A 4XMEA 3O22A 4I9SA 4M7MA 1YUPA 3WJEA 3JS1A 1LIBA 1YP7A 2A13A 3WXQA 2PY1A 4IB8A 2AT5X 1ZNLA 3PH6A 4AZRA 2FS6A 2G78A 1JJXA 3FA8A 3BDRA 1CBSA 1BSQA 1QY0A 3ZUIA 1B56A 4IB9A 5FAZA 3WVMA 5K06A 4BOEA 4IB7A 2ALLX 1B4MA 1D2UA 3KQ0A 2K62A 4BVMA 2LKKA 3FR4A 3U0DA 4GNYA 4A1YA 2HZRA 1N0SA 2L9CA 5AQ6A 5LJDA 1YWAA 4QZTA 4WFVA 3D96A 1ZRYA 2Q9SA 1U17A 4D6BA 5LJKA
chains in the Genus database with same CATH superfamily
4QAEA 1QFVA 1N9YA 1NBXA 2BC3A 2BLGA 5L8IA 5AEOA 1EQDA 4GUZA 2WWPA 4D6BA 4YBUA 4GJVA 3P6GA 4NNTA 3I0AA 4ID2A 4O4XA 3MVFA 3B2HA 1HBPA 1ZNDA 2RTBB 3CBCA 5FQ7E 3WJGA 5L3YA 2HLVA 3HOEA 3E3CA 4QQ1A 4Y0PA 4YFPA 1X89A 3RDUA 2L5PA 4NNSA 4O3ZA 5HBSA 2RTKA 4PJ2A 1NDJA 3T2XA 1HMTA 5LJGA 3H3IA 3HWEA 2LB6A 3P6HA 1VWJB 5HTEA 2KT4B 4AZMA 2AVIA 2WQ9A 1AB0A 1SWQA 4O4OA 5HZ8A 2BHVA 1LIFA 1PTSA 1QG5A 2X4MA 3WJBA 4ZGUA 3PP6A 4GNWA 4OEMA 4DQ3A 4HFOA 1VWDB 4I3BA 3VHMA 4AW8A 2CAMA 2X8FA 1SY3A 3EYCA 1GXAA 5LJBA 2AKQA 2QM9A 2IZFB 1O8VA 1MUPA 3RKGA 4CDEA 3RDQA 1SREA 2RTRB 3JSQA 3RDXA 1IFBA 5HAEA 2KD2A 5FQ6E 2MJIA 1SWOA 5EDCA 4BX7A 4HPDA 4QYPA 3WZQA 2OL6O 4ZHFA 1BLRA 3KFHA 1GKAA 1NP4A 1RXJA 2OFRX 3KVNA 3MBTA 2Q39A 4YCHA 1SWEA 4ZJ0A 3TGAA 3S26A 4Z6JA 1MX8A 4Z28A 1RAVA 1X8NA 2NNQA 2A8GA 3CKFA 2BS6A 4XMHA 1MVGA 1OEKA 4NV8A 2JU8A 2OY1O 1IFCA 4NP1A 2ZSCA 1PM1X 1T8VA 3U9PC 4GDAA 5IXGA 3NX1A 4Z27A 2QMIA 5H9AA 5DG4A 2OYBO 2BS5A 1JYJA 1W4TA 2FT9A 1FDQA 5B10O 1VWIB 1KT7A 1UYOX 2RTNB 3D9WA 3I17A 4I9RA 4WBKA 3VG6A 2RTGB 5LJEA 2HNXA 4ORYA 1SRIA 1PBYA 3ZW0B 2IZEB 3VG5A 2KTDA 3FDCA 2W2FA 1HMSA 1SWCA 4JO6A 5B5GA 3X00A 3D95A 4O4SA 1XCAA 4Y0SA 2JU3A 1BM5A 4MEEA 1CRBA 4Y0QA 4YDAA 4CPHA 5HZ5A 1DFVA 3WOVA 3DTQA 3HOLA 1SMPI 3OBLA 2FLJA 5JD2A 2IZAA 4BJ8A 4XMGA 3CBSA 5IRAA 5B29A 5EEEA 3O2YA 1RBPA 1OPAA 2C1QA 1KFFA 1VWAB 1ZNGA 1FJ1E 1MEPA 2X32A 4GZVA 3LV4A 2UYWA 1ZNKA 2CM4A 3P02A 4NYQA 1YWCA 1LFOA 1A57A 2FTBA 4N7CA 1MK5A 1X8OA 2OZQA 2RTFB 3OJYC 3UEXA 2IZIA 4YKOA 3PQSA 3B2IA 5H9LA 3MM0A 5IO7A 4WHIA 1BJ7A 5BVQA 1EPBA 2FKGA 2MWHA 3S60A 2K23A 3ZQ3A 1STRB 4ARHA 1G5WA 1X8PA 3WZPA 1KZWA 5F58A 3BU9A 1KT5A 3B2JA 5HZ6A 1ICNA 1GX8A 2IZBA 5F1EA 1IKJA 1JZUA 2F01A 1I06A 1SXWA 4OMWA 3RE6A 4TKHA 4BX6B 1OPBA 1TOWA 1MDCA 1LIDA 2A3FX 1SY1A 2OFAA 2QOMA 2VFBA 4N7DA 4ALBA 4YMYA 5HCDC 1B8EA 1EALA 1HQQA 3VPJE 1EIOA 2NNDA 4O3XB 3ZW2A 2IZHB 4GE1A 4YBPA 3EW2A 2G5LA 4HPBA 2GTLO 3HWGA 4M6SA 4BQUA 2FHLA 3BY0A 3WYQA 1A3YA 4OKAA 2L67A 3P6DA 1SWNA 5EZ2A 3UEWA 1VWBB 5L8NA 1JYDA 2R74A 4GD9A 4Z2PA 5H8TA 3FEKA 5HZQA 5HA1A 3BLGA 1Y52X 2Q2MA 3FIQA 4RUUA 2AH7X 3NBXX 3VE1A 5HZ9A 1S44A 4MVLA 5KIDA 3T1DA 3APXA 1SRHA 1AELA 1R0UA 3BSZE 4K19A 3VG7A 2QO5A 4QGXA 4GH7A 2FWVA 1RXKA 1HY2A 3NQ3A 3PPTA 1E02A 2FS7A 1RXHA 1VYGA 1KOIA 5FQ8E 5K68A 3K3LA 1FTPA 3EBKA 4A1HA 2FR2A 1KL4A 1LCZA 2Y3FA 4XMDA 2GTLN 4UU3A 2C4IA 2KTSA 2L68A 1NP1A 2W2AA 2RN4A 4I95A 2JN3A 4NLIA 2AF5A 5F6BA 4D6AA 2Y3EA 4BX5A 2JW1A 1GKAB 3DSZA 2GH7A 4ZHHA 1LKEA 2WUTA 1IKEA 4O4UA 2MO5A 2DM5A 5BYPA 4GETA 5LJCA 4I60A 1X8UA 1VWGB 1KT6A 2MHDA 2RTMA 3G7XA 4JGLA 3L4RA 2OVDA 1PBOA 3VG3A 1E00A 3TGCA 4EEJA 3F6ZB 2VFCA 2LFOA 2FHNX 1TW4A 4ML7B 3KFIA 1KQXA 1VWNB 3T2WA 2YG2A 4HWMA 4CSBA 4AZPA 2JMBA 2G79A 5F7GA 3WJFA 3RWXA 4ZGFA 2WPUA 4KC8A 1XKIA 3MX7A 4IB6A 3RSWA 2FKJA 1GX9A 4GU8A 1QABE 1GGLA 5HCCC 1SWLA 1X8QA 1EW3A 3HTYA 1JIWI 3PK2A 4YH0A 2ZAIA 3RZYA 2CZTA 3APVA 2DJGA 2LBVA 4DNEA 2I5ZO 2CBRA 2BSZA 3BX8A 3FW4A 4LZUA 1CJ5A 1OBUA 4U3QA 4IMNA 2RTPB 4EFGA 1E06A 1AQBA 1E5PA 1T68X 2AMMX 2RTHB 4QZUA 4Y5DA 3RY1A 2GC9A 5EEDA 1VWRB 3C78X 3S5VA 4COTA 4OS3A 4CV7A 1SRFA 4MIRA 3BS2A 1KL5A 4A8ZA 4FGIB 2HMBA 1KXOA 1N7YA 1SXYA 3IA8A 4GGZA 3STKA 4IBAA 4TLJA 2FR3A 1TVQA 1G7NA 2VDFA 4NYRA 3SOTA 3T6LA 1LCVA 4Z2OA 2A5CA 1NC9A 1VWOB 2X46A 2OF9A 4CDDA 5HWZA 1LDQA 4YDBA 2R56A 5B27A 3FR2A 4BGFA 2YMSA 1I4UA 3FA7A 2RCTA 4YGZA 1JMXA 1I9HA 4CDFA 1Y0GA 5K67A 2XSTA 1SWGA 1GT5A 3FIDA 4INNA 1DZPA 3EW1A 4OS8A 3HK1A 2OL8O 5F6ZA 1TOUA 1P6PA 2X8SA 2X8TA 3D4RA 1ERXA 1HXLA 4NW4A 1BBPA 1IW2A 2KW1A 4YFRA 1GT4A 1HMRA 1BRPA 2DJFA 3CR6A 4IAWA 1BRQA 1SXXA 3APUA 2X56A 4KH8A 4OMXA 1LDOA 2PI3O 2OY7A 4CPEA 4FBOA 4TKJA 1AVGI 2NNEA 1G74A 1OEEA 5B2AO 4NLJA 3VG4A 4O3WA 4AZOA 3T6FA 1OBPA 4WFUA 2MF6A 3PH5A 3VG2A 2QCBA 3Q34A 1ADLA 1KL3A 2AT3X 4GK9A 3SZJA 1L6MA 4ES7A 1I05A 2N93A 1SLDB 1GM6A 1Y9TA 4BCSA 1E2TA 1LICA 1MX7A 2OFMX 2RTEB 3KFFA 2OVEA 4I3DA 3ZW1B 4AZQA 1GT1A 5IO5A 4ZH6A 3BX7A 1ZNHA 1VYOA 4ZH9A 1BEBA 3FELA 3V8UA 1K24A 1KGLA 5LKFA 1QQSA 1BSOA 4LQZA 2G8CO 3U03A 4JHQA 4CK4A 4U8UM 2WEWA 1YIVA 1QFTA 2XKLA 1DZJA 4TJZA 1JV4A 1RLBE 3STNA 3ZUOA 5HTDA 3ZW0A 3CQRA 4ORXA 1SWKA 3B2KA 4Y59A 5CSEA 3WJDA 4ORRA 2P8GA 2IFBA 2O62A 2RD7C 1YWDA 1MOYA 3NADA 1FE3A 1CBRA 3NP1A 1MM9A 1VWMB 1ACDA 1DZKA 3NX2A 4JNJA 2FRSA 5IRUA 4C5PA 4GDZA 5CE4A 3KZAA 1QY2A 1WUBA 2HYSA 4BX5B 5KHPA 1NQNA 5FENA 2RTDB 1W5RA 4ZR2A 1TXLA 1VYFA 1LNMA 3FA9A 4QNIA 3SZIA 1HXZA 3UEVA 4ZHCA 3FA6A 4B55A 1VPRA 3WBGA 3ZZVA 2OFBA 3D97A 2AT6X 3HWDA 3WZNA 1Y55X 2E4JA 2WQAE 4Y0RA 2CM9A 3SLTA 1I78A 2OVAA 1VWCB 2X34A 2OY8A 1EPAA 1AVEA 2GTFX 3MG5A 2WR6A 4FQBB 2ANSA 4YGGA 1IIUA 5B11O 2JGSA 3PEDA 4R0BA 1FEMA 4BX7B 4IMOA 5CHKA 3LTWA 1EXSA 1CBQA 4TQ2A 1SWJA 2POAA 4I6SA 4YGHA 3RBYA 3SLOA 2IZDB 4KIIA 5DPQA 4BX6A 2Y32A 3OD9A 2RTAA 2RQ0A 5BVSA 1LELA 4TKBA 4A60A 4EQAC 3APWA 1UZ2X 3FLLA 1JJJA 4YVBA 2A2UA 1KQWA 2WSJA 3ELZA 4IAXA 4RUNA 3GAQA 4OS0A 1O1UA 1HN2A 4KT5A 5LJHA 4I3CA 1FENA 1PMPA 2Q4NA 1OBQA 4GGRA 3BRNA 3CWKA 4TNNA 1WBIA 1YWBA 5B5FA 2AL0X 4YCEA 5H9KA 5L8OA 3Q6LA 1PEEA 2WEXA 3PQUA 1JBHA 3CKGA 5BVTA 1U0XA 1O1VA 4ZCBA 5HCEC 2MM3A 1LF7A 1HBQA 5B3MO 2ASNX 1HQPA 2IZKA 2IZGB 2OF8A 1EI5A 2W2BA 4GKCA 4ORUA 3TZSA 2A0AA 3P6CA 5HA0A 1D3SA 1VWLB 2CZUA 1VWEB 4ORSA 4EXZA 3NPOA 1SY2A 1DC9A 1ICMA 1ML7A 1U18A 3QQ2A 2OY5O 1KT3A 4ON1A 4CPHB 4Z2VA 3O19A 4ZHDA 1SA8A 2A5BA 2QOSC 1LCWA 1S7DA 1SXUA 3SLJA 2RTIB 2A2GA 3P6EA 2RCQA 1UREA 2RTOB 5D45A 2RTCB 2X55A 5EPQA 4QGWA 3N91A 3F8AA 4QYNA 1Y9LA 1N43A 1QY1A 4EDEA 3SAOA 1YP6A 3NQKA 2AT0X 3S5XA 3VGWA 1SLEB 4DCBA 4DQ4A 2ACPX 1SWTA 3FYFA 1FELA 2EU7X 3AKNA 4O49A 1NQMA 2JU7A 3F9DA 3FMZA 4HPCA 4LKTA 4UU2A 5FFHA 5AJCA 4L3RA 4GRJA 3AKMA 3NQ9A 1RSTB 3EC5A 4U46A 5D8JA 2JOZA 2AT8X 2M4LA 2NP1A 4MVKA 4XMFA 3RDOA 1OSPO 1T0VA 4OELA 3TF6A 2QO4A 4GJSA 3FEPA 1SWUA 3QKGA 1LUQA 1OEJA 1SWSA 4ORWA 3VU1A 1VWHB 2F09A 1ERBA 1DZMA 1VWKB 2R73A 3CQNA 3EMMA 1DV9A 5D4AA 1VWFB 5D48A 1AVDA 3UEUA 1VWQB 2RA6A 4ZFXA 3FR5A 5JR8A 3PECA 1A2DA 3WYPA 2BT9A 4LZVA 5EDBA 4ALOA 2C1SA 5IO6A 2LA7A 1ZNEA 2GJ5A 2X45A 3HWFA 4KCAA 4CDCA 4BBOA 1S2PA 4QGVA 4U8UO 3TGBA 1STSB 1BSYA 1X71A 3VE2A 4O9SA 5H9NA 2G7BA 4XMCA 3WJCA 5KICA 1NGLA 4HPAA 5C0NA 5D47A 1SWPA 4GGTA 4IRWA 1SWFA 2Z4IA 4QRLA 3RDMA 3VHHA 2UZ2A 4AYHA 1LIEA 1SWHA 1SLGB 3PDFA 5LKEA 4MVIA 2I5VO 2CBSA 1SWRA 4LKPA 1VWPB 1G85A 3WZOA 4MISA 1CBIA 3FENA 1DF3A 3EM0A 1QWDA 1Z24A 3EBWA 1SWAA 1EUOA 4ZHGA 1A18A 1H91A 3NR3A 3STMX 1B0OA 2Q2PA 4IABA 3RDSA 4EKVA 1EIIA 5IRWA 1UYNX 3RE5A 4FBRA 1Y53X 4O3YA 4FBVA 5F2BA 2OL7A 3HPEA 1SLFB 4ODDA 2HZQA 3CMPA 3KFGA 1K3BA 3C76X 4CPIA 3ZI8A 2IZLB 3IFBA 1GT3A 2F73A 3BU1A 3FW5A 5CYBA 4YKMA 1BWYA 3ELXA 1SY0A 2Z4HA 1I04A 1SRJA 4PSQA 3B2LA 3C77X 2LBAA 1LPJA 3P6FA 1ALBA 2QO6A 4U8UN 4YFQA 2ACOA 2RTLA 1KT4A 5AJBA 3OE3A 4XMEA 3O22A 3P24A 4I9SA 1KZXA 4M7MA 1YUPA 3WJEA 1DF8A 1SRGA 1STPA 3JS1A 1LIBA 1YP7A 2A13A 3WXQA 2PY1A 4IB8A 3RY2A 2AT5X 1ZNLA 3PH6A 4AZRA 2FS6A 2G78A 1JJXA 4U9CA 2ZAGA 3FA8A 3BDRA 1CBSA 1BSQA 1QY0A 1W6FA 4KC7A 3ZUIA 1B56A 4AZNA 4IB9A 4MVEA 5FAZA 3VHIA 3WVMA 2FGSA 5K06A 3SZHA 4BOEA 1JQPA 4IB7A 2ALLX 1B4MA 1JJUA 1D2UA 1RSUB 3KQ0A 3GE2A 1JMZA 3ZWEA 1N4JA 2K62A 4BVMA 2LKKA 3FR4A 4CPFA 3U0DA 2RTJA 4GNYA 3ZW1A 1GX3A 4A1YA 2HZRA 3UAQA 1N9MA 1N0SA 2L9CA 3AEHA 3LHNA 4NV7A 1YWAA 5AQ6A 5LJDA 3AUMO 4QZTA 1SWDA 4WFVA 1IJ8A 3JQOA 2OVSA 1ZRYA 2IZCB 2IZJA 1U17A 2Q9SA 3D96A 2RTQB 1SWBA 2GTLM 4L1NA 5LJKA 2HKDA
chains in the Genus database with same CATH topology
4QAEA 1QFVA 2BLGA 5L8IA 5AEOA 1EQDA 2WWPA 4YBUA 4O4XA 3P6GA 4NNTA 3I0AA 4ID2A 3MVFA 3B2HA 1HBPA 1ZNDA 3CBCA 5FQ7E 3WJGA 2HLVA 3HOEA 3E3CA 4QQ1A 4Y0PA 4YFPA 1X89A 2L5PA 4NNSA 4O3ZA 5HBSA 4PJ2A 1HMTA 5LJGA 3H3IA 3HWEA 2LB6A 3P6HA 5HTEA 2KT4B 4AZMA 4O4OA 2WQ9A 1AB0A 5HZ8A 2BHVA 1LIFA 1QG5A 3WJBA 4ZGUA 3PP6A 4GNWA 4DQ3A 4HFOA 4I3BA 5LJBA 4AW8A 2X8FA 1SY3A 3EYCA 1GXAA 2AKQA 2QM9A 1O8VA 1MUPA 3RKGA 3JSQA 1IFBA 5HAEA 2KD2A 5FQ6E 2MJIA 5EDCA 4HPDA 4QYPA 4ZHFA 1BLRA 3KFHA 1GKAA 1NP4A 2OFRX 3MBTA 2Q39A 4YCHA 4ZJ0A 3TGAA 3S26A 1MX8A 1X8NA 2NNQA 2BS6A 4XMHA 1MVGA 1OEKA 2JU8A 1IFCA 4NP1A 1PM1X 1T8VA 3U9PC 3NX1A 2QMIA 5H9AA 5DG4A 2BS5A 1JYJA 2FT9A 1FDQA 4FBRA 1KT7A 3VG6A 3I17A 4I9RA 5LJEA 2HNXA 4ORYA 3ZW0B 3VG5A 2KTDA 2W2FA 1HMSA 3D95A 4O4SA 1XCAA 4Y0SA 2JU3A 1BM5A 1CRBA 4Y0QA 4YDAA 5HZ5A 1DFVA 3WOVA 3DTQA 3HOLA 1SMPI 3OBLA 2FLJA 4XMGA 3CBSA 5B29A 5EEEA 3O2YA 1RBPA 1OPAA 1ZNGA 4GZVA 3LV4A 1ZNKA 2CM4A 3P02A 4NYQA 1YWCA 1LFOA 1A57A 2FTBA 4N7CA 1X8OA 2OZQA 3OJYC 3UEXA 4YKOA 3PQSA 3B2IA 5H9LA 5IO7A 4WHIA 1BJ7A 5BVQA 1EPBA 4ARHA 2MWHA 3S60A 2K23A 3ZQ3A 4ZHHA 5HTDA 1G5WA 1X8PA 1KZWA 5F58A 3BU9A 1KT5A 3B2JA 5HZ6A 1ICNA 1GX8A 5F1EA 1IKJA 1JZUA 1I06A 1SXWA 4OMWA 4TKHA 1OPBA 1TOWA 1MDCA 2A3FX 1LIDA 1SY1A 4N7DA 4WBKA 4ALBA 5HCDC 1EALA 4YMYA 1EIOA 1B8EA 3VPJE 2NNDA 4O3XB 3ZW2A 4GE1A 4YBPA 4HPBA 2GTLO 3HWGA 4M6SA 4BQUA 3BY0A 1A3YA 2L67A 3P6DA 5EZ2A 3UEWA 5L8NA 1JYDA 2R74A 5H8TA 3FEKA 5HZQA 5HA1A 3BLGA 2Q2MA 3FIQA 4RUUA 2AH7X 3NBXX 3VE1A 1S44A 4MVLA 5KIDA 3T1DA 3APXA 1AELA 1R0UA 3BSZE 4K19A 3VG7A 2QO5A 4QGXA 4GH7A 2FWVA 3NQ3A 3PPTA 1E02A 2FS7A 1VYGA 1KOIA 5FQ8E 3K3LA 1FTPA 3EBKA 4A1HA 2FR2A 4XMDA 2GTLN 4UU3A 2KTSA 2L68A 1NP1A 2W2AA 2RN4A 4I95A 2JN3A 4NLIA 5F6BA 4D6AA 2JW1A 1GKAB 3DSZA 1LKEA 2WUTA 1IKEA 4O4UA 2MO5A 2DM5A 5BYPA 4GETA 5LJCA 1X8UA 3VG3A 1KT6A 2MHDA 4JGLA 3G7XA 3L4RA 2OVDA 1PBOA 1E00A 3TGCA 4EEJA 3F6ZB 2LFOA 1TW4A 4ML7B 3KFIA 1KQXA 2YG2A 4HWMA 4CSBA 2JMBA 2G79A 5F7GA 3WJFA 3RWXA 4ZGFA 4KC8A 1XKIA 3MX7A 4IB6A 3RSWA 1GX9A 4GU8A 1QABE 1GGLA 5HCCC 1X8QA 3RZYA 1EW3A 3HTYA 1JIWI 4YH0A 2ZAIA 2CZTA 3APVA 2LBVA 2CBRA 3FW4A 3BX8A 4LZUA 1CJ5A 1OBUA 4U3QA 4IMNA 4EFGA 1E06A 1AQBA 1E5PA 1T68X 2AMMX 4QZUA 3S5VA 4AZPA 4COTA 2GC9A 5EEDA 4CV7A 3C78X 5HZ9A 4OS3A 4MIRA 3BS2A 4A8ZA 4FGIB 2HMBA 1KXOA 1SXYA 3IA8A 3STKA 4IBAA 4TLJA 2FR3A 1TVQA 1G7NA 4NYRA 3SOTA 2X46A 5HWZA 4YDBA 2R56A 5B27A 3FR2A 2YMSA 1I4UA 3FA7A 2RCTA 4YGZA 2XSTA 1GT5A 4INNA 1DZPA 4OS8A 3HK1A 5F6ZA 1TOUA 1P6PA 2X8SA 2X8TA 3D4RA 1ERXA 4NW4A 1BBPA 1IW2A 2KW1A 4YFRA 1GT4A 1HMRA 1BRPA 4KH8A 3CR6A 4IAWA 1BRQA 1SXXA 3APUA 4OMXA 3WJCA 4FBOA 4TKJA 1AVGI 2NNEA 1G74A 1OEEA 4NLJA 3VG4A 4O3WA 4AZOA 1OBPA 4WFUA 3PH5A 3VG2A 1ADLA 2AT3X 4GK9A 1L6MA 4ES7A 1I05A 2N93A 1Y9TA 1GM6A 1LICA 1MX7A 2OFMX 4AZQA 4I3DA 3KFFA 2OVEA 3ZW1B 1GT1A 5IO5A 4ZH6A 3BX7A 1ZNHA 4ZH9A 1KGLA 1BEBA 3FELA 3V8UA 5LKFA 1QQSA 1BSOA 4LQZA 3U03A 4CK4A 4U8UM 2WEWA 1YIVA 1QFTA 2XKLA 1DZJA 4TJZA 1JV4A 1RLBE 3STNA 3ZUOA 3ZW0A 3CQRA 4ORXA 3B2KA 3WJDA 4ORRA 2P8GA 2IFBA 2O62A 2RD7C 1YWDA 3NADA 1FE3A 1CBRA 3NP1A 1ACDA 1DZKA 3NX2A 2FRSA 4GDZA 5CE4A 3KZAA 1QY2A 2HYSA 5KHPA 5FENA 4ZR2A 1TXLA 1VYFA 1LNMA 3FA9A 4QNIA 3UEVA 4ZHCA 3FA6A 1VPRA 3WBGA 3ZZVA 3D97A 2AT6X 3HWDA 2E4JA 2WQAE 4Y0RA 2CM9A 2OVAA 1EPAA 2GTFX 2WR6A 4FQBB 2ANSA 4YGGA 1IIUA 3PEDA 4R0BA 1FEMA 4IMOA 1EXSA 1CBQA 4TQ2A 2POAA 4YGHA 4I6SA 3RBYA 4KIIA 5DPQA 3OD9A 2RQ0A 5BVSA 4TKBA 4A60A 4EQAC 3APWA 1UZ2X 3FLLA 1JJJA 2A2UA 1KQWA 2WSJA 3ELZA 4IAXA 4RUNA 3GAQA 4OS0A 1O1UA 1HN2A 4KT5A 5LJHA 4I3CA 1FENA 1PMPA 2Q4NA 1OBQA 4TNNA 3BRNA 3CWKA 1YWBA 2AL0X 4YCEA 5H9KA 5L8OA 3Q6LA 1PEEA 2WEXA 3PQUA 1JBHA 5BVTA 1U0XA 1O1VA 4ZCBA 5HCEC 2MM3A 1LF7A 1HBQA 2ASNX 1HQPA 1EI5A 2W2BA 4GKCA 4ORUA 3TZSA 2A0AA 3P6CA 5HA0A 1D3SA 2CZUA 4ORSA 4EXZA 3NPOA 1SY2A 1DC9A 1ICMA 1ML7A 1U18A 1KT3A 4ON1A 3O19A 4ZHDA 1SA8A 2QOSC 1S7DA 1SXUA 3P6EA 2A2GA 5D45A 2RCQA 1UREA 1KZXA 5EPQA 4QGWA 3N91A 3F8AA 4QYNA 1Y9LA 1QY1A 4EDEA 3SAOA 1YP6A 3NQKA 2AT0X 3S5XA 4DQ4A 2ACPX 3FYFA 1FELA 2EU7X 3AKNA 4O49A 2JU7A 3FMZA 3F9DA 4HPCA 4LKTA 5FFHA 4UU2A 4AZNA 5AJCA 4L3RA 4GRJA 3AKMA 3NQ9A 5D8JA 2JOZA 2AT8X 2M4LA 2NP1A 4MVKA 4XMFA 1T0VA 3TF6A 2QO4A 3FEPA 3QKGA 4ORWA 1OEJA 3VU1A 2F09A 1ERBA 1DZMA 2R73A 3CQNA 3EMMA 1DV9A 5D4AA 5D48A 3UEUA 2RA6A 4ZFXA 3FR5A 5JR8A 3PECA 1A2DA 2BT9A 4LZVA 5EDBA 4ALOA 5IO6A 2LA7A 1ZNEA 2GJ5A 2X45A 3HWFA 4KCAA 4QGVA 3TGBA 1S2PA 4U8UO 1BSYA 1X71A 3VE2A 4O9SA 5H9NA 2G7BA 4XMCA 5KICA 1NGLA 4HPAA 5C0NA 5D47A 2Z4IA 4QRLA 4AYHA 5LKEA 1LIEA 4MVIA 2CBSA 4LKPA 1G85A 4MISA 1CBIA 3FENA 1DF3A 3EM0A 1QWDA 1Z24A 3EBWA 1EUOA 4ZHGA 1A18A 1H91A 3NR3A 3STMX 1B0OA 2Q2PA 4IABA 1EIIA 4O3YA 4FBVA 4ODDA 2HZQA 3CMPA 3KFGA 3C76X 3ZI8A 3IFBA 1GT3A 2F73A 3BU1A 3FW5A 5CYBA 4YKMA 1BWYA 3ELXA 1SY0A 2Z4HA 1I04A 4PSQA 3B2LA 3C77X 2LBAA 1LPJA 3P6FA 1ALBA 2QO6A 4U8UN 4YFQA 2ACOA 1KT4A 5AJBA 3OE3A 4XMEA 3O22A 3P24A 4I9SA 4M7MA 1YUPA 3WJEA 3JS1A 1LIBA 1YP7A 2A13A 3WXQA 2PY1A 4IB8A 2AT5X 1ZNLA 3PH6A 4AZRA 2FS6A 2G78A 1JJXA 4U9CA 2ZAGA 3FA8A 3BDRA 1CBSA 1BSQA 1QY0A 4KC7A 3ZUIA 1B56A 4IB9A 4MVEA 5FAZA 3WVMA 5K06A 4BOEA 4IB7A 2ALLX 1B4MA 1D2UA 3KQ0A 3GE2A 3ZWEA 2K62A 4BVMA 2LKKA 3FR4A 3U0DA 4GNYA 3ZW1A 4A1YA 2HZRA 3UAQA 1N0SA 2L9CA 3LHNA 5AQ6A 5LJDA 1YWAA 4QZTA 4WFVA 3JQOA 2OVSA 1ZRYA 3D96A 2Q9SA 1U17A 4D6BA 2GTLM 5LJKA 4L1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QAE A;  1QFV A;  2BLG A;  5L8I A;  1EQD A;  2WWP A;  4YBU A;  3P6G A;  4NNT A;  3I0A A;  3MVF A;  3B2H A;  1HBP A;  1ZND A;  3CBC A;  3WJG A;  2HLV A;  4Y0P A;  4YFP A;  1X89 A;  2L5P A;  4NNS A;  5HBS A;  1HMT A;  5LJG A;  3HWE A;  2LB6 A;  3P6H A;  5HTE A;  2KT4 B;  4AZM A;  2WQ9 A;  1AB0 A;  5HZ8 A;  1LIF A;  1QG5 A;  3WJB A;  4ZGU A;  3PP6 A;  4GNW A;  4DQ3 A;  4HFO A;  4I3B A;  5LJB A;  4AW8 A;  1SY3 A;  3EYC A;  1GXA A;  2AKQ A;  2QM9 A;  1O8V A;  1MUP A;  3JSQ A;  1IFB A;  5HAE A;  2MJI A;  5EDC A;  4HPD A;  4QYP A;  4ZHF A;  1BLR A;  3KFH A;  1GKA A;  1NP4 A;  2OFR X;  3MBT A;  2Q39 A;  4YCH A;  4ZJ0 A;  3TGA A;  3S26 A;  1MX8 A;  1X8N A;  2NNQ A;  4XMH A;  1MVG A;  1OEK A;  2JU8 A;  1IFC A;  4NP1 A;  1PM1 X;  1T8V A;  3U9P C;  3NX1 A;  5H9A A;  5DG4 A;  1JYJ A;  2FT9 A;  1FDQ A;  1KT7 A;  3VG6 A;  3I17 A;  4I9R A;  5LJE A;  2HNX A;  4ORY A;  3VG5 A;  2KTD A;  2W2F A;  1HMS A;  3D95 A;  1XCA A;  4Y0S A;  2JU3 A;  1BM5 A;  1CRB A;  4Y0Q A;  4YDA A;  5HZ5 A;  1DFV A;  3DTQ A;  2FLJ A;  4XMG A;  3CBS A;  5B29 A;  5EEE A;  3O2Y A;  1RBP A;  1OPA A;  1ZNG A;  1ZNK A;  2CM4 A;  4NYQ A;  1YWC A;  1LFO A;  1A57 A;  2FTB A;  4N7C A;  1X8O A;  2OZQ A;  3OJY C;  3UEX A;  4YKO A;  3B2I A;  5H9L A;  5IO7 A;  1BJ7 A;  5BVQ A;  1EPB A;  4ARH A;  3ZQ3 A;  4ZHH A;  2K23 A;  5HTD A;  1G5W A;  1X8P A;  1KZW A;  5F58 A;  3BU9 A;  1KT5 A;  3B2J A;  5HZ6 A;  1ICN A;  1GX8 A;  5F1E A;  1IKJ A;  1JZU A;  1I06 A;  1SXW A;  4OMW A;  4TKH A;  1OPB A;  1TOW A;  1MDC A;  2A3F X;  1LID A;  1SY1 A;  4N7D A;  4WBK A;  4ALB A;  5HCD C;  1EAL A;  4YMY A;  1EIO A;  1B8E A;  2NND A;  4GE1 A;  4YBP A;  4HPB A;  3HWG A;  4M6S A;  4BQU A;  3BY0 A;  1A3Y A;  2L67 A;  3P6D A;  5EZ2 A;  3UEW A;  5L8N A;  1JYD A;  2R74 A;  5H8T A;  3FEK A;  5HZQ A;  5HA1 A;  3BLG A;  2Q2M A;  3FIQ A;  4RUU A;  2AH7 X;  1S44 A;  4MVL A;  5KID A;  3T1D A;  3APX A;  1AEL A;  1R0U A;  3BSZ E;  4K19 A;  3VG7 A;  2QO5 A;  4QGX A;  4GH7 A;  2FWV A;  3NQ3 A;  3PPT A;  1E02 A;  2FS7 A;  1VYG A;  1KOI A;  3K3L A;  1FTP A;  3EBK A;  4A1H A;  2FR2 A;  4XMD A;  4UU3 A;  2W2A A;  2L68 A;  1NP1 A;  2JN3 A;  4NLI A;  5F6B A;  4D6A A;  1GKA B;  3DSZ A;  1LKE A;  2WUT A;  1IKE A;  2MO5 A;  2DM5 A;  4GET A;  5LJC A;  1X8U A;  3VG3 A;  1KT6 A;  3G7X A;  3L4R A;  2OVD A;  1PBO A;  1E00 A;  3TGC A;  4EEJ A;  2LFO A;  1TW4 A;  3KFI A;  1KQX A;  2YG2 A;  2G79 A;  5F7G A;  3WJF A;  1XKI A;  4IB6 A;  3RSW A;  1GX9 A;  1QAB E;  1GGL A;  5HCC C;  1X8Q A;  3RZY A;  1EW3 A;  4YH0 A;  2CZT A;  3APV A;  2LBV A;  2CBR A;  3FW4 A;  3BX8 A;  4LZU A;  1CJ5 A;  1OBU A;  4IMN A;  4EFG A;  1E06 A;  1AQB A;  1E5P A;  1T68 X;  2AMM X;  4QZU A;  4AZP A;  5HZ9 A;  2GC9 A;  5EED A;  3C78 X;  4OS3 A;  3BS2 A;  4A8Z A;  2HMB A;  1KXO A;  1SXY A;  3IA8 A;  3STK A;  4IBA A;  4TLJ A;  2FR3 A;  1TVQ A;  1G7N A;  4NYR A;  2X46 A;  5HWZ A;  4YDB A;  2R56 A;  5B27 A;  3FR2 A;  1I4U A;  3FA7 A;  2RCT A;  4YGZ A;  2XST A;  1GT5 A;  1DZP A;  4OS8 A;  3HK1 A;  5F6Z A;  1TOU A;  1P6P A;  1ERX A;  1BBP A;  1IW2 A;  4YFR A;  1GT4 A;  1HMR A;  1BRP A;  3WJC A;  3CR6 A;  4IAW A;  1BRQ A;  1SXX A;  3APU A;  4OMX A;  4TKJ A;  1AVG I;  2NNE A;  1G74 A;  1OEE A;  4NLJ A;  3VG4 A;  4AZO A;  1OBP A;  4WFU A;  3PH5 A;  3VG2 A;  1ADL A;  2AT3 X;  1L6M A;  4ES7 A;  1I05 A;  2N93 A;  1GM6 A;  1LIC A;  1MX7 A;  2OFM X;  4AZQ A;  4I3D A;  3KFF A;  2OVE A;  1GT1 A;  5IO5 A;  4ZH6 A;  3BX7 A;  1ZNH A;  4ZH9 A;  1KGL A;  1BEB A;  3FEL A;  5LKF A;  1QQS A;  1BSO A;  3U03 A;  4CK4 A;  2WEW A;  1YIV A;  1QFT A;  2XKL A;  1DZJ A;  4TJZ A;  1JV4 A;  1RLB E;  3STN A;  3ZUO A;  3CQR A;  4ORX A;  3B2K A;  3WJD A;  4ORR A;  2P8G A;  2IFB A;  2O62 A;  2RD7 C;  1YWD A;  3NAD A;  1FE3 A;  1CBR A;  3NP1 A;  1ACD A;  1DZK A;  3NX2 A;  2FRS A;  5CE4 A;  3KZA A;  1QY2 A;  2HYS A;  5KHP A;  5FEN A;  4ZR2 A;  1TXL A;  1VYF A;  1LNM A;  3FA9 A;  3UEV A;  4ZHC A;  3FA6 A;  1VPR A;  3WBG A;  3D97 A;  2AT6 X;  3HWD A;  2E4J A;  2WQA E;  4Y0R A;  2CM9 A;  2OVA A;  1EPA A;  2GTF X;  2WR6 A;  2ANS A;  4YGG A;  1IIU A;  3PED A;  4R0B A;  1FEM A;  4IMO A;  1EXS A;  1CBQ A;  4TQ2 A;  2POA A;  4YGH A;  4KII A;  5DPQ A;  2RQ0 A;  5BVS A;  4TKB A;  4A60 A;  3APW A;  1UZ2 X;  3FLL A;  1JJJ A;  2A2U A;  1KQW A;  2WSJ A;  3ELZ A;  4IAX A;  4RUN A;  3GAQ A;  4OS0 A;  1O1U A;  1HN2 A;  5LJH A;  4I3C A;  1FEN A;  1PMP A;  2Q4N A;  1OBQ A;  4TNN A;  3BRN A;  3CWK A;  1YWB A;  2AL0 X;  4YCE A;  5H9K A;  5L8O A;  3Q6L A;  1PEE A;  2WEX A;  1JBH A;  5BVT A;  1U0X A;  1O1V A;  4ZCB A;  5HCE C;  2MM3 A;  1LF7 A;  1HBQ A;  2ASN X;  1HQP A;  2W2B A;  4GKC A;  4ORU A;  3TZS A;  2A0A A;  3P6C A;  5HA0 A;  1D3S A;  2CZU A;  4ORS A;  4EXZ A;  3NPO A;  1SY2 A;  1DC9 A;  1ICM A;  1ML7 A;  1U18 A;  1KT3 A;  3O19 A;  4ZHD A;  1SA8 A;  2QOS C;  1S7D A;  1SXU A;  3P6E A;  2A2G A;  5D45 A;  2RCQ A;  1URE A;  1KZX A;  5EPQ A;  4QGW A;  4QYN A;  3F8A A;  1QY1 A;  4EDE A;  3SAO A;  1YP6 A;  2AT0 X;  4DQ4 A;  2ACP X;  1FEL A;  2EU7 X;  3AKN A;  5FFH A;  2JU7 A;  3FMZ A;  3F9D A;  4HPC A;  4LKT A;  4AZN A;  4UU2 A;  4GRJ A;  3AKM A;  3NQ9 A;  5D8J A;  2JOZ A;  2AT8 X;  2NP1 A;  4XMF A;  4MVK A;  1T0V A;  3TF6 A;  2QO4 A;  3FEP A;  3QKG A;  4ORW A;  1OEJ A;  1ERB A;  1DZM A;  2R73 A;  3CQN A;  3EMM A;  1DV9 A;  5D4A A;  5D48 A;  3UEU A;  2RA6 A;  4ZFX A;  3FR5 A;  5JR8 A;  3PEC A;  1A2D A;  4LZV A;  5EDB A;  4ALO A;  5IO6 A;  1ZNE A;  2GJ5 A;  2X45 A;  3HWF A;  4QGV A;  3TGB A;  1S2P A;  1BSY A;  1X71 A;  4O9S A;  5H9N A;  2G7B A;  4XMC A;  5KIC A;  1NGL A;  4HPA A;  5C0N A;  5D47 A;  4AYH A;  5LKE A;  1LIE A;  4MVI A;  2CBS A;  4LKP A;  1G85 A;  1CBI A;  3FEN A;  1DF3 A;  3EM0 A;  1QWD A;  1Z24 A;  3EBW A;  1EUO A;  4ZHG A;  1A18 A;  1H91 A;  3NR3 A;  3STM X;  1B0O A;  2Q2P A;  1EII A;  4ODD A;  2HZQ A;  3CMP A;  3KFG A;  3C76 X;  3IFB A;  1GT3 A;  2F73 A;  3BU1 A;  3FW5 A;  1BWY A;  4YKM A;  3ELX A;  1SY0 A;  4PSQ A;  1I04 A;  3B2L A;  3C77 X;  2LBA A;  1LPJ A;  3P6F A;  1ALB A;  2QO6 A;  4YFQ A;  2ACO A;  1KT4 A;  4XME A;  3O22 A;  4I9S A;  4M7M A;  1YUP A;  3WJE A;  3JS1 A;  1LIB A;  1YP7 A;  2A13 A;  3WXQ A;  2PY1 A;  4IB8 A;  2AT5 X;  1ZNL A;  3PH6 A;  4AZR A;  2FS6 A;  2G78 A;  1JJX A;  3FA8 A;  3BDR A;  1CBS A;  1BSQ A;  1QY0 A;  3ZUI A;  1B56 A;  4IB9 A;  5FAZ A;  3WVM A;  5K06 A;  4BOE A;  4IB7 A;  2ALL X;  1B4M A;  1D2U A;  3KQ0 A;  2K62 A;  4BVM A;  2LKK A;  3FR4 A;  3U0D A;  4GNY A;  4A1Y A;  2HZR A;  1N0S A;  2L9C A;  5AQ6 A;  5LJD A;  1YWA A;  4QZT A;  4WFV A;  3D96 A;  1ZRY A;  2Q9S A;  1U17 A;  4D6B A;  5LJK A; 
#chains in the Genus database with same CATH topology
 4QAE A;  1QFV A;  1N9Y A;  1NBX A;  2BC3 A;  2BLG A;  5L8I A;  5AEO A;  1EQD A;  4GUZ A;  2WWP A;  4D6B A;  4YBU A;  4GJV A;  3P6G A;  4NNT A;  3I0A A;  4ID2 A;  4O4X A;  3MVF A;  3B2H A;  1HBP A;  1ZND A;  2RTB B;  3CBC A;  5FQ7 E;  3WJG A;  5L3Y A;  2HLV A;  3HOE A;  3E3C A;  4QQ1 A;  4Y0P A;  4YFP A;  1X89 A;  3RDU A;  2L5P A;  4NNS A;  4O3Z A;  5HBS A;  2RTK A;  4PJ2 A;  1NDJ A;  3T2X A;  1HMT A;  5LJG A;  3H3I A;  3HWE A;  2LB6 A;  3P6H A;  1VWJ B;  5HTE A;  2KT4 B;  4AZM A;  2AVI A;  2WQ9 A;  1AB0 A;  1SWQ A;  4O4O A;  5HZ8 A;  2BHV A;  1LIF A;  1PTS A;  1QG5 A;  2X4M A;  3WJB A;  4ZGU A;  3PP6 A;  4GNW A;  4OEM A;  4DQ3 A;  4HFO A;  1VWD B;  4I3B A;  3VHM A;  4AW8 A;  2CAM A;  2X8F A;  1SY3 A;  3EYC A;  1GXA A;  5LJB A;  2AKQ A;  2QM9 A;  2IZF B;  1O8V A;  1MUP A;  3RKG A;  4CDE A;  3RDQ A;  1SRE A;  2RTR B;  3JSQ A;  3RDX A;  1IFB A;  5HAE A;  2KD2 A;  5FQ6 E;  2MJI A;  1SWO A;  5EDC A;  4BX7 A;  4HPD A;  4QYP A;  3WZQ A;  2OL6 O;  4ZHF A;  1BLR A;  3KFH A;  1GKA A;  1NP4 A;  1RXJ A;  2OFR X;  3KVN A;  3MBT A;  2Q39 A;  4YCH A;  1SWE A;  4ZJ0 A;  3TGA A;  3S26 A;  4Z6J A;  1MX8 A;  4Z28 A;  1RAV A;  1X8N A;  2NNQ A;  2A8G A;  3CKF A;  2BS6 A;  4XMH A;  1MVG A;  1OEK A;  4NV8 A;  2JU8 A;  2OY1 O;  1IFC A;  4NP1 A;  2ZSC A;  1PM1 X;  1T8V A;  3U9P C;  4GDA A;  5IXG A;  3NX1 A;  4Z27 A;  2QMI A;  5H9A A;  5DG4 A;  2OYB O;  2BS5 A;  1JYJ A;  1W4T A;  2FT9 A;  1FDQ A;  5B10 O;  1VWI B;  1KT7 A;  1UYO X;  2RTN B;  3D9W A;  3I17 A;  4I9R A;  4WBK A;  3VG6 A;  2RTG B;  5LJE A;  2HNX A;  4ORY A;  1SRI A;  1PBY A;  3ZW0 B;  2IZE B;  3VG5 A;  2KTD A;  3FDC A;  2W2F A;  1HMS A;  1SWC A;  4JO6 A;  5B5G A;  3X00 A;  3D95 A;  4O4S A;  1XCA A;  4Y0S A;  2JU3 A;  1BM5 A;  4MEE A;  1CRB A;  4Y0Q A;  4YDA A;  4CPH A;  5HZ5 A;  1DFV A;  3WOV A;  3DTQ A;  3HOL A;  1SMP I;  3OBL A;  2FLJ A;  5JD2 A;  2IZA A;  4BJ8 A;  4XMG A;  3CBS A;  5IRA A;  5B29 A;  5EEE A;  3O2Y A;  1RBP A;  1OPA A;  2C1Q A;  1KFF A;  1VWA B;  1ZNG A;  1FJ1 E;  1MEP A;  2X32 A;  4GZV A;  3LV4 A;  2UYW A;  1ZNK A;  2CM4 A;  3P02 A;  4NYQ A;  1YWC A;  1LFO A;  1A57 A;  2FTB A;  4N7C A;  1MK5 A;  1X8O A;  2OZQ A;  2RTF B;  3OJY C;  3UEX A;  2IZI A;  4YKO A;  3PQS A;  3B2I A;  5H9L A;  3MM0 A;  5IO7 A;  4WHI A;  1BJ7 A;  5BVQ A;  1EPB A;  2FKG A;  2MWH A;  3S60 A;  2K23 A;  3ZQ3 A;  1STR B;  4ARH A;  1G5W A;  1X8P A;  3WZP A;  1KZW A;  5F58 A;  3BU9 A;  1KT5 A;  3B2J A;  5HZ6 A;  1ICN A;  1GX8 A;  2IZB A;  5F1E A;  1IKJ A;  1JZU A;  2F01 A;  1I06 A;  1SXW A;  4OMW A;  3RE6 A;  4TKH A;  4BX6 B;  1OPB A;  1TOW A;  1MDC A;  1LID A;  2A3F X;  1SY1 A;  2OFA A;  2QOM A;  2VFB A;  4N7D A;  4ALB A;  4YMY A;  5HCD C;  1B8E A;  1EAL A;  1HQQ A;  3VPJ E;  1EIO A;  2NND A;  4O3X B;  3ZW2 A;  2IZH B;  4GE1 A;  4YBP A;  3EW2 A;  2G5L A;  4HPB A;  2GTL O;  3HWG A;  4M6S A;  4BQU A;  2FHL A;  3BY0 A;  3WYQ A;  1A3Y A;  4OKA A;  2L67 A;  3P6D A;  1SWN A;  5EZ2 A;  3UEW A;  1VWB B;  5L8N A;  1JYD A;  2R74 A;  4GD9 A;  4Z2P A;  5H8T A;  3FEK A;  5HZQ A;  5HA1 A;  3BLG A;  1Y52 X;  2Q2M A;  3FIQ A;  4RUU A;  2AH7 X;  3NBX X;  3VE1 A;  5HZ9 A;  1S44 A;  4MVL A;  5KID A;  3T1D A;  3APX A;  1SRH A;  1AEL A;  1R0U A;  3BSZ E;  4K19 A;  3VG7 A;  2QO5 A;  4QGX A;  4GH7 A;  2FWV A;  1RXK A;  1HY2 A;  3NQ3 A;  3PPT A;  1E02 A;  2FS7 A;  1RXH A;  1VYG A;  1KOI A;  5FQ8 E;  5K68 A;  3K3L A;  1FTP A;  3EBK A;  4A1H A;  2FR2 A;  1KL4 A;  1LCZ A;  2Y3F A;  4XMD A;  2GTL N;  4UU3 A;  2C4I A;  2KTS A;  2L68 A;  1NP1 A;  2W2A A;  2RN4 A;  4I95 A;  2JN3 A;  4NLI A;  2AF5 A;  5F6B A;  4D6A A;  2Y3E A;  4BX5 A;  2JW1 A;  1GKA B;  3DSZ A;  2GH7 A;  4ZHH A;  1LKE A;  2WUT A;  1IKE A;  4O4U A;  2MO5 A;  2DM5 A;  5BYP A;  4GET A;  5LJC A;  4I60 A;  1X8U A;  1VWG B;  1KT6 A;  2MHD A;  2RTM A;  3G7X A;  4JGL A;  3L4R A;  2OVD A;  1PBO A;  3VG3 A;  1E00 A;  3TGC A;  4EEJ A;  3F6Z B;  2VFC A;  2LFO A;  2FHN X;  1TW4 A;  4ML7 B;  3KFI A;  1KQX A;  1VWN B;  3T2W A;  2YG2 A;  4HWM A;  4CSB A;  4AZP A;  2JMB A;  2G79 A;  5F7G A;  3WJF A;  3RWX A;  4ZGF A;  2WPU A;  4KC8 A;  1XKI A;  3MX7 A;  4IB6 A;  3RSW A;  2FKJ A;  1GX9 A;  4GU8 A;  1QAB E;  1GGL A;  5HCC C;  1SWL A;  1X8Q A;  1EW3 A;  3HTY A;  1JIW I;  3PK2 A;  4YH0 A;  2ZAI A;  3RZY A;  2CZT A;  3APV A;  2DJG A;  2LBV A;  4DNE A;  2I5Z O;  2CBR A;  2BSZ A;  3BX8 A;  3FW4 A;  4LZU A;  1CJ5 A;  1OBU A;  4U3Q A;  4IMN A;  2RTP B;  4EFG A;  1E06 A;  1AQB A;  1E5P A;  1T68 X;  2AMM X;  2RTH B;  4QZU A;  4Y5D A;  3RY1 A;  2GC9 A;  5EED A;  1VWR B;  3C78 X;  3S5V A;  4COT A;  4OS3 A;  4CV7 A;  1SRF A;  4MIR A;  3BS2 A;  1KL5 A;  4A8Z A;  4FGI B;  2HMB A;  1KXO A;  1N7Y A;  1SXY A;  3IA8 A;  4GGZ A;  3STK A;  4IBA A;  4TLJ A;  2FR3 A;  1TVQ A;  1G7N A;  2VDF A;  4NYR A;  3SOT A;  3T6L A;  1LCV A;  4Z2O A;  2A5C A;  1NC9 A;  1VWO B;  2X46 A;  2OF9 A;  4CDD A;  5HWZ A;  1LDQ A;  4YDB A;  2R56 A;  5B27 A;  3FR2 A;  4BGF A;  2YMS A;  1I4U A;  3FA7 A;  2RCT A;  4YGZ A;  1JMX A;  1I9H A;  4CDF A;  1Y0G A;  5K67 A;  2XST A;  1SWG A;  1GT5 A;  3FID A;  4INN A;  1DZP A;  3EW1 A;  4OS8 A;  3HK1 A;  2OL8 O;  5F6Z A;  1TOU A;  1P6P A;  2X8S A;  2X8T A;  3D4R A;  1ERX A;  1HXL A;  4NW4 A;  1BBP A;  1IW2 A;  2KW1 A;  4YFR A;  1GT4 A;  1HMR A;  1BRP A;  2DJF A;  3CR6 A;  4IAW A;  1BRQ A;  1SXX A;  3APU A;  2X56 A;  4KH8 A;  4OMX A;  1LDO A;  2PI3 O;  2OY7 A;  4CPE A;  4FBO A;  4TKJ A;  1AVG I;  2NNE A;  1G74 A;  1OEE A;  5B2A O;  4NLJ A;  3VG4 A;  4O3W A;  4AZO A;  3T6F A;  1OBP A;  4WFU A;  2MF6 A;  3PH5 A;  3VG2 A;  2QCB A;  3Q34 A;  1ADL A;  1KL3 A;  2AT3 X;  4GK9 A;  3SZJ A;  1L6M A;  4ES7 A;  1I05 A;  2N93 A;  1SLD B;  1GM6 A;  1Y9T A;  4BCS A;  1E2T A;  1LIC A;  1MX7 A;  2OFM X;  2RTE B;  3KFF A;  2OVE A;  4I3D A;  3ZW1 B;  4AZQ A;  1GT1 A;  5IO5 A;  4ZH6 A;  3BX7 A;  1ZNH A;  1VYO A;  4ZH9 A;  1BEB A;  3FEL A;  3V8U A;  1K24 A;  1KGL A;  5LKF A;  1QQS A;  1BSO A;  4LQZ A;  2G8C O;  3U03 A;  4JHQ A;  4CK4 A;  4U8U M;  2WEW A;  1YIV A;  1QFT A;  2XKL A;  1DZJ A;  4TJZ A;  1JV4 A;  1RLB E;  3STN A;  3ZUO A;  5HTD A;  3ZW0 A;  3CQR A;  4ORX A;  1SWK A;  3B2K A;  4Y59 A;  5CSE A;  3WJD A;  4ORR A;  2P8G A;  2IFB A;  2O62 A;  2RD7 C;  1YWD A;  1MOY A;  3NAD A;  1FE3 A;  1CBR A;  3NP1 A;  1MM9 A;  1VWM B;  1ACD A;  1DZK A;  3NX2 A;  4JNJ A;  2FRS A;  5IRU A;  4C5P A;  4GDZ A;  5CE4 A;  3KZA A;  1QY2 A;  1WUB A;  2HYS A;  4BX5 B;  5KHP A;  1NQN A;  5FEN A;  2RTD B;  1W5R A;  4ZR2 A;  1TXL A;  1VYF A;  1LNM A;  3FA9 A;  4QNI A;  3SZI A;  1HXZ A;  3UEV A;  4ZHC A;  3FA6 A;  4B55 A;  1VPR A;  3WBG A;  3ZZV A;  2OFB A;  3D97 A;  2AT6 X;  3HWD A;  3WZN A;  1Y55 X;  2E4J A;  2WQA E;  4Y0R A;  2CM9 A;  3SLT A;  1I78 A;  2OVA A;  1VWC B;  2X34 A;  2OY8 A;  1EPA A;  1AVE A;  2GTF X;  3MG5 A;  2WR6 A;  4FQB B;  2ANS A;  4YGG A;  1IIU A;  5B11 O;  2JGS A;  3PED A;  4R0B A;  1FEM A;  4BX7 B;  4IMO A;  5CHK A;  3LTW A;  1EXS A;  1CBQ A;  4TQ2 A;  1SWJ A;  2POA A;  4I6S A;  4YGH A;  3RBY A;  3SLO A;  2IZD B;  4KII A;  5DPQ A;  4BX6 A;  2Y32 A;  3OD9 A;  2RTA A;  2RQ0 A;  5BVS A;  1LEL A;  4TKB A;  4A60 A;  4EQA C;  3APW A;  1UZ2 X;  3FLL A;  1JJJ A;  4YVB A;  2A2U A;  1KQW A;  2WSJ A;  3ELZ A;  4IAX A;  4RUN A;  3GAQ A;  4OS0 A;  1O1U A;  1HN2 A;  4KT5 A;  5LJH A;  4I3C A;  1FEN A;  1PMP A;  2Q4N A;  1OBQ A;  4GGR A;  3BRN A;  3CWK A;  4TNN A;  1WBI A;  1YWB A;  5B5F A;  2AL0 X;  4YCE A;  5H9K A;  5L8O A;  3Q6L A;  1PEE A;  2WEX A;  3PQU A;  1JBH A;  3CKG A;  5BVT A;  1U0X A;  1O1V A;  4ZCB A;  5HCE C;  2MM3 A;  1LF7 A;  1HBQ A;  5B3M O;  2ASN X;  1HQP A;  2IZK A;  2IZG B;  2OF8 A;  1EI5 A;  2W2B A;  4GKC A;  4ORU A;  3TZS A;  2A0A A;  3P6C A;  5HA0 A;  1D3S A;  1VWL B;  2CZU A;  1VWE B;  4ORS A;  4EXZ A;  3NPO A;  1SY2 A;  1DC9 A;  1ICM A;  1ML7 A;  1U18 A;  3QQ2 A;  2OY5 O;  1KT3 A;  4ON1 A;  4CPH B;  4Z2V A;  3O19 A;  4ZHD A;  1SA8 A;  2A5B A;  2QOS C;  1LCW A;  1S7D A;  1SXU A;  3SLJ A;  2RTI B;  2A2G A;  3P6E A;  2RCQ A;  1URE A;  2RTO B;  5D45 A;  2RTC B;  2X55 A;  5EPQ A;  4QGW A;  3N91 A;  3F8A A;  4QYN A;  1Y9L A;  1N43 A;  1QY1 A;  4EDE A;  3SAO A;  1YP6 A;  3NQK A;  2AT0 X;  3S5X A;  3VGW A;  1SLE B;  4DCB A;  4DQ4 A;  2ACP X;  1SWT A;  3FYF A;  1FEL A;  2EU7 X;  3AKN A;  4O49 A;  1NQM A;  2JU7 A;  3F9D A;  3FMZ A;  4HPC A;  4LKT A;  4UU2 A;  5FFH A;  5AJC A;  4L3R A;  4GRJ A;  3AKM A;  3NQ9 A;  1RST B;  3EC5 A;  4U46 A;  5D8J A;  2JOZ A;  2AT8 X;  2M4L A;  2NP1 A;  4MVK A;  4XMF A;  3RDO A;  1OSP O;  1T0V A;  4OEL A;  3TF6 A;  2QO4 A;  4GJS A;  3FEP A;  1SWU A;  3QKG A;  1LUQ A;  1OEJ A;  1SWS A;  4ORW A;  3VU1 A;  1VWH B;  2F09 A;  1ERB A;  1DZM A;  1VWK B;  2R73 A;  3CQN A;  3EMM A;  1DV9 A;  5D4A A;  1VWF B;  5D48 A;  1AVD A;  3UEU A;  1VWQ B;  2RA6 A;  4ZFX A;  3FR5 A;  5JR8 A;  3PEC A;  1A2D A;  3WYP A;  2BT9 A;  4LZV A;  5EDB A;  4ALO A;  2C1S A;  5IO6 A;  2LA7 A;  1ZNE A;  2GJ5 A;  2X45 A;  3HWF A;  4KCA A;  4CDC A;  4BBO A;  1S2P A;  4QGV A;  4U8U O;  3TGB A;  1STS B;  1BSY A;  1X71 A;  3VE2 A;  4O9S A;  5H9N A;  2G7B A;  4XMC A;  3WJC A;  5KIC A;  1NGL A;  4HPA A;  5C0N A;  5D47 A;  1SWP A;  4GGT A;  4IRW A;  1SWF A;  2Z4I A;  4QRL A;  3RDM A;  3VHH A;  2UZ2 A;  4AYH A;  1LIE A;  1SWH A;  1SLG B;  3PDF A;  5LKE A;  4MVI A;  2I5V O;  2CBS A;  1SWR A;  4LKP A;  1VWP B;  1G85 A;  3WZO A;  4MIS A;  1CBI A;  3FEN A;  1DF3 A;  3EM0 A;  1QWD A;  1Z24 A;  3EBW A;  1SWA A;  1EUO A;  4ZHG A;  1A18 A;  1H91 A;  3NR3 A;  3STM X;  1B0O A;  2Q2P A;  4IAB A;  3RDS A;  4EKV A;  1EII A;  5IRW A;  1UYN X;  3RE5 A;  4FBR A;  1Y53 X;  4O3Y A;  4FBV A;  5F2B A;  2OL7 A;  3HPE A;  1SLF B;  4ODD A;  2HZQ A;  3CMP A;  3KFG A;  1K3B A;  3C76 X;  4CPI A;  3ZI8 A;  2IZL B;  3IFB A;  1GT3 A;  2F73 A;  3BU1 A;  3FW5 A;  5CYB A;  4YKM A;  1BWY A;  3ELX A;  1SY0 A;  2Z4H A;  1I04 A;  1SRJ A;  4PSQ A;  3B2L A;  3C77 X;  2LBA A;  1LPJ A;  3P6F A;  1ALB A;  2QO6 A;  4U8U N;  4YFQ A;  2ACO A;  2RTL A;  1KT4 A;  5AJB A;  3OE3 A;  4XME A;  3O22 A;  3P24 A;  4I9S A;  1KZX A;  4M7M A;  1YUP A;  3WJE A;  1DF8 A;  1SRG A;  1STP A;  3JS1 A;  1LIB A;  1YP7 A;  2A13 A;  3WXQ A;  2PY1 A;  4IB8 A;  3RY2 A;  2AT5 X;  1ZNL A;  3PH6 A;  4AZR A;  2FS6 A;  2G78 A;  1JJX A;  4U9C A;  2ZAG A;  3FA8 A;  3BDR A;  1CBS A;  1BSQ A;  1QY0 A;  1W6F A;  4KC7 A;  3ZUI A;  1B56 A;  4AZN A;  4IB9 A;  4MVE A;  5FAZ A;  3VHI A;  3WVM A;  2FGS A;  5K06 A;  3SZH A;  4BOE A;  1JQP A;  4IB7 A;  2ALL X;  1B4M A;  1JJU A;  1D2U A;  1RSU B;  3KQ0 A;  3GE2 A;  1JMZ A;  3ZWE A;  1N4J A;  2K62 A;  4BVM A;  2LKK A;  3FR4 A;  4CPF A;  3U0D A;  2RTJ A;  4GNY A;  3ZW1 A;  1GX3 A;  4A1Y A;  2HZR A;  3UAQ A;  1N9M A;  1N0S A;  2L9C A;  3AEH A;  3LHN A;  4NV7 A;  1YWA A;  5AQ6 A;  5LJD A;  3AUM O;  4QZT A;  1SWD A;  4WFV A;  1IJ8 A;  3JQO A;  2OVS A;  1ZRY A;  2IZC B;  2IZJ A;  1U17 A;  2Q9S A;  3D96 A;  2RTQ B;  1SWB A;  2GTL M;  4L1N A;  5LJK A;  2HKD A; 
#chains in the Genus database with same CATH homology
 4QAE A;  1QFV A;  2BLG A;  5L8I A;  5AEO A;  1EQD A;  2WWP A;  4YBU A;  4O4X A;  3P6G A;  4NNT A;  3I0A A;  4ID2 A;  3MVF A;  3B2H A;  1HBP A;  1ZND A;  3CBC A;  5FQ7 E;  3WJG A;  2HLV A;  3HOE A;  3E3C A;  4QQ1 A;  4Y0P A;  4YFP A;  1X89 A;  2L5P A;  4NNS A;  4O3Z A;  5HBS A;  4PJ2 A;  1HMT A;  5LJG A;  3H3I A;  3HWE A;  2LB6 A;  3P6H A;  5HTE A;  2KT4 B;  4AZM A;  4O4O A;  2WQ9 A;  1AB0 A;  5HZ8 A;  2BHV A;  1LIF A;  1QG5 A;  3WJB A;  4ZGU A;  3PP6 A;  4GNW A;  4DQ3 A;  4HFO A;  4I3B A;  5LJB A;  4AW8 A;  2X8F A;  1SY3 A;  3EYC A;  1GXA A;  2AKQ A;  2QM9 A;  1O8V A;  1MUP A;  3RKG A;  3JSQ A;  1IFB A;  5HAE A;  2KD2 A;  5FQ6 E;  2MJI A;  5EDC A;  4HPD A;  4QYP A;  4ZHF A;  1BLR A;  3KFH A;  1GKA A;  1NP4 A;  2OFR X;  3MBT A;  2Q39 A;  4YCH A;  4ZJ0 A;  3TGA A;  3S26 A;  1MX8 A;  1X8N A;  2NNQ A;  2BS6 A;  4XMH A;  1MVG A;  1OEK A;  2JU8 A;  1IFC A;  4NP1 A;  1PM1 X;  1T8V A;  3U9P C;  3NX1 A;  2QMI A;  5H9A A;  5DG4 A;  2BS5 A;  1JYJ A;  2FT9 A;  1FDQ A;  4FBR A;  1KT7 A;  3VG6 A;  3I17 A;  4I9R A;  5LJE A;  2HNX A;  4ORY A;  3ZW0 B;  3VG5 A;  2KTD A;  2W2F A;  1HMS A;  3D95 A;  4O4S A;  1XCA A;  4Y0S A;  2JU3 A;  1BM5 A;  1CRB A;  4Y0Q A;  4YDA A;  5HZ5 A;  1DFV A;  3WOV A;  3DTQ A;  3HOL A;  1SMP I;  3OBL A;  2FLJ A;  4XMG A;  3CBS A;  5B29 A;  5EEE A;  3O2Y A;  1RBP A;  1OPA A;  1ZNG A;  4GZV A;  3LV4 A;  1ZNK A;  2CM4 A;  3P02 A;  4NYQ A;  1YWC A;  1LFO A;  1A57 A;  2FTB A;  4N7C A;  1X8O A;  2OZQ A;  3OJY C;  3UEX A;  4YKO A;  3PQS A;  3B2I A;  5H9L A;  5IO7 A;  4WHI A;  1BJ7 A;  5BVQ A;  1EPB A;  4ARH A;  2MWH A;  3S60 A;  2K23 A;  3ZQ3 A;  4ZHH A;  5HTD A;  1G5W A;  1X8P A;  1KZW A;  5F58 A;  3BU9 A;  1KT5 A;  3B2J A;  5HZ6 A;  1ICN A;  1GX8 A;  5F1E A;  1IKJ A;  1JZU A;  1I06 A;  1SXW A;  4OMW A;  4TKH A;  1OPB A;  1TOW A;  1MDC A;  2A3F X;  1LID A;  1SY1 A;  4N7D A;  4WBK A;  4ALB A;  5HCD C;  1EAL A;  4YMY A;  1EIO A;  1B8E A;  3VPJ E;  2NND A;  4O3X B;  3ZW2 A;  4GE1 A;  4YBP A;  4HPB A;  2GTL O;  3HWG A;  4M6S A;  4BQU A;  3BY0 A;  1A3Y A;  2L67 A;  3P6D A;  5EZ2 A;  3UEW A;  5L8N A;  1JYD A;  2R74 A;  5H8T A;  3FEK A;  5HZQ A;  5HA1 A;  3BLG A;  2Q2M A;  3FIQ A;  4RUU A;  2AH7 X;  3NBX X;  3VE1 A;  1S44 A;  4MVL A;  5KID A;  3T1D A;  3APX A;  1AEL A;  1R0U A;  3BSZ E;  4K19 A;  3VG7 A;  2QO5 A;  4QGX A;  4GH7 A;  2FWV A;  3NQ3 A;  3PPT A;  1E02 A;  2FS7 A;  1VYG A;  1KOI A;  5FQ8 E;  3K3L A;  1FTP A;  3EBK A;  4A1H A;  2FR2 A;  4XMD A;  2GTL N;  4UU3 A;  2KTS A;  2L68 A;  1NP1 A;  2W2A A;  2RN4 A;  4I95 A;  2JN3 A;  4NLI A;  5F6B A;  4D6A A;  2JW1 A;  1GKA B;  3DSZ A;  1LKE A;  2WUT A;  1IKE A;  4O4U A;  2MO5 A;  2DM5 A;  5BYP A;  4GET A;  5LJC A;  1X8U A;  3VG3 A;  1KT6 A;  2MHD A;  4JGL A;  3G7X A;  3L4R A;  2OVD A;  1PBO A;  1E00 A;  3TGC A;  4EEJ A;  3F6Z B;  2LFO A;  1TW4 A;  4ML7 B;  3KFI A;  1KQX A;  2YG2 A;  4HWM A;  4CSB A;  2JMB A;  2G79 A;  5F7G A;  3WJF A;  3RWX A;  4ZGF A;  4KC8 A;  1XKI A;  3MX7 A;  4IB6 A;  3RSW A;  1GX9 A;  4GU8 A;  1QAB E;  1GGL A;  5HCC C;  1X8Q A;  3RZY A;  1EW3 A;  3HTY A;  1JIW I;  4YH0 A;  2ZAI A;  2CZT A;  3APV A;  2LBV A;  2CBR A;  3FW4 A;  3BX8 A;  4LZU A;  1CJ5 A;  1OBU A;  4U3Q A;  4IMN A;  4EFG A;  1E06 A;  1AQB A;  1E5P A;  1T68 X;  2AMM X;  4QZU A;  3S5V A;  4AZP A;  4COT A;  2GC9 A;  5EED A;  4CV7 A;  3C78 X;  5HZ9 A;  4OS3 A;  4MIR A;  3BS2 A;  4A8Z A;  4FGI B;  2HMB A;  1KXO A;  1SXY A;  3IA8 A;  3STK A;  4IBA A;  4TLJ A;  2FR3 A;  1TVQ A;  1G7N A;  4NYR A;  3SOT A;  2X46 A;  5HWZ A;  4YDB A;  2R56 A;  5B27 A;  3FR2 A;  2YMS A;  1I4U A;  3FA7 A;  2RCT A;  4YGZ A;  2XST A;  1GT5 A;  4INN A;  1DZP A;  4OS8 A;  3HK1 A;  5F6Z A;  1TOU A;  1P6P A;  2X8S A;  2X8T A;  3D4R A;  1ERX A;  4NW4 A;  1BBP A;  1IW2 A;  2KW1 A;  4YFR A;  1GT4 A;  1HMR A;  1BRP A;  4KH8 A;  3CR6 A;  4IAW A;  1BRQ A;  1SXX A;  3APU A;  4OMX A;  3WJC A;  4FBO A;  4TKJ A;  1AVG I;  2NNE A;  1G74 A;  1OEE A;  4NLJ A;  3VG4 A;  4O3W A;  4AZO A;  1OBP A;  4WFU A;  3PH5 A;  3VG2 A;  1ADL A;  2AT3 X;  4GK9 A;  1L6M A;  4ES7 A;  1I05 A;  2N93 A;  1Y9T A;  1GM6 A;  1LIC A;  1MX7 A;  2OFM X;  4AZQ A;  4I3D A;  3KFF A;  2OVE A;  3ZW1 B;  1GT1 A;  5IO5 A;  4ZH6 A;  3BX7 A;  1ZNH A;  4ZH9 A;  1KGL A;  1BEB A;  3FEL A;  3V8U A;  5LKF A;  1QQS A;  1BSO A;  4LQZ A;  3U03 A;  4CK4 A;  4U8U M;  2WEW A;  1YIV A;  1QFT A;  2XKL A;  1DZJ A;  4TJZ A;  1JV4 A;  1RLB E;  3STN A;  3ZUO A;  3ZW0 A;  3CQR A;  4ORX A;  3B2K A;  3WJD A;  4ORR A;  2P8G A;  2IFB A;  2O62 A;  2RD7 C;  1YWD A;  3NAD A;  1FE3 A;  1CBR A;  3NP1 A;  1ACD A;  1DZK A;  3NX2 A;  2FRS A;  4GDZ A;  5CE4 A;  3KZA A;  1QY2 A;  2HYS A;  5KHP A;  5FEN A;  4ZR2 A;  1TXL A;  1VYF A;  1LNM A;  3FA9 A;  4QNI A;  3UEV A;  4ZHC A;  3FA6 A;  1VPR A;  3WBG A;  3ZZV A;  3D97 A;  2AT6 X;  3HWD A;  2E4J A;  2WQA E;  4Y0R A;  2CM9 A;  2OVA A;  1EPA A;  2GTF X;  2WR6 A;  4FQB B;  2ANS A;  4YGG A;  1IIU A;  3PED A;  4R0B A;  1FEM A;  4IMO A;  1EXS A;  1CBQ A;  4TQ2 A;  2POA A;  4YGH A;  4I6S A;  3RBY A;  4KII A;  5DPQ A;  3OD9 A;  2RQ0 A;  5BVS A;  4TKB A;  4A60 A;  4EQA C;  3APW A;  1UZ2 X;  3FLL A;  1JJJ A;  2A2U A;  1KQW A;  2WSJ A;  3ELZ A;  4IAX A;  4RUN A;  3GAQ A;  4OS0 A;  1O1U A;  1HN2 A;  4KT5 A;  5LJH A;  4I3C A;  1FEN A;  1PMP A;  2Q4N A;  1OBQ A;  4TNN A;  3BRN A;  3CWK A;  1YWB A;  2AL0 X;  4YCE A;  5H9K A;  5L8O A;  3Q6L A;  1PEE A;  2WEX A;  3PQU A;  1JBH A;  5BVT A;  1U0X A;  1O1V A;  4ZCB A;  5HCE C;  2MM3 A;  1LF7 A;  1HBQ A;  2ASN X;  1HQP A;  1EI5 A;  2W2B A;  4GKC A;  4ORU A;  3TZS A;  2A0A A;  3P6C A;  5HA0 A;  1D3S A;  2CZU A;  4ORS A;  4EXZ A;  3NPO A;  1SY2 A;  1DC9 A;  1ICM A;  1ML7 A;  1U18 A;  1KT3 A;  4ON1 A;  3O19 A;  4ZHD A;  1SA8 A;  2QOS C;  1S7D A;  1SXU A;  3P6E A;  2A2G A;  5D45 A;  2RCQ A;  1URE A;  1KZX A;  5EPQ A;  4QGW A;  3N91 A;  3F8A A;  4QYN A;  1Y9L A;  1QY1 A;  4EDE A;  3SAO A;  1YP6 A;  3NQK A;  2AT0 X;  3S5X A;  4DQ4 A;  2ACP X;  3FYF A;  1FEL A;  2EU7 X;  3AKN A;  4O49 A;  2JU7 A;  3FMZ A;  3F9D A;  4HPC A;  4LKT A;  5FFH A;  4UU2 A;  4AZN A;  5AJC A;  4L3R A;  4GRJ A;  3AKM A;  3NQ9 A;  5D8J A;  2JOZ A;  2AT8 X;  2M4L A;  2NP1 A;  4MVK A;  4XMF A;  1T0V A;  3TF6 A;  2QO4 A;  3FEP A;  3QKG A;  4ORW A;  1OEJ A;  3VU1 A;  2F09 A;  1ERB A;  1DZM A;  2R73 A;  3CQN A;  3EMM A;  1DV9 A;  5D4A A;  5D48 A;  3UEU A;  2RA6 A;  4ZFX A;  3FR5 A;  5JR8 A;  3PEC A;  1A2D A;  2BT9 A;  4LZV A;  5EDB A;  4ALO A;  5IO6 A;  2LA7 A;  1ZNE A;  2GJ5 A;  2X45 A;  3HWF A;  4KCA A;  4QGV A;  3TGB A;  1S2P A;  4U8U O;  1BSY A;  1X71 A;  3VE2 A;  4O9S A;  5H9N A;  2G7B A;  4XMC A;  5KIC A;  1NGL A;  4HPA A;  5C0N A;  5D47 A;  2Z4I A;  4QRL A;  4AYH A;  5LKE A;  1LIE A;  4MVI A;  2CBS A;  4LKP A;  1G85 A;  4MIS A;  1CBI A;  3FEN A;  1DF3 A;  3EM0 A;  1QWD A;  1Z24 A;  3EBW A;  1EUO A;  4ZHG A;  1A18 A;  1H91 A;  3NR3 A;  3STM X;  1B0O A;  2Q2P A;  4IAB A;  1EII A;  4O3Y A;  4FBV A;  4ODD A;  2HZQ A;  3CMP A;  3KFG A;  3C76 X;  3ZI8 A;  3IFB A;  1GT3 A;  2F73 A;  3BU1 A;  3FW5 A;  5CYB A;  4YKM A;  1BWY A;  3ELX A;  1SY0 A;  2Z4H A;  1I04 A;  4PSQ A;  3B2L A;  3C77 X;  2LBA A;  1LPJ A;  3P6F A;  1ALB A;  2QO6 A;  4U8U N;  4YFQ A;  2ACO A;  1KT4 A;  5AJB A;  3OE3 A;  4XME A;  3O22 A;  3P24 A;  4I9S A;  4M7M A;  1YUP A;  3WJE A;  3JS1 A;  1LIB A;  1YP7 A;  2A13 A;  3WXQ A;  2PY1 A;  4IB8 A;  2AT5 X;  1ZNL A;  3PH6 A;  4AZR A;  2FS6 A;  2G78 A;  1JJX A;  4U9C A;  2ZAG A;  3FA8 A;  3BDR A;  1CBS A;  1BSQ A;  1QY0 A;  4KC7 A;  3ZUI A;  1B56 A;  4IB9 A;  4MVE A;  5FAZ A;  3WVM A;  5K06 A;  4BOE A;  4IB7 A;  2ALL X;  1B4M A;  1D2U A;  3KQ0 A;  3GE2 A;  3ZWE A;  2K62 A;  4BVM A;  2LKK A;  3FR4 A;  3U0D A;  4GNY A;  3ZW1 A;  4A1Y A;  2HZR A;  3UAQ A;  1N0S A;  2L9C A;  3LHN A;  5AQ6 A;  5LJD A;  1YWA A;  4QZT A;  4WFV A;  3JQO A;  2OVS A;  1ZRY A;  3D96 A;  2Q9S A;  1U17 A;  4D6B A;  2GTL M;  5LJK A;  4L1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...